Dataset Viewer
Auto-converted to Parquet Duplicate
pred_label
stringclasses
2 values
pred_label_prob
float64
0.5
1
wiki_prob
float64
0.25
1
text
stringlengths
71
984k
source
stringlengths
39
45
__label__wiki
0.881258
0.881258
| Listen Live Today's Globe THIS STORY HAS BEEN FORMATTED FOR EASY PRINTING Fire at Peru rehab center kills 14 Relatives weep after learning the names of the victims of the pre-dawn blaze at the Sacred Heart of Jesus clinic in Chosica, Peru, Saturday, May 5, 2012. A fire swept through the rehabilitation center for addicts near the Peruvian capital of Lima and officials say at least 14 people are dead. (AP Photo/Karel Navarro) By Mauricio Munoz and Franklin Briceno Associated Press / May 5, 2012 E-mail| Text size – + Add a personal message:(80 character limit) Sending your article Your article has been sent. CHOSICA, Peru—A predawn fire swept through a drug rehabilitation center in a town on Lima's outskirts Saturday, killing 14 people in the second blaze in Peru this year to claim the lives of addicts trapped behind locked doors in a private treatment residence. The only known survivor of the blaze at the Sacred Heart of Jesus clinic escaped by jumping from the building's second floor after the blaze broke out about 4 a.m., his brother said. Local health director Pablo Cespedes said officials don't yet know what caused the blaze. Thirteen bodies were found in bedrooms on the second floor and one on the first floor of the two-story home in Chosica, about 19 miles (32 kilometers) east of Lima, the coastal capital, he said. Rescue efforts were complicated by locked doors and barred windows, said fire chief Fernando Campos. "The doors were padlocked shut. We had to use tools to get in the front door. On the second floor, the windows have bars," he told reporters at the scene. The apparent lone survivor, 39-year-old Luis Zevallos, jumped out of the building from a section of the second floor that lacks bars, his brother, Jose Zevallos, told The Associated Press. "His friends were afraid and didn't." "He's got burns on his face but it's not too serious," Jose Zevallos said of his brother. "It's a miracle he's alive." The aunt of an 18-year-old who died in the fire, Jennifer Rugel, told the AP that drug rehabilitation centers in Peru, as a rule, "seal their doors with locks because those interned want to escape and are there against their will." She said by phone from the morgue where police took the 14 bodies that her nephew, Marco Cespedes, had to be interned because he was selling objects from his home in order by buy drugs. The local health director, Cespedes, said the Sacred Heart clinic was licensed but that a 2011 inspection recommended physical improvements to prevent overcrowding and said it needed professional health care workers. The owners of the clinic could not immediately be located for comment. After a Jan. 28 fire at a Lima rehab residents for addicts claimed 29 lives, government officials acknowledged that the state has limited capacity for treating drug addicts. "The state has 700 beds for 100,000 drug-dependent people. That's the root of the problem," the country's drug czar, Carmen Masias, said in radio interview the following day. A 2010 study by the agency she runs, Devida, counted 222 private rehabilitation centers in Peru, 80 percent of them unlicensed and many lacking doctors and psychologists. Associated Press writer Franklin Briceno reported from Lima, Peru. More articles in Latin America/Caribbean Sorry, we could not find your e-mail or password. Please try again, or click here to retrieve your password. *Screen name: (* fields are required) Please take a minute to register. After you register and pick a screen name, you can publish your comments everywhere on the site. Posting Policy. Your comment is subject to the rules of our Posting Policy This comment may appear on your public profile. Public Profile FAQ Boston.com top stories on Twitter Waiting for Twitter to feed in the latest... Boston.com Most EmailedSubscribe to SliceBookmark Boston.com Most Emailed120 MOST E-MAILED » Report: Warrant Issued for Roggie’s Bar Owner Map of Greater Boston Farmers Markets Boston Pops Concert Move Keeps the Beach Boys, Ditches Joey McIntyre We Tried Out Those New Solar Benches New England’s top outdoor water parks Drink of the Week: Mojito Italiano Lawmakers pass compounding pharmacy oversight bill Follow this list on Twitter: @BostonPopular Contact Boston.com Contact The Boston Globe Boston Globe Insiders The Boston Globe Gallery © Boston Globe Media Partners, LLC
cc/2021-04/en_middle_0055.json.gz/line5
__label__cc
0.701988
0.298012
My Summer of Ceviche – Ole Ole By Fuzzy Gerdes June 12th, 2006 @ 10:00 AM Food & Drink Last year when we were performing the Neutrino Project as a late-night show at the Improv Kitchen, I got into a routine — every night after the show the whole crew would head over the Twisted Spoke and I’d have a beer and ceviche, which they serve in a hearty pint glass. I was devastated when, late in the run, my waiter announced that ceviche was a seasonal item and they had switched to their winter menu. So, now that summer has returned, I’ve decided to get a little obsessive and make this my Summer of Ceviche — I’m going to try to hit as many places in town as possible that serve fish ‘cooked’ in acidic fruit juices (that is, ceviche). I started with the closest restaurant to my house that serves ceviche — Ole Ole (5413 N Clark). Ole Ole has two varieties of ceviche — a mixed seafood (shrimp, calimari, scallop) marinated in a tomato base, and a fish of the day (which was Mako Shark on our visit) marinated in a lime juice. I wanted to get both, and we decided to fill out our meal with some of their appetizer and tapas selection. The last place I ate small-plate style food (cough, Lennox Lounge*) the portions were tiny, so with that in mind we ordered an array of items. It turns out the portions are not small at Ole Ole. There were two of us, but we had enough food for four. And we only spent $60 (with two drinks each). The food was great — the black beans and rice and fried plantains were both surprisingly good for side dishes. My Caipirinha was tasty and plenty strong. And the ceviches were everything I hoped for — tangy, fish-ful, the shellfish ceviche somewhat spicier. Oh, and for desert we just walked across the street to bon bon (5410 N Clark) and got a truffle each. Theoretically they close at 8 on the weekends, but the owner, Elizabeth, told us that she stays open as long as there’s traffic (which let us get in at 8:30) and that she was considering longer summer hours. * Don’t get me wrong about the Lennox Lounge — the food was great, the staff was friendly, the atmosphere is delightful. Just, you know, small portions. Alana (unregistered) on June 12th, 2006 @ 5:22 pm I want a recipe! Favorite?
cc/2021-04/en_middle_0055.json.gz/line24
__label__wiki
0.82553
0.82553
Thomas & Friends: Blue Mountain Mystery FETCH! with Ruff Ruffman Big Cat Diary: Season 7 Kids' TV for ages 5 to 7 on Netflix After being sent to help his Narrow Gauge friends at Blue Mountain Quarry, Thomas spies a small engine trying to hide -- and no one will offer clues to the engine's identity. Thomas is determined to learn the truth, but it's harder than he imagined. Details about Thomas & Friends: Blue Mountain Mystery Ruff Ruffman is the canine host of this partly animated reality show in which kids attempt to meet wacky challenges involving science. From his well-appointed headquarters doghouse, Ruff awards points and keeps things running according to plan. Details about FETCH! with Ruff Ruffman With a mix of fresh and familiar faces, the seventh season of this nature series captures full-grown leopard Chui clinging to his mother, tiny cheetah cub Toto struggling to survive scary attacks and dominant male lion Notch battling outside rivals. Throughout each exciting episode, wildlife experts Simon King, Saba Douglas-Hamilton and Jonathan Scott share insightful observations as well as their gut emotions, which often heighten the suspense. Details about Big Cat Diary: Season 7 Return to the Masai Mara for more exciting big cat escapades in this wildlife soap opera, which finds Kike's grown cheetah cubs struggling to fend for themselves and male leopard Chui refusing to venture away from his mother, Bella. Hosted by experts Saba Douglas-Hamilton, Simon King and Jonathan Scott, season 6 of this compelling nature series introduces the Ridge Pride of lions, which includes mischievous cubs Sala and Cheza. Danger lurks at every turn in season 5 of this thrilling nature series, which showcases the Marsh Pride battling advances from two unknown invaders, while Kike fights a pregnant cheetah that desperately wants to take over her territory. To draw viewers further into the world of the Masai Mara, this wildlife program features expanded coverage of other animals, including hyenas and mongooses, and personal video diaries from the production team. Young cheetah Honey copes with three lively cubs, while the lions of the Ridge Pride encroach on the hunting grounds of the dominant Marsh Pride and a fierce battle for the prime territory ensues. Big Cat Diary Zoologist and wildlife photographer Jonathan Scott, nature documentarian Simon King and, in later seasons, wildlife conservationist Saba Douglas-Hamilton trace the lives of African lions, cheetahs and leopards in Kenya's Masai Mara National Reserve. Details about Big Cat Diary FETCH! with Ruff Ruffman: Season 1 From PBS KIDS: Part game show, part reality TV, and part spoof, FETCH! With Ruff Ruffman features real kids, real challenges, real science, and an unreal animated host - a dog named Ruff Ruffman. The series mixes unscripted live-action with animation, and breaks the mold with its educational and comical take on America's newest television genre. For 6 to 10-year-olds, FETCH! is spontaneous and full of surprises. Details about FETCH! with Ruff Ruffman: Season 1 "Big Cat Diary" returns to tell the tales of Kenya's leopard, cheetah and lion families. Six-week-old Solo is the latest addition to the Ridge Pride, while Amber the cheetah is still in fine form, and leopard Shadow has a new cub named Safi. Back in the Masai Mara game reserve, hosts Simon King and Jonathan Scott catch up with their old friends in the Marsh Pride and spend time tracking several new big cats, including Half-Tail's daughter Shadow, and Amber and her three cheetah cubs. Join wildlife experts Jonathan Scott and Simon King as they roam the spectacular Masai Mara game reserve, following the fascinating adventures of a large pride of lions, cheetah mother Kidogo and her two cubs, and a female leopard named Half-Tail. Located in a strip mall, the Bobby Wasabi Martial Arts Academy is in danger of closing -- until Sensei Rudy recruits Jack, the only student who can restore glory to the dojo and vanquish their bitter rivals. Details about Kickin' It The Magic School Bus: Season 4 Wahoo get out there and explore! The Magic School Bus takes teacher extraordinaire Ms. Frizzle and her enthusiastic, inquisitive students on cliff-hanging field trips into the human body, inside an ant colony, and far out into space. The series, based on the best-selling Scholastic books, transforms the world into a fresh and funny science laboratory - each time with a new destination. Details about The Magic School Bus: Season 4 Scooby-Doo!: Mystery Incorporated In this animated update of the beloved Saturday-morning cartoon classic, Scooby-Doo, Shaggy, Fred, Velma and Daphne roll in the Mystery Machine to solve paranormal mysteries in Crystal Cove, a hamlet bedeviled by all kinds of supernatural bedlam. Details about Scooby-Doo!: Mystery Incorporated Disney Animation Collection: Vol. 5: Wind in the Willows This Disney collection features six cartoons based on children's stories and fairy tales. Included are Wind in the Willows, The Ugly Duckling, The Grasshopper and the Ants, The Golden Touch, The Robber Kitten and The Wise Little Hen. Details about Disney Animation Collection: Vol. 5: Wind in the Willows Thanks to his excessive spending, the incorrigible J. Thaddeus Toad is about to lose the home he adores, Toad Manor. Luckily, his good friends Rat, Mole and Angus MacBadger will help Mr. Toad -- as long as he promises to adjust his attitude. Disney Animation Collection: Vol. 4: The Tortoise and the Hare This fanciful collection of Disney classics features six cartoons based on children's fairy tales. Included are The Tortoise and the Hare, Babes in the Woods, The Goddess of Spring, Toby Tortoise Returns, Paul Bunyan and The Saga of Windwagon Smith. Details about Disney Animation Collection: Vol. 4: The Tortoise and the Hare Kickin' It: Season 1 Jerry, Milton and Eddie invite Jack, a new kid at school who's got a knack for karate, to join their dojo, the Bobby Wasabi Martial Arts Academy. Season 1 follows the friends as they face off against the rival Black Dragon dojo. Details about Kickin' It: Season 1 Phineas and Ferb: Season 2 Phineas and Ferb's adventures this season include constructing the world's tallest building, attending a sci-fi and fantasy convention, searching for the "Lake Nose Monster" and accidentally dosing Candace with a growth potion. Details about Phineas and Ferb: Season 2 When speedy Max Hare and poky Toby Tortoise compete in a foot race, Max is certain he'll win. But as the overconfident hare stops along the way to show off his athletic skills and take a nap, the persistent Toby moves steadily toward the finish line. Codename: Kids Next Door Headquartered in a massive tree house, five 10-year-olds known as the Kids Next Door battle the forces that make young lives miserable, like candy-stealing pirates, evil dentists and kids who love homework. Details about Codename: Kids Next Door Zoologists Martin and Chris Kratt morph from live forms into their animated selves, complete with Creature Power Suits, in this animal show for kids. With their wild humor, the Kratts travel the globe to search out exotic and endangered creatures. Details about Wild Kratts Anything goes in the fertile minds of stepbrothers Phineas and Ferb as they turn each day of summer vacation into an adventure, building everything they can dream up and squeezing the most fun possible into every day.
cc/2021-04/en_middle_0055.json.gz/line38
__label__cc
0.684257
0.315743
Month-End Flood of Economic Data Markets remain worried about the Greek deficit but are showing somewhat less risk aversion today. The yen fell 0.4% against the dollar, which is otherwise weaker by 0.6% against the kiwi, 0.4% versus the Swiss franc, 0.2% relative to the Canadian dollar, and 0.1% against the euro. EUR/USD remains below $1.4000, while dollar/yen is hovering just above 90.0. Trichet again endorsed the U.S. strong dollar policy, revealing no concern over the euro’s recent depreciation. European stocks have traded up with gains of 1.0% in Germany, 0.9% in France and 0.8% in Great Britain. Asian stocks had a rougher time, posting losses of 2.1% in Japan, 1.2% in Hong Kong, and 2.4% in South Korea. The Australian bourse lost 2.2%. The ten-year British gilt yield is somewhat lower, while the JGB yield is steady at 1.32%. Oil climbed 0.5% to $74.00 per barrel. Gold is steady at $1084.70 per troy ounce. The following Japanese data results were announced: The manufacturing PMI slid 1.3 points to 52.5 in January from 53.8 in December. Export orders printed at 51.5 after 54.7. Total and core consumer prices posted December-over-November declines on a seasonally adjusted basis. Core CPI in on-year terms fell 1.3% both in December and full-2009. That was the largest calendar year drop thus far. Tokyo consumer prices in January fell on month by 0.2% seasonally adjusted. Tokyo’s on-year core CPI rate was minus 2.0%. Housing starts fell on year by 15.7% in December after a 19.1% drop in the year to November. Construction orders reverted to a 12-month uptick of 0.6% from a drop of 11.6% in the year to November. December’s jobless rate of 5.1% was two-tenths less than forecast and down from 5.2% in November. Employment was 1.7% lower than a year earlier, and the job offers-to-seekers ratio improved to 0.46 from 0.43 in November and a recent low of 0.42 last July and August. Real household spending jumped on month by 1.0% in December on a seasonally adjusted basis and recorded an on-year increase of 2.1%. But among workers, real disposable income and real household incomes registered 12-month declines of 4.7% and 4.8%. Industrial production provided another bright spot, increasing 2.2% for a second straight month in December and by 5.3% from a year earlier. In the year between 1Q08 and 1Q09, industrial production had plunged 34.6%, and a large 22.4% decline was posted in 2009 as a whole after a drop of 3.4% in 2008. Officials predict increases in industrial output of 1.3% in January and 0.3% in February, thanks to solid regional export demand. The inventory ratio in December was 18.3% less than a year earlier. Such leaped 52.6% between the first quarter of 2008 and 1Q09. Private credit in Australia grew 0.3% in December and 1.5% from a year earlier. Credit to households rose, but that to businesses eased. New Zealand building permits fell 2.4% last month, printing much worse than expectations of a 3% increase. RBNZ Governor Bollard made some dovish remarks about New Zealand interest rates. New Zealand’s trade balance in December was better than forecast. As a preliminary step for a future interest rate hike, the Reserve Bank of India announced a two-stage 75-basis point increase in cash reserve requirements from the present 5.0% to 5.5% on February 13 and 5.75% on February 27th. Analysts expected such to be raised by a smaller amount. The key repo rate was left at 4.75%, and the reverse repo rate stays at 3.25%. In Asia, China’s central bank reiterated obtuse plans to pursue a moderately loose monetary policy while observing that inflationary pressure is likely to rise in 2010. Taiwan’s jobless rate edged down to an 11-month low of 5.74% in December from 5.86% in November. Thailand reported an improved business sentiment index of 50.4 in December after 49.0 in November, noting too that factory output in December was 35.7% higher than a year earlier. Hong Kong M3 growth slowed to 10.5% in December. Hong Kong producer prices edged up 0.1% in December and were 1.3% above year-earlier levels. Singapore’s jobless rate dived to 2.1% last quarter from 3.4% in 3Q. Bank of Japan minutes from its December meetings revealed nothing startling. South Korea’s index of leading economic indicators firmed to 12.8% in December from 12.6% the month before. South Korea also reported a 3.5% jump in industrial production last month and a whopping 33.9% increase from December 2008. In the euro area, the preliminary CPI estimate for January was a 12-month rate of 1.0%, less than forecast but a tick above December’s 0.9% result. Euroland unemployment climbed to 10.0% in December from 9.9% in October and November. Unemployment had been at 8.2% at end-2008 and 7.2% at end-2007. The rise last year was held down by German job creation schemes. German joblessness only advanced four-tenths to 7.5%. By contrast, unemployment increased by 1.5 percentage points in France and Italy and by 4.7 percentage points in Spain between end-2008 and end-2009. Euroland’s household savings rate fell to 13.0% last summer from 19.8% in the second quarter of 2009. Euroland M3 fell 0.2% between December 2008 and December 2009 and by 0.1% between 4Q08 and 4Q09. Loans to firms were 2.3% less than a year before in December, while lending to households went up by 1.3%. Private credit expanded just 0.7% in the latest 12-month period. ECB officials expect subdued inflation to persist into the medium term because of the very low growth of money and credit. The ECB also indicated, however, that credit conditions in the market were somewhat less restrictive last quarter than in 3Q. Swedish wages were 2.8% higher in November than a year earlier, similar to October’s pace of 2.6%. Norwegian retail sales volumes rose 0.8% in December and were 3.9% greater than at the end of 2008. Italian producer prices rose 0.2% in December but fell 1.6% from a year earlier. Italy’s 8.5% jobless rate in December exceeded expectations. Greek retail sales were 9.0% lower in November than a year earlier. The Swiss index of leading economic indicators printed at 1.77 in January, better than forecast. Spanish consumer price inflation accelerated to 1.1% in January from 0.9%. Hungarian producer prices firmed 0.1% in December and 1.3% from a year earlier. Czech industrial output in December was 2.1% greater than a year before. British consumer confidence rose two points in January to minus 17. The U.K. Nationwide house price index recorded an on-year advance of 1.2% in December, up from 0.5% in November. The data parade isn’t over. The United States releases its first estimate of fourth-quarter GDP, seen arriving at around 4.5%, as well as the employment cost index, Chicago PMI, and U. Michigan index of consumer sentiment. Canada announces producer prices and monthly GDP. South Africa’s central bank reported an on-year drop of 0.8% in credit and a 1.6% rise of M3 in December. Copyright Larry Greenberg 2010. All rights reserved. No secondary distribution without express permission. This entry was posted on Friday, January 29th, 2010 at 6:51 am and is filed under New Overnight Developments Abroad - Daily Update. You can follow any responses to this entry through the RSS 2.0 feed. Both comments and pings are currently closed.
cc/2021-04/en_middle_0055.json.gz/line52
__label__cc
0.646305
0.353695
Watch Aaj Tak New Online Live Watch Aaj Tak hindi news channel live For FREE. Aajtak news is the leading news channel and the #1 rated 24-hour Hindi-language news channel in India. Aajtak is the fastest news channel provide information from all over india. Aajtak is the winner of many awards of News filed. Aaj Tak has earned the tag line "Nation's Best News Channel" due to its aggressive journalism and cutting edge reporting. It has a reach of more than 45 million viewers in India. This is the only channel that connects you to the whole world not after the event happens, but on the time of incidents happen, so this is the only channel that lives you and connects you to the whole world. Not only the news, this also entertains the public by showing varities of show. this is the only channel of India that remains indians connected not only with the news but also with some other knowledgeable things and with the entertainment world also. Aaj Tak is the world class broad caster of News that provides not only the Indians but also the foreigners its services by warming up the people through its hot and live news. Aaj Tak gives information to public about each and every field ie. News regarding each and every field. Therefore Aaj Tak is the Perfect and Upto date News Channel. Aaj Tak's wide array of news programming includes daily new bulletins on "Aaj Subaha" and "10tak," politics, sports, business, entertainment, international coverage and much more. Aaj Tak delivers the latest news in a viewer friendly language – as and when it happens. Besides the unrivalled bulletin coverage, Aaj Tak has also pioneered feature-based programming within the news genre with leading shows such as Seedhi Baat, Cinema, Khel and Jurm. It reaches to people in remote villages too, where this channel is hugely popular because of the channel`s India centric programming. It is a free to air channel in India and is being offered as a pay channel in the overseas market. Watch Hindi News channel Aajtak News Live On Yupptv.com Labels: Aaj Tak
cc/2021-04/en_middle_0055.json.gz/line62
__label__wiki
0.765742
0.765742
Your Daily Science Source This ‘terror crocodile’ had teeth the size of bananas, perfect for eating dinosaurs August 12, 2020 by admin 0 Comments It was a different time. Towards the end of the Cretaceous period, North America was cleaved in two by a giant inland sea. Dinosaurs, nearing the end of their reign, still abounded in this hot, wet place. But they had to watch their step, especially by the water’s edge. In the shallows lurked Deinosuchus: the ‘terror crocodile’. This giant extinct crocodylian was the largest carnivore in its semi-aquatic environment – a powerful apex predator that would feast even on dinosaurs should they stray too close. Deinosuchus fossils were first found in the US in the 1850s and have been studied for well over a century, but species classifications within the genus have long been debated. In a new study, researchers from the University of Iowa revisited the existing fossil evidence, and also looked at newly collected fossil specimens. Deinosuchus schwimmeri skull. (Cossette & Brochu, Journal of Vertebrate Paleontology, 2020) The results of their phylogenetic re-evaluation suggest three distinct species of Deinosuchus can be discerned in the fossil record: the suggested type species D. riograndensis, D. hatcheri, and a newly identified species, D. schwimmeri. “Deinosuchus was a giant that must have terrorised dinosaurs that came to the water’s edge to drink,” says lead researcher and palaeontologist Adam Cossette, now with the New York Institute of Technology. “Until now, the complete animal was unknown. These new specimens we’ve examined reveal a bizarre, monstrous predator with teeth the size of bananas.” While the oldest known Deinosuchus specimen to date is approximately 82 million years old, the researchers say a common ancestral population for all the different species is likely, and would have existed in North America before rising seas led to the Western Interior Seaway cutting the continent in half. When this happened, the researcher speculate that different environments on the east and west coasts led to evolutionary adaptations that resulted in the slightly divergent morphologies and body sizes of D. riograndensis, D. hatcheri, and D. schwimmeri. Artist’s impression of Deinosuchus. (Tyler Stone) “It was a strange animal,” says palaeontologist Christopher Brochu. “It shows that crocodylians are not ‘living fossils’ that haven’t changed since the age of dinosaurs. They’ve evolved just as dynamically as any other group.” Based on the fossil evidence, D. riograndensis and D. hatcheri spent their dinosaur-hunting days in the west of North America, from Montana down to northern Mexico. D. schwimmeri, meanwhile, lived along the Atlantic coast, between New Jersey and Mississippi. Regardless of their coastal affiliations, though, these giant creatures – which ranged up to 10 metres (33 ft) in length – were some of the largest and most fearsome crocodylians ever, and were closer in appearance to modern-day alligators than crocodiles. “At the time it was living here in the eastern US, there was nothing bigger,” Columbus State University geologist and palaeontologist David Schwimmer told the Ledger-Enquirer. Schwimmer was not involved with the new study, but was the inspiration for the naming of D. schwimmeri, given his contributions to the field. “We actually have bite marks from these guys on dinosaur bones. Now, the only question you can ask: Were they scavenging or predatory?” Schwimmer said. “My guess is predatory… This creature was big enough to take down most dinosaurs. Also, interestingly enough, most of the bites we see are in leg bones and tailbones. If you’re going to grab a dinosaur, that’s the place you’re going to grab them.” The findings are reported in Journal of Vertebrate Paleontology. This article was originally published by Sciencealert.com. Read the original article here. Photos: Incredibly well preserved mammoth bones keep turning up in Mexico NASA reveals the ‘heart’ of the Nancy Roman space telescope is now complete Too much CO2 has an unnerving effect on the world’s trees, new study finds Across 10 million stars, not a single whisper of alien technology Where you live in the US is linked to certain personality traits, study finds Egyptian authorities have discovered 13 completely sealed 2,500-year-old coffins ‘Zombie’ fires are once again blazing through the Arctic, causing record burning Psychedelic ‘trips’ really are similar to religious experiences in many ways Mammal extinctions are speeding to an unprecedented ‘second wave’, scientists warn Something strange happens on Mars during a solar eclipse China lands mysterious reusable spacecraft after 2 days in space Simulation reveals what dark matter might look like if we could see it Is maths real? That’s actually a much smarter question than you might think Physicists made boats sail upside-down on an ocean of levitating liquid We just found another obstacle for quantum computers to overcome – and it’s everywhere Physicists just found a new quantum paradox that casts doubt on a pillar of reality Silica takes on a strange ‘half way’ form in meteorite impacts, experiment suggests Copyright © 2021 by Science News. All rights reserved. All articles, images, product names, logos, and brands are property of their respective owners. All company, product and service names used in this website are for identification purposes only. Use of these names, logos, and brands does not imply endorsement unless specified. By using this site, you agree to the Terms of Use and Privacy Policy.
cc/2021-04/en_middle_0055.json.gz/line75
__label__wiki
0.855051
0.855051
‘liked icon of Latino way of life’: Hispanic Caucus nominates ‘Selena’ for country wide movie Registry should still the Gregory Nava-directed and written movie be selected with the aid of the Library of Congress, it would become one of most effective a handful of Latino movies within the countrywide movie Registry, together with 1981’s Zoot swimsuit; 1988’s Stand and bring, for which Olmos acquired an Academy Award nomination for ideal Actor; and 1983’s El Norte, which become additionally directed with the aid of Nava and depicts the tragic migration story of two indigenous Mayans to the U.S. El Norte garnered Nava and his cowriter Anna Thomas an Oscar nomination for customary screenplay. Legislators observed in the letter that “[m]any of those films made essential contributions to the countrywide consciousness and figuring out of issues like labor rights, immigration, and tutorial disparities that the CHC seeks to address legislatively these days. other films tragically certainly not bought the wide-distribution or recognition that has been afforded to other classics of yankee cinema, despite their ongoing relevance to Latinos these days. “As such, we respectfully ask that the country wide movie Registry discover methods to spotlight the Latino-focused films within the registry, to make sure that these crucial examples of american Hispanic heritage not simply be preserved however considered,” they proceed. “As a subsequent step, we also are looking to formally nominate the 1997 film Selena for inclusion in the national movie Registry in 2021.” Selena depicts the performer’s life story, from singing as a younger lady with her siblings A.B. and Suzette at the household’s restaurant and carnivals to Grammy-successful stardom, and her tragic killing via an associate on the age of only 23 in 1995. Selena’s posthumous album changed into launched shortly after her death and contained songs that had been intended for a full-size English language album. “Dreaming of You” cemented Selena’s fame as a tune icon, breaking a couple of tune information and helping make her the top-quality-selling Latina artist of the Nineteen Nineties. greater than 20 years after its free up—and nearing the twenty fifth anniversary of Selena’s death—the movie still attracts pleasure from fans, with theaters across the nation nonetheless preserving occasional screenings. “Selena is an American icon and he or she’s so celebrated in the Latino neighborhood,” Castro tells NBC information. “I suppose a part of the affirmation of that changed into, not best the success of the movie, however also the recent success of the television series.“ The inclusion of Selena within the countrywide film Registry would also characterize a triumph for Nava, who with Thomas additionally cowrote Frida and My household (Nava directed the latter) and would now have numerous films blanketed in the registry. “For too long U. S. Latinx filmmakers’ contribution to the movie business has been disregarded and underrepresented,” he mentioned within the commentary. “Our community is important and becoming and our stories deserve to learn. I applaud the Congressional Hispanic Caucus’ efforts to deliver attention to this and to honor the accomplishments of Latinx filmmakers.” Georgia’s runoffs are a total f’ing wild card—and a window into the subsequent several election cycles Stacey Abrams says terrible Republican response to COVID in Georgia may impact the particular election Previous post:Georgia’s runoffs are a total f’ing wild card—and a window into the subsequent several election cycles Next post:Stacey Abrams says terrible Republican response to COVID in Georgia may impact the particular election
cc/2021-04/en_middle_0055.json.gz/line80
__label__cc
0.585803
0.414197
Think Piece How Digital Trade is Transforming Globalisation By James Manyika, Susan Lund, PDF - Download The spread of digital technologies is transforming global flows of goods, services, money, and people. Digital trade represents an important, albeit hard-to-measure, component of these global flows. As digital trade grows, develops, and assumes new forms, it is both facilitating globalisation and transforming it. This paper examines three ways this transformation process is taking place: through cross-border flows of purely digital goods; by using “digital wrappers” to enable physical flows of goods — an essential component of the “Internet of Things”; and through the creation of online platforms for production, exchange, and consumption. Large and small companies, as well as individual entrepreneurs and consumers, in both developed economies and the emerging world will be increasingly affected by these developments, which constitute both an opportunity and a competitive challenge. For governments and policymakers, the rapid transformation of digital trade raises important issues that will need to be addressed, including lingering barriers to its growth, appropriate ways of measuring it, and questions about governance and data security. Tag: Digital Economy, Diversification & Competitiveness, Infrastructure, Multinational Enterprise, Services, Small and Medium-Sized Enterprises James Manyika Director (Senior Partner), McKinsey Global Institute, McKinsey & Company Susan Lund Partner, McKinsey Global Institute Data Moving Across Borders: The Future of Digital Trade Policy Maximizing the Opportunities of the Internet for International Trade Addressing Barriers to Digital Trade Information Goes Global: Protecting Privacy, Security and the New Economy in a World of Cross-border Data Flows New WTO Trade Rules for Bits and Bytes?
cc/2021-04/en_middle_0055.json.gz/line84
__label__cc
0.733605
0.266395
Television aka TV discussion » Go Team Venture! Author Topic: Go Team Venture! (Read 29245 times) Re: Go Team Venture! So I'm looking at some Adult Swim cartoons on Netflix DVD and this show along with Aqua Teen Hunger Force, The Brak Show, Harvey Birdman, Futurama, and Squidbillies look like they could be funny.. Got Robot Chicken up to Season 4 and plan on getting 5 & 6 but 7 is only available for sale, and season 8 is not available at all on DVD Any other recommendations? I love every one of those shows and suspect you would as well. Early Adult Swim captures a lot of the weird energy that made Space Ghost so great. I would add Sealab 2021 (At least the first 2 volumes) to the list. There are a lot of other Adult Swim shows that I love, but they're way less accessible. Quote from: Pak-Man on October 18, 2017, 08:59:02 AM Ok cool Yeah I was wondering about Sealab 2021, I'll add that to my queue as well Quote from: RVR II on October 18, 2017, 09:01:10 AM I love Sealab 2021, so I second the recommendation. The later episodes do lose a step, but there was no real avoiding it as one of the main cast had passed away. They did the best with what they had though. Ah ok. I'll keep that in mind when I watch it. Thanks! Pastor of Muppets Now available in minty fresh flavor. The Brak Show I always found random and obnoxious, even though I sort of liked Space Ghost. Squidbillies I'm just too turned off by the poor quality of the artwork. I'm not particularly religious, and I don't really like Muppets, but I do love word play. Beavis and ButtHead artwork was poor but was still a very funny show in my opinion.. The Venture Bros. are Back with Season 7 and Mark Hamill is on board https://screenrant.com/mark-hamill-venture-bros-season-7/ Darth Geek likes this Season 7 starts tomorrow! So we picked up "Go Team Venture! The Art of the Venture Bros." I was expecting a big coffee table book full of pretty pictures with maybe a few captions, but this thing is like an in-depth director's commentary for everything Venture Bros. from the conception of the show to the present. Totally worth the $27 it's going for on Amazon. https://www.amazon.com/Go-Team-Venture-Making-Bros/dp/1506704875 Edward J Grug III Forum Tokens Collected: 5000 https://news.avclub.com/jackson-publick-confirms-that-the-venture-bros-has-bee-1844978868 Jackson Publick confirms that The Venture Bros. has been canceled My name is Raphaël Ambrosius Costeau NOOOOO! 17 years and we only got 7 seasons out of it. At least it was a good 7 seasons. What's the best use for all those extra quarters? Arcade games of course! Counting down the Top 50 Coin Operated Games! So the rumor is that Hulu kept exclusivity for some of Adult Swim's shows, but ever since the AT&T merger, and with the launch of HBO Max, Hulu is a competitor. So they don't want to create new content for their competitors, so shows that aren't HBO Max got axed (Including Mike Tyson Mysteries, one of my favorites.) Of course they paid a bunch of money to get rights to non-exclusively show Rick and Morty because they know where their bread is buttered, but Venture Bros. didn't quite have the following to be worth the money. BUT there's still a chance that HBO Max could get Venture Bros. exclusively if it changed to a different name. Apparently this is why Mr. Pickles was changed to "My Mama Called Me Sherriff." This might be why Adult Swim tweeted that they're working with Doc Hammer and Jackson Publik to keep the story going. Edward J Grug III likes this The Lurker Grendel's Mom Well this looks promising... https://screencrush.com/hbo-max-venture-bros-cancelation/
cc/2021-04/en_middle_0055.json.gz/line93
__label__cc
0.728719
0.271281
songs about survival in the wild WATCH ON AMAZON WATCH ON ITUNES. Welcome to the best animal game, Wild Animals Online (WAO) Wild Animals Online is a survival for the fittest game. Stormfall: Saga of Survival. ★ Build your own Wild West ranch ★ Fight gangsters with pistols and rifles ★ Wood logging, mining, deer hunting ★ Craft new equipment and … This is a wild game of survival. This storyline is pretty interesting. via TV Series Finale. Survival Album has 1 song sung by Eminem. Each of the … The film stars Emile Hirsch as McCandless … Enjoy. The EX Champion Daruk's Song is one of DLC Main Quests in The Legend of Zelda: Breath of the Wild. The sticker at the helm of his boat … Norway, WWII: A group of British and German soldiers find themselves stranded in the wilderness after an aircraft battle. A thunderhead loomed to the south of the island of Culebra, in Puerto Rico, threatening to drench Paul Knapp Jr. and the three passengers of his 18-foot inflatable dinghy, the Little Compass. This album is composed by Liz Rodrigues. Play. Survival Tips In The Wild, survival hacks, best survival tips, survival games. I … LittleThings / Maya Borenstein . Wild. #1: Finding Clean Water. Survival RPG 3: Lost in time adventure retro 2d. Survival in the wild lyrics: Underneath a burning sky the tenants of the fire sit in silence as they ponder survival in the wild With our love to keep us up there is nothing in the world that can knock us down we can ta Title Artist Duration Price Purchase; 1. 20130325092614142_0001. Into the Wild is a 2007 American biographical adventure drama film written, co-produced, and directed by Sean Penn.It is an adaptation of the 1996 non-fiction book of the same name written by Jon Krakauer and tells the story of Christopher McCandless ("Alexander Supertramp"), a man who hiked across North America into the Alaskan wilderness in the early 1990s. They could be the difference between life and death! Preschool Music Samples < Prev. Enjoy the videos and music you love, upload original content, and share it all with friends, family, and the world on YouTube. With Jon Voight, Jamie Kennedy, Vail Bloom, Aidan Cullen. Next > Play All. This is a true test of what you are made of in this day in age. Often these items will have multiple possible uses as space and weight are often at a premium. When he moaned and sobbed, it was with the pain of living that was of old the pain of his wild fathers, and the fear any mystery of the cold and dark that was to them fear and mystery. Gain power as President, deliver justice as Sheriff, fight for your tribe as Chief, or show some southern hospitality as Governor. Director: Petter Næss | Stars: Florian Lukas, David Kross, Lachlan Nieboer, Stig Henrik Hoff It is a world of animals whereby the strongest of all animals survives based on the law of the jungle. Loading... Save for later. Below is an Infographic that summarizes the 17 Basic Survival Skills. The letters must be at least nine feet tall in order to be seen by pilots from the air. 7Y1 SURVIVAL WEEK 1. notebook, 820 KB. The playlist, a compilation of 70 songs, includes more contemporary music than the one preceding it, as well as songs released last year. After graduating from Emory University, top student and athlete Christopher McCandless abandons his possessions, gives his entire $24,000 savings account to charity and hitchhikes to Alaska to live in the wilderness. There are two important things to consider as far as water is concerned; collecting water and purifying water. Songs for Survival: A Playlist Art, Music, & Pop Culture November 17, 2016. Read more. Another true story, this one follows Cheryl Strayed – a divorcee and substance abuser who decides to leave everything behind and hike the 1,000+ mile Pacific Crest trail… unaided and with no experience. Directed by Sean Penn. This amazing game permits you to play as 20 different animal types ranging from carnivores to herbivores and to omnivores and to also hunt in several different maps and environment. Released: 2014. For wilderness survival, they often contain items like a knife, water container, fire starting apparatus, first aid equipment, food obtaining devices (snare wire, fish hooks, firearms, or other,) a light, navigational aids, and signalling or communications devices. a) Collecting … Survival Song number six we have a childhood favorite of mine with Nena’s 99 Luftballons. Download the Wild Horse Simulator today while it's 50% OFF for a very limited time! Dominating global markets, American pop, hip hop/rap, blues, and soul are known … Game Features + REALISTIC SIMULATOR - You'll need to maintain your health, … Hi to day I want to show you about videos: Finding worms in wild & Grilled on clay for food Thanks you for watching and hope you enjoy my video. In this apocalypse, you’ll need your wits about you to guard against others who may try to attack you for your survival supplies. In the 80’s with the cold war going on people were afraid of nuclear war. Teleport in medieval time in 2d game. People have, at all times, been fighting against something heinous in the United States. Do I Hate My Ex Quiz, Axial Scx10 Ii Raw Builders Kit Review, Midwestern University Do Acceptance Rate, Most Stressful College Majors, Best Ever Spaghetti Squash Soup, How To Pronounce Progenitor, Ncert Class 4 Science Book, Wave Surfing Yappe, The Hours Cast, songs about survival in the wild 2020
cc/2021-04/en_middle_0055.json.gz/line96
__label__wiki
0.948531
0.948531
Theatre Projects About | RS Home / Press / Movie News and Reviews / The Turning a career catalyst for first-time directors – Inside Film (01jul13) The Turning a career catalyst for first-time directors – Inside Film (01jul13) 11 Jul 2013 / Leave a Comment / Tags: Movie News and Reviews Don Groves David Wenham, Stephen Page and Mia Wasikowska had their first taste of film directing on The Turning, an innovative feature based on Tim Winton’s collection of short stories, and now they’ve got the directing “bug.” All three will graduate to directing features, according to Arenamedia’s Robert Connolly who produced The Turning with Maggie Miles. Billed by Connolly as a “bold cinematic event,” the film will premiere at the Melbourne International Film Festival, which opens July 25, and debut in cinemas later this year, co-distributed by Connolly’s CinemaPlus and Madman Entertainment. Connolly tells IF the film will screen as a three-hour event with intermission around Australia and attendees will receive copies of the programme. He’ll finish the film at the end of next week, one year after he started on what he describes as a “huge endeavour.” Spanning 30 years, the inter-locking stories revolve around the turning points in the lives of the people of a small coastal community in Western Australia. Each óf the 17 segments is 10 minutes, utilising a mix of first-time directors and seasoned hands including Connolly, Tony Ayres, Claire McCarthy, Warwick Thornton and Justin Kurzel. Connolly is developing a feature with Wenham based on Clinton Caward’s novel Love Machine, a quirky romance set in a Kings Cross sex shop. Wenham has written the screenplay and plans to direct, with Connolly producing. Stephen Page is working on a feature with producer John Harvey, with whom he collaborated on a segment of The Turning. The topic is under wraps but Connolly says the project stems from Page’s role as artistic director of the Bangarra Dance Theatre. Connolly isn’t sure when Wasikowska will make her feature directing debut but says, “She’s got the bug; her work is so good.” Late this year Connolly will direct Paper Planes, a drama about a boy from a small outback town who dreams of competing in the World Paper Plane Championships in Japan, shot in Perth . On his slate for next year are The Shipkiller, a high seas revenge saga which he’ll direct and produce with Hollywood hot shot Gale Ann Hurd; and The Man Who Walked Around the World, an HBO movie he’ll write and direct, based on the true story of the first person verified to have completed circling the entire land mass of the Earth (except the oceans) on foot. Movie News and Reviews Copyright© 2004 - Hugo Weaving | Random Scribblings / Sirens Theme by Peerapong
cc/2021-04/en_middle_0055.json.gz/line99
__label__cc
0.55147
0.44853
Biggest Hurdle for Young Burn Survivors Is Acceptance MONDAY, June 1, 2020 (HealthDay News) -- The way they're treated by other people can cause young burn survivors more distress than their physical challenges, two surveys find. In one, researchers asked 64 burn survivors between 17 and 25 years of age what they found hardest to deal with. The seven most common responses: people staring; being bullied; memories of being burned; needing more surgeries; self-consciousness about scars; unwanted questions; pain and itching. In the second survey, 147 burn survivors between 10 and 16 years of age and 81 young adult survivors were asked about each of the seven issues. More than 70% were bothered by staring and bullying. More than half reported issues with scars (65%), memories of being burned (52%), and pain and itching (50%). Scarring bothered girls much more than boys. For the younger survivors, 61% were bothered most by memories and unwanted questions, the findings showed. There were some significant differences between the two age groups. Child burn survivors were more likely than young adults to report being troubled by unwanted questions (61% versus 43%). Young adults were much more likely to be upset about being bullied (63% versus 46%). The findings were published recently in the Journal of Burn Care & Research. Burn treatment typically focuses on physical wounds, but the survey results suggest that survivors require more help to deal with traumatic memories and social anxieties, according to the researchers. "Over the years, we have made many advancements in treating the physical wounds of burn survivors, but more needs to be done to treat the social and emotional wounds that come from these injuries," said Ruth Rimmer, former director of psychosocial research for the Arizona Burn Center at Valleywise Health in Phoenix. "Our research shows that the most difficult issue that children and young adult survivors deal with is the reaction they get from other people. Giving them the tools to handle these interactions is critical to their well-being," she said in a journal news release. The U.S. National Institute of General Medical Sciences has more on burns. SOURCE: Journal of Burn Care & Research, news release, May 12, 2020 Women and Children's After a Burn: When to Call Your Child's Healthcare Provider Anxiety Disorders in Children Wound Culture Avoid Injury Around Barbecue Grills Bullying on the Job Bacitracin eye ointment Burns Quiz Anxiety: Learning to Just Be
cc/2021-04/en_middle_0055.json.gz/line102
__label__cc
0.720977
0.279023
HorsesAss.Org About HA Mickey Mosque by Goldy — Tuesday, 8/17/10 , 11:05 am As always, the Daily Show nails it. Mr. Cynical spews: Tuesday, 8/17/10 at 11:43 am Pretty clever. Seems like Stewart is being hard on ObaMao and making fun of him. YES WE CAN…but should we???????????? Perhaps you should edit that part Goldy. YLB spews: LMAO!! The end to that segment was freaking hilarious! Heh. Silly KLOWN@1 – there goes that so-called liberal media bullshit. The entire media saying Obama is tanking it for the Dems in November. Imagine that. Zotz sez: Puddybud is just another word for arschloch spews: I thought KO’s tour of the area in pictures was also very effective. There’s no activity (decay) a little ways away from the WTC; and there is already a mosque directly across the street. Apparently 70% of us don’t watch either show, including Harry Reid who should lose his leadership job over his stance on this in the next congress (assuming he’s re-elected). Jason Osgood spews: Tuesday, 8/17/10 at 12:09 pm Mr Cynical @ 1 Out of curiosity, how many right wing comedians (Glenn Beck, Dennis Miller, Kelsey Gramer, Ted Nugent, George Will, etc) poked fun at Bush The Lessers’ hypocrisy, lies, looting, war crimes, and general purpose bad taste? Come now…Jon Stewart’s glancing blow at ObaMao ain’t much. And if you watched Glen Beck, you would realize he rips Bush and the Republican establishment on a regular basis. Establishment R’s HATE Beck. You use the terms “looting, war crimes, and general purpose bad taste?” Lots of unsubstantiated assumptions and obvious political opinion by you. Has Olberman or MadKow ripped ObaMao? Never. The issue is how the MSM who hold themselves out as objective news REPORTERS have performed as reporting news for R’s and D’s. The factual review of stories shows an incredible bias…by any standard. You are tangling 2 seperate issues. Something KLOWNS often do. Lola spews: Tuesday, 8/17/10 at 1:14 pm @ Mr. Cynical (all comments) Ha. Can’t you come up with something better than ObaMao? Really. Name calling only discredits anything you have to say. But, let’s say you are right. I hope ObaMao sends his secret terror force to your house first so the rest of us learn the lessen not to speak out against our diabolical dictator. AHHHHHHHHHHHHHHHH!!!!!!!!!!! [the preceding paragraph is satirical in nature. no one really wishes mr. cynical any harm. thank you, Evergreen Free-dumbed-down Foundation] proud leftist spews: The more I read of this issue, the more pathetic, immature, and irresponsible the Rs appear. They will stoop to any depth, apparently, to try to score political points. A quarter of the world’s population is Muslim, yet these faux-patriots deem it a terrorist religion. Newt Gingrich equates Islam to Nazism. Obama said the right thing, and I’m glad he did. He has principles, unlike those who criticize him on this issue. By comparison, you elevated the comedy The Daily Show to the role of a news organization. I, in turn, denigrated select guiding lights from the right, spanning the spectrum of Very Serious People, by equating them to servile court jesters. See what I did there? By mimicking you, I mocked your argument. Which reminds me… You once stated, emphatically, that govt’s sole roles are defense, police, and patronage. I then asked In your libertarian utopia, who pays for the administration of our courts and elections? Please know that I’m trying very hard to understand the libertarian mindset. An answer, any answer, would greatly benefit my studies. proud @ 7 Speaking of which… I wasn’t surprised that Dick Cheney’s number one groupie, Pamela Geller, was a prime instigator of this manufactured controversy: How the “ground zero mosque” fear mongering began Ace reporting by Justin Elliott, and why I continue to give salon.com money. The success of the “conveyor belt of faux outrage” strategy is a marvel to me. The smears and lies just keep coming. Splinter spews: This made-up mosque controversy is the perfect example of why I don’t refer to myself as a Democrat. It is disgusting that a party that claims to be “conservative” would use this as a wedge issue for political gain in the mid-terms, regardless of it playing directly into the hands of Islamic fundamentalists that want nothing more than a religious war with the West. What’s even more disgusting is the totally spineless capitulation of some democrats that can’t stand up for something that is such a clear-cut example of a basic principal that our nation was founded on: The right to practice your religion freely. Does Harry Reid really need to look at polling data to decide if he should take a stand on basic Constitutional rights…. the constitution that he swore to defend? Apparently so. Crusader spews: Mr. Cynical – there’s no point in trying to reason with lefties. They’re in their own little reality distortion bubble. Such rich irony–you suggesting that Cynny and you can reason and that you reside outside your “own little reality distortion bubbles.” CaughtInTheMiddle spews: Most don’t deny right to build mosque at that location, just think that all things considered it is inconsiderate for them to build it there considering the circumstances. It is poking the majority of Americans in the eye by building there. Constitution goes not give rights. It tells government that it cannot infringe on those rights. Try to remember that. Apparently Harry Reid never was taught that in school and never learned it while in the Senate. Steve spews: @12 Teabaggers might not get irony, but that doesn’t stop them from delivering a shitload of it here. @14 and 12: Getting irony would require appreciation of nuance. Nuance is not a strength for wingnuts. Rujax! spews: 13. CaughtInTheMiddle spews: Just what this site needs…another Constitutional scholar. liar liar pants on fire spews: apparently he know’s more than you do. Is it inconsiderate of Republicans to be near children? http://www.republicanoffenders.com/Pedophiles.html I do know the Constitution and I have noticed that this blog maintains a veritable vacuum of Constitutional understanding! I can tell some get it, but just don’t like what it says and would probably give their eye teeth to change it, but most just are truly ignorant from what I read. 17. liar liar pants on fire spews: OK asshole…I’ll bite. What does that dumbass know that I don’t know? see post #19. It is inconsiderate of Republicans to be near anyone who does not suffer from the illness that afflicts them. Personally, I can’t stand the smell of them. thats funny(not), because your old lady doesnt seem to mind… THE FUCKING PURPOSE OF THE FUCKING CONSTITUTION IS TO DEFINE THE RIGHTS OF CITIZENS! THE “BILL OF RIGHTS”!!! HELLO?????? ANYBODY HOME???? FUCK!!!! How are you morons so stupid. Were you born this way or do you WORK at it? End of your story you stupid prick. 13: “Constitution goes [sic] not give rights.” Ah, yes, an adherent of the old natural rights school of thought. How quaint. Yet, you nonetheless claim to be a constitutional scholar. How charming. 11. Crusader spews: I just like to torment them with the TRUTH. Nothing more devastating to a Leftist Pinheaded KLOWN than the light of the truth. It burns their corneas. They can’t handle the truth. I’ve got the essence of ‘jesusownbutthole…mr. cynical” right here: “More for me, less for you.” Not hard. lostinaseaofblue spews: Re 26 You say you’re an attorney. Riddle me this- “We hold these truths to be self-evident, that all men are created equal, that they are endowed by their Creator with certain unalienable Rights..” So the men who wrote and signed this document believed that rights are granted by the government, not natural and inalienable when they later wrote the Constitution? The men who wrote that the rights and duties in the Constitution are the sole rights and duties of Federal government, with all else retained by the state and the citizens of them? How quaint that some backward conservatives actually believe the words of the Declaration of Independence and Constitution, you know, mean something. Umm, no, it isn’t. It is to define the role and purpose of government and the powers they have to fulfill them. It is a positive grant document, which limits government and empowers citizens by doing so. Did you miss Civics class or just ignore it? Last time I looked…there were 27 Amendments to the US Constitution. The first 10 are known as the “Bill of Rights”. Somewhere an asshole is looking for a way out of his own asshole. lost @ 30 When the Declaration of Independence and Constitution were drafted, natural rights theories were all the rage among progressive thinkers–and I’m most certainly glad that they were. Those theories were quite an improvement over some of the divine right of kings sorts of political theory that had previously prevailed. Ultimately, however, political philosophy moved past the indefensible–if certain rights are “natural,” inherent in humanity, then why is there no agreement within a particular community, let alone across the globe, concerning what those rights are? You and I, for instance, sharply disagree on what “rights” the Constitution protects. I believe in more personal liberties than you do; you believe in more liberties in the marketplace. So, practicality suggests that “rights” are not some inherently recognizable commodity, but are what a government chooses to recognize and protect. No more, no less. lostinhisownasshole is parsing gas. har-har Certainly the argument you raise has merit. Otherwise a majority could define rights. The result would be chaos and tyranny of the majority. The Constitution doesn’t leave us guessing some of the rights which are inalienable in the view of those who wrote it. It tells us how to add the protection of government to further rights by Amendment. As Rujax points out this has been done 27 times. But nowhere does it indicate that these rights didn’t exist before. Judge Wheeler, in his mind, is not creating a right for gay people to marry. In his mind he is recognizing a right that existed before, and should have been enforced. No matter how wrong his interpretation, the underlying principle is sound. That is, we don’t create rights in the courts, or by amending the Constitution, or by laws. We recognize those rights that the Constitution either always protected, or we amend it to do so on felt necessity. Sorry, 35 referred to 33. BTW, no matter how much we might disagree on personal rights in the marketplace, I suspect we largely agree on individual freedoms. The Patriot Act is an obsenity. Wiretapping citizens without warrants, illegal searches at airports, courthouses, federal buildings and so on are borderline treason by those who mandate them. In my mind they are treason. Criminal civil rights, while protecting objectionable people, may protect me from illegal police activity someday. Even if they didn’t, the principle of justice administered fairly and by a set of established rules is too valuable to lose. I simply believe that without economic rights, without the right to that which I produce, the other rights are paper tigers. Similarly, without basic personal rights my security in my property is a sham. Each enhances the other. Recent HA Brilliance… Friday Open Thread Friday, 1/15/21 Wednesday Morning Open Thread Wednesday, 1/13/21 Monday Open Thread Monday, 1/11/21 Friday Night Multimedia Extravaganza! Friday, 1/8/21 Friday Open Thread Friday, 1/8/21 Open Thread Jan 6 Wednesday, 1/6/21 First Open Thread of 2021! Monday, 1/4/21 Open Thread Wednesday Wednesday, 12/30/20 December 28 Open Thread Monday, 12/28/20 Election 2020: Biden versus Trump Biden Trump > 99.9% probability < 0.1% probability 360 electoral votes 178 electoral votes From the Cesspool… G on Friday Open Thread Elijah SFA McDotcom on Friday Open Thread Eleven Time Person Woman Man Camera TV Cognitive Noble Prize Winner in Dropping Humiliation Bombs on Rapepublican "Losers and Suckers", Elijah SFA McDotcom on Friday Open Thread Roger Rabbit on Friday Open Thread Tweets by @GoldyHA I appreciate feeling appreciated. Also, money. U.S. Dollars Australian Dollars Canadian Dollars Euros Pounds Sterling Yen Can’t Bring Yourself to Type the Word “Ass”? Eager to share our brilliant political commentary and blunt media criticism, but too genteel to link to horsesass.org? Well, good news, ladies: we also answer to HASeattle.com, because, you know, whatever. You're welcome! Search HA Follow Goldy [iire_social_icons] HA Commenting Policy It may be hard to believe from the vile nature of the threads, but yes, we have a commenting policy. Comments containing libel, copyright violations, spam, blatant sock puppetry, and deliberate off-topic trolling are all strictly prohibited, and may be deleted on an entirely arbitrary, sporadic, and selective basis. And repeat offenders may be banned! This is my blog. Life isn’t fair. © 2004–2021, All rights reserved worldwide. Except for the comment threads. Because fuck those guys. So there.
cc/2021-04/en_middle_0055.json.gz/line105
__label__wiki
0.86055
0.86055
/playlists/285185362 g-HA & Olanskii Two pivotal bodies in the sphere of Norwegian electronic music, g-HA & Olanskii are an event, a club, a DJ duo, and a musical authority for Norway. Individually adept as DJ, selectors and tastemaker, Ola “Olanskii” Smith-Simonsen and Geir “g-HA” Holger’s musical voices unified for Sunkissed, an events series that has become the backbone of Oslo’s electronic music scene and beyond. Prior to Sunkissed, Ola had been the programmer for the Notting Arts Club in London, while Geir booked some of the most iconic nights for Skansen, in Oslo – nights that established a new era for electronic music in Norway. They joined forces in the looming light of Oslo’s growing Disco scene, when it was still just House, before it even had a name and bonded over a shared love of music from the diverse corners of the dance floor. Geir’s selections, which had found its way on Glasgow Underground before, found a perfect symbioses with Ola’s own musical inclinations, and ever since the first time g-HA featured on a Sunkissed bill, their musical pursuits have been a combined effort and an esoteric highlight in Oslo’s music scene. Sunkissed’s kaleidoscopic view to the musical world, which was informed by the personal relationships they’ve forged with their peers, remain a beacon of taste in Oslo and Norway, but where trend informs, g-HA & Oalnskii are always had a step ahead. Guided by their appreciation for electronic dance music and its roots, they invariably lead the way to new dimensions through their bookings and DJ sets, bringing new sounds to Norway and exporting the sound of Norway to the rest of the world. They have played a fundamental role in the development of Norwegian music abroad with residencies at Panorama Bar, Fabric, Robert Johnson, Into the Valley and Moog, where they’ve given fellow Norwegian artists a platform to the outside world, proving to be a motivational force behind Oslo and Norway’s thriving electronic music scene, through Sunkissed and more recently through Jæger – the club founded by Olanskii and host to their internationally acclaimed Frædag residencies. Facebook Soundcloud info@jaegeroslo.no lost@jaegeroslo.no Grensen 9, 0159, © All rights reserved Jaeger Oslo 2018 Baggy made this
cc/2021-04/en_middle_0055.json.gz/line109
__label__wiki
0.792757
0.792757
Published on Jamaica Gleaner (http://jamaica-gleaner.com) Home > Blvk H3ro, Wayne J represent for ‘New Millennium’ Published:Friday | October 2, 2020 | 12:10 AMStephanie Lyew/Gleaner Writer [1] The art of collaboration may not be as simple as dipping a paintbrush into paint, but when Blvk H3ro (pronounced Black Hero) and Wayne J found themselves staring at the same canvas, more than once, the lyrical artistes decided to aim for a musical masterpiece. The recording artistes rise from different generations. Blvk H3ro, given name Hervin Bailey, is poised to stir it up in reggae as one part of the tribute group The Wailer’s Trio, and Wayne J, by the age of 12, had recorded the radio hit 18 and Older that demonstrated wisdom beyond his years. “We found a way to make an impact; at the same time, package our individual styles in a real way that people can appreciate our skills and lyrical ability. It bridges the gap between the different generations and set a pace where more artistes will be inspired to work together, leggo some of the unnecessary conflicts and make some big tune that will ultimately build careers,” Wayne J told The Gleaner. The Original track, released earlier this year, was the perfect amalgamation of the young music masterminds, which he says, “after the completion of the project, it only felt right to do a full project where both of us as artistes display our different styles”. “It’s a natural phenomenon; I’ve known H3ro for a while now. We have been making music around each other for years, but it was just in the stars for us to do music together and at this level. Once Original was recorded, all the other songs magically came together without any serious premeditation,” Wayne J continued. Nearing the end of extensive writing and recording sessions, the artistes compiled what has been dubbed New Millennium. “We want it to be a project that will represent for the current generation of music lovers, but also stand the test of time to live on and inspire the next generation that will forward when we gone – we’re laying the blueprint for the next millennium, not just this one, similar to those classic albums our parents gifted us with,” Wayne J explained. Blvk H3ro added, “This project is a statement from us as the new generation of Jamaican musicians. We grew up consuming the music of our parents and their parents, and now we as the youths are using our voices and singing the songs in our style and pattern. New vibes, new style, but with old-school sensibilities.” The album is etched in vintage-dancehall instrumentals and pays lyrical homage to originators, from King Jammys to Super Cat. There are jaw-dropping moments while listening to the voices of Blvk H3ro and Wayne J, both performing at the proficiency of seasoned veterans. The solidarity is admirable, even though for them it doesn’t come as a surprise “because we grow in the music like brothers,” said Blvk H3ro. “The connection has been good, creating music together, training on stage and preparing for the time we would step out together as we call it, the top team.” Blvk H3ro’s music video for Kush & Schweppes, one of his earlier productions, was filmed on the doorsteps of Wayne J’s house in Waterhouse; several years later the two stand in the same place shooting the video for what would be the catalyst to more collaborations. Speaking of collaborations, fast-rising dancehall deejay Skillibeng is the guest artiste on Young Boss Remix, which happens to be the album-closing track. “It’s like the universe brought together a dream team inna music; this is another one of those magical stories with this project. Linking with Skillibeng was organic, and it just so happens that he is based out of east, like us. While on the ends, he mentioned how much he rated Young Boss and the next thing I know, we have the sickest Skillibeng verse to make history with,” Blvk H3ro shared. Blvk H3ro also recommends first-time listeners to select Original and Ghetto Queen, while Wayne J says his picks on the album are number three, Top Team, and number five, The Prayer. “From the very beginning when Wayne J and I decided we wanted to be artistes, it has always been a team of us working together to make the dream work. Artistes, producers, creatives; and at one point Wayne J’s dad was the maestro. This is our vision coming to life, and the plan to build a strong team that will put out some great music together,” Blvk H3ro said. stephanie.lyew@gleanerjm.com [2] Source URL: http://jamaica-gleaner.com/article/entertainment/20201002/blvk-h3ro-wayne-j-represent-new-millennium [1] http://jamaica-gleaner.com/ana-marie-rodriquez/stephanie-lyewgleaner-writer [2] mailto:stephanie.lyew@gleanerjm.com
cc/2021-04/en_middle_0055.json.gz/line110
__label__wiki
0.630502
0.630502
Difference between revisions of "User:Moss/My Sandbox/Starfleet Marine Corps" < User:Moss‎ | My Sandbox Moss (talk | contribs) (Created page with "{{Military/Starfleet |color=Federation |image=250px |name=Starfleet Marine Corps |unit= |active=2161 |partof=Starfleet |government=United Federation of...") |decorations= |cincsf=President of the United Federation of Planets |cmdtsfmc=[[General]] Zachary Douglas |cmdtsfmc=[[Alan Taylor|Lt. General Alan Taylor]] |dcmdtsfmc=[[General]] Helen Roberts |dcmdtsfmc= |sgtmajsfmc=[[Sergeant Major of the Marine Corps]] Gareb th'Zarath |sgtmajsfmc= The '''Starfleet Marine Corps''', or ''SFMC'', is a department of [[Starfleet]] founded in 2161, charged with being the dedicated peacekeeping, ground assault of the [[United Federation of Planets]]. The Corps represents the practical reality that, despite the vaunted ideals of the Federation which Starfleet embodies, they exist in a continuously hostile and aggressive galaxy and require a dedicated military arm to deter hostile actions and provide a dedicated force of soldiers to augment Starfleet's otherwise defensively-oriented military operations. Starfleet Marine Corps United Federation of Planets Marine Combined Arms Ground forces Commander-in-Chief of the Federation Starfleet: President of the United Federation of Planets Commandant of the Starfleet Marine Corps: Lt. General Alan Taylor The Starfleet Marine Corps, or SFMC, is a department of Starfleet founded in 2161, charged with being the dedicated peacekeeping, ground assault of the United Federation of Planets. The Corps represents the practical reality that, despite the vaunted ideals of the Federation which Starfleet embodies, they exist in a continuously hostile and aggressive galaxy and require a dedicated military arm to deter hostile actions and provide a dedicated force of soldiers to augment Starfleet's otherwise defensively-oriented military operations. They are a relatively small department, and routinely detach groups of Marines to starships on an as-needed basis, depending on the mission and the commanding officer's desires. Starfleet Marine Corps members can be distinguished by the forest green colored undershirt to the traditional Starfleet uniform and their unique rank pips. 1.1 MACOs 1.2 2320 to the Dominion War 1.3 Dominion War 2 Capabilities 3.1 Space-ground task forces 3.2 Marine Corps camops 4.1 Leadership 4.2 Rank structure 4.3 Initial training During the formation of the Federation, it was decided that in the wake of the Earth-Romulan War that a ground presence was need since Starfleet Security was low on manpower and equipment. At the time of it formation, it was not known as the Starfleet Marine Corps, it would remain known as Military Assault Command Operations, also known as MACOs. The MACOs were used to fulfill the ground assault role for starships and act as an extra protective force. For nearly a century and a half, the MACO office at West Point, New York, was an independent body, comprised of trained military personnel and Starfleet officers in brevet positions within the structure, lending tactical expertise and advanced training facilities for Starfleet Security. Officer and enlisted exchange was common between the two organizations; Starfleet Security saw that the training was valuable for keeping their personnel sharp, and the MACOs benefited from the mobility of the Starfleet organization. Several senior high ranking officers inside of Starfleet was not happy with the MACOs retaining their own command authoity an having to seek approval to use them. They were envious of the special operations structure that the MACOs had developed. In turn, the MACOs relied very heavily on Starfleet to ferry them around, and their harmonious relationship often brought up talks about their merging. There were several attempts to bring the MACO structure under the control of Starfleet. The most worthwhile movements for this were put on hold in 2293, after the Klingon Empire and the Federation entered into the Khitomer Accords, and several MACO bases of operations were no longer needed along the Klingon border. It was also during this time that an embarrassment occurred when Colonel Patrick West, tactical adviser to the President, was discovered to be in the Cartwright conspiracy, and was killed during a botched assassination attempt of both the President and the Klingon Chancellor. Other parts of Starfleet, the people who wanted Starfleet to continue on the science and exploration and to be less viewed as a military force, kept pushing the MACO structure away. Several Starfleet captains denied their own personnel training at West Point due to this conflict; some even were very prejudiced towards the people that had received the training, a feeling that still runs through Starfleet to this day. Considerable conventional resistance was encountered at every step of the way, with Starfleet's peaceful exploration pushing the MACO structure away. From 2295 to well into the 2310s, this was the situation. MACO fully merged with Starfleet on 10 November 2320, after tensions with the Klingon Empire and the start of a Cardassian-Federation conflict stretched Starfleet Security too thin to guarantee the safety and security of the Federation. An Executive Order issued by the Federation President at the time and ratified by the Federation Council amended the charter of Starfleet to form the department known as the Starfleet Marine Corps. 2320 to the Dominion War Almost instantaneously, there were challenges for the newly minted department. There were members of the Joint Chiefs of Staff for Starfleet who were unhappy with having to dedicate resources to the new department. The Director of Starfleet Science whom was a member of the exploration arms, did not like the Marines in Starfleet, and wanted them removed. However, since the POUFP had a mandate that handled their merger and creation this created a great deal resentment overnight. Nevertheless, the Starfleet Marine Corps was pressed into service right away, setting up bases of operations along the Cardassian border, as well as the Gorn and Tholian border regions. It should be noted that the Marines were not only used for battle. When a Federation member asked for a peacekeeping force to enter their planet, the Marine Corps was asked in to represent the Federation. Marines were first used as the first line of defense for all Federation embassies scattered around the galaxy in 2339, and, in a joint operation with Starfleet Security, still make up Federation Embassy Security to this day. During the Federation-Cardassian War the Commandant of the Marine Corps at the time, ordered that five division be mobilized to the border for enhanced defenses. However, since the Corps was dependent upon Starfleet there were a lack of deployment cruisers, once set on a planet it was difficult and time consuming to move the divisions, as a result the Marine were not as able to defend the colonies as they should have been. Following the end of the Federation-Cardassian War in a surprising vote, the Federation Council ordered that the Starfleet Marine Corps be downsized to a at peace forces. This call recalled nearly all Marines back to Sol III and virtually disbanded the Marine Corp. With no force able to challenge Starfleet, and the Marines having not been a decisive force since before the Organian Peace Treaty the Marine Corp was reduced to ten divisions which were strategically places at Core Worlds. As a result if this action, General Wolf Lemon would resign as the Commandant of the Marine Corps. In 2367, the Federation and Starfleet would see and event that had never been foreseen as the Battle of Wolf 359. It was during this battle that Starfleet saw a major loss outside of a declared war, where they faced an enemy that had never been seen before. The 1st Marine Division and the 2nd Marine Divisions were forced to watch helpless from their headquarters on Luna and Titan as over eleven thousand Starfleet personnel either killed or assimilated. Following this battle, the Federation Council voted for the rearmament of the Marine Corp since it was shown that Starfleet was not equipped to handle an opponent. The Marine Corps was expanded at the time for a Division to every fleet. Dominion War The Dominion War started in late 2373, and the Marines were there to answer the call of battle. Being a mobile infantry corps armed with advanced weaponry, Marine bases were the only places to at least hold their lines during the first assault of Cardassian and Dominion troops on the ground along the Cardassian border. The ground operations during the First Battle of Chin'toka was fought mainly with Marines and Klingons working side by side, representing a joint operations in mind that quelled some of the distrust of the former combatants in the brief Federation-Klingon conflicts of 2372. Further operations include three failed operations to retake Betazed in 2374 and the fourth successful push in a joint operation with Reman commandos in 2375. The primary role of the Marines within the fleet is to maintain a well-armed offensive & defensive force for rapid deployment anywhere within Federation and outlying space. When assigned to a starship or starbase’s Marine detachments work with the crew in battles, board enemy ships and conduct planetary actions as well as assist in the protection of starbase's port. They also serve as a landing force to secure an area for transporter or shuttle landing. Unlike security, Marines do not walk a patrol, investigate crime or administer the brig and, unlike tactical, Marines do not operate the ship's weaponry. Because of their mixed land and space role, Marine forces are mainly specialized in planetary assaults using Infantry, Armor, Artillery, Air/Spacecraft, and other means. They train for many combat scenarios including hostage recovery, rescue of Federation citizens caught in the midst of conflict as well as full ground based combat. Marines also specialize in Visit, Board, Search & Seizure (VBSS) operations allowing them to assault, board and gain control of enemy vessels and stations as well as the job of sabotage. These specializations give Starfleet vessels an edge in combat. Since the Marine Corps does not employ many unique combat arms, as a force it has the ability to rapidly deploy a combined-arms task force to almost anywhere in the Federation within days. The basic structure for all deployed units is a Marine Advance Ground-Space Task Force (MAGSTF) that integrates a ground combat element, an aviation combat element and a Logistics combat element combat component under a common Command element. While the creation of joint commands has improved inter-service coordination between the Fleet and The Corps', their ability to maintain integrated multi-element task forces under a single command provides a smoother implementation of combined-arms warfare principles. Main article: Organization of the Starfleet Marine Corps The senior most Marine in the Marine Corps is the Starfleet Marine Corps Commandant; this individual is responsible for setting mandates for the Corps and for overseeing the training and operations of the Corps. They are assisted by the Starfleet Marine Corps Assistant Commandant, both hold the rank of General. They also serve as the point of contact between the Corps and the Federation Council as well as between the Corps and the Fleet. Space-ground task forces Marine Corps camops The Marine Corps operates many major camps, several of which host operating forces, several support and training installations, as well as satellite facilities. Marine Corps' bases are concentrated around the locations of the Marine Expeditionary Forces, though reserve units are scattered throughout the Federation. Other important camps include air stations, recruit depots, logistics bases, and training commands. Marines operate detachments at many installations owned by Starfleet and Federation member worlds to better share resources, such as specialty schools. Marines are also present at, and operate many, forward camps during expeditionary operations. As stated above, the Commandant of the Marine Corps is the highest-ranking officer of the Marine Corps; though s/he may not be the senior officer by time in grade and/or position of office. S/he is both the symbolic and functional head of the Corps, and holds a position of very high esteem among Marines. The Commandant has the responsibility to man, train, and equip the Marine Corps. S/he does not serve as a direct battlefield commander. The Commandant is a member of the Chiefs of Staff of Starfleet, and reports to the Commander, Starfleet. The Assistant Commandant of the Marine Corps acts as a deputy to the Commandant. The Sergeant Major of the Marine Corps is the senior enlisted Marine, and acts as an adviser to the Commandant. Headquarters Marine Corps comprises the rest of the Commandant's counsel and staff, with deputy Commandants that oversee various aspects of the Corps assets and capabilities. Rank structure Main article: Marine Rank As in the rest of Starfleet, Marine Corps ranks fall into one of three categories: commissioned officer, warrant officer (, and enlisted, in decreasing order of authority. To standardize compensation, each rank is assigned a pay grade. Branches of Starfleet Starfleet Communications Starfleet Research and Development Starfleet Corps of Engineers Starfleet Shipyards Operations Starfleet Intelligence Starfleet Aerospace Corps Starfleet Operations Starfleet Strategic Operations Starfleet Security Starfleet Tactical Starfleet Medical Starfleet Science Starfleet Diplomatic Corps Starfleet First Contact Office Starfleet Judge Advocate General Department of Logistics & Personnel Temporal Investigation Department Commander-in-Chief Chief of Staff, Starfleet Chief of Starfleet Operations Commandant of Starfleet Academy Director of Research & Development Chief of Starfleet Corps of Engineers Director of Starfleet Intelligence Head of Starfleet Aerospace Corps Chief of Starfleet Strategic Operations Chief of Starfleet Shipyard Operations Chief of Starfleet Security Director of Starfleet Tactical Director of Starfleet Science Surgeon General of Starfleet Judge Advocate General of Starfleet Director of Internal Affairs Director of Starfleet Diplomatic Corps Director of Starfleet Communications Director of Starfleet Logistics & Personnel Director of Temporal Investigations Ranks & Rates of Starfleet & other Govts Starfleet Uniforms UCIP Policies Retrieved from "http://lcars.ucip.org/index.php?title=User:Moss/My_Sandbox/Starfleet_Marine_Corps&oldid=25873"
cc/2021-04/en_middle_0055.json.gz/line115
__label__wiki
0.721542
0.721542
Relentless: Three Novels Boxed set of three bestselling suspense stories by Lindsey Stiles The Duel in European History: Honour and the Reign of Aristocracy Posted on Jan 16, 2021 Jan 16, 2021 by Victor G. Kiernan The Duel in European History Honour and the Reign of Aristocracy The romance and drama of the duel has made it an enduring attraction in novels plays and operas but it takes on a deeper significance when considered in its social evolutionary setting From medieva The romance and drama of the duel has made it an enduring attraction in novels, plays, and operas but it takes on a deeper significance when considered in its social, evolutionary setting From medieval times, the privilege of duelling was regarded as a badge of rank, an assertion of preeminence by Europe s dominant classes This book describes the evolution of the duel fThe romance and drama of the duel has made it an enduring attraction in novels, plays, and operas but it takes on a deeper significance when considered in its social, evolutionary setting From medieval times, the privilege of duelling was regarded as a badge of rank, an assertion of preeminence by Europe s dominant classes This book describes the evolution of the duel from its medieval origins to the early 20th century It also looks at the opinions about duelling in different areas and historical eras, as reflected in legislation, church pronouncements, and the works of philosophers such as Montesquieu, and writers like Walter Scott Kiernan discusses the duel as something unique to Europe and its colonies, its practice in Ireland and Scotland compared with English practice, what women thought of it, and how it contributed to the development of an officer corps, throwing new light on the long ascendancy of aristocratic classes and their values in European history. [PDF] Read ✓ The Duel in European History: Honour and the Reign of Aristocracy : by Victor G. Kiernan Victor G. Kiernan 247 Victor G. Kiernan Victor G. Kiernan says: Professor Victor Gordon Kiernan was a British Marxist historian and a former member of the Communist Party Historians Group with a particular focus on the history of imperialism. 363 Reply to “The Duel in European History: Honour and the Reign of Aristocracy” Miroku Nemeth Moore found in dueling annals astonishing proofs of the force and prevalence of wayward fashion over sound judgment and reason of the despotic tyranny and usurpation of the flitting phantom honour Throughout history societies have lived within the walls and under the roof of ideas and conventions slowly drying up into things they could only half or fitfully believe in, but could not break away from, for fear of a disruption of the social fabric Men are always dying, a Great War essayist wrote, f [...] E. Kahn The book is informative but deceptively old fashioned Kiernan s remarks on Eastern despotism contrasted to freewheeling Western aristos calls back to De Quincey s writings on the Caesars I was very surprised to find the book was published in 1988, because I would have placed it before WW2 at the very latest. This book is packed with anecdotes and references that only someone with both an extensive education in the arts and history, AND with a good memory for trivia will be able to understand Heck, I ve been a Jeopardy contestant and many of these references go over my head.When you combine that with some vaguely racist and sexist comments you end up with a book that reads like it was written in 1887 instead of 1987 The author clearly knew his subject, but it s hard for me to easily recommend this to [...] Kendine Ait Bir Oda Bardzo Czarna Dziura Vampire State of Mind The Silence of Bonaventure Arrow Meditation on Space-Time The Krishna Key عش سعيداً Povetron: Meteor Complete Quantum and Woody Classic Omnibus Cool Is For Fools: The Poetry of Marketing Girls' Night Out বাড়ি থেকে পালিয়ে A Final Act of Cruelty Tent Camping in the Pacific Northwest: Alaska Spec... নীল চোখের ছেলে অপারেশন কাঁকনপুর nexttimes powered by Victor G. Kiernan
cc/2021-04/en_middle_0055.json.gz/line130
__label__wiki
0.510959
0.510959
Year- End Assessment conducted, MGB kicks off for 2015 By: Lyndee Rose S. Basilio The Mines and Geosciences Bureau (MGB) R02 conducted its year-end assessment of its 2014 accomplishments vis- a -vis its target activities held on December 18, 2014, Planning Officer Ms. Imee Gatan- Agaloos briefed the MGB employees on the targets and accomplishment for the year. In its presentation, Agaloos stressed that MGB R02 surpassed most of its targeted activities and programs for the year 2014. MGB R02 Regional Director Mario Ancheta said that he is pleased with the Region’s accomplishment, giving credit to the devotion and dedication of the MGB R02 team. Further, he said that the reports of accomplished targets were a sign of well carried out projects and programs for the year 2014. One of the highlights of the 2014 accomplishment was the conduct of 4th Provincial Mining Regulatory Board (PMRB) Summit held on December 10, 2014 where it served as a venue for policy updates and discussion of mining and other related concerns among the Provincial Environment and Natural Resources Office (PENRO) of Region 02. Likewise, the office also spearheaded the 3rd Regional Mining Conference last December 11-12,2014 where over a hundred participants from the different mining companies, government agencies and private institutions from all over the region joined the two-day event. “This is a good end for 2014 and a good start for year 2015,” Ancheta said. Ancheta affirms end of Black sand mining in Cagayan Tuguegarao City, Cagayan (MGB)- The Mines and Geosciences Bureau Region 02 (MGB R02) through MGB Regional Director Mario Ancheta affirmed the end of black sand mining along the shorelines of Cagayan province. Ancheta made an assurance that black sand mining in Cagayan is already stopped with the issuance of corresponding orders. Ancheta ordered the former black sand mining permitees to conduct rehabilitation efforts in mining areas . Further, he said that the mining companies should free the area with its mining equipment. “By the end of 2014 we hope to see no traces of their operations (black sand mining),” Ancheta said referring to 10 China based mining firms whose permits were canceled last September by the MGB. This interview was made in response to the issue that black sand mining still exists in guise of dredging. Mines Bureau participates in JOGMEC conference By: LRB With the theme:”Sustainable Development and Environmental Conservation for the Mining Sector of the Philippines”, the Mines and Geosciences Bureau and the technical division chiefs from its Regional Offices participated in the seminar spearheaded by the Japan Oil, Gas and Metals National Corporation (JOGMEC) held last January 23, 2017 at New World Hotel, Makati. JOGMEC is a Japan-based company on minerals and energy that was established last 2004 to assure a stable supply of oil, natural gas, mineral resources, coal and geothermal energy of Japan and the Philippines. The said conference aimed to share information on exploration and environmental conservation for the mining sector, building good working rapport between the public and private sectors Japan. Discussed during the conference were: Philippines’ Policy for the Development of Mining Sector; Japanese Policy for Sustainable Development of the Mining Sector in Asia; Philippines’ Investment Promotion in the Mining Sector; Overview of JOGMEC Exploration Activities; Pollution Prevention Measures of Abandoned Mines in Japan; Current Status and Futures Prospect of the Mining Sector in the Philippines; and Mining Business in the Philippines. “ Since I assumed office last August 1, 2016, as Department of Environment and Natural Resources (DENR) Undersecretary and Concurrent MGB Director, news and headlines highlighted the alleged environmental violations of miners, suspensions of mining operations and show cause orders, audit of mining operations pursuant to memorandum order 2016-01 of Secretary Gina Lopez,” said Mario Luis J. Jacinto in his keynote address. He added,” I have always been inclined to believe that the responsible mining firms have nothing to fear from the conduct of the audit. I see the audit as in fact a blessing in disguise to responsible miners who have religiously followed and are compliant of mining and environmental laws, rules, and regulations.” Engr. Rommel L. Amogan, Chief, Mine Safety, Environment, and Social Development Division (MSESDD); Engr. Raymond D. Carreon, OIC Chief of Mine Management Division (MMD); and Ms. Felicitas V. Piligan, Chief of Geosciences Division were the participants of Region 02 during the JOGMEC conference. “ The mining industry will continue to be a potent force in the total effort for nation-building,” Jacinto expressed in his closing message. MGB R02 employees arrange surprise birthday party for RD Ancheta The employees of the Mines and Geosciences Bureau Region 02 (MGB R02) organized a surprise birthday party in honor of the OIC Regional Director Mario A. Ancheta in celebration of his 49th birthday last May 18, 2015 at MGB Conference hall. The revelry for RD Ancheta included birthday messages from the representatives of each division, video presentation and mini get together of MGB R02 employees. Demetrio Corsino, Community Affairs Officer (CAO) thanked RD Ancheta for the support he gave him during the setbacks in his life. Corsino said he almost gave up, but RD Ancheta told him to stay in MGB. Further, MGB R02 Budget Officer Remigia Manuel likewise thanked the Regional Director for his good leadership. Manuel added that RD Ancheta should continue his public servant’s leadership. Engr. Geoffrey Prado also gave a short message to RD Ancheta. “Buddy, we surpassed the challenges that came along our way. We are able to stop the controversial black sand mining in Cagayan. We are able to do it through your leadership and guidance. Buddy, continue helping those people who are in need,” Prado said. On the other hand, RD Ancheta gave a response by thanking the MGB R02 employees. “Thank you for the surprise party, but most of all thank you for always being there through thick or thin; thank you for remembering me,” the birthday celebrant said. “It’s been seven years since I became the Regional Director, and yet you are still there supporting me despite the hindrances during my first year of leadership,” he added. “You know how hard we tried to develop our office, you know what our accomplishments are, let our accomplishments speak for what we have done these past few years, thank you for believing in me, thank you for always being there,” he further said. Geosciences Division intensifies IEC drive “ Public awareness about geologic hazards is important to mitigate its impact”, said Regional Director Engr. Mario A, Ancheta during the Information, Education and Communication (IEC) drive on Geohazard Assessment and Mapping Program at Valley Hotel, Alimanao Hills, Penablanca, Cagayan. The Mines and Geosciences Bureau thru its Geosciences Division intensified its IEC campaign by inviting local leaders and their barangay officials to inform them on the impacts of geologic hazards in the community. Lectures focused on rain-induced landslide hazard, flood hazard and hazard in Karst Areas. The IEC drive likewise presented to the LGUs of Tuguegarao City and Penablanca, Cagayan the 1:10,000 flood and landslide susceptibility maps of their respective barangays. Geologists from MGB R0II explained to the local officials the use of the maps that will serve as their guides in their community-based disaster preparedness plans, comprehensive land use plans, development plans and identification of relocation sites in case of landslide and flooding incidents in their area. In the year 2014, the Bureau has already completed the assessment of 93 cities/municipalities and over 2,000 barangays in the Cagayan Valley Region for their 1:10,000 mapping scale. For 2015 onwards, MGB has been conducting region-wide IEC to educate the local government officials on geohazard. #LRB RD Ancheta attends 1st expanded staff meeting of MGB CO R02 Geologists partake in 2015 Geosciences Workshop MGB R02 pays tribute to retiree employee MGB R02 participates in 61st annual mining confab
cc/2021-04/en_middle_0055.json.gz/line132
__label__wiki
0.770542
0.770542
elizabeth brasfield carter Unknown number of other children (all died in infancy), George Washington Parke Custis (1801–1877), 3 other daughters (none of whom survived past age three), Elizabeth Kortright Gouverneur (1824–1868), Samuel Laurence Gouverneur, Jr. (1826–1880), Mary Louisa (December 2, 1828 – July 16, 1859), Georgiana Frances (September 10, 1830 – November 20, 1839), Grant Grenville Edward Sartoris (1875 – 1876), Ruth Chandler Roosevelt (Lindsley) (1934–2018), Sara Delano "Sally" Roosevelt (1946–1960), Tatiana Celia Kennedy Schlossberg (b. Female. Stepdaughter Sarah Reynolds (née Chuldenko) is a book illustrator (for Jimmy Carter's poetry volume) and painter who has worked with Jeff Koons,[6] and is married to Australian artist Stephen Reynolds. Explore how the celebrity world connects. Carbondale: Southern Illinois University Press, 2012, P. 478. Giant in the Shadows: The Life of Robert T. Lincoln. Starsight Delver, Amy married James Gregory Wentzel in 1996, and they became the parents of Hugo James in 1999. ", Margaret's illness was described by her father as "bilious fever. Elizabeth Brasfield Carter (1992–present) Children: Jason, Sarah (by Juliet Langford) Parents: Jimmy Carter Rosalynn Carter: John William "Jack" Carter (born July 3, 1947) is an American businessman and politician who unsuccessfully ran for the United States Senate in Nevada in 2006. Presidential children have been studied individually and as a class. with Unknown, Sarah Chuldenko-Reynolds{ "@context": "http://schema.org", "@type": "Person", "name": "Sarah Chuldenko-Reynolds", "gender": "Female" }, born 1978, age 40 born 1975, age 43 with Unknown. Should you have information that conflicts with anything shown please make us aware by email. She was born Eleanor Rosalynn Smith on August 18, 1927 in Plains, Georgia. IMPORTANT PRIVACY NOTICE & DISCLAIMER: YOU HAVE A RESPONSIBILITY TO USE CAUTION WHEN DISTRIBUTING PRIVATE INFORMATION. She wedded Carter following hi graduation in 1946 from the Naval Academy in Annapolis, Maryland. All Rights Reserved. His first marriage was to Juliet "Judy" Langford Carter. His second and current wife is Elizabeth Brasfield Carter, whom he married in 1992. step-child with Jack Carter{ "@context": "http://schema.org", "@type": "Person", "name": "Jack Carter", "gender": "Male" }, Sarah Murphy{ "@context": "http://schema.org", "@type": "Person", "name": "Sarah Murphy", "gender": "Female" }, born 1978, age 39 John Scott Harrison is the only person to be both the child and the parent of a U.S. president, being the son of William Henry Harrison and the father of Benjamin Harrison. Elizabeth Carter Children. Learn how your comment data is processed. They have two children, Jason and Sarah. Discover the Coney Barret family tree. Lock. His second and current wife is Elizabeth Brasfield Carter, whom he married in 1992. Study has generally followed two paths: The issue of what access and inclusion within the circles of power does to individuals' lives, aspirations, and outcomes;[1] and the issue of their influence on society and politics.[2]. Maiden name. Your email address will not be published. AKA: elizabeth sawyer carter, carter ellizabeth sawyer, ellizabeth sawyer carter, elizabeth a chuldenko, elizabeth sawyer carter, elizabeth a chuldenko, elizabeth s brasfield, elizabeth sawyer brasfield, lizabeth brasfield, elizabeth s carter. Maggot Brain Chords, Marriage with Jack Carter since 15 May 1992; parent of. Carter was born at the Naval Medical Center Portsmouth in Portsmouth, Virginia. Find Elizabeth Brasfield's phone number, address, and email on Spokeo, the leading online directory for contact information. Washable Tissues, Betty Bliss served as President Taylor's White House hostess, as the First Lady was an invalid. Carter's primary issues were his opposition to the Iraq War and his concerns about the healthcare system, especially what he characterized as its failure to meet its commitment to veterans. Father of Richard, Zachary, Louise, Elizabeth, and Myrthe. Join Facebook to connect with Sara Brasfield Carter and others you may know. Jimmy Carter has kept active despite his age, working with groups such as Habitat for Humanity, winning the Nobel Peace Prize in 2002 and founding the Georgia based nonprofit Carter Center. Elizabeth Carter's grandfather in law was, Elizabeth Carter's grandmother in law was, Elizabeth Carter's sister in law-by-marriage is, Elizabeth Carter's brother in law-by-marriage is, Elizabeth Carter's husband Jack Carter's aunt in law was, Elizabeth Carter's husband Jack Carter's uncle-by-marriage is, Elizabeth Carter's husband Jack Carter's uncle in law was, Elizabeth Carter's husband Jack Carter's aunt-by-marriage is, Elizabeth Carter's husband Jack Carter's aunt in law is. Who is Elizabeth Brasfield Carter? The most recent presidential child to die was John Eisenhower, the son of Dwight D. Eisenhower, who died on December 21, 2013. Carter struggled when he first entered college in 1965, attending Georgia Tech, Emory University, and Georgia Southwestern State University before enlisting in the United States Navy in April 1968 at the suggestion of his father. From 1977 to 1981, James Earl “Jimmy” Carter, Jr. was 39th president of the United States. Elizabeth Brasfield Carter is the wife of Jack Carter.. Elizabeth Brasfield James Earl Carter III nickname: Chip;Jim III and Jimmy Jr. born Apr 12, 1950 Caron Griffin Father of James Earl Carter IV (b. He received a "less than honorable" general discharge in late 1970 after he and 53 classmates were caught smoking marijuana at the Naval Reactors Facility in Idaho Falls, Idaho. stepson from Florence's first marriage, to Henry Athenton DeWolfe, Illegitimate daughter of Warren G. Harding, proven by DNA testing in 2015, Father of William Donner Roosevelt (1932–2003), Currently the oldest living presidential child. In order of their ages, they are: .mw-parser-output .legend{page-break-inside:avoid;break-inside:avoid-column}.mw-parser-output .legend-color{display:inline-block;min-width:1.25em;height:1.25em;line-height:1.25;margin:1px 0;text-align:center;border:1px solid black;background-color:transparent;color:black}.mw-parser-output .legend-text{} Current First Child. Outback Steakhouse Singapore Delivery, John Donelson was not related to Rachel Donelson Jackson, Frances Parke Lewis was the step great-granddaughter of, William Henry Harrison Taylor was Anna Tuthill Harrison's cousin. It’s been documented, after the 1953 death of her father-in-law, the Carters returned to Plains, Georgia to assume management of the family’s peanut farming business. Pokemon Trainer In Super Smash Bros Ultimate, African American Newspapers In The 1930s Faced Many Hardships, What Methods Did The Alabama State Troopers Use, Treating and Preventing Obstetric Fistula. stepson from Florence's first marriage, to Henry Athenton DeWolfe, Illegitimate daughter of Warren G. Harding, proven by DNA testing in 2015, Father of William Donner Roosevelt (1932–2003), Currently the oldest living presidential child. James Monroe wrote that his only son died on September 28, 1800. "[39][40] died in train accident in front of his parents, weeks before his father was inaugurated. Jothe Jotheyali Serial 2020 Cast, My Sim Can't Go To Work Sims 3, Fallout 76 Camera Locations 2020, 2001 Tracker Targa 17 For Sale, Miguel Almaguer Home, Kodak Pixpro Az401 Tips And Tricks, Steve Mcgarrett House Floor Plan, Games Inspired By The Thing, Falling Inflation Means Quizlet, Paul Renner Quotes, How Do I Write A Mail To Client Asking About Current Order Status?, Nra Convention 2021, Boy's Life Robert Mccammon Themes, Lou Perryman In Poltergeist, Piaggio Beverly 350 Review Mcn, Bitumen Definition Art History, My Favorite Snack Essay, Electromagnetic Waves Staelin Pdf, How To Wire Wall Light With Pull Switch, Lancer Raps Lyrics, Butterfly Digimon Tri Lyrics, Mr Monk Goes To Jail Cast, Mazda Cosmo Price, Biggest Carp Caught In Australia, Apocalypse Now Medevac Scene, Nicole Sheindlin Net Worth, Hercules Vs Poseidon, Bike Gear Calculator Speed, Pure As The Driven Snow Lyrics Ballad Of Songbirds And Snakes, Chano Pozo Cause Of Death, How Did Josh Bay Die, All Astroworld Merch, Michele Michaels Wdve, How To Calculate Total Amps In 3 Phase, Sandra Goldstein Husband, Buoyancy Game Wiki, Pictures Of Master P Brother Kevin Miller, Michele Michaels Wdve, Homeward Bound' On Netflix, Koala To The Max, Lily Lesser Age, Mead Me Vs I Mcat, Ford Paint Code 03, elizabeth brasfield carter 2020
cc/2021-04/en_middle_0055.json.gz/line135
__label__wiki
0.526988
0.526988
More Than 20 Arrested in Blockades of Train Delivering Coal to N.H. Power Plant (SOURCE: Boston Globe) Protesters blocked railroad freight tracks in Worcester, Ayer, and Hooksett, N.H., on Saturday and Sunday, trying to keep a train from delivering coal to a New Hampshire power plant. “In 2019, there’s no reason for us to still be burning coal,” said Marla Marcum, director of the Climate Disobedience Center. “We’re tired of paying for it. We’re tired of paying for the kind of plant that pollutes the river and causes asthma and contributes to climate change.” The train was delivering coal to Merrimack Station, a power plant in Bow, N.H. The protests were part of an ongoing effort to shut down the coal power plant. No injuries were reported. Protesters called the train’s dispatchers before they blocked the tracks so as not to take engineers by surprise, Marcum said. In Worcester on Saturday, protesters were given warnings and left the railroad tracks without being arrested, Marcum said. In Ayer, police arrested 12 people on charges of trespassing on railroad property Sunday. All were released on personal recognizance and scheduled to appear in Ayer District Court, Ayer Police Deputy Chief Brian Gill said. Bow Coal Train 1/26/10 Another 12 people were arrested on a railroad bridge in Hooksett, where they had hung an anti-coal banner, said Rebecca Beaulieu, a climate organizer with 350 New Hampshire, a climate advocacy organization. They were charged with trespassing and are due in court in January. Labels: ayer, bow, coal, MBTA, new hampshire, railroad, train Coal Protesters Arrested for Blocking Train in Ayer MA (SOURCE: Lowell Sun) AYER — Environmental activists brandishing signs protesting the use of gas and coal were arrested after they blocked the path of an oncoming freight train during the early morning hours Sunday, authorities say. Between 15 and 20 protesters — bundled in winter gear — were found by police standing on the train tracks at about 3:45 a.m., according to the Ayer Police Department Facebook page. The group held signs that stated, “Stop the coal trains,” and “Coal Kills.” After the protesters refused to leave the tracks, Ayer Police said they contacted state police and police departments in Groton, Harvard, Littleton and Shirley to assist at the scene. According to police, 12 protesters were taken into custody and charged with trespassing on railroad property. They will be arraigned in Ayer District Court on Monday. The names of the protesters facing charges were not immediately available. An investigation into the protest forced Ayer Police Sgt. John MacDonald to break away from a motor vehicle accident involving a car into a tree, according to the police Facebook post. Labels: arrested, ayer, freight, liberals, Massachusetts, police, protesters, railroad MBTA Safety Review Panel Final Report Want to read more about the December 9, 2019 MBTA Safety Review Panel Final Report? Try these links: https://d279m997dpfwgl.cloudfront.net/wp/2019/12/12-09_MBTA_Safety_Executive_Summary.pdf https://www.bostonglobe.com/metro/2019/12/09/read-panel-summary-mbta-operations-and-safety/7cJoGcT8qEibnkZyDSkQGP/story.html https://blog.mass.gov/transportation/mbta/mbta-safety-review-panel-recommendations-to-fmcb-to-improve-safety-for-t-riders-employees/ Labels: Massachusetts, MBTA, railroad, Review Panel Final Report, safety, subway, train Damning MBTA Safety Report Released (SOURCE: Boston Globe - J. Ellement) The MBTA’s safety system was examined by three outside experts and their findings were damning at best. What follows is five of the major conclusions outlined in the executive summary based on interviews with T employees at every level of the workforce. - The T has failed to include safety concerns in its daily operations, routine maintenance schedules or long-term investment and construction plans, according to the report. “In essence, safety is not the priority at the T, but it must be. To meet the demands of the future, the agency must address its safety culture – it is critical to every aspect of the agency.’’ - Turnover at the top job, the T’s general manager, has eroded the importance of safety issues at the very highest levels of the region’s primary public transit system, the panel found. There have been nine general managers since 2010. “Leadership sets the tone for safety ... the recurrent turnover in general managers (GMs) over the past 10 years has been incredibly disruptive and has placed the agency in a vulnerable position. This may be the overarching reason that we see the level of safety deficiency at the agency.” - T employees don’t talk to one another, and this is especially troubling because safety concerns raised inside the agency rarely reach the right person or office that can then take the needed corrective action, the report found. “There is a total lack of routine upward or downward communication within the agency. Employees at all levels told the Panel that the T has many siloes and that communication is rarely, if ever, done across departments. Leadership has not identified or attempted to open channels of communication with the workforce.... The only avenue for communication we identified during this review is a ‘safety hotline’ which does not appear to have received the confidence of the workforce in the field.” - The T does have a stand-alone safety department but it is an organizational orphan with little ability to play a forceful role in workplace safety and other safety concerns facing the agency. “The safety department, which should be providing day-to-day leadership for safety initiatives, is somewhat debilitated in what they can accomplish, and lacks the ability to guide the agency at large,” the report said. “For example, the staff is absent in the field to support the workforce and champion a safe work environment. On the other hand, the safety department is grossly understaffed, lacks subject matter experts (SMEs) and is currently not in any position to manage the needs of the agency.” - The experts concluded that the MBTA’s commuter rail system, which is operated by Keolis Commuter Services, has a far better safety environment than the T’s transit system. The experts noted that Keolis operates under the Federal Railroad Administration rules and regulations. “It is noteworthy to mention that the commuter rail service is performing well and does not face many of the challenges that were identified on the transit side of the house. The Panel attributes this higher level of performance to the structure provided by FRA regulations, which are clearly defined and have fiscal consequences if not complied with.” John R. Ellement can be reached at ellement@globe.com. Follow him on Twitter @JREbosglobe. Labels: 2019, Massachusetts, MBTA, railroad, report, review, safety, subway, train Search the NED Blog! NED Blog Pages New England Railroad Station Sign Reference Images New England Railroad Lineside Sign Reference Image... More Than 20 Arrested in Blockades of Train Delive... Coal Protesters Arrested for Blocking Train in Aye... Railroad Items For Sale The New England Depot RR Picture Archive PLEASE NOTE: All original photos within this blog are property of Jonelle DeFelice unless otherwise noted. DO NOT COPY without permission! Photos from other photographers are noted as such when possible and belong to the original owners. Original Content/Photos © 2010-2017 Jonelle DeFelice - Linked/Editorial Content © Original Owners. Simple theme. Powered by Blogger.
cc/2021-04/en_middle_0055.json.gz/line140
__label__wiki
0.815544
0.815544
The PopBrokers Release New Single, “3 Words” Check out The PopBrokers and Their Latest Collaboration With Wes Quave The PopBrokers was started by Anthony Cruze as a supergroup to shake the music industry. Anthony brings to this musical act, years of experience creating chart-topping remixes and talent that got him gigs like the 2014 FIFA World Cup and the 2016 Olympic Games ceremony in Rio. “3 Words” is The PopBrokers’ new single, featuring the American recording artist, Wes Quave. “It takes you on a slow ride with its smooth pop tune and vocals as it tells the story of a man and a woman who stopped communicating amid troubled times.” As the song goes on, it leaves listeners with the soulful message to not take communication for granted. Even 3 simple words like “I love you” or “are you ok?” are enough for showing the listener’s care and concern for their loved ones. “3 Words” is a relatable pop song that will resonate with a wide range of audiences. The PopBrokers have beautifully echoed the struggles and experiences of listeners during the pandemic, through this single. The act capped the year 2020 by being the #3 most popular dance act in the world on ReverbNation. With this new song and many other upcoming releases, they hope to only go further up next year. Check out The PopBrokers and their music, available for streaming on all digital media platforms. To contact the artist for interviews, reviews, and collaborations, use the information given below. Anthony Cruze is a Guinness World Record winning producer, creator, and DJ hailing from Australia. The DJ artist is considered a pioneer in music, streaming, video, and other entertainment technologies. His 3-decade long experience deejaying has helped Anthony achieve great heights in his career, nationwide and internationally. Apart from his musically inclined skills, what really makes Anthony stand out is his enthusiastic showmanship throughout concerts and major launch parties. Anthony is now busy working with his new musical group, The PopBrokers. Main Website URL: https://popbrokers.com Youtube Video URL: https://youtu.be/IuCVZXSfmsc Youtube URL: https://www.youtube.com/channel/UCtivYqDbeRj6e6TAe7sMGaA Other Website URLs https://www.facebook.com/popbrokers https://www.instagram.com/antcruze Tweets by ant_cruze Company Name: The PopBrokers Contact Person: Anthony Cruze City: Melbourne State: Victoria Website: https://popbrokers.com
cc/2021-04/en_middle_0055.json.gz/line141
__label__cc
0.717744
0.282256
Breaking the link between exploitative recruitment and modern slavery “I bought you…” By Roel Nieuwenkamp, Chair of the OECD Working Party on Responsible Business Conduct (@nieuwenkamp_csr) Ahmed, from India, paid over 1,300 USD to a recruiter to accept a position as a driver in Saudi Arabia. However, upon arrival his employer confiscated his passport and refused to pay him although Ahmed worked 12 to 14 hour days. Benny, from the Philippines, invested over 2,000 USD in recruitment fees in exchange for the promise of a well-paid factory job in Taiwan. Upon arrival Benny’s wages were half of what was originally promised to him and after three years of working 12 to 17 hour days he barely managed to save enough to pay off his initial investment, returning home with no savings. These men’s stories are not unique. A quick scan of the website of Verité, an organization committed to promoting fair labour standards and combating exploitative recruitment practices, reveals many shocking histories of migrant workers who have been subject to abuse and fraud. Exploitative recruitment of migrant workers often results in situations of de facto modern slavery. Recruitment can involve up to seven different middle men all charging a fee which means workers incur debts in the thousands of dollars before they even take up employment. Even in situations where employment is provided as promised, these upfront debts can mean that any wages a worker manages to save simply go back to paying off their debt to the recruiter. Issues around recruitment of migrant workers have received particular attention in the context of the Gulf countries. In this region use of the Kafala system, a sponsorship-based employment system for migrant workers, is common. Under the Kafala system migrant worker’s legal residency is tied to their employer, giving employers power over working conditions and whether workers can change jobs, quit jobs, or leave the country. This system paired with exploitative recruitment practices leads to situations where workers, thousands of miles from home and severely indebted, are at the mercy of their employers. However de facto modern slavery is by no means an issue limited to the Gulf region. Recent research produced by Verisk Maplecroft found that almost 60 percent of countries are at high risk of using slave labour. Source: Modern Slavery Index, Verisk Maplecroft In previous articles, I have highlighted some of regulatory approaches that nations are taking to combat modern slavery at home and throughout global supply chains, including through the UK Modern Slavery Act, trade regulations in the US prohibiting imports made with forced labour, and more generally regulations promoting increased due diligence and reporting across global supply chains to promote responsible business conduct including the EU Directive on non-financial disclosure. Additionally, earlier this year an executive order was a finalised by the Obama administration which prohibits companies from receiving US federal contracts if they recently violated labour laws. This regulation has provided even more impetus to companies to ensure that they are not linked to exploitative labour practices. In addition, tools and standards are also being developed to target the issue of exploitative recruitment practices specifically. For example the Dhaka Principles for Migration With Dignity were launched in 2012 and provide a set of human rights based principles to enhance respect for the rights of migrant workers from the point of recruitment, during employment and through to further employment or safe return. The principles align with the UN Guiding Principles for Business and Human Rights and thus also with the OECD Guidelines for Multinational Enterprises. Verité has developed a Fair Hiring Toolkit which provides targeted guidance around recruitment issues for various actors along the supply chain including for brands, suppliers, governments, advocates, auditors, and investors. This tool kit includes a list of red flags with regard to recruiter-induced hiring traps. For example one red flag is long ‘’supply chains’’ between the worker and employer in terms of intermediaries used in the hiring process and degrees of separation such as language barriers, cultural and social differences, and geographical distances. Brands are also taking initiative to combat exploitative recruitment processes. Earlier this year five of the world’s largest multinationals, the Coca-Cola Company, HP Inc., Hewlett Packard Enterprise, IKEA and Unilever, launched the Leadership Group for Responsible Recruitment. This initiative focuses on promoting ethical recruitment, specifically through recognizing the employer pays principle. Under the employer pays principle, workers are never responsible for their own recruitment fees. According to the Ethical Trading Initiative 71% of companies suspect the presence of modern slavery in their supply chains. Thus it is important to promote human rights due diligence that addresses recruitment issues throughout supply chains. In this regard the OECD has developed detailed guidance on carrying out supply chain due diligence in several sectors based off of the general principles of the OECD Guidelines for Multinational Enterprises. For example the OECD Due Diligence Guidance for Responsible Supply Chains of Minerals from Conflict-Affected and High-Risk Areas, the global standard on mineral supply chain responsibility, provides a 5 step framework for due diligence to manage risks in supply chains of minerals including forced labour in the context of artisanal mining. This Guidance is now the leading standard for avoiding child and forced labour in mineral supply chains and has been integrated as an operating requirement in the DRC, Rwanda and Burundi. The FAO and OECD recently jointly developed a Due Diligence Guidance for Responsible Agricultural Supply Chains which also provides due diligence recommendations to manage risks related to forced labour in high risk agriculture sectors including palm oil and cocoa. Such approaches could be applied in the context of the Thai shrimping industry as well. Additionally, the OECD is also developing a Due Diligence Guidance on Responsible Garment and Footwear Supply Chains, which provides specific recommendations for addressing risks of forced labour. This Guidance will be launched later this year and will be relevant to migrant workers in textiles factories. Resources to help businesses identify responsible recruitment agencies are also needed. This has been one of the objectives behind the International Recruitment Integrity System (IRIS) an initiative of the International Organization for Migration. As part of its principle activities IRIS is planning to develop an accreditation framework under which members can be recognized as fair recruiters. This will be based, among other criteria, on the fact that no fee is charged to job seekers, worker’s passports of identity documents are not retained and there is transparency in labour supply chains. A strong relationship exists between exploitative recruitment practices and forced labour. Breaking this link through promoting ethical recruitment will be very important given the vast scope of the issue as well as increasing regulation seeking to prevent these practices. The initiatives discussed in this article provide promising ways forward. In order to effectively eradicate abusive recruitment practices companies should engage in supply chain due diligence processes which take into account these risks. Commitments to the ‘’employer pays’’ principle must be scaled up. Companies faced with significant risks with regard to these issues should follow the recommendations of the Leadership group for Responsible Recruitment and use the resources being developed through the IRIS initiative. OECD Guidelines for Multinational Enterprises OECD CleanGovBiz initiative Roel Nieuwenkamp maintains a blog where all of his articles are archived. Please visit https://friendsoftheoecdguidelines.wordpress.com/ Tags:employment, responsible business conduct, slavery 2 comments to “Breaking the link between exploitative recruitment and modern slavery” You can leave a reply or Trackback this post.
cc/2021-04/en_middle_0055.json.gz/line148
__label__cc
0.691713
0.308287
Southern Christian Leadership Conference 28 National Association for the Advancement of Colored People (NAACP) 15 Mays, Benjamin E. (Benjamin Elijah) 14 Montgomery Improvement Association 13 King, Martin Luther 12 Wilkins, Roy 12 Abernathy, Ralph 11 Dexter Avenue Baptist Church (Montgomery, Ala.) 10 Ebenezer Baptist Church (Atlanta, Ga.) 10 Jesus Christ 10 Randolph, A. Philip (Asa Philip) 9 Lincoln, Abraham 8 Rockefeller, Nelson A. (Nelson Aldrich) 6 Tillich, Paul 6 DeWolf, L. Harold (Lotan Harold) 5 Morehouse College (Atlanta, Ga.) 5 Peace Corps 5 Sermon 10 Speech 10 Martin Luther King, Jr. - Public Speaking 320 Martin Luther King, Jr. - Publications 172 Montgomery Bus Boycott 148 Martin Luther King, Jr. - Career in Ministry 126 Nonviolence 123 Strength to Love 100 Martin Luther King, Jr. - Political and Social views 92 Support correspondence 76 Voter registration 71 Martin Luther King, Jr. - Religion 69 Church and Race Relations 57 Communism 52 School integration 51 Southern Christian Leadership Conference--meetings 51 Brown vs. Board of Education, Topeka, Kansas 50 Afro-Americans - Economic conditions 45 Segregation--law and legislation 44 Southern Christian Leadership Conference--relations with other organizations 40 Martin Luther King, Jr. - Publications - Reprints 39 Poverty 39 Race relations 37 Bible, N.T. 35 MLKPP, Martin Luther King, Jr. Papers Project, Stanford University, Stanford, Calif. 1963 MLKP-MBU, Martin Luther King, Jr., Papers, 1954-1968, Boston University, Boston, Mass. 1073 MLKJP-GAMK, Martin Luther King, Jr. Papers (Series I-IV), Martin Luther King, Jr., Center for Nonviolent Social Change, Inc., Atlanta, Ga. 297 DABCC-INP, Dexter Avenue King Memorial Baptist Church Collection, In Private Hands 84 SCLCR-GAMK, Southern Christian Leadership Conference Records, 1954-1970, Martin Luther King, Jr., Center for Nonviolent Social Change, Inc., Atlanta, Ga. 72 CSKC-INP, Coretta Scott King Collection, In Private Hands 47 CKFC-INP, Christine King Farris Collection, In Private Hands 22 MLKEC-INP, Martin Luther King, Jr. Estate Collection, In Private Hands 20 NAACPP-DLC, National Association for the Advancement of Colored People Papers, 1909-1955, Library of Congress, Washington, D.C. 14 RBFP-INP, Robert Brank Fulton Papers, In Private Hands 14 BRP-DLC, Bayard Rustin Papers, Manuscript Division, Library of Congress, Washington, D.C. 12 CAABP-WHi, Carl and Anne Braden Papers, State Historical Society of Wisconsin, Madison, Wis. 12 BRP-DLC, Bayard Rustin Papers, Library of Congress, Washington, D.C. 11 NAACPP-DLC, National Association for the Advancement of Colored People Collection, Manuscript Division, Library of Congress, Washington, D.C. 10 RKC-WHi, Richard Kaplan Collection, State Historical Society of Wisconsin, Madison, Wis. 10 APRP-DLC, A. Philip Randolph Papers, Manuscript Division, Library of Congress, Washington, D.C. 9 DJG-GEU-S, David J. Garrow Collection, Manuscript, Archives, and Rare Book Library, Emory University, Atlanta, Ga. 8 SNCCP-GAMK, Student Nonviolent Coordinating Committee Papers, 1959-1972, Martin Luther King, Jr., Center for Nonviolent Social Change, Inc., Atlanta, Ga. 8 AFSCR-PPAFS, American Friends Service Committee Records, American Friends Service Committee Archives, Philadelphia, Pa. 7 EBCR-INP, Ebenezer Baptist Church, Miscellaneous Records, In Private Hands 7 HRECR-WHi, Highlander Research and Education Center Records, State Historical Society of Wisconsin, Madison, Wis. 7 SLFBI-DJ, Stanley Levison FBI File, United States Department of Justice, Washington, D.C. 7 FBIDG-NN-Sc, David Garrow Federal Bureau of Investigation Collection, Manuscripts, Archives and Rare Books Division, Schomburg Center for Research in Black Culture, The New York Public Library, New York, N.Y. 6 188 records – page 1 of 19. Letter to William Robert Miller Miller, William Robert WRMP-GAMK William Robert Miller Papers, 1955-1968, Martin Luther King, Jr., Center for Nonviolent Social Change, Inc., Atlanta, Ga. Box 61, folder 8,9 Letter to W. T. (William Talbout) Handy Initialed Handy, W. T. (William Talbout) [Newman Methodist Church] Handy, Ruth Newman Methodist Church Alexandria, La. WTH-INP W. T. Handy Collection, In Private Hands Letter to Glenn E. Smiley Smiley, Glenn E. [Fellowship of Reconciliation (U.S.)] Hassler, Alfred Tuskegee Institute Denver, Colo. Martin Luther King, Jr. - Health Montgomery Improvement Association--publicity Montgomery Improvement Association--relations with other organizations FORR-PSC-P Fellowship of Reconciliation Records, 1943-1973 , Swarthmore College Peace Collection, Swarthmore, Pa. ''The Dexter Echo: Vol. 1, no. 3'' King, Yolanda Denise Nabors, Billy Joe Letter to Nannie Helen Burroughs Burroughs, Nannie Helen [National Trade and Professional School for Women and Girls] National Trade and Professional School for Women and Girls NHBP-DLC Nannie H. Burroughs Papers, Library of Congress, Washington, D.C. Box 63, folders 15, 16, 17. Letter to Walter George Muelder Muelder, Walter George, [Boston University. School of Theology] Boston University. School of Theology WMP-MBU Walter Muelder Papers, Boston University, Boston, Mass. ''Existentialism and Theology: An Investigation of the Contribution of Rudolf Bultmann to Theological Thought'' Not in Inscription by Davis 12/22/1958. Marginal comments by King New York: Philosophical Library, 1957 Sermon file, folder 50 Letter to A. Philip (Asa Philip) Randolph Randolph, A. Philip [Brotherhood of Sleeping Car Porters and Maids] Eisenhower, Dwight D (Dwight David) Martin Luther King, Jr. - Presidential meetings APRP-DLC A. Philip Randolph Papers, Manuscript Division, Library of Congress, Washington, D.C. BRP-DLC, Bayard Rustin Papers, Manuscript Division, Library of Congress, Washington, D.C. Box 64A, folder 22, 23
cc/2021-04/en_middle_0055.json.gz/line149
__label__wiki
0.682452
0.682452
New mass promo video released by Master team For the last few days, ‘Master’ makers have been promo videos through their Twitter handle. The sixth promo video got released last day. It features both Vijay and Vijay Sethupathi with the track ‘Polakattum Para Para’, composed by Anirudh, in the background. While Vijay Sethupathi is seen dancing and having fun with a bunch of gangsters, Vijay can be seen delivering some punches. ‘Master’ directed by Lokesh Kanagaraj has Vijay and Vijay Sethupathi pitted against each other. The former plays an alcoholic college professor, while Sethupathi essays the villain role of a villainous gangster named Bhavani. Others in the cast include Malavika Mohanan, Andrea Jeremiah, Shanthanu Bhagyaraj, Arjun Das and Gouri Kishan among others. ‘Master’ is all set for a massive release on January 13. Since the Tamil Nadu government has only allowed 50% occupancy, there is a great demand for tickets. Most screens have already been sold out for the opening day. The film is also getting dubbed and released in Hindi and Telugu. The Telugu version is releasing simultaneously on January 13, while the Hindi dubbed version will be out on January 14. Related Items:actor vijay, Lokesh Kanagaraj, Master, Vijay Sethupathi Arun Vijay as a cop; Watch Sinam teaser here! Vijay Sethupathi’s Tughlaq Durbar teaser is promising
cc/2021-04/en_middle_0055.json.gz/line151
__label__cc
0.542089
0.457911
Front1.jpg http://annemccrory.co.uk/images/Front1.jpg Parishes and Mass Times On this site you will find Mass times and information about the parishes and clergy within our Archdiocese. Archbishop Tartaglia's Speeches View Archbishop Tartaglia's speeches, letters and upcoming engagements for the month. You can now donate online to your Parish or Fund of choice within the Archdiocese of Glasgow. Parish Name: Saint Margaret Mary 99 Dougrie Road Post Code: G45 9NT Parish Email: Parish Priest: Rev. Ian Bathgate SX MDiv PGCE BTh (1990) Sunday Masses: Vigil: 6.00pm Morning: 10.00am Weekday Mass: 10.00am Holy Day of Obligation: as announced. Confession: after morning Masses; before and after Vigil Mass. Archdiocese Twitter Tweets by @ArchdiocGlasgow Pope Francis prays for Indonesia after deadly earthquake Vatican City, Jan 15, 2021 / 06:19 pm (CNA).- Pope Francis sent a telegram Friday with his condolences for Indonesia, after a strong Rome Newsroom, Jan 15, 2021 / 01:00 pm (CNA).- The Vatican court is due to hold a sentence hearing next week in a criminal trial Vatican City, Jan 15, 2021 / 12:40 pm (CNA).- The United States ambassador to the Holy See, Callista Gingrich, met with Pope Francis What changes to the Vatican may the replacement of the Archpriest of St Peter's Basilica bring Vatican City, Jan 14, 2021 / 05:45 pm (CNA).- Pope Francis might soon choose a new Archpriest of St. Peter's Basilica, to Scottish Christian Internet Radio Radioalba.org christian is sponsored by Glasgow Churches Together and by the music committee of the Archdiocese of Glasgow. We welcome contributions gladly and are particularly keen on promoting material from schools as we continue to develop our service to the community. Download the free Radio Alba app from iTunes. Flourish Newspaper The award winning Flourish newspaper is the official full colour monthly newspaper for the Archdiocese of Glasgow. The Mungo Foundation The Mungo Foundation is a leading independent provider organisation founded by the Archdiocese of Glasgow. Archdiocese of Glasgow Arts Project The Archdiocese of Glasgow Arts Project exists to help people explore, express and celebrate faith through the arts. Click here to visit the website. Pastoral Care Fund The Pastoral Care Trust/St Nicholas Care Fund was set up in 1992 to mark the 500th anniversary of the Archdiocese of Glasgow.
cc/2021-04/en_middle_0055.json.gz/line158
__label__wiki
0.909124
0.909124
otis dozovic wife [38][39] On the September 11 episode of Smackdown, Otis and Tucker began a feud with The Miz and John Morrison after they stole the Money in the Bank briefcase from Otis. Daniel Bryan • He competed against Austin Aries on an episode of NXT. Rose responded with the following message on Twitter: The current plan is to reportedly have a mixed tag team match between Otis & Mandy Rose and Sonya Deville & Dolph Ziggler, possibly at the Money in the Bank PPV. Dominik Dijakovic • 310 lbs (141 kg) Johnny Gargano • Ideanomics Wikipedia, Otis Otis Dozovic: Billed height: 5 ft 10 in (1.78 m) Billed weight: 350 lb (160 kg) Trained by: Mercury Pro Wrestling Academy WWE Performance Center: Debut: 2015: After signing with WWE in 2016 and was assigned to their developmental brand NXT, he has since teamed with Tucker Knight as … [22] The following week on Raw, they defeated The Ascension (Konnor and Viktor) in their in-ring debut. They're creative thinkers, economic, cautitous and appreciate the arts, they can also be indecisive. Carmax Reviews Selling, [31][32] On the February 14, 2020 episode of SmackDown, Otis had a date with Rose, but Dolph Ziggler appeared in Otis's place during the date,[33] the storyline then evolved into a love triangle involving a feud between Otis and Ziggler over Rose. Charles Robinson • Team Heavy Machinery made their televised returned during the November 7 episode (taped on October 17), during which they defeated Forgotten Sons members Steve Cutler & Wesley Blake. [25] As part of the Superstar Shake-Up, Heavy Machinery was moved to the SmackDown brand. 664.3k Followers, 823 Following, 1,943 Posts - See Instagram photos and videos from OTIS (Dozer) (@otis_wwe) People who are born with Saturn as the ruling planet are disciplined and are hard workers. Three nights later, team Heavy Machinery returned for the October 20 house show, competing in a Fatal Four Way Elimination No. After that, Rose started her career in the bikini competition circuit and it soon translated into a role on WWE Tough Enough. Kavita Devi • Akira Tozawa • Sean Maher Death, Then coach Sara Amato goes, “We need everyone to have a fruit nickname.” I go “That’s hard to do,” because we’d call her a banana or a strawberry something in between there. Orlando, Florida. Lince Dorado • Discover what happened on this day. Having been raised under the mantra "follow your dreams" and being told they were special, they tend to be confident and tolerant of difference. When Dolph was struggling to try and make the cover Mandy came down and confronted Deville. The following year on February 24, 2017, Heavy Machinery had their first title match challenging the The Authors Of Pain (Akam & Rezar) for the NXT Tag Team Championship. CelebsMoney has recently updated Otis Dozovic’s net worth. Best Stain Remover, He was a champion at the 2009 Greco-Roman junior Nationals. Myomo Screening, Drew McIntyre • Candice LeRae • Otis Dozovic is part of a Millennial Generation (also known as Generation Y). Zelina Vega, Adam Cole • Thanks to his penchant for putting up inhuman numbers and reps in the Performance Center’s weight room, the 330-pounder has made waves since his arrival at the WWE PC. Byron Saxton • Bray Wyatt • Billed from “When I said ‘hi’ to her the first time, she literally spoke to me for about half an hour. Heavy Machinery", "3/14 NXT TV Report: Tomasso Ciampa returns, Adam Cole vs. Pete Dunne, Almas-Black contract signing, Sanity vs. Moss & Sabbatelli", "Heavy Machinery def. [12] On April 12, 2016, Bogojevic signed a contract with WWE and was assigned to the WWE Performance Center. The 28-year-old wrestler was born in Duluth, Minnesota, USA. Marcel Barthel • Debut However, we don't know whether they are still together. Cathy Kelley • Organization: WWE Birth Name: Nikola Bogojevic Born: December 21, 1991 (age 27) in Duluth, Minnesota, USA Height & Weight: 5 ft 10 in, 330 lbs. Mandy Rose revealed that she got famous after taking selfies. Aliyah • The Usos • Otis had at least 1 relationship in the past. Tucker • On October 13 Heavy Machinery joined the first round of the Dusty Rhodes Tag Team Classic Tournament where they were eliminated by the team of Austin Aries & Roderick Strong. Otis and Rose have the chemistry to make this angle a long-term success and it's also down to the WWE to book them well. Dexter Lumis • Heavy Machinery returned to television on the August 1 episode, defeating The Mighty (Nick Miller & Shane Thorne). Accusations on Alberto. Chad Gable • He has also worked for the National Wrestling Alliance and Ultra Championship Wrestling-Zero. If you see something that doesn’t look right, contact us. Une Vie D'amour Lyrics English, Mike Rome (Raw) • Mitsubishi Suv 2004, Why Is Pte Stock Falling, What is the cost of her diamond ring? Alicia Taylor (NXT), Aja Smith • Killian Dain • Imperium • Pro Wrestling is a FANDOM Lifestyle Community. Litecoin Usd, Terry Taylor, Shane McMahon (Smackdown) • [17] On the July 12 episode of NXT, Heavy Machinery unsuccessfully challenged The Authors of Pain for the NXT Tag Team Championship. Big E • Humberto Carrillo • Pete Dunne • So I just kept on like pretend creeping here on a post saying, “Hey, you look great in this.” I would pretend she was my girlfriend, and it was obvious, at the time, she’s not. Zodiac Sign: Otis Dozovic is a Capricorn. [41], Otis uses The Caterpillar as a finishing maneuver during his matches, which is very similar to Scotty 2 Hotty's finishing maneuver, The Worm. After the April 16 update of the 2019 WWE draft, Otis and Tucker made their televised debut during the June 11 episode of Smackdown Live in Sacramento, California. 5 ft 10 in (1.78 m) Weight. On November 30, Dozovic and Tucker Knight joined a 20-Man Battle Royal won by Trent Seven. In 1992 the first text message was sent, DVDs were invented, Sony PlayStation was released and Google was founded. When Otis defeated Dolph Ziggler in the WWE WrestleMania 36. Ring names. In a rare occurrence, Dozovic teamed with Montez Ford in a successful tag match during the April 28 house show, defeating TM-61 (Nick Miller & Shane Thorne). His second singles victory followed after he defeated Patrick Clark during the July 21st edition of NXT. Majority of Otis’s money comes from being a wrestler. From the Performance Center the angle moved to social media, where fans took notice, and that made its way onto WWE Smackdown. Norman Smiley • Rose revealed that her boyfriend doesn't have an issue with it as it's all done to entertain and is a kayfabe storyline at the end of the day. Baron Corbin • Superior, Wisconsin. Born Once more details are available on who he is dating, we will update this section. Average Rainfall In Mysore, Three months later on June 15, Heavy Machinery challenged The Authors Of Pain in a second rematch but did not succeed in winning the titles. [3][16] The duo returned and had their first televised victory on the March 29, 2017 episode of NXT, defeating the team of Jonathan Ortagun and Mike Marshall. Oney Lorcan • Elias • Discover what happened on this day. Chris Soules Whitney, Drake Wuertz • Dozovic ended the month during the October 27 house show competing in a Halloween Costume Battle Royal No. Birth Place Who is she engaged to? [18] In March 2018, Heavy Machinery once again participated in the Dusty Rhodes Tag Team Classic tournament, but were eliminated by The Street Profits (Angelo Dawkins and Montez Ford) in the first round. Charly Caruso • School: Superior High School, Favourite wrestler: Big Show He is currently signed to World Wrestling Entertainment (WWE) on the Smackdown brand under the ring name Otis where he is one-half of the tag team known as Heavy Machinery with Tucker. Tina Turner River Deep – Mountain High Other Recordings Of This Song, Ivar • [42], Otis made his video game debut as a playable character in WWE 2K19[43] and has since appeared in WWE 2K20. Hilaria Baldwin reveals that her husband Alec Baldwin had not kissed her until 6 weeks after they started dating! taunt), 2007 Fila Cadet Greco-Roman national champion, 2009 USA Wrestling Junior Greco-Roman national champion, 2010, Ranked #13 in Wrestling's USA Magazine's Best High School Wrestlers, Superior High School's All-Time Leader in wins (135), 2014, Bronze Medal at Pan-American Games (Mexico City, Mexico). Safaree Samuels Announced His Divorce From Erica Mena; Says ‘Ending 2020 Right’! Source: Instagram, Sportskeeda, The Overtimer, / Mandy Rose and Otis Dozovic kissed each other? They ended their relationship after five years and called their engagement off. Professional wrestler who rose to fame as the mononymous Otis. P90dl For Sale, [27] The following month at Extreme Rules, Heavy Machinery again competed for the SmackDown Tag Team Championship, this time in a triple threat tag team match involving Bryan and Rowan, and The New Day (Big E and Xavier Woods), which The New Day won. Pete Dunne • Lars Sullivan • Golden Striker Rocket League, Fandango • Otis has arrived in WWE and declared that he’s hungry, which is unfortunate news for his competition. During the April 11 episode, Heavy Machinery wrestled two tag matches, one against the War Raiders (Hanson & Rowe). Borderlands Pre Sequel Online Co Op Pc, They returned eight nights later during the October 13 house show, teaming with NXT recruit Keith Lee in defeating Kona Reeves & The Mighty (Nick Miller & Shane Thorne). A.J. Bogojevic attended Colorado State University-Pueblo, studying Recreation. Trent Seven • Xia Brookside • Gallus • Michael Cole • Dolph Ziggler • Jessika Carr • Know about his married life with Jill Biden and net worth. [36] On the May 1 episode of SmackDown, Otis defeated Ziggler to qualify for the Money in the Bank ladder match. [13] He made his debut at a NXT house show on July 8, 2016, teamed with Adrian Jaoude in a loss to The Authors of Pain (Akam and Rezar). Recently, she gave her fans some entertainment with her Instagram story post. [10], In 2015, Bogojevic trained to become a professional wrestler at the Mercury Pro Wrestling Academy in Arvada, Colorado. All Rights Reserved, Otis Dozovic is a Capricorn and his 29th birthday is in, The 28-year-old American was born in the Millennials Generation and the Year of the Goat. Two nights later during the July 29 house show, Heavy Machinery lost to The Undisputed ERA in a tag team title rematch. Patrick Reynolds Net Worth, The education details are not available at this time. Kona Reeves • Copyright ©2016 Frame Tents. Karrion Kross • Joaquin Wilde • He is best known for being a Wrestler. Please check back soon for updates. Mercedes Martinez • From the Performance Center the angle moved to social media, where fans took notice, and that made its way onto WWE Smackdown. [23] In February, his ring name was shortened to Otis, while Knight's ring name was shortened to Tucker. North Korea has secret camps to keep COVID-19 patients where they are left to die. Deville cut a scathing promo on Rose in which she spoke about always being in the shadows of Rose. Danny Burch • How To Move On From Someone, Vroom Lease Buyout, Samir Singh • Although they defeated Drake and Gibson, Heavy Machinery did not win the tag titles due to the victory being won by disqualification. Overthinking Is From Shaytan. The WWE couple recently appeared on the Bump and have also used social media to push their storyline forward. Northwest Airlines 985 A320, Entry Level Aws Jobs Reddit, Dorothy Shelton Obituary, Rose Bundy Interview, R6 Defenders Tier List, Fortnite Aim Trainer, Western Movie Name Generator, Antawn Jamison Instagram, Toad Tongue Hanging Out, Frigidaire Oven Handle A067502, Supreme Anime Collab, Polaris Rzr 1000, Karen Rietz Baldwin, Bigbluebutton Error 1020 Webcam, Losmandy G11 History, Aileen Quinn Married, Lamia Persona 5, Fiberglass Fish Gig Pole, Asgore Virtual Piano, Billy Loomis Zodiac, Metamorphic Force Sprites, Matrix Mod B Essay, Chad Lindberg Death, Vip Smule Magic Email Spam, Plural Of Words Ending In Ey, Diy Kaizen Foam, Higher Human Biology Specimen Paper, 3 Day Food Diary Essay, Andrew Cashner Wife, Ribbon Template Pdf, Washington State Abbreviation, Bedrag Saison 2 Vf, Owl And Ostrich, Common Daughter Howard University, Sarah Lind Ethnicity, Neymar School Education, Ubc Engineering Admission Average Reddit, Retro Ps1 Games, Management Of Head Injury Wikipedia, Down Bad Definition, Dax Shepard Car Collection, Acute Care Nursing Essay, Yoshi Tongue Sound, Super Cuisine Stonehaven Menu, Kyrie 6 Sizing Reddit, Zercher Squat With Dumbbells, Ken Norton Accident, How To Change Language Of Dual Audio Movie In Lg Tv, Renee Geyer Health, Christmas In Heaven Accompaniment Track, Bmw E30 Restoration Specialist, Am I A Bugman, Master Kohga Glitch, Murdoch And Epstein,
cc/2021-04/en_middle_0055.json.gz/line160
__label__wiki
0.717856
0.717856
Fox News Flash Impeachment a 'complete waste of time' a week before Biden takes office: Rep. Van Duyne Freshman GOP congresswoman calls the second Trump impeachment a ‘political theatre’ By Stephanie Giang-Paunon | Fox News Democrats’ rush to remove Trump from office is ‘political theatre’: Rep. Van Duyne Freshman GOP congresswoman Beth Van Duyne, R-Texas, provides insight into the second Trump impeachment on ‘Fox and Friends.’ Freshman Congresswoman Beth Van Duyne, R-Texas, said Wednesday on "Fox & Friends" she will not be joining the five Republicans so far that are voting to impeach President Trump, calling the effort a "complete waste of time." The five Republicans that stated they support the impeachment are Reps. Liz Cheney of Wyoming, Adam Kinzinger of Illinois, Fred Upton of Michigan, Jaime Herrera Beutler of Washington, and John Katko of Washington. The support of Trump’s impeachment comes nearly a week after rioters breached the Capitol as lawmakers counted electoral votes. Duyne called the Democrats’ rush to remove Trump from office "political theater." REP. BETH VAN DUYNE: We’ve had a lot of discussions, we’ve had a lot of passion, we’ve had a lot of thoughtful debate and each individual is voting their conscience, is voting their district, and is voting in the best interests that they believe is for the country. I happen to think that right now impeachment is a complete waste of time. I think about all the hours, millions of dollars that we wasted the last four years on impeaching this president, and next week we are going to be entering a new phase, with a totally new administration, a brand new president... North Texas, we have small businesses that are going out of business, we have restaurants that are closing that have been open for decades, we’ve got the aviation industry that is floundering. We’ve got families who are not able to put food on their table or pay for insurance and we are going to continue talking about impeachment for a president who is going to be gone in 7 days. This is doing nothing to empower families and is doing everything to further divide the country and further divide this Congress... [Impeachment] is not doing anything proactive, it is not doing anything that actually helps working families at a time when we need it…Leaders of this country need to band together and need to defend our democracy, defend our country and we need to speak as one and instead, we are further having a victory lap, taking a final pound of flesh. It is doing nothing to help people and everything to cause more division in our country and, quite honestly, the American people deserve better than that. Stephanie Giang-Paunon is a Web Show Page Producer for FoxNews.com. Follow her on Twitter @SGiangPaunon
cc/2021-04/en_middle_0055.json.gz/line163
__label__wiki
0.5846
0.5846
SAVE THE DATE – PROGRAM IS ONLINE Wed 28, October 2015 Éva Homor 4th Hungarian Film Festival of San Francisco August Coppola Theater Friday, November 13 (4pm – 10pm) 4:00-4:30 — Introduction to Contemporary Hungarian Cinema 4:30 – 6:30 — Ricsi and Drifter Q&A via Skype with director Gábor Hörcher Ricsi (15 min.) 2014 dir. Gábor Hörcher The protagonist in the documentary “Drifter” gets a chance to act in a fiction film. Ricsi’s friends have organized a farewell party the night before he leaves. But it is his mother who is packing for the trip, not Ricsi. Best Hungarian Short Fiction Film Prize – Mediawave Film Festival 2015, Best Performance – Budapest Short Film Festival 2015, Visegrad Fund Special Prize – Budapest Short Film Festival 2015 Drifter (72 min.) Documentary feature 2014 Ricsi, the young rebel, lives his life on the edge. ‘Trouble’ is his middle name. He is unruly, restlessly scaring up problem after problem. Driving cars without a license, stealing and escaping from the cops are all part of his daily routine, much to his parents’ despair. Ricsi won’t stand for routines nor the expectations of his deadbeat father. After all, where was he when Ricsi needed him the most? IDFA Award for the Best First Appearance Documentary 2014, Best Documentary Award – Fünf Seen Filmfestival 2015, Special Mention of the Jury – goEast Film Festival 2015, Special Mention of the Jury – Docs Against Gravity Film Festival 2015 DOCU Rough Cut Boutique Postproduction Award 2013 – Sarajevo Film Festival, DOK.Incubator Sound Postproduction Prize 2014 – DOK Leipzig 6:30-7:30 Break and Reception 7:30—10:00 – The Border /Határ (24 min.) and Afterlife / Utóélet (93min.) The Border / Határ (24 min.) Short, 2014 dir. Mátyás Szabó A prisoner by the name of Maydan has a chance to escape from his guard. He has no way of knowing who is friend and foe, or whether the girl he meets will help him evade the law. Afterlife / Utóélet (93 min.) Feature, 2014 dir. Virág Zomborácz This is the story of the dysfunctional Tulipan family. The father is a pastor who rules the life of his family with an iron fist. But when he meets his untimely demise, the family breaks down. They search for a new life and maybe a ghost can help them. Is it a ghost story? Yes, but it is also a unique, black comedy set in a small village, just after the collapse of Communism. First Prize – Bergamo Film Meeting 2015, Audience Award – Timisoara Ceau Cinema! European film festival 2015, Best Actor: Márton Kristóf – Vilnius International Film Festival 2015, Best Feature Film (Meeting Point) – Valladolid International Film Festival 2014 Saturday, November 14 (9AM – 10PM) 9:00-9:30–Introduction 9:30 – 11:00–Free Entry (70 min.) Feature, 2015 dir. Yvonne Kerékgyártó Betty is a young girl whose father still taxis her back and forth in his car, asking her why she has done her hair in such a strange way and what she’s up to with her friends. V is her best friend, with few inhibitions and worries in her life, sporting a more outlandish hairstyle, and with no responsible adults around her. Betty and V are getting ready to set off on an adventure together: gate-crashing the biggest music festival they have ever been to and experiencing everything it can offer–sex, drugs, excitement, danger…After all, what is being an adult all about? Gamechanger Award – Austin SXSW Film Festival 2015, Cineuropa Prize – Novi Sad Cinema City – 2014 11:15 – 11:30 Station / Az Állomás (12 min.) Short, 2014 dir. Csaba Vékes After finishing her stint on this planet, Aunt Terry would like to get somewhere else. But that’s impossible without the necessary documents. 11:30 – 12:45 Wild Hungary / Vad Magyarország (51 min.) Nature Documentary, 2011 dir. Zoltán Török A country like no other in Europe, Hungary is influenced by the rhythms of its rivers. White-tailed eagles, otters and enormous catfish share the wetlands with many other species living close to the local people, often unnoticed. This is their story presenting quite a few never-before-filmed animal behavior. Narrated by János Kulka. Kollányi Ágoston Prize – Hungarian Film Week – 2011 12:45– 2:00 Break 2:15 – 4:30–No Man’s Island / Senki Szigete (93 min.) Feature, 2014, dir. Ferenc Török Vera is a cab driver who has been saving up for years to buy a house and settle on No Man’s Island in the Pacific to escape from the world in which she lives. Zoli has what it takes to become a professional basketball player, but beats a cowardly retreat from his own talent. These two youngsters, each on the run, are joined by Mia, the runaway bride. Their three lives clash and intermingle as they journey towards an unexpected solution. It is a modern fairy tale about young people in search of true happiness who, through Mia’s ethereal purity, come to accept themselves and find a way to realize their dreams. 4:30 – 4:45 Discussion and Summary 5:00 – 5:30 Reception 5:30 – 7:30 Hot Men/Cold Dictatorships / Meleg Férfiak, Hideg Diktatúrák, (90 min.) Documentary feature 2015, dir. Mária Takács Q and A and a recorded interview in Hungary with director Maria Takacs A documentary dealing with the personal dramas of gay men living in communist Hungary. Has the situation of gay men improved since the fall of communism or is homophobia even worse today? This is the first documentary produced in our region that deals with the generations of older and younger gay men. 7:30-7:45 Break/reception continued 7:45-10:00 Mirage/Délibáb (110 min.) Feature, 2014 dir. Szabolcs Hajdú Mirage tells the story of an African football player in a small Hungarian town, who commits a crime and has to flee. He finds refuge on a farm deep in the Hungarian plains. Soon he realizes that the farm is a modern slave camp where he is forced to fight for his freedom and ultimately his life. SIGN UP AND GET NOTIFIED We promise we won’t spam you. HUNGARIAN FILM FESTIAL IN SAN FRANCISCO is a non-profit cultural organization that organizes film screenings, festivals and other film events. The events focus on Central Eastern European feature films and documentaries. Éva Karafiáth-Homor Réka Pigniczky This website was funded by CECI California European Cultural Initiative © Copyright 2013-2014 / All rights reserved. Created and Designed by Circumstances Creative Co.
cc/2021-04/en_middle_0055.json.gz/line164
__label__cc
0.568694
0.431306
Clay Aiken Tried To Reconcile With Father Before His Death Globe magazine has more details on ‘American Idol’ runner-up Clay Aiken missing his father’s funeral and spoke with a friend of Vernon Grissom who says despite the singer’s efforts, there was no reconciliation before he died. “Clay tried all his life to forgive his dad and wanted very much for things to be better between them, but Vern never gave him a chance,” the friend revealed. “Clay was afraid of his temper, his anger, and violence, yet still reached out to him. But Vernon remained mean and difficult right up until the end. He broke Clay’s heart. I guess going to the funeral would have been too painful for him.” Clay Aiken Chats With Detroit’s Mojo In The Morning March 14, 2004 – Clay was on Mojo in the Morning on 95.5 FM in Detroit. Clay talked about his rabid fans, what he would be doing had he not made it through the ‘Idol’ auditions, how blessed he feels for making it through all the auditions, how he knew Ruben Studdard had won ahead of time, sharing the tour bus with Kelly Clarkson, and more. The interview has since been removed from channel955.com. Clay Aiken Grants A Wish To Boston Area Child March 11, 2004 – The Boston Herald reports Clay helped Make A Wish come true for 10-year-old Rockland gal Danielle George backstage at the Centrum, where he and fellow ‘Idol’ Kelly Clarkson performed on Monday (March 8). Clay Aiken Accepts ‘Geek’ Label March 10, 2004 – Ratethemusic.com reports Clay confesses that although he’s gone through a major style makeover, he’ll never be as cool as many of his entertainment business peers. “I can’t dance like Justin Timberlake, I can’t dress like Ashton Kutcher, I can’t do that type of thing,” Aiken admitted. “I can’t relate to that. They’re great to watch on TV but they’re not who people relate to. So to me, the term ‘geek’ doesn’t mean that I’m a geek, but I think that it’s just kind of a symbol of realness. The American Dream, I guess, is about normal people being successful.” March 27, 2004 Jeff C Gossip 3 Comments Clay Aiken «Britney’s One Night Stand On Blind Date Plus Justin Love Cheat Admission Brave New Girl’s Official Site Launched» Clay Aiken Didn’t Attend Father’s Funeral Gay Man Tells Tabloid He Slept With Clay Aiken Kelly Clarkson Has A Blackberry Addiction Man Knew Clay Aiken Was Gay ‘American Idol’ Star Clay’s Painful Family Secret 3 thoughts on “Clay Aiken Tried To Reconcile With Father Before His Death” milasmine says: Poor guy. Some people are not meant to have a heart. Hopefully Clay will move on from this and one day become a wonderful father himself, because of this. Lava33 says: I feel bad for Clay, this is something that you never truly get over though. I wonder why his father was the way he was, maybe he had a bad childhood, who knows? but he should have been nicer to Clay. Well, good luck to Clay, I’m sure everything will work out very well for him in his personal life. Hi Lava 33…Reading what you have just posted here makes me believe you have a heart…What I do not get is how you can say nice things about Clay and not like Nick Carter. They are both amazingly nice people (I’ve meet Nick, so I feel I have a better take on him.) I think Justin is too…I feel all three of them are obviously good people…So I do not get it???Go figure…Oh well, to each his own.
cc/2021-04/en_middle_0055.json.gz/line167
__label__cc
0.641967
0.358033
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents a clade of ABC porter genes with relatively weak homology compared to its neighbour clades, the molybdate (IPR006229 from INTERPRO) and sulphate (IPR005667 from INTERPRO) porters. Neighbour-Joining, PAM-distance phylogenetic trees support the separation of these clades in this way. Included in this group are the NifC genes of Clostridium pasteurianum and Pasteurella multocida, which are involved in the biosynthesis and/or control of nitrogenase. It would be reasonable to presume that NifC acts as a molybdate porter since the most common form of nitrogenase is a molybdoenzyme. Several other sequences falling within this group are annotated as molybdate porters and one, from Halobacterium, is annotated as a sulphate porter. There is presently no experimental evidence to support annotations with this degree of specificity.; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane. Probab=99.72 E-value=5.4e-16 Score=114.75 Aligned_cols=175 Identities=25% Similarity=0.423 Sum_probs=136.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH--HHHHCCCHHHHHHHHCCCCCHHHHHHHHCCC-CH------------ Q ss_conf 99999999999999788766677642101211--2320235034544201202101100000021-01------------ Q gi|254780341|r 91 QETTETLSLVLVSTFISMFIGVPLGVLAAWYP--RFYSIIRLFLDSMQTIPTFVYLIPALVLFGL-GM------------ 155 (281) Q Consensus 91 ~~~~~Tl~~~~~~~~ia~~igiplGi~~~~~~--~~~~~~~p~l~~~~~iP~~v~l~p~i~~fG~-g~------------ 155 (281) T Consensus 21 ~al~lSl~Ts~~sl~l~~~~g~P~A~~lar~~n~pl~~~l~~ll~LP~VlPPlV~G~aLLl~FG~~g~lG~~l~~aGi~~ 100 (226) T TIGR01581 21 KALRLSLLTSLASLLLAVVLGIPTAYVLARVRNFPLKKLLDTLLDLPLVLPPLVAGIALLLLFGRLGLLGPYLEAAGIQV 100 (226) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHCCHHH Q ss_pred ----HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HH Q ss_conf ----7889999998878999995887412998999999960788201012236886267999999999999999----99 Q gi|254780341|r 156 ----VPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLS----MV 227 (281) Q Consensus 156 ----~~~i~a~~i~~~~pi~~~t~~gl~~v~~~~~eaa~~~Gas~~q~l~~V~lP~a~P~i~~Gi~~~~~~~l~----~v 227 (281) T Consensus 101 ~Fs~~gvvlAQ~FVa~p~~vr~~r~~f~~v~~~ye~va~~lG~g~~~t~~~v~lPl~~~~ll~G~vLafaRalGEFGATL 180 (226) T TIGR01581 101 IFSTLGVVLAQTFVASPYLVRVARSTFESVDPDYEDVARSLGAGPLETFRKVTLPLARPGLLAGLVLAFARALGEFGATL 180 (226) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_pred HHH-HHHC-CCCHHHHHHHHHHHHCHHHHHHHHHHHHHHH Q ss_conf 999-9970-5880499999997407898999999999999 Q gi|254780341|r 228 VVT-ALVG-SNGLGVPVLRALNTVDIGRGFESGLCIVILA 265 (281) Q Consensus 228 via-~~ig-~~GLG~~i~~a~~~~~~~~~~~~~l~Iv~la 265 (281) T Consensus 181 ~~AG~~~g~TrTlPl~iY~~~~~d~~~~aV~~a~~Ll~ia 220 (226) T TIGR01581 181 MFAGSLQGKTRTLPLAIYLNIESDDIEAAVALAVLLLVIA 220 (226) T ss_pred HHHCCCCCCCEEHHHHHHHHHHCCCHHHHHHHHHHHHHHH T ss_conf 9843677753012788864574177327999999999999
cc/2021-04/en_middle_0055.json.gz/line170
__label__wiki
0.91425
0.91425
A Christmas column AN OUTSIDERS VIEW Ken Fuller 12/20/2011 A Christmas column Regular readers who assume that my silence on the subject of Christmas stems from belief — or, more precisely, the lack of it — are not entirely wrong. But there is another reason: since I first visited the Philippines in late 1989, I have rarely been able to suppress a smile (or, should the mood take me, a grimace) at the wildly inappropriate practice of Christmas songs and carols, many of which have a snowy theme, being played in shopping malls in a tropical climate. This is, of course, an example of US commercial imperialism, just as the practice of Christianity itself arises from Spanish colonialism. Has Christmas ever been celebrated without Christianity? Yes — although it didn’t go by that name. In pagan times, Northern European peoples celebrated a mid-winter festival. In some places, this was associated with the god Odin (in Anglo-Saxon this is “Woden,” from which “Wednesday” is derived). But gods were not — and are not — a necessary component of such a festival, because one often needs cheering up during a bleak northern winter, and a festival is as good a way as any of accomplishing this..... MORE OWS marks 3-month anniversary in New York From the Arab Spring - to America's Autumn, now turned Winter. The Occupy Wall Street movement has marked its 3-month anniversary this weekend. ­Images of arrests, brutality, and mass protesting in America over the last 3 months have been gripping the world. “The cops must be smacking themselves in the forehead, because they’ve given such life to this movement,” said Truthout contributor JA Myerson..... MORE URL: http://rt.com/usa/news/new-york-movement-occupy-201/ Kim Young-il body placed in glass coffin (VIDEO, PHOTOS) The body of North Korea’s leader is lying in state in an open glass coffin so that mourners can pay their last respects. His personal armored railway wagon and official Mercedes are on display nearby. ­The commemorative events are taking place in Kumsusan Memorial Palace (also called Kim Il-sung Mausoleum) in downtown Pyongyang. According to official sources, Kim Jong-il died on the morning of December 17 of fatigue and overwork. Reportedly he had been battling heart disease since allegedly suffering a stroke in 2008..... MORE URL: http://rt.com/news/jong-il-commemorative-events-pyongyang-231/ CSTO talks tough on NATO The member states of the Collective Security Treaty Organization released a strong message warning that European missile defense and unilateral military action may work to destabilize international security and strategic stability around the world. The harsh statement was released by President Dmitry Medvedev and his counterparts from Armenia, Belarus, Kazakhstan, Kyrgyzstan, Tajikistan and Uzbekistan in Moscow on Tuesday. The leaders made specific mention of the missile defense system that the United States is currently constructing in Eastern Europe, just miles from the Russian border..... MORE URL: http://rt.com/politics/csto-nato-russia-medvedev-kazakhstan-257/ Christmas VIEWPOINTS Archbishop Oscar V. Cruz 12/20/2011 The times are bad and the future is dark. The country is stagnant and millions of Filipinos are suffering from hunger and uncertainty. The local and national problems are not only multiplying but also worsening. The quest for justice and peace remains elusive and the imperative of socio-economic development is far from being seriously attended, much less realistically pursued. The Philippines nevertheless continuous to have one singular blessing: The Filipinos who keep the faith, live with hope, believe in love — especially so during Christmas. This is the primary reason, notwithstanding all arguments to the contrary, the Philippines is rather known for having the longest Christmas Season in the world. This is also why the Filipinos — creative and ingenious as they are — successfully combine their own native Christian heritage with many elements of imported Christmas symbols and practices..... MORE Environment defenders’ alliance born By ALDWIN QUITASOL with reports from LARA CARTUJANO www.nordis.net BAGUIO CITY — More than 500 anti-mining activists and advocates from different towns of Northern Luzon expressed unity on programs to save the environment and resources together in the first Northern Luzon Mining and Human Rights Summit held from December 13-15 of 2011 at the Quirino Hall, Teachers’ Camp. On the theme “Defend and preserve our national patrimony against foreign big business plunder! Assert our rights to life, land, culture, food security and development!”, the three-day summit aimed to study the relation of mining projects to the human rights situation in Northern Luzon, vis a vis national and international developments..... MORE Source: NORDIS URL: http://www.nordis.net/?p=11383 Ilocos group calls for troop pull out By RODA TAJON CANDON CITY, Ilocos Sur — “Karapatan ng mamamayan, ipaglaban!” More than 300 human rights advocates in Ilocos repeatedly chanted the above call as they marched to commemorate International Human Rights Day last December 11. The activity was launched despite efforts from Philippine National Police (PNP) and the city government to frustrate them because of their “no permit, no rally policy”. Mila Marcelo, public information officer of the Ilocos Human Rights Alliance (IHRA), said that the state-sponsored terror in the countryside and the escalating human rights violations in the Ilocos region has instead served as a challenge to the people to assert their rights..... MORE Decomposing bodies pile up; casualties hit 823 12/20/2011 ‘WE LOST COUNT OF MISSING PEOPLE’ — NDRRMC CHIEF Decomposing bodies pile up; casualties hit 823 As the body count rose to 823 late yesterday, authorities expect that the casualties from flash floods that devastated two port cities in Mindanao spawned by Typhoon Sendong will continue to pile up in the coming days as officials said more are missing than reported since entire families were believed swept to sea as they slept in coastal slums. Towns in Cagayan de Oro and Iligan cities which were worst hit by the devastation prepared mass burials for decomposing bodies with authorities saying unclaimed cadavers piling up in mortuaries were posing health risks and had to be buried. Several television footage showed decomposing bodies lined up in different centers where the dead were delivered for identification, underlining the serious tragedy that some of the survivors compared to the recent tsunami that hit parts of northern Japan last March. One footage from an Iligan mortuary showed a corridor lined with bodies wrapped in white plastic bags bound with tan-colored packaging tape..... MORE Luisita seeks SC recall ruling, SDO validity, high just compensation By Benjamin B. Pulta 12/20/2011 Luisita seeks SC recall ruling, SDO validity, high just compensation First the Cojuangco-Aquinos of Hacienda Luisita said they would no longer seek a motion for reconsideration from the Supreme Court ruling that generally favored the hacienda farmers, but with the focus on the impeachment trial of SC Chief Justice Renato Corona and the vow of President Aquino to lobby with the senators to convict the CJ in an impeachment trial, the Cojuangco clan is pushing not only a recall of the SC ruling but for the court to declare the stock distribution option (SDO) valid, and also called for a higher just compensation for the clan. Lawyers representing the Cojuangco-Aquino family-owned Hacienda Lusita Inc. (HLI) has asked the SC to reconsider its decision last Nov. 22 placing the centuries-old sugar estate under the government’s agrarian reform program. In a 45-page motion to clarify and reconsider, HLI sought among other things, to have the reckoning point in determining the valuation of the hacienda moved to a later date, 2006, from the original SC decision which said that the just compensation shall be based on the value of the property in November 1989 when the stock distribution option (SDO) was approved. The high court in its decision this year had struck down the SDO..... MORE CPP-NPA approves four-day truce with government By Mario J. Mallari 12/20/2011 CPP-NPA approves four-day truce with government By Mario J. Mallari 12/20/2011 After the New People’s Army (NPA) committed at least two major atrocities following the government’s unilateral suspension of offensive military operations (Somo), the Communist Party of the Philippines (CPP) yesterday reciprocated the government’s 18-day Christmas truce with its own four-day ceasefire. In a statement, the CPP-Central Committee issued a ceasefire order to all commands and units of the NPA nationwide starting Dec. 24 to Dec. 26 for the Christmas and Dec. 31 to Jan. 2 for the New Year. “During the indicated periods, all commands and units of the NPA and the people’s militia shall cease and desist from carrying out offensive operations against the armed units and personnel of the Armed Forces of the Philippines (AFP), Philippine National Police and paramilitary forces of the Government Republic of the Philippines (GRP),” the CPP said..... MORE Gov’t ready to recognize North Korean successor By Michaela P. del Callar 12/20/2011 Gov’t ready to recognize North Korean successor The Philippine government yesterday said it is prepared to recognize the new North Korean leader following the demise of its Kim Jong-Il, as it called for a “smooth transition to a new leadership.” In a statement, the Department of Foreign Affairs said: “The Philippine government values its relations with the Democratic People’s Republic of Korea and will continue to cooperate with them to intensify the promotion and maintenance of peace and stability in the Asia-Pacific region, including in the Korean Peninsula , to ensure the region’s continued prosperity.” Manila, which has decade-old diplomatic ties with Pyongyang , likewise offered its condolences to its government and people on the death of Kim Jong-Il..... MORE Customs seizes P10.6-M worth of pyrotechnics from China 12/20/2011 Customs seizes P10.6-M worth of pyrotechnics from China The Bureau of Customs (BoC) seized P10.6-milliion worth of firecrackers and fireworks misdeclared as school supplies that were illegally imported from China, BoC report said yesterday. Commissioner Ruffy Biazon said the two 40-footer container vans of firecrackers and pyrotechnic devices were consigned to FEC Trading which is owned by a certain Francisco Edward Lopez Claudio of Makati City. It was learned that the pyrotechnic shipment was lodged at the BoC by FEC Trading’s customs broker Advenzur Ubas..... MORE Toxins detected on food containers in Metro Manila outlets 12/20/2011 Toxins detected on food containers in Metro Manila outlets The EcoWaste Coalition yesterday reported that it has detected sky-high levels of toxic elements on several beverage and food containers purchased from popular retail outlets in Metro Manila. The samples were obtained from Landmark Department Store in Quezon City; Puregold Supermarket in Cubao, Quezon City; Robinsons Supermarket in Mandaluyong City; Shopwise in Vito Cruz, Makati City; and Savemore in Santa Ana, Manila City. All purchases had receipts. The EcoWaste Coalition has notified the retail outlets about the test results and requested the management to remove the tainted products off the store shelves..... MORE A Christmas column AN OUTSIDERS VIEW Ken Fuller 1... Kim Young-il body placed in glass coffin (VIDEO, P... Christmas VIEWPOINTS Archbishop Oscar V. Cruz 12/... Decomposing bodies pile up; casualties hit 823 12... Luisita seeks SC recall ruling, SDO validity, high... CPP-NPA approves four-day truce with government By... Gov’t ready to recognize North Korean successor By... Customs seizes P10.6-M worth of pyrotechnics from ... Toxins detected on food containers in Metro Manila...
cc/2021-04/en_middle_0055.json.gz/line181
__label__wiki
0.823003
0.823003
Rock Star Martyr Entertainment is the opiate of the masses, drugs are are consumed religiously, and today's religion is just another form of entertainment. You are here: Home / Folk Phil Ochs Wrote the Songs, but Who Tied the Noose? April 9, 2011 By Joe Allen The Vietnam War stirred a stunning spirit of rebellion in America’s youth, and folk singer Phil Ochs was at the front of the picket line to rouse the rabble with a tune. Like Bob Dylan, Phil Ochs used his acoustic guitar to skewer the warmongering authorities and wowed the ladies with his earnest eyes. But unlike Bob Dylan, Phil Ochs did not go on to capriciously convert to a succession of Abrahamic religions, wear clownish white suits, paint his old face with girly make-up, or launch multiple comeback tours. Unlike Dylan, Phil never achieved enough success to feel contempt for the stagehands who toil all day to erect his stage and lug his gear around. Phil never ordered his heavy-handed security guards to corral these grimy-pawed laborers into some dark corner backstage so that the legendary populist Bob Dylan wouldn’t have to make eye contact with the help… asshole. Nope, Phil Ochs was found hanging in his sister’s New York apartment on April 9, 1976 at the age of 34. Despite the bizarre antics of the schizophrenic alter-ego which consumed him in his latter days, Phil Ochs is remembered by the radical left as a man with a message. Whether it was civil rights in Mississippi, miner strikes in Kentucky, draft-paper bonfires in Washington DC, or revolution in Cuba, Phil Ochs had something to sing about the cause. His debut album in 1964, All the News That’s Fit to Sing, earned him the title of “the singing journalist.” While kids were getting groovy in the Age of Aquarius, their television sets were dripping with the blood of young American men and Vietnamese villagers. Kids were coming home maimed or in coffins by the tens of thousands. That’s one bad fucking trip, man. The obvious hypocrisy of spreading democracy by way of heavy artillery became more than many could bear. American streets filled with angry youth whose radical ideas were often inspired by the revolutionary zeal that was transforming volatile nations such as Cuba or China. Not next week, you asshole! Go to any anti-war rally, and there’s Phil with his guitar. The 1965 release of I Ain’t Marchin’ Anymore solidified his identity as a voice of conscience in the folk scene. His goofy protest ditty “Draft Dodger Rag” became the feel-good hit of the Peace Movement. The album’s title track hits a more serious note. Ochs sings from the perspective of all the young men throughout history who have marched to their deaths in war. He bore witness to the bloody Battle of New Orleans and the fratricide of the Civil War. He crawled in the trenches of Germany and heard Hiroshima’s “mushroom roar.” But Phil Ochs ain’t marching anymore, and he would appreciate it if everyone else would stop, too. But the marching didn’t stop, and the war in Vietnam began to wear on Phil’s nerves. He threw himself into new songs. His sound began to change, utilizing more polished production techniques, and he eventually incorporated a full band. Many hardcore folk fans were furious at this new, electric Phil, but few could deny the power of his morbidly fascinated anthem, “Crucifixion.” Robert Kennedy wept when he heard Ochs perform the song on a DC train. Written as a tribute to John F. Kennedy, the lyrics could memorialize any martyr enshrined by masses: But you know I predicted it, I knew he had to fall How did it happen? I hope his suffering was small Tell me every detail, for I’ve got to know it all And do you have a picture of the pain? So good to be alive when the eulogy is read The climax of emotion, the worship of the dead And the cycle of sacrifice unwinds… Phil watched in horror as the US government went insane. The US government was also watching Phil, and the feeling was mutual. It is an established fact that the FBI and CIA were keeping tabs on troublesome youngsters clamoring for peace, and stepped in to manipulate the movement whenever possible. Some suspicious observers even accuse these powerful agencies of resorting to covert murder to stifle dissent. Poisoned tablets. Drug-induced mind control. Grassy knolls. Manchurian Candidates. Phil’s tirades against The Man earned him a dossier in the extensive FBI files kept on dangerous “subversives” and “Communists.” After the assassinations of Martin Luther King Jr. and Robert Kennedy in 1968, Ochs began to wonder how long it might be before “Crucifixion” was about him. Even in the face of what he thought to be certain death, Phil refused to be quiet. In 1969 he released his last studio recording, Rehearsals for Retirement. The cover features a somber tombstone that reads: Phil Ochs (American) Born: El Paso, Texas 1940 Died: Chicago, Illinois 1968 The death date is a reference to the police brutality Ochs witnessed at the Democratic National Convention in Chicago that year and the subsequent election of the ultra-conservative Richard Nixon. It must have killed his soul. Ochs intended this last album to be Elvis Presley sings Che Guevara, but it sounds more like a jammin’ Jimmy Buffet grasping for the Revolution—and wrapping his fingers around another icy margarita instead. Disillusioned with the radio’s refusal to play his music and America’s increasing apathy toward social idealism, Ochs set off to travel abroad in 1971. After a short spell in China, he moved on to Chile, joining folk-singer Victor Jara in support of the revolutionary Marxists that were taking hold in Latin America. Phil’s activist adventures found him running afoul of the Argentinian and Bolivian governments, from which he narrowly escaped long-term imprisonment. Shaken, he retreated back to the US before embarking to Australia, and then Africa in 1973. If there was any place for Phil to make a real difference, it had to be Africa. One night Phil went for a walk on the beach in Tanzania. A band of thugs leapt out of the shadows and fell upon him. One held Ochs in a brutal stranglehold while the others stripped him of his possessions. His vocal chords were crushed. Ochs refused to believe that the attack was the responsibility of savage marauders. It had to be a CIA plot. “They” had taken his voice away. Broken and destitute, Phil returned to New York, where he flew over the cuckoo’s nest with all the grace of a crippled pigeon. The Vietnam War was finally “finished” in April of 1975. Suddenly the lifetime revolutionary was left without a purpose. Friends got worried. It wasn’t just his slurred rants about various government agencies out to get him or the countless hours spent alone in quiet misery. No, it was his insistence that he was no longer Phil Ochs that really raised eyebrows. Phil Ochs was dead, he told people. John Train killed him. A song fragment scribbled at the time reads: Phil Ochs checked into the Chelsea Hotel There was blood on his clothes… Train, Train, Train, the outlaw and his brain… His psychotic transformation was sudden and absolute. Phil who? John Train is a right-wing hard-ass and a whiskeybent street-brawler. John Train sings country songs and punches you in the eye. John Train don’t take no shit from nobody, especially not Bob Dylan. In one delusional tirade, a wasted John Train told his audience: “I put out a contract on [CIA Director, William] Colby for a hundred thousand dollars. I told Colby he’s got a half year to get out or he’s dead. They can kill me but he’s dead.” William Colby was replaced by George H. W. Bush in January of 1976, and a few months later, John Train slipped a rope around Phil Ochs’ neck and strung him up in his sister’s apartment. It would be fifteen years before the next major war. When the bombs began falling on Baghdad in 1991, Phil Ochs’ passionate voice of protest was absent—but then, so was everyone else’s. © 2011 Joseph Allen Phil Ochs — “I Ain’t Marching Anymore” Filed Under: Martyrology, Most Exalted Tagged With: Folk, Suicide, Wrath Why Dead Celebrities? Joe Allen Entertainment is the opiate of the masses. Drugs are are consumed religiously. Today's religion is just another form of entertainment. Daily interjections: @EvoPsychosis Brandt Hardin Pop Surrealist and Iconographer read bio here Rock Star Martyrology January 1: - Hank Williams - Sid Vicious - Buddy Holly - Karen Carpenter - Del Shannon - Bon Scott March 5: - Patsy Cline - Biggie Smalls March 26: - Eazy E April 1: - Marvin Gaye - Rozz Williams - Kurt Cobain - Layne Staley -Wendy O Williams - Per Yngve Ohlin — aka “Dead” - Phil Ochs May 11: - Ian Curtis - Bradley Nowell - Michael Jackson - GG Allin July 3: - Jim Morrison August 9: - Jerry Garcia August 16: - Robert Johnson - Elvis Presley September 13: - Tupac Shakur - Jimi Hendrix October 4: - Janis Joplin October 20: - Ronnie Van Zant November 13: - Ol’ Dirty Bastard - Michael Hutchence - Freddie Mercury December 7: - Darby Crash - John Lennon - Dimebag Darrell Pretiosa in conspectu Domini mors sanctorum eius. Copyright © 2021 · Prose Theme on Genesis Framework · WordPress · Log in
cc/2021-04/en_middle_0055.json.gz/line188
End of preview. Expand in Data Studio

No dataset card yet

Downloads last month
4