pred_label stringclasses 2
values | pred_label_prob float64 0.5 1 | wiki_prob float64 0.25 1 | text stringlengths 105 1.02M | source stringlengths 39 45 |
|---|---|---|---|---|
__label__cc | 0.602942 | 0.397058 | Meep Reference
Revision as of 17:52, 31 March 2015; Stevenj (Talk | contribs)
Meep manual
Here, we document the features exposed to the user by the Meep package. We do not document the Scheme language or the functions provided by libctl (see also the libctl User Reference section of the libctl manual).
This page is sim... | cc/2019-30/en_middle_0019.json.gz/line6 |
__label__cc | 0.608159 | 0.391841 | Government misses pay-day for clean-up workers
(CNS): At the end of last week’s roadside cleanup, many workers on the Christmas job scheme were left empty handed when government failed to make the pay-day. Police were called out in George Town on Friday evening after many of the temporary workers who had been given ten... | cc/2019-30/en_middle_0019.json.gz/line17 |
__label__wiki | 0.761553 | 0.761553 | Focus on Haiti: Washington's Militarized Takeover
Top Priority is Command & Control, Hindering Desperately Needed Humanitarian Aid
US troops control Port-au-Prince's airport and port facilities, blocking and slowing aid, including relief flights from NGOs, France, Brazil, Italy and other countries, diverting them to th... | cc/2019-30/en_middle_0019.json.gz/line22 |
__label__cc | 0.696069 | 0.303931 | Geographical Index > United States > Michigan > Wexford County > Report # 26196
Report # 26196 (Class B)
Submitted by witness NO on Sunday, June 28, 2009.
Possible intimidation experienced by two bow hunters near Cadillac
(Show Printer-friendly Version)
YEAR: 2000/01
MONTH: October
COUNTY: Wexford County
LOCATION DETAI... | cc/2019-30/en_middle_0019.json.gz/line29 |
__label__wiki | 0.603878 | 0.603878 | Addis Abeba, Ethiopia
Tel: +251115 51 35 41
Fax: +251 115 51 38 51
info@africahumanitarian.org
Public Advocacy
HIV-AIDS Prevention
Relief and Recovery
SGBV
Home Who We Are History
By africa Who We Are December 28, 2011
Dr. Dawit Zawde launched Africa Humanitarian Action (AHA) in 1994 with several like-minded indi... | cc/2019-30/en_middle_0019.json.gz/line39 |
__label__cc | 0.650766 | 0.349234 | Africa Cancer Foundation: Eat and exercise your way out of cancer
By Chepkemoi Lasoi
Fun and informative. That is the simplest way to describe the ‘Move Eat family friendly’ event held by the Africa Cancer Foundation (ACF) at The Nairobi Arboretum on Saturday 7 July 2018 to educate Nairobi residents on living right, ea... | cc/2019-30/en_middle_0019.json.gz/line40 |
__label__wiki | 0.67129 | 0.67129 | Online dating high standards
hispanic women dating
Bonneville Hot Springs, WA
Are you looking for sex without obligations? CLICK HERE - registration is free!
Arrive Quito Quito, Ecuador, is a spectacular city positioned just a few miles shy of the equator in a narrow valley surrounded by volcanoes. At 9, feet above sea... | cc/2019-30/en_middle_0019.json.gz/line44 |
__label__cc | 0.647612 | 0.352388 | Habitable Zones & Global Climate: October 2017
Is Life Most Likely Around Sun-like Stars?
We consider the habitability of Earth-analogs around stars of different masses, which is regulated by the stellar lifetime, stellar wind-induced atmospheric erosion, and biologically active ultraviolet (UV) irradiance.
Obliquity E... | cc/2019-30/en_middle_0019.json.gz/line47 |
__label__cc | 0.73612 | 0.26388 | Stem Cells & Autism: One Year Later by James Jeffrey Bradstreet, MD, MD(H), FAAF
Posted August 9th, 2012 by Ed Arranga
Stem Cell Research for Therapeutic Applications
Stem Cells & Autism: One Year Later by James Jeffrey Bradstreet, MD, MD(H), FAAFP
(c) 2012 Autism Science Digest
ONe YeAR lAteR
By JAmES JEFFREy BRADStRE... | cc/2019-30/en_middle_0019.json.gz/line49 |
__label__cc | 0.506638 | 0.493362 | Alberta adoptee finds biological family online after nearly 4 decades
(Charlene’s sister Priscilla Giesbrecht, Charlene Whitford and sister Crystal Whitford.)
National News | May 13, 2015 by Brandi Morin | APTN National News
An Edmonton woman who was adopted at age three found her biological family using social media.
... | cc/2019-30/en_middle_0019.json.gz/line55 |
__label__cc | 0.748489 | 0.251511 | ENGAGE 2017: A Recap
By: Kim Jaeger, Global Partner Program Manager
Each year, I have the pleasure of attending DigitalGlobe’s ENGAGE events with some of our very best team members, partners and customers. This year, my ENGAGE “world tour” took me from London in late April to Hong Kong and Houston in May. Each region o... | cc/2019-30/en_middle_0019.json.gz/line56 |
__label__wiki | 0.859355 | 0.859355 | Economy – Macleans.ca
Prenatal entertainment, coming to a screen near you 2019-06-13 06:30:06In the age of Instagram, 3D ultrasounds fit seamlessly among adorable pregnancy and birth announcements—most of the time The post Prenatal enter
Dirty money: it’s a Canadian thing 2019-06-12 06:00:35Canada’s housing markets are... | cc/2019-30/en_middle_0019.json.gz/line74 |
__label__cc | 0.709736 | 0.290264 | young boy old babe sex mpgs
How to improve sex in the bedroom
Clip free online sex video watch
Interracial sex pictures white on black
Cam free sex strip tease web
Ultimate guide to anal sex for women torrent
Nikogore on How can a cow have sex
when old men look for sex
How can a cow have sex
Linked in a cycle with ovul... | cc/2019-30/en_middle_0019.json.gz/line76 |
__label__wiki | 0.824973 | 0.824973 | During Gatwick’s trial flight path of February 2014 Gatwick was inundated by complaints, for every plane that followed the route, over new areas not flown over before, residents in their hundreds were emailing Gatwick for every flight that destroyed their usual tranquility. The trial, ADNID, finished in August 2014 but... | cc/2019-30/en_middle_0019.json.gz/line80 |
__label__cc | 0.743994 | 0.256006 | Alienation Nation
My reference in last week's essay The Art of Survival, Taoism and the Warring States (June 27, 2008) to camping in the wilds as a 13-year old sparked a dialog with frequent contributor Chuck D. While this topic may seem at first blush to be unimportant compared to rising gasoline and food prices or th... | cc/2019-30/en_middle_0019.json.gz/line90 |
__label__cc | 0.548046 | 0.451954 | Turning a Profit on Abandoned McMansions and SUVs
Capitalist extraordinaire Ronald Dump is touting two "huge" profit-center ideas: converting abandoned/worthless McMansions into modern tenements, and recycling abandoned/worthless SUVs into gas-sipping 3-wheelers.
It's been a while since we checked in with trend-setting... | cc/2019-30/en_middle_0019.json.gz/line91 |
__label__cc | 0.598541 | 0.401459 | Eureka! Solved: The Mind/Matter Genesis
Goto page Previous 1, 2, 3 ... 10, 11, 12, 13, 14, 15 Next
RELATED TOPIC:
There's a great exploration of Structure of Number
going on since October 2018 in this topic thread
I'm posting some Rupert Sheldrake material here now, because
of his insights into memory and morphogenic r... | cc/2019-30/en_middle_0019.json.gz/line109 |
__label__cc | 0.712816 | 0.287184 | My brother asks a great question in the comments section of my last post: “…how is Pollack's drips any more inspired than [Twombly's]?” He brings this up not only because they are both Abstract Expressionists, but also because he knows me well and knows that I am an ardent fan of Pollock’s work. I could attempt a justi... | cc/2019-30/en_middle_0019.json.gz/line112 |
__label__wiki | 0.54264 | 0.54264 | Air Lease signs long-term lease placements for four Airbus jets
4 weeks ago DieselGasoil Comments Off on Air Lease signs long-term lease placements for four Airbus jets
FILE PHOTO: An Airbus A320neo aircraft is pictured during a news conference to announce a partnership between Airbus and Bombardier on the C Series air... | cc/2019-30/en_middle_0019.json.gz/line113 |
__label__wiki | 0.544624 | 0.544624 | Title IX Sexual Misconduct Appeal Form
Student Name: *
Student ID: *
Local Address: Street/Apt. Number:
Date of Conference/Hearing: *
Charges: *
If you feel that you have been wrongfully accused, please follow the instructions below:
Grounds for appeal are limited to the following: An appeal of a disciplinary decision ... | cc/2019-30/en_middle_0019.json.gz/line118 |
__label__cc | 0.73354 | 0.26646 | Author: Charles Wilson
Ultra Races are for Heroes
Ultra Races are intense. My first ultra race was a 50 mile 3 day 2 night race in the eastern sierra nevada’s. I completed it with another USMC vet and friend of mine. We served together as marines and as a result our bound has lasted well beyond our military days.
We ta... | cc/2019-30/en_middle_0019.json.gz/line124 |
__label__wiki | 0.917338 | 0.917338 | русская версия | english version
Topical Events
Are you interested in politics?
Yes, sure
Yes, it is important for my work/business
No, anyway commoner has no political influence
No, I don't care about it
Погода в Горловке Погода в Броварах
Odesa > Topical Events
The ports of the country at the end of 8 months: the gen... | cc/2019-30/en_middle_0019.json.gz/line143 |
__label__wiki | 0.616006 | 0.616006 | Url:Home » Achievements » Animal Breeding and Genetics » Cattle
Evaluation of genetic diversity of dairy cows by microsatellite markers
The genetic diversity protection of domesticated animals is one of the important targets of Aichi Biodiversity Targets adopted by the Tenth Meeting of the Conference of the Parties (CO... | cc/2019-30/en_middle_0019.json.gz/line144 |
__label__cc | 0.505872 | 0.494128 | Physiotherapy education in Singapore: a new degree programme through collaboration between Trinity College Dublin and Singapore Institute of Technology
Hussey, Juliette and Wong, WaiPong and Connell, Amanda (2013) Physiotherapy education in Singapore: a new degree programme through collaboration between Trinity College... | cc/2019-30/en_middle_0019.json.gz/line146 |
__label__wiki | 0.915856 | 0.915856 | Moscow pursuing ‘forced integration’ of Belarus into Russia now, Sivitsky says
Belarus and Russia
2018/08/18 - 13:50 • International, More
Russian actions toward Belarus since 2015 show that Moscow is no longer pursuing the “union deal” it had established with Minsk earlier and instead has placed its bets on the forced... | cc/2019-30/en_middle_0019.json.gz/line147 |
__label__cc | 0.697544 | 0.302456 | Graphic proposal for the tourism brand of the city of Zaragoza. The design reflects the dynamics, diversity and creativity of Zaragoza. A city that is in constant movement, evolution and transformation; it is restless, non-conformist, versatile and entrepreneur. It is a human city, liveable and authentic, with an envia... | cc/2019-30/en_middle_0019.json.gz/line151 |
__label__wiki | 0.597456 | 0.597456 | April 04 - Live In Los Angeles
Touchdown proudly presents the re-release the concert from November 14, 1970. That’s something we wanted to do for a long time. The recording we got was carefully remastered and and sounds much better than on the former release “Forum of Inglewood” from fourteen years ago.
Elvis was on fi... | cc/2019-30/en_middle_0019.json.gz/line153 |
__label__wiki | 0.854671 | 0.854671 | Twitter users are better educated than general public- Research
Robert Ojwang April 30, 2019 7:28 am GMT+0000 News_Lifestyle #SurvivalTactics, 1, Bloggers association of Kenya, Education, Pew, Twitter
Twitter has evolved from just another social media platform to a powerful tool when it comes to digesting news.
Twitter... | cc/2019-30/en_middle_0019.json.gz/line156 |
__label__wiki | 0.658419 | 0.658419 | Circling '84
by Ginnah Howard
Other things are on my mind when the Tupperware lady says, "First, let's move your couch over by the door and the table here."
Before her words reach my brain, she's got one end of that maroon monster, a cast-off from Steve's mother, waist high and swinging away from the wall. Vaguely I re... | cc/2019-30/en_middle_0019.json.gz/line161 |
__label__cc | 0.664455 | 0.335545 | Rules Don’t Apply
Foolhardy
23 November 2016| No Comments on Rules Don’t Apply by Sean Chavel
I was hoping other reviews were too harsh on it, for I so badly wanted to love a film the establishment doesn’t understand. But the truth is it only works in fits and starts. Rules Don’t Apply turns out to be the Warren Beatty... | cc/2019-30/en_middle_0019.json.gz/line165 |
__label__cc | 0.597354 | 0.402646 | Events Home / Freshwater Saltwater Weave
Freshwater Saltwater Weave
Sep 20 - Jan 6, 2019
(weekly Tuesday through Sunday for 15 times)
Kluge-Ruhe Aboriginal Art Collection
400 Worrell Drive
Charlottesville, VA 22911 Map
Displaying the work of glass artist Jenni Kemarre Martiniello of Australia, an award-winning visual a... | cc/2019-30/en_middle_0019.json.gz/line168 |
__label__wiki | 0.573311 | 0.573311 | Concerts & Gig Guide
Covers, Tribute Bands
Kim Willoughby and the Bandoleros
Sat 9 Mar ’19, 8:00pm – 11:00pm
The Refinery, 5 Willoughby St, Paeroa
General Admin: $28.62
General Admin top up: $28.62
Celebrated for her charming vocal style and charismatic stage presence, Kim is one of New Zealand’s favourite female vocal... | cc/2019-30/en_middle_0019.json.gz/line169 |
__label__cc | 0.518637 | 0.481363 | Home Page & Events
What is Christian Meditation
Talks on Meditation
Meditation with Children
Meditation Tracks
Tracks for Beginners
Tracks for Regular Meditation
Tracks without Music
Tracks for Secular/Multi-Denominational Schools
Photoelicitation
Teacher Newsletters
Benefits and Fruits of Meditation
Benefits of Medita... | cc/2019-30/en_middle_0019.json.gz/line174 |
__label__cc | 0.714774 | 0.285226 | Government95
Cold War52
Europe[remove]1,185
Working Paper2,257
Policy Brief1,248
Journal Article[remove]1,185
Special Report47
Commentary and Analysis21
The International Spectator126
European Journal of International Law121
Insight Turkey118
Cultures Conflits68
European Affairs48
Istituto Affari Internazionali126
SETA... | cc/2019-30/en_middle_0019.json.gz/line176 |
__label__cc | 0.684477 | 0.315523 | Director: Scott Mosier, Yarrow Cheney
Actors: Angela Lansbury, Benedict Cumberbatch, Brad O'Hare, Cameron Seely, Kenan Thompson, Pharrell Williams, Rashida Jones
Country: China, France, Japan, USA
Shopkins: Wild
Find your Wild Style and come on a totally Pawesome adventure to Pawville to meet the Shoppets. When famous ... | cc/2019-30/en_middle_0019.json.gz/line179 |
__label__cc | 0.717086 | 0.282914 | Adimec Focuses on Defense Vision Applications at SPIE DSS 2011
Ruggedized, high resolution digital HD cameras
optimized for outdoor, military applications on display;
“See Through the Fog” demo showcases VEM video enhancement technology
BOSTON, Mass. – April 12, 2011 -- Adimec (www.adimec.com ), a world leader in appli... | cc/2019-30/en_middle_0019.json.gz/line180 |
__label__wiki | 0.545213 | 0.545213 | The Radiating Atom 1: Schrödinger's Enigma
Are there quantum jumps?
This is a first step in my search for a wave equation for a radiating atom as an analog of the wave equation with small damping studied in Mathematical Physics of Blackbody Radiation.
Schrödinger formulated his basic equation of quantum mechanics in th... | cc/2019-30/en_middle_0019.json.gz/line182 |
__label__cc | 0.662177 | 0.337823 | Board index ‹ Community Center ‹ Might Possibly Play Well With Others ‹ Errant Road, The Role Playing Game ‹ OOC Discussion
Calling new writers/characters...
For the Rules, Character Workshop, and other general discussion of the game.
by Jack Rothwell » January 1st, 2011, 5:05 pm
We're in serious need of some new chara... | cc/2019-30/en_middle_0019.json.gz/line191 |
__label__cc | 0.506023 | 0.493977 | Board index Games Japanese Video Games
The Official WTF are YOU playing right now thread
Talk about all aspect of Japanese games.
Moderator: Gaijin Punch
Past The Newbie Stage
Re: The Official WTF are YOU playing right now thread
Postby schadenfreude » Thu Aug 10, 2017 5:41 am
I'm pretty stoked, bros. I've been playing... | cc/2019-30/en_middle_0019.json.gz/line192 |
__label__wiki | 0.915459 | 0.915459 | Gebetsraum » Dein Gebet zum Thema » Heilen » throw by first baseman Kevin Frandsen helped the Mets
#1 | throw by first baseman Kevin Frandsen helped the Mets 14.03.2019 03:33
BUFFALO, N.Y. -- With Jim Calhoun watching from the stands, Shabazz Napier capped Connecticut coach Kevin Ollies first NCAA tournament appearance... | cc/2019-30/en_middle_0019.json.gz/line194 |
__label__cc | 0.617833 | 0.382167 | The Mexico-USA tuna war rumbles on
Excerpts from Geo-Mexico, Updates to Geo-Mexico
More than a year ago, the World Trade Organization (WTO) sided with Mexico and appeared to finally bring to an end a long-running dispute between Mexico and the USA over “dolphin-safe” tuna. The WTO decision confirmed that the methods us... | cc/2019-30/en_middle_0019.json.gz/line196 |
__label__wiki | 0.919503 | 0.919503 | Madison and the big Ps
Hard to believe that the Giants did it again. Bochy was enough of a genius to recognize the weapon he had in Bumgarner last night.
An old friend of mine asked me how in the world could a team that looked and played like the worst team in baseball in June and July could turn around. My answer was ... | cc/2019-30/en_middle_0019.json.gz/line202 |
__label__wiki | 0.562553 | 0.562553 | About Hekate
The goddess Hekate was one of the most significant dieties of the ancient world. Her history stretches back across the millenia. We find traces of her in the recent past, through into the Renaissance - stretching back through the Byzantine and Roman Empires, Hellenistic, Classical and Archaic Greece throug... | cc/2019-30/en_middle_0019.json.gz/line206 |
__label__wiki | 0.855502 | 0.855502 | Home Education Science NASA finding bolsters Indian theory on black hole
NASA finding bolsters Indian theory on black hole
The so-called black holes are not "true" black holes but actually ultra hot balls of fire like our Sun.
By K.S. Jayaraman
BANGLORE– An Indian astrophysicist says the recent observation by NASA scie... | cc/2019-30/en_middle_0019.json.gz/line219 |
__label__cc | 0.711211 | 0.288789 | Romance in Jamaica with Round Hill Hotel and Villas
Destination Honeymoon at Chabil Mar Placencia
Seychelles: Jewel of the Indian Ocean
Winter Bliss at Vista Verde Ranch
A Journey Through Croatia
Honeymoon & Romance Packages at St. George's Caye Resort
Cove Haven Entertainment Resorts
Vista Verde Ranch
Chabil Mar Place... | cc/2019-30/en_middle_0019.json.gz/line229 |
__label__cc | 0.634345 | 0.365655 | GUYANESE BISHOP CHARGED WITH MURDER OF HIS WIFE IN TRINIDAD
(Trinidad Express) ‘GOD is good’ were the words from Melroy Corbin after his court appearance on the charge that he murdered his wife, pastor Alisa Ali.
Corbin, 45 a bishop, cried as he faced Chaguanas magistrate Adrian Darmanie.
The magistrate told Corbin he ... | cc/2019-30/en_middle_0019.json.gz/line240 |
__label__cc | 0.683862 | 0.316138 | HomeUncategorizedThe duration of procedure from intubation to closing skin incis
The duration of procedure from intubation to closing skin incis
Proceedings, Sixty-first Annual Meeting Medical Library Association, Inc. Factors determining the relative clinical importance of different blood-group antibodies. We also sho... | cc/2019-30/en_middle_0019.json.gz/line249 |
__label__cc | 0.596157 | 0.403843 | Fragile Home at Amar Gallery for EVE exhibition, 2018
Straight out of studio, my new work Fragile Home is going on a group exhibition this month at Amar Gallery in London.
Sonja Brass, Renee Cox, Guerrilla Girls, Mekhala Bahl, Jenna Burchell, Antony Gormley.
23rd January - 23rd March 2018
Amar Gallery is proud to prese... | cc/2019-30/en_middle_0019.json.gz/line251 |
__label__wiki | 0.962367 | 0.962367 | UK 7-y-0 gets top grade in maths GCSE
Published:Sunday | August 29, 2010 | 12:00 AM
Oscar Selby
Paula Fentiman, Contributor
With an actuary and a computer software engineer for parents, seven-year-old Oscar Selby was destined to be mathematical.
But his love of numbers and ability to learn quickly marked him out and la... | cc/2019-30/en_middle_0019.json.gz/line261 |
__label__wiki | 0.735561 | 0.735561 | You are here: Home / Blog / French pilots flying Iraqi Combat Aircraft during Iran-Iraq War / 2010 / December
Zarathustra and Iranian Culture (Revised)
December 30, 2010 /in Zoroastrianism /by manuvera
The following is a 19-part Persian-language video documentary by Akbar Moarefi/ اکبر معارفی on the influence of Zoroas... | cc/2019-30/en_middle_0019.json.gz/line262 |
__label__wiki | 0.551177 | 0.551177 | Self Portrait as the Center of the Universe
The self-portrait animatronic head has open-ended, improvisational conversations with its alter ego, a virtual head that appears as the central figure in the projection. Like If/Then, the conversations between these two figures do not include the audience; rather, they intera... | cc/2019-30/en_middle_0019.json.gz/line263 |
__label__wiki | 0.501778 | 0.501778 | Get your Friday Questions answered here!
VincentS is up first.
Was it ever on the radar to make Bebe Neuwirth a regular on FRASIER?
Since I’m not really qualified to answer that, I got one of the shows creators, David Lee to graciously respond for me.
One always considers such things if for no other reason than trying ... | cc/2019-30/en_middle_0019.json.gz/line265 |
__label__wiki | 0.613269 | 0.613269 | Friendly Confines of Wrigley Field celebrates 100th birthday – a Cubs fan remembers
Wrigley Field isn’t unchanged in my lifetime, but it’s close enough that I spend more time being bombarded by memories rather than watching the game when I make a pilgrimage there.
Sure, I’m pissed off that the Cubs have no chance to wi... | cc/2019-30/en_middle_0019.json.gz/line266 |
__label__wiki | 0.738341 | 0.738341 | 1760 - Austro-Russian campaign in Silesia
Hierarchical Path: Seven Years War (Main Page) >> Campaigns >> 1760 - Austro-Russian campaign in Silesia
The campaign lasted from March to October 1760
1.1 Prelude to the Campaign
1.2 Contest about Landeshut
1.3 Capture of Glatz by the Austrians
1.4 Siege of Breslau
1.5 Prussia... | cc/2019-30/en_middle_0019.json.gz/line267 |
__label__cc | 0.654982 | 0.345018 | Filters: Author is Hetrick, B.A.D. [Clear All Filters]
Hetrick BAD, Bloom J. Vesicular-arbuscular mycorrhizal fungi associated with native tall grass prairie and cultivated winter wheat. Canadian Journal of Botany. 1983;61:2140 -2146. doi:10.1139/b83-231.
Zajicek JM, Albrecht ML, Hetrick BAD. Vesicular-arbuscular mycor... | cc/2019-30/en_middle_0019.json.gz/line271 |
__label__cc | 0.724687 | 0.275313 | Liddington
Liddington in Wiltshire, UK, is situated on the ancient Ridgeway track at the edge of the North Wessex Downs Area of Outstanding Natural Beauty. The village dates back well over 1000 years to the Saxon kingdom of Wessex, and is entered in the Domesday Book. The parish has been inhabited since the distant pas... | cc/2019-30/en_middle_0019.json.gz/line272 |
__label__cc | 0.748604 | 0.251396 | Fast Glance
Stories, Tips, & Musings
godley trail
Jeremy Nickel
Is New Zealand a Real Place?
I'm pretty sure they just give you acid when you arrive in New Zealand.
I say this because so much of it is so awe-inspiring, vivid, and fantastically scenic that I wonder if I was just on an acid trip the whole time I was ther... | cc/2019-30/en_middle_0019.json.gz/line279 |
__label__cc | 0.698083 | 0.301917 | Home » Hiking News » Safety Concerns Lead To Emergency Closure Near Jenny Lake In Grand Teton National Park
Safety Concerns Lead To Emergency Closure Near Jenny Lake In Grand Teton National Park
Posted by Jeff on Jul 11, 2018 @ 11:48 am in Hiking News | 0 comments | Last modified: July 10, 2018
A highly popular area ne... | cc/2019-30/en_middle_0019.json.gz/line281 |
__label__cc | 0.657125 | 0.342875 | Rasikananda dasa
Vaivasvata Manu Worships Lord Matsya, 1997, oil on canvas, 80 x 108 cm
Srimad-Bhagavatam
Krishna says: "Time I am."
In contrast to the Western concept of linear time, the sacred texts of India view reality from the perspective of cycles called yugas. Our current cycle of history is seen as one of many ... | cc/2019-30/en_middle_0019.json.gz/line284 |
__label__wiki | 0.684415 | 0.684415 | Greene (x) ›
Biologic and geologic characteristics of cold seeps in Monterey Bay, California,
Cold seep communities discovered at three previously unknown sites between 600 and 1000 m in Monterey Bay, California, are dominated by chemoautotrophic bacteria (Beggiatoa sp.) and vesicomyid clams (5 sp.). Other seep-associa... | cc/2019-30/en_middle_0019.json.gz/line286 |
__label__wiki | 0.701768 | 0.701768 | Hall, N.C. (x) ›
Coale (x) ›
Benthic manganese fluxes along the Oregon-California continental shelf and slope
Here we examine the factors that influence the manganese (Mn) benthic flux from eastern North Pacific marine sediments, with a primary emphasis on continental shelf locations off Oregon and California and studi... | cc/2019-30/en_middle_0019.json.gz/line287 |
__label__wiki | 0.721951 | 0.721951 | The effects of Cu on the adenylate energy charge of open ocean phytoplankton,
The effects of short-term, acute Cu exposure (6 h) on the adenylate energy charge (EC A) of open-ocean phytoplankton populations (northeastern equatorial Pacific) were investigated. Energy charge remained at ̃0.77 over the range of Cu additio... | cc/2019-30/en_middle_0019.json.gz/line288 |
__label__wiki | 0.617101 | 0.617101 | Johnson (x) ›
PCB and DDE contamination in harbor seals (Phoca vitulina) from North-Central California and Bristol Bay, Alaska,
In recent years, concerns have increased regarding accumulation of persistent, lipophilic contaminants by marine mammals. We quantified blood levels of the two most prevalent organochlorine (O... | cc/2019-30/en_middle_0019.json.gz/line289 |
__label__cc | 0.600562 | 0.399438 | Website owner hasn't paid for Site.pro services
If you are an owner of this website – please upgrade to remove ads
Urban Tees
Add your business motto by double clicking.
Replace this text with information about you and your business or add information that will be useful for your customers.
Add the main advantages of y... | cc/2019-30/en_middle_0019.json.gz/line290 |
__label__wiki | 0.675763 | 0.675763 | Home News Breaking News No Joke: Cash-Strapped NYC Mulling Bicycle Toll On Bridges
No Joke: Cash-Strapped NYC Mulling Bicycle Toll On Bridges
The city’s former traffic commissioner has a new plan to put tolls on East River bridges. But this proposal has some novel “selling points,” including a first-ever toll for cycli... | cc/2019-30/en_middle_0019.json.gz/line295 |
__label__wiki | 0.508482 | 0.508482 | MCCRG | Markham Citizens Coalition for Responsive Government
Projects & Accomplishments
Arena Latest News Links
News Links – Globe and Mail
News Links – Toronto Star
ARENA Facts
Arena Survey Results
Posting Entry
Candidate Endorsement
2015 Meet & Greet
Secret Reports
Thanks very much to those of you who attended our Me... | cc/2019-30/en_middle_0019.json.gz/line297 |
__label__cc | 0.652312 | 0.347688 | Earth kratom maeng da capsules dosage - Cheapest price, Approved Pharmacy
Glutaraldehyde is used in biochemistry applications as an amine-reactive homobifunctional crosslinker and fixative prior to SDS-PAGE, staining, or kratom wax electron microscopy. His Purchase generic ultram in mexico skin tone became much lighter... | cc/2019-30/en_middle_0019.json.gz/line301 |
__label__cc | 0.558814 | 0.441186 | @battle-of-the-bands
Blog Categories Band Of The Month Swirl is the winners of Metal Devastation Radios Battle Of The Bands for June 2018
Swirl is the winners of Metal Devastation Radios Battle Of The Bands for June 2018 Saturday June 2 2018, 5:52 PM
California rockers Swirl have kicked off the new year with a new song... | cc/2019-30/en_middle_0019.json.gz/line304 |
__label__wiki | 0.701365 | 0.701365 | Metro of Shenyang
Metro of Shenyang Asia / China
Shenyang Metro is the underground rapid transit system serving Shenyang, the capital of Liaoning province in China. It started operation since 2010. Though such metro systems were already in service in other parts of the country, this was the first system to serve the no... | cc/2019-30/en_middle_0019.json.gz/line308 |
__label__cc | 0.729118 | 0.270882 | Dine In Menu
MOSA White Station
850 White Station
Tuesday to Thursday 11:00 AM – 9:00 PM
Friday 11:00 AM – 10:00 PM
Saturday 12:00 PM – 10:00 PM
Mosa blends the bold flavors and savory spices found in classic Thai, Chinese and Japanese cuisine and incorporates the freshest, local ingredients. These Asian comfort food d... | cc/2019-30/en_middle_0019.json.gz/line312 |
__label__wiki | 0.707511 | 0.707511 | Centipedes and Millipedes
Fungi and Lichens
Snails and Slugs
Follow @MinnesotaSeason
American black currant
(Ribes americanum)
not yet assessed
NatureServe
N5 - Secure
SNR - Unranked
FACW - Facultative wetland
Northcentral & Northeast
Moist. Upland woods, floodplains.
Late April to early June
Yellowish white
40″ to 60″... | cc/2019-30/en_middle_0019.json.gz/line316 |
__label__cc | 0.716561 | 0.283439 | Home>Search Posters>Search Results>The Fly (1958)
The Fly (1958) Poster
This is a glorious example of a sci-fi horror double-bill, twinning "The Fly" (1958) with "The Return of the Fly" (1959), probably dating to early 1960's. The artists depiction of the subject matter was unusually graphic for the time & even today p... | cc/2019-30/en_middle_0019.json.gz/line318 |
__label__cc | 0.553182 | 0.446818 | http://notationquarterly.us/wp-content/uploads/2018/05/screen-shot-2018-05-07-at-12.57.28-pm-335x256.png
“…THE NEW SHAPE OF PROTEST MUSIC” | JASON PARHAM x WIRED
http://notationquarterly.us/wp-content/uploads/2017/05/p90260685_highres_bmw-concept-8-series-335x256.jpg
The BMW Concept 8 Series
http://notationquarterly.us... | cc/2019-30/en_middle_0019.json.gz/line333 |
__label__cc | 0.532503 | 0.467497 | Selim Lemouchi (The Devil's Blood) dead?!
Goto page Previous 1, 2, 3, 4, 5, 6, 7, 8, 9 Next
Carpathian_Florist
Posted: Thu Mar 06, 2014 10:23 pm Post subject:
Madhukapala wrote:
skeletor666 wrote:
sick of this suicide love in bullshit like these clowns are somehow enlightened and can see a clear path .sad to see a youn... | cc/2019-30/en_middle_0019.json.gz/line335 |
__label__wiki | 0.808106 | 0.808106 | Reunion Exclusives
Porsha Williams Gives You a Tour of Daughter Pilar Jhena's Nursery
You need to see Pilar Jhena's amazing closet!
More Season 11 / Episode 53
Exclusive Porsha Williams Gives You a Tour of Daughter Pilar Jhena's Nursery
Show Highlight Porsha Williams Introduces You to Her Daughter Pilar Jhena
Preview P... | cc/2019-30/en_middle_0019.json.gz/line337 |
__label__cc | 0.706778 | 0.293222 | Learn about the conditions that led to Frank Furness' most incredible masterworks, including the Pennsylvania Academy of the Fine Arts seen here, on Wednesday.
Back to PlanPhilly
Viddler Twitter Facebook EOTS RSS Events RSS NEWSLETTER SIGNUP
You are viewing 23 articles with the tag Planning by the author Ashley Hahn
$1... | cc/2019-30/en_middle_0019.json.gz/line342 |
__label__cc | 0.546018 | 0.453982 | Home » Africa, Articles, Columnists, NNP Columnists, P » Royal Wedding: Why the Queen Snubbed Jonathan – By Phil Tam-Al Alalibo
Royal Wedding: Why the Queen Snubbed Jonathan – By Phil Tam-Al Alalibo
Posted by admin Africa, Articles, Columnists, NNP Columnists, P Friday, April 29th, 2011
Prince Williams Kissing his Brid... | cc/2019-30/en_middle_0019.json.gz/line343 |
__label__wiki | 0.824342 | 0.824342 | Hey Bay Area Husker Fans,
Whew!!! Another nail-biter! Way too close for comfort for 3+ quarters...especially after that razor-thin win over the Sooners the week before. It took the offense most of the game to finally get rolling for a couple of touchdowns that sealed the deal for a win over Kansas, allowing the Husker ... | cc/2019-30/en_middle_0019.json.gz/line344 |
__label__wiki | 0.89457 | 0.89457 | Five civilians killed in fresh east Ukraine violence
Three civilians were killed and 10 were wounded overnight in the rebel bastion of Donetsk, where further explosions and gunfire were heard Sunday morning, local authorities said. The pro-Kiev governor of the rebel region of Lugansk meanwhile said two civilians were k... | cc/2019-30/en_middle_0019.json.gz/line346 |
__label__wiki | 0.919689 | 0.919689 | 32301 Corgi Lightning F1A - 74 Sqn RAF. Ltd Edn £ 0.00
Lightning F1A in the superb markings of 74 Squadron, "The Tigers" aerobatic team, RAF. Outstanding limited edition of only 4,000. Complete with optional undercarriage and canopy positions, removable steps and engine covers. All Corgi Lightnings are now highly colle... | cc/2019-30/en_middle_0019.json.gz/line347 |
__label__wiki | 0.676598 | 0.676598 | Jane De Leon Officially Cast as Darna In ABS-CBN Remake
Hino Joins First Nationwide Modern PUV Caravan, Showcases New Jeepneys
By Featuresdesk (ICG) on July 10, 2019
Hino Motors Philippines (HMP), one of the pioneer participants of the government’s Public Utility Vehicle (PUV) Modernization Program, joined the first Mo... | cc/2019-30/en_middle_0019.json.gz/line351 |
__label__cc | 0.726988 | 0.273012 | Pakistan 360 degrees
All About Pakistan-Nargis Sarfraz’s Blog
About Pakistan360Degrees
Pakistan destination: Top ten National Parks of Pakistan
by MairaS on November 17, 2011
in Pakistan: Tourist Destinations
A park is a way of providing recreational facilities to a number of people. Not only it acts as a tourist point... | cc/2019-30/en_middle_0019.json.gz/line352 |
__label__wiki | 0.730656 | 0.730656 | Margaret Baumgaertner » LaCross, WI
Visit artist's full web site
Honors, 1998, ASOPA
Margaret Baumgaertner
LaCross, WI
Baumportrait@cs.com
Margaret Carter Baumgaertner's notable commissions have included governors, congressman, chief executive officers, actors, physicians, and families.
Baumgaertner has a strong feelin... | cc/2019-30/en_middle_0019.json.gz/line360 |
__label__wiki | 0.565806 | 0.565806 | Why Didn’t Holocaust Victims Fight Back?
June 19, 2014 by Steve Coombes
Why Didn't Holocaust Victims Fight Back?
I saw this image on a friend's Facebook wall today which prompted me to think... and reply.
The Holocaust, despite a vocal handful of deniers, was a tragic and real event in world history.
While the image an... | cc/2019-30/en_middle_0019.json.gz/line367 |
__label__wiki | 0.948352 | 0.948352 | EDITORIAL: Timor crisis - Alkatiri's murky role
NATIONAL AFFAIRS: Will Snowy Hydro sale create Australia's Enron?
CANBERRA OBSERVED: Merger no answer to declining Nationals vote
ENERGY CRISIS: How to make Australia energy self-sufficient
SAME-SEX MARRIAGE: Ex-Family Court judge defends gay 'marriage'
WESTERN AUSTRALIA:... | cc/2019-30/en_middle_0019.json.gz/line374 |
__label__cc | 0.657996 | 0.342004 | Niagara VegFest returns with vegan Big Macs
Vegetables. (File photo)
May 22, 2018 | Tuesday
What does marathon runner and power lifter Dominick Thompson have in common with Big Macs?
Both will be at Niagara VegFest on Sunday, June 3, when the annual celebration of plant-based diets hits St. Catharines Market Square for... | cc/2019-30/en_middle_0019.json.gz/line376 |
__label__wiki | 0.930321 | 0.930321 | The NM Political Report (http://nmpoliticalreport.com/2017/09/19/video-federal-sting-draws-responses-in-abq-mayors-race/)
Video: Federal sting draws responses in ABQ mayor’s race
By Jeff Proctor, New Mexico In Depth | September 19, 2017
Criticism of a massive undercover drug- and gun-crime sting spilled into the Albuqu... | cc/2019-30/en_middle_0019.json.gz/line378 |
__label__cc | 0.690593 | 0.309407 | Open Loop Design: Portland, Oregon Web Design & Web site Content Development using WordPress Website Content Management Systems for Web site Search Engine Optimization (S.E.O.).
Contact OpenLoopDesign: Portland, Oregon Web Design & Website [web site] Content Development using WordPress Website [web site] Content Manage... | cc/2019-30/en_middle_0019.json.gz/line385 |
__label__cc | 0.656214 | 0.343786 | Home » Medications » Dupixent approved for chronic rhinosinusitis with nasal polyps
Dupixent (dupilumab) has been approved to treat nasal polyps in adults with chronic rhinosinusitis, the U.S. Food and Drug Administration announced today.
Dupixent, which is administered through injection, was previously approved to tre... | cc/2019-30/en_middle_0019.json.gz/line388 |
__label__wiki | 0.587775 | 0.587775 | Earthquake prediction
The poetry of reality
We must know.
We will know.
A view from the
shoulders of giants.
'Oumuamua
Galileo gambit
Ideomotor effect
Scientific law
Scientific revolution
Sound science
The dose makes the poison
Earthquake prediction is the art or science of determining the time, location, and magnitude... | cc/2019-30/en_middle_0019.json.gz/line401 |
__label__cc | 0.507433 | 0.492567 | The Qualities Of Soft Pastel
Soft pastels are pure, lightfast, ground pigments mixed with a binder which is then compressed into sticks and allowed to dry.
An artwork is created by stroking the sticks of dry pigment across an abrasive ground which may be paper or board.If the ground is completely covered with Pastel, t... | cc/2019-30/en_middle_0019.json.gz/line405 |
__label__wiki | 0.690113 | 0.690113 | You are here: Home › Pete Sixsmith › The First Time Ever I Saw Your Ground › The First Time Ever I Saw Your Ground: Barnsley’s Oakwell
Pete Sixsmith, The First Time Ever I Saw Your Ground March 11, 2019
The First Time Ever I Saw Your Ground: Barnsley’s Oakwell
Sixer now …
Pete Sixsmith was adamant. There simply wasn’t ... | cc/2019-30/en_middle_0019.json.gz/line407 |
__label__cc | 0.707636 | 0.292364 | TO ALL: Principals of Nursing Education Institutions
Cancellation of the Examination for the Diploma in Midwifery (Government Notice No. R.254 of 14 February 1989) Scheduled for 21, 23, 25 February 2011 and the Examination for Bridging Course for Enrolled Nurses Leading to the Registration as a General Nurse (Governmen... | cc/2019-30/en_middle_0019.json.gz/line409 |
__label__wiki | 0.531057 | 0.531057 | Sandberg Phoenix Highly Ranked by U.S. News
November 6, 2017Sandberg PhoenixFirm News
The firm earned top tier rankings in five categories in the just-released U.S. News Best Lawyers Best Law Firms Rankings. The survey’s rakings placed Sandberg Phoenix in the Tier One category in the following: Closely Held Companies a... | cc/2019-30/en_middle_0019.json.gz/line410 |
__label__cc | 0.705915 | 0.294085 | Obama F's over Chrysler
Leave it to the Obama admin and his foreign car loving taskforce to force this. From Forbes magazing.
The U.S. government has threatened to suspend federal aid for Chrysler unless it secures a deal with the Italian carmaker within 30 days, senior administration officials told Forbes. (See “Obama... | cc/2019-30/en_middle_0019.json.gz/line415 |
__label__cc | 0.602949 | 0.397051 | Fighting the oobleck
I didn't plan this long of an absence from blogs - I've been under the weather. Where the fuck does that expression come from, anyway? It feels more like being under the oobleck - as in this:
Dr. Seuss made up a lot of words, but I think that one may be my favorite, because it so accurately describ... | cc/2019-30/en_middle_0019.json.gz/line427 |
__label__cc | 0.654806 | 0.345194 | Delay the Oasis demolition!
Please consider attending the upcoming community meeting hosted by Councillor Adam Vaughan of Ward 20. The meeting concerns the proposed Minto/freed development at Front and Bathurst, which is ultimately going to result in the demolition of the warehouse structure that houses the Rock Oasis ... | cc/2019-30/en_middle_0019.json.gz/line437 |
__label__wiki | 0.744316 | 0.744316 | The domain within your query sequence starts at position 254 and ends at position 309; the E-value for the LIM domain shown below is 2.92e-7.
YCDTCAQHIGIDQGQMTYDGQHWHATETCFCCAHCKKSLLGRPFLPKQGQIFCSRA
Zinc-binding domain present in Lin-11, Isl-1, Mec-3.
Zinc-binding domain family. Some LIM domains bind protein partners v... | cc/2019-30/en_middle_0019.json.gz/line439 |
__label__wiki | 0.574649 | 0.574649 | Smash Pages Q&A: Phil Hester on Image ‘Mythic’
Late September saw the release of Mythic #4 by Phil Hester and John McCrea — to mark the release I interviewed Hester.
Continue reading “Smash Pages Q&A: Phil Hester on Image ‘Mythic’”
Author Tim O'SheaPosted on November 9, 2015 May 20, 2017 Categories InterviewsTags Image... | cc/2019-30/en_middle_0019.json.gz/line445 |
__label__wiki | 0.97541 | 0.97541 | ABBATH To Release ‘Outstrider’ Album In July
ABBATH, the solo project of former IMMORTAL frontman Abbath (real name Olve Eikemo), will release its second album, “Outstrider”, on July 5 via Season Of Mist. The disc was recorded at Dub Studios in Kristiansand, Norway with producer Endre Kirkesola, who has previously work... | cc/2019-30/en_middle_0019.json.gz/line447 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.