Entry stringlengths 6 10 | Entry Name stringlengths 5 11 | Sequence stringlengths 2 35.2k | EC number stringlengths 7 118 ⌀ | Cofactor stringlengths 38 1.77k ⌀ | Gene Ontology (biological process) stringlengths 18 11.3k ⌀ | Gene Ontology (cellular component) stringlengths 17 1.75k ⌀ | Gene Ontology (molecular function) stringlengths 24 2.09k ⌀ | Pfam stringlengths 8 232 ⌀ | Gene3D stringlengths 10 250 ⌀ | Protein families stringlengths 9 237 ⌀ | Post-translational modification stringlengths 16 8.52k ⌀ | Subcellular location [CC] stringlengths 29 6.18k ⌀ | Catalytic activity stringlengths 64 35.7k ⌀ | Kinetics stringlengths 69 11.7k ⌀ | Pathway stringlengths 27 908 ⌀ | pH dependence stringlengths 64 955 ⌀ | Temperature dependence stringlengths 70 1.16k ⌀ | Function [CC] stringlengths 17 15.3k ⌀ | Organism stringlengths 8 196 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
O88397 | SO1A5_RAT | MGETEKRVATHEVRCFSKIKMFLLALTWAYVSKSLSGIYMNTMLTQIERQFDIPTSIVGFINGSFEIGNLLLIIFVSYFGTKLHRPIMIGVGCVIMGLGCFLMSLPHFLMGRYEYETTISPTSNLSSNSFLCMENRSQTLKPTQDPAECIKEMKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILETGKVFGPIVGLLLGSFCASIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLICAGVNILSSIPFFFFPKTLPKEGLQDDVDGTNNDKEEKHREKAKEENRGITKDFLPFMKSLSCNPIYML... | null | null | animal organ regeneration [GO:0031100]; bile acid and bile salt transport [GO:0015721]; intestinal absorption [GO:0050892]; monoatomic ion transport [GO:0006811]; monocarboxylic acid transport [GO:0015718]; organic anion transport [GO:0015711]; sodium-independent organic anion transport [GO:0043252] | basal plasma membrane [GO:0009925]; basolateral plasma membrane [GO:0016323]; brush border membrane [GO:0031526] | bile acid transmembrane transporter activity [GO:0015125]; monocarboxylic acid transmembrane transporter activity [GO:0008028]; organic anion transmembrane transporter activity [GO:0008514]; sodium-independent organic anion transmembrane transporter activity [GO:0015347]; thyroid hormone transmembrane transporter activ... | PF07648;PF03137; | 1.20.1250.20; | Organo anion transporter (TC 2.A.60) family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:P46721}; Multi-pass membrane protein {ECO:0000305}. Basal cell membrane {ECO:0000250|UniProtKB:P46721}; Multi-pass membrane protein {ECO:0000305}. | CATALYTIC ACTIVITY: Reaction=taurocholate(out) = taurocholate(in); Xref=Rhea:RHEA:71703, ChEBI:CHEBI:36257; Evidence={ECO:0000269|PubMed:11093941, ECO:0000269|PubMed:9712861, ECO:0000305|PubMed:19129463}; CATALYTIC ACTIVITY: Reaction=glycocholate(out) = glycocholate(in); Xref=Rhea:RHEA:71851, ChEBI:CHEBI:29746; Evidenc... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=17.99 uM for taurocholate {ECO:0000269|PubMed:9712861}; KM=20.9 uM for taurocholate {ECO:0000269|PubMed:11093941}; KM=4.93 uM for L-thyroxine {ECO:0000269|PubMed:9712861}; KM=7.33 uM for 3,3',5'-triiodo-L-thyronine {ECO:0000269|PubMed:9712861}; KM=8.8 uM for cholat... | null | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.5 with estrone 3-sulfate, taurocholate, prostaglandin E2 and L-thyroxine (T4) as substrates. {ECO:0000269|PubMed:19129463}; | null | FUNCTION: Na(+)-independent transporter that mediates the cellular uptake of a broad range of organic anions such as the endogenous bile salts cholate and deoxycholate, either in their unconjugated or conjugated forms (taurocholate and glycocholate), estrone 3-sulfate and prostaglandin E2, at the plasma membrane (PubMe... | Rattus norvegicus (Rat) |
O88398 | AVIL_MOUSE | MSLSSAFRAVSNDPRIITWRIEKMELALVPLSAHGNFYEGDCYIVLSTRRVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKKGGVASGMKHVETNTYDVKRLLHVKGKRNIQATEVEMSWDSFNRGDVFLLDLGMVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPGLMTVLQDTLGRRSMIKPAVSDEIMDQQQKSSIMLYHVSDTAGQLSVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKVEKQAAMSKALDFIKMKG... | null | null | actin filament organization [GO:0007015]; actin filament severing [GO:0051014]; actin polymerization or depolymerization [GO:0008154]; barbed-end actin filament capping [GO:0051016]; cilium assembly [GO:0060271]; nervous system development [GO:0007399]; positive regulation of lamellipodium assembly [GO:0010592]; positi... | actin cytoskeleton [GO:0015629]; actin filament [GO:0005884]; axon [GO:0030424]; cell projection [GO:0042995]; cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; lamellipodium [GO:0030027]; neuron projection [GO:0043005] | actin binding [GO:0003779]; actin filament binding [GO:0051015]; Arp2/3 complex binding [GO:0071933]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546] | PF00626;PF02209; | 3.40.20.10;1.10.950.10; | Villin/gelsolin family | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:O75366}. Cell projection, lamellipodium {ECO:0000250|UniProtKB:O75366}. Cell junction, focal adhesion {ECO:0000250|UniProtKB:O75366}. Cell projection, neuron projection {ECO:0000250|UniProtKB:Q9WU06}. Cell projection, axon {ECO:0000250|UniProtKB:Q9WU0... | null | null | null | null | null | FUNCTION: Ca(2+)-regulated actin-binding protein which plays an important role in actin bundling. May have a unique function in the morphogenesis of neuronal cells which form ganglia. Required for SREC1-mediated regulation of neurite-like outgrowth. Plays a role in regenerative sensory axon outgrowth and remodeling pro... | Mus musculus (Mouse) |
O88406 | SMAD7_RAT | MFRTKRSALVRRLWRSRAPGGEDEEEGVGGGGGGGGLRGEGATDGRAYGAGGGGAGRAGCCLGKAVRGAKGHHHPHPPSSGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPASAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSDETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCG... | null | null | adherens junction assembly [GO:0034333]; anatomical structure morphogenesis [GO:0009653]; artery morphogenesis [GO:0048844]; cell differentiation [GO:0030154]; cellular response to leukemia inhibitory factor [GO:1990830]; cellular response to transforming growth factor beta stimulus [GO:0071560]; intracellular signal t... | cytoplasm [GO:0005737]; heteromeric SMAD protein complex [GO:0071144]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991] | activin receptor binding [GO:0070697]; beta-catenin binding [GO:0008013]; collagen binding [GO:0005518]; I-SMAD binding [GO:0070411]; metal ion binding [GO:0046872]; transcription corepressor activity [GO:0003714]; transcription regulator inhibitor activity [GO:0140416]; type I transforming growth factor beta receptor ... | PF03165;PF03166; | 2.60.200.10;3.90.520.10; | Dwarfin/SMAD family | PTM: Phosphorylation on Ser-249 does not affect its stability, nuclear localization or inhibitory function in TGFB signaling; however it affects its ability to regulate transcription (By similarity). Phosphorylated by PDPK1 (By similarity). {ECO:0000250|UniProtKB:O15105, ECO:0000250|UniProtKB:O35253}.; PTM: Ubiquitinat... | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:O15105}. Cytoplasm {ECO:0000250|UniProtKB:O15105}. Note=Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm. TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucle... | null | null | null | null | null | FUNCTION: Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-bet... | Rattus norvegicus (Rat) |
O88407 | LFG2_RAT | MTQGKLSVANKAPGTEGQQQANGEKKDAPAVPSAPPSYEEATSGEGLKAGAFPQGPTAVPLHPSWAYVDPSSSSGYEGGFPAGHHELFSTFSWDDQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTKFDFTSCHGVLFVLLMTLFFSGLLLAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE | null | null | apoptotic signaling pathway [GO:0097190]; cerebellar granular layer development [GO:0021681]; cerebellar Purkinje cell differentiation [GO:0021702]; cerebellar Purkinje cell layer development [GO:0021680]; cerebellum development [GO:0021549]; negative regulation of apoptotic signaling pathway [GO:2001234]; negative reg... | endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]; membrane raft [GO:0045121]; postsynaptic membrane [GO:0045211] | null | PF01027; | null | BI1 family, LFG subfamily | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:12414123}; Multi-pass membrane protein {ECO:0000269|PubMed:12414123}. Membrane raft {ECO:0000250}. Postsynaptic cell membrane {ECO:0000269|PubMed:12414123}. | null | null | null | null | null | FUNCTION: Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. Plays a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development... | Rattus norvegicus (Rat) |
O88410 | CXCR3_MOUSE | MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPALYSLLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAVQWVFGPGLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPRVRVALTCIVVWGLCLLFALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKSVTSGMGYMHCCLNPLLYAFV... | null | null | angiogenesis [GO:0001525]; calcium-mediated signaling [GO:0019722]; cell chemotaxis [GO:0060326]; G protein-coupled receptor signaling pathway [GO:0007186]; immune response [GO:0006955]; inflammatory response [GO:0006954]; negative regulation of execution phase of apoptosis [GO:1900118]; positive regulation of angiogen... | cell surface [GO:0009986]; external side of plasma membrane [GO:0009897]; plasma membrane [GO:0005886] | C-C chemokine binding [GO:0019957]; C-C chemokine receptor activity [GO:0016493]; C-X-C chemokine binding [GO:0019958]; C-X-C chemokine receptor activity [GO:0016494]; signaling receptor activity [GO:0038023] | PF00001; | 1.20.1070.10; | G-protein coupled receptor 1 family | PTM: Sulfation on Tyr-27 and Tyr-29 is essential for CXCL10 binding. {ECO:0000250}.; PTM: N-glycosylated. {ECO:0000250}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. | null | null | null | null | null | FUNCTION: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response (By similarity). Binds to CCL21. Upon activation by PF4, induces activa... | Mus musculus (Mouse) |
O88413 | TULP3_MOUSE | MEAARCAPGPRGDSAFDDETLRLRQLKLDNQRALLEKKQRKKRLEPLMVQPNPEARLRRLKPRGSEEHTPLVDPQMPRSDVILHGIDGPAAFLKPEAQDLESKPQVLSVGSPAPEEGTEGSADGESPEETAPKPDLQEILQKHGILSSVNYDEEPDKEEDEGGNLSSPSARSEESAAASQKAASETGASGVTAQQGDAQLGEVENLEDFAYSPAPRGVTVKCKVTRDKKGMDRGLFPTYYMHLEREENRKIFLLAGRKRKKSKTSNYLVSTDPTDLSREGESYIGKLRSNLMGTKFTVYDHGVNPVKAQGLVEKAHTRQE... | null | null | anterior/posterior pattern specification [GO:0009952]; bone development [GO:0060348]; brain development [GO:0007420]; bronchus morphogenesis [GO:0060434]; central nervous system neuron differentiation [GO:0021953]; dorsal/ventral neural tube patterning [GO:0021904]; embryonic camera-type eye development [GO:0031076]; e... | 9+0 non-motile cilium [GO:0097731]; axoneme [GO:0005930]; ciliary base [GO:0097546]; cilium [GO:0005929]; extracellular region [GO:0005576]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886] | enzyme binding [GO:0019899]; G protein-coupled receptor binding [GO:0001664]; intraciliary transport particle A binding [GO:0120160]; phosphatidylinositol binding [GO:0035091]; protein-containing complex binding [GO:0044877] | PF01167;PF16322; | null | TUB family | null | SUBCELLULAR LOCATION: Nucleus. Cell membrane. Cell projection, cilium. Cytoplasm. Secreted. Note=Translocates from the plasma membrane to the nucleus upon activation of guanine nucleotide-binding protein G(q) subunit alpha (By similarity). Does not have a cleavable signal peptide and is secreted by a non-conventional p... | null | null | null | null | null | FUNCTION: Negative regulator of the Shh signaling transduction pathway: recruited to primary cilia via association with the IFT complex A (IFT-A) and is required for recruitment of G protein-coupled receptor GPR161 to cilia, a promoter of PKA-dependent basal repression machinery in Shh signaling. Binds to phosphorylate... | Mus musculus (Mouse) |
O88419 | B4GT6_RAT | MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYSPHLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIEPGGHWRPQDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYSGYNVTRPEGDLGKYTS... | 2.4.1.-; 2.4.1.274 | COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000269|PubMed:9593693}; Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:9593693}; Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000269|PubMed:9593693}; | carbohydrate metabolic process [GO:0005975]; central nervous system myelination [GO:0022010]; central nervous system neuron axonogenesis [GO:0021955]; ganglioside biosynthetic process via lactosylceramide [GO:0010706]; glycosphingolipid biosynthetic process [GO:0006688]; glycosylation [GO:0070085]; lactosylceramide bio... | Golgi apparatus [GO:0005794]; Golgi cisterna membrane [GO:0032580] | galactosyltransferase activity [GO:0008378]; metal ion binding [GO:0046872]; UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity [GO:0008489] | PF02709;PF13733; | null | Glycosyltransferase 7 family | null | SUBCELLULAR LOCATION: Golgi apparatus, Golgi stack membrane {ECO:0000250|UniProtKB:P15291}; Single-pass type II membrane protein. Note=Trans cisternae of Golgi stack. {ECO:0000250|UniProtKB:P15291}. | CATALYTIC ACTIVITY: Reaction=a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + UDP-alpha-D-galactose = a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + H(+) + UDP; Xref=Rhea:RHEA:31495, ChEBI:CHEBI:15378, ChEBI:CHEBI:17950, ChEBI:CHEBI:22801, ChEBI:CHEBI:58223, ChEBI:CHEBI:66914; EC=2.4.1.274; Evidence={ECO:0000... | null | PATHWAY: Protein modification; protein glycosylation.; PATHWAY: Sphingolipid metabolism. | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.2. {ECO:0000269|PubMed:9593693}; | null | FUNCTION: Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (PubMed:9593693). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal m... | Rattus norvegicus (Rat) |
O88420 | SCN8A_RAT | MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNPPEWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKTNFYMVPGMLE... | null | null | adult walking behavior [GO:0007628]; locomotory behavior [GO:0007626]; membrane depolarization during action potential [GO:0086010]; muscle organ development [GO:0007517]; myelination [GO:0042552]; nerve development [GO:0021675]; neuronal action potential [GO:0019228]; optic nerve development [GO:0021554]; peripheral n... | axon [GO:0030424]; axon initial segment [GO:0043194]; dendrite [GO:0030425]; glutamatergic synapse [GO:0098978]; membrane [GO:0016020]; neuronal cell body [GO:0043025]; node of Ranvier [GO:0033268]; parallel fiber to Purkinje cell synapse [GO:0098688]; postsynaptic density membrane [GO:0098839]; presynaptic active zone... | ATP binding [GO:0005524]; sodium ion binding [GO:0031402]; voltage-gated sodium channel activity [GO:0005248] | PF00520;PF00612;PF06512;PF11933; | 1.10.287.70;1.10.238.10;1.20.5.1190;1.20.120.350; | Sodium channel (TC 1.A.1.10) family, Nav1.6/SCN8A subfamily | PTM: May be ubiquitinated by NEDD4L; which would promote its endocytosis. {ECO:0000250}.; PTM: Phosphorylation at Ser-1495 by PKC in a highly conserved cytoplasmic loop slows inactivation of the sodium channel and reduces peak sodium currents. {ECO:0000250}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:9603190}; Multi-pass membrane protein {ECO:0000250|UniProtKB:D0E0C2}. Cell projection, axon {ECO:0000250|UniProtKB:Q9WTU3}. Note=Mainly localizes to the axon initial segment. {ECO:0000250|UniProtKB:Q9WTU3}. | null | null | null | null | null | FUNCTION: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. {E... | Rattus norvegicus (Rat) |
O88422 | GALT5_RAT | MNKIRKFFRGSGRVLAFIFVASVIWLLFDMAALRLSFSEINTGILKEDIMRREQTGFRVEADQMTILSPSSRGMRPPRNGAGGKESFRKAENRVLKVEENVDQVQRKGKMQFLLGRGKAVSLWHRTHVQTLPVTLPMQKTQGRDSKPEVSSLHMMSKQTTVLGSEKDSFTVSRGVPLNKTAEHTETLDKKQEAPENYNLSSDTSKQASQRALNVTISVRTDRSKQQSQTVTKSSIQFASLPILKPEEVTVTKKTEAQGKDLKYEAHKARPLLKFTADVGHLKKQSTNETGLGVLPEADGAKVAPGKKLNFSESQIVIITK... | 2.4.1.41 | COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; | protein O-linked glycosylation [GO:0006493] | Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139] | carbohydrate binding [GO:0030246]; metal ion binding [GO:0046872]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653] | PF00535;PF00652; | 2.80.10.50; | Glycosyltransferase 2 family, GalNAc-T subfamily | null | SUBCELLULAR LOCATION: Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. | CATALYTIC ACTIVITY: Reaction=L-seryl-[protein] + UDP-N-acetyl-alpha-D-galactosamine = 3-O-[N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein] + H(+) + UDP; Xref=Rhea:RHEA:23956, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:12788, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:53604, ChEBI:CHEBI:58223, ChEBI:CHEBI:67138; EC=2... | null | PATHWAY: Protein modification; protein glycosylation. | null | null | FUNCTION: Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward EA2 peptide substrate, but has a weak activity toward Muc2, Muc1b, rMuc-2 or mG-Muc substrates. | Rattus norvegicus (Rat) |
O88427 | CAC1H_MOUSE | MTEGTLAADEVRVPLGASPSAPAAPVRASPASPGVPGREEQRGSGSSVLAPESPGTECGADLGADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVSRRWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEENPFICSSRRDNGMQKCSHIPSRRELRVQCTLGWE... | null | null | aldosterone biosynthetic process [GO:0032342]; calcium ion import [GO:0070509]; calcium ion transport [GO:0006816]; cortisol biosynthetic process [GO:0034651]; inorganic cation transmembrane transport [GO:0098662]; membrane depolarization during action potential [GO:0086010]; neuronal action potential [GO:0019228]; pos... | caveola [GO:0005901]; dendrite [GO:0030425]; glutamatergic synapse [GO:0098978]; neuron projection [GO:0043005]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; presynaptic active zone membrane [GO:0048787]; sarcolemma [GO:0042383]; voltage-gated calcium channel complex [GO:00... | low voltage-gated calcium channel activity [GO:0008332]; metal ion binding [GO:0046872]; voltage-gated monoatomic ion channel activity [GO:0005244]; voltage-gated sodium channel activity [GO:0005248] | PF00520; | 1.10.287.70;1.20.120.350; | Calcium channel alpha-1 subunit (TC 1.A.1.11) family, CACNA1H subfamily | PTM: In response to raising of intracellular calcium, the T-type channels are activated by CaM-kinase II. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:O95180}; Multi-pass membrane protein {ECO:0000250|UniProtKB:O95180}. Note=Interaction with STAC increases expression at the cell membrane. {ECO:0000250|UniProtKB:O95180}. | null | null | null | null | null | FUNCTION: Voltage-sensitive calcium channel that gives rise to T-type calcium currents. T-type calcium channels belong to the 'low-voltage activated (LVA)' group. A particularity of this type of channel is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking fu... | Mus musculus (Mouse) |
O88428 | PAPS2_MOUSE | MSANFKMNHKRDQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNKNLGFSAGDREENIRRIAEVARLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPECVLKTNLSSVSDCVQQVVELLQEQNIVPHTTIKGIHELFVPENKVDQIRAEAETLPSLPITKLDLQWVQILSEGWATPLKGFMREKEYLQTLHFDTLLDGVVPRDGVINMSIPIVLPVSADDKARLEGCS... | 2.7.1.25; 2.7.7.4 | null | 3'-phosphoadenosine 5'-phosphosulfate biosynthetic process [GO:0050428]; blood coagulation [GO:0007596]; bone development [GO:0060348]; hormone metabolic process [GO:0042445]; phosphorylation [GO:0016310]; sulfate assimilation [GO:0000103] | cytosol [GO:0005829] | adenylylsulfate kinase activity [GO:0004020]; ATP binding [GO:0005524]; nucleotidyltransferase activity [GO:0016779]; sulfate adenylyltransferase (ATP) activity [GO:0004781] | PF01583;PF01747;PF14306; | 3.40.50.620;3.40.50.300;3.10.400.10; | APS kinase family; Sulfate adenylyltransferase family | null | null | CATALYTIC ACTIVITY: Reaction=ATP + H(+) + sulfate = adenosine 5'-phosphosulfate + diphosphate; Xref=Rhea:RHEA:18133, ChEBI:CHEBI:15378, ChEBI:CHEBI:16189, ChEBI:CHEBI:30616, ChEBI:CHEBI:33019, ChEBI:CHEBI:58243; EC=2.7.7.4; Evidence={ECO:0000269|PubMed:10559207}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:181... | null | PATHWAY: Sulfur metabolism; sulfate assimilation. {ECO:0000305|PubMed:10559207}. | null | null | FUNCTION: Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yield... | Mus musculus (Mouse) |
O88436 | PAX4_RAT | MQQDGLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPAVVARIAQLKDEYPALFAWEIQRQLCAEGLCTQDKAPSVSSINRVLRALQEDQRLHWTQLRSPAVLAPALPSPHSNCEAPRGPHPGTSHRNRTIFSPGQAEALEKEFQRGQYPDSVVRGKLAAATSLPEDTVRVWFSNRRAKWRRQEKLKWETQMPGASQDLMVPKDSPGIISAQQSPGSVPSAALPVLEQLNPSFCQLCWGAVPDRCSSDTTSQACLQPYWECHSLLPVASSSYMEF... | null | null | circadian rhythm [GO:0007623]; negative regulation of apoptotic process [GO:0043066]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of epithelial cell differentiation [GO:0030858]; regulation of cell different... | nucleus [GO:0005634] | DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; double-stranded DNA binding [GO:0003690]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978... | PF00046;PF00292; | 1.10.10.60;1.10.10.10; | Paired homeobox family | null | SUBCELLULAR LOCATION: Nucleus. | null | null | null | null | null | FUNCTION: Plays an important role in the differentiation and development of pancreatic islet beta cells. Transcriptional repressor that competes with PAX6 in binding to a common element in the glucagon, insulin and somatostatin promoters (By similarity). {ECO:0000250}. | Rattus norvegicus (Rat) |
O88444 | ADCY1_MOUSE | MAGAPRGQGGGGGAGEPGGAERAAGPGGRRGFRACGEEFACPELEALFRGYTLRLEQAATLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCILFLALFVVTNVRSLQVSQLQQVGQLALFFSLTFALLCCPFALGGPARSSAGGAMGSTVAEQGVWQLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTAALVPAKRPRLWRTLGANALLFFGVNMYGVFVRILTERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTA... | 4.6.1.1 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProtKB:P19754}; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P19754}; Note=Binds 2 magnesium ions per subunit. Is also active with manganese (in vitro). {ECO:0000250|UniProtKB:P30803}; | adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; axonogenesis [GO:0007409]; cAMP biosynthetic process [GO:0006171]; cAMP-mediated signaling [GO:0019933]; cellular response to calcium ion [GO:0071277]; cellular response to forskolin [GO:1904322]; circadian rhythm [GO:0007623]; long... | cytoplasm [GO:0005737]; glutamatergic synapse [GO:0098978]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; postsynaptic density membrane [GO:0098839]; presynapse [GO:0098793]; Schaffer collateral - CA1 synapse [GO:0098685... | adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; calcium- and calmodulin-responsive adenylate cyclase activity [GO:0008294]; calmodulin binding [GO:0005516]; metal ion binding [GO:0046872] | PF16214;PF00211; | 3.30.70.1230; | Adenylyl cyclase class-4/guanylyl cyclase family | PTM: N-glycosylated. {ECO:0000250|UniProtKB:P19754}. | SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:9662407}; Multi-pass membrane protein {ECO:0000305}. Cell membrane {ECO:0000250|UniProtKB:P19754}; Multi-pass membrane protein {ECO:0000250|UniProtKB:P19754}. Cytoplasm {ECO:0000269|PubMed:24482543}. Membrane raft {ECO:0000250|UniProtKB:P19754}. Note=Expressed in the c... | CATALYTIC ACTIVITY: Reaction=ATP = 3',5'-cyclic AMP + diphosphate; Xref=Rhea:RHEA:15389, ChEBI:CHEBI:30616, ChEBI:CHEBI:33019, ChEBI:CHEBI:58165; EC=4.6.1.1; Evidence={ECO:0000269|PubMed:9662407}; | null | null | null | null | FUNCTION: Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling. Mediates responses to increased cellular Ca(2+)/calmodulin levels (PubMed:7816821, PubMed:9662407). May be involved in regulatory processes in the central nervous system (PubMed:9662407). May play a role in memory and l... | Mus musculus (Mouse) |
O88445 | AURKC_MOUSE | MEPSTSTRKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVLPC | 2.7.11.1 | null | cell division [GO:0051301]; meiotic cell cycle [GO:0051321]; mitotic spindle organization [GO:0007052]; protein phosphorylation [GO:0006468]; regulation of cytokinesis [GO:0032465] | chromosome [GO:0005694]; chromosome passenger complex [GO:0032133]; chromosome, centromeric region [GO:0000775]; condensed chromosome [GO:0000793]; cytoplasm [GO:0005737]; kinetochore [GO:0000776]; meiotic spindle midzone [GO:1990385]; midbody [GO:0030496]; nucleus [GO:0005634]; spindle microtubule [GO:0005876]; spindl... | ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00069; | 1.10.510.10; | Protein kinase superfamily, Ser/Thr protein kinase family, Aurora subfamily | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. Chromosome {ECO:0000250}. Chromosome, centromere {ECO:0000250|UniProtKB:Q9UQB9}. Cytoplasm, cytoskeleton, spindle {ECO:0000250|UniProtKB:Q9UQB9}. Note=Distributes in the condensed chromosomes during prophase to metaphase. After entering anaphase, there is a dissociation from... | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[pr... | null | null | null | null | FUNCTION: Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabiliz... | Mus musculus (Mouse) |
O88446 | S22A3_RAT | MPTFDQALRKAGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGSQPDYYWCRGPRATALAERCAWSPEEEWNLTTPELHVPAERRGQGHCHRYLLEDTNTSSELSCDPLAAFPNRSAPLVPCSGDWRYVETHSTIVSQFDLVCGNAWMLDLTQAILNLGFLAGAFTLGYAADRYGRLIVYLISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKALQILRRVAKCNGKHLSSNYSE... | null | null | dopamine transport [GO:0015872]; dopamine uptake [GO:0090494]; epinephrine transport [GO:0048241]; epinephrine uptake [GO:0051625]; establishment of localization in cell [GO:0051649]; histamine transport [GO:0051608]; histamine uptake [GO:0051615]; monoamine transport [GO:0015844]; monocarboxylic acid transport [GO:001... | apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; endomembrane system [GO:0012505]; mitochondrial membrane [GO:0031966]; neuronal cell body [GO:0043025]; nuclear outer membrane [GO:0005640]; plasma membrane [GO:0005886]; presynapse [GO:0098793] | dopamine:sodium symporter activity [GO:0005330]; monoamine transmembrane transporter activity [GO:0008504]; neurotransmitter transmembrane transporter activity [GO:0005326]; organic anion transmembrane transporter activity [GO:0008514]; organic cation transmembrane transporter activity [GO:0015101]; quaternary ammonium... | PF00083; | 1.20.1250.20; | Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:27659446}; Multi-pass membrane protein {ECO:0000305}. Apical cell membrane {ECO:0000269|PubMed:15817714}; Multi-pass membrane protein {ECO:0000305}. Basolateral cell membrane {ECO:0000250|UniProtKB:O75751}; Multi-pass membrane protein {ECO:0000305}. Mitochondrion ... | CATALYTIC ACTIVITY: Reaction=(R)-noradrenaline(out) = (R)-noradrenaline(in); Xref=Rhea:RHEA:73871, ChEBI:CHEBI:72587; Evidence={ECO:0000269|PubMed:16581093}; CATALYTIC ACTIVITY: Reaction=(R)-adrenaline(out) = (R)-adrenaline(in); Xref=Rhea:RHEA:73875, ChEBI:CHEBI:71406; Evidence={ECO:0000269|PubMed:16581093}; CATALYTIC ... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=500 uM for serotonin {ECO:0000269|PubMed:16581093}; KM=900 uM for agmatine {ECO:0000269|PubMed:12538837}; KM=1900 uM for noradrenaline {ECO:0000269|PubMed:16581093}; KM=1500 uM for adrenaline {ECO:0000269|PubMed:16581093}; KM=1500 uM for dopamine {ECO:0000269|PubMe... | null | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.5 for MPP(+) uptake (PubMed:9830022). Optimum pH is 8.5 for TEA uptake (PubMed:9632645). {ECO:0000269|PubMed:9632645, ECO:0000269|PubMed:9830022}; | null | FUNCTION: Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:12538837, PubMed:16581093, PubMed:23458604, PubMed:9830022). Cation cellular uptake or release is driven by the electrochemical pot... | Rattus norvegicus (Rat) |
O88447 | KLC1_MOUSE | MYDNMSTMVYIKEEKLENVTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQNVRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLFPNDEDEPGQGIQHSDSSAAAARQGYEIPARLRTLHNLVIQYASQGRYEVAVPSCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKR... | null | null | axo-dendritic transport [GO:0008088]; cell adhesion [GO:0007155]; intracellular protein transport [GO:0006886]; microtubule-based movement [GO:0007018]; protein localization to synapse [GO:0035418]; stress granule disassembly [GO:0035617] | axon [GO:0030424]; ciliary rootlet [GO:0035253]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; growth cone [GO:0030426]; kinesin complex [GO:0005871]; membrane [GO:0016020]; membrane-bounded organelle [GO:0043227]; microtubule [GO:0005874]; neuron projection [GO:0043005]; neuronal cell... | kinesin binding [GO:0019894]; tubulin binding [GO:0015631] | PF13374;PF13424; | 1.25.40.10; | Kinesin light chain family | PTM: Phosphorylation at Ser-459 by ERK inhibits interaction with CLSTN1 and localization to cytoplasmic vesicles. {ECO:0000250|UniProtKB:Q07866}. | SUBCELLULAR LOCATION: Cell projection, growth cone {ECO:0000250|UniProtKB:P37285}. Cytoplasmic vesicle {ECO:0000250|UniProtKB:P37285}. Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:P37285}. | null | null | null | null | null | FUNCTION: Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity. {ECO:0000250|UniProtKB:P37285}. | Mus musculus (Mouse) |
O88448 | KLC2_MOUSE | MATMVLPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEMLPQEEKGDVPKDSLDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHP... | null | null | axo-dendritic transport [GO:0008088]; lysosome localization [GO:0032418]; microtubule-based movement [GO:0007018] | ciliary rootlet [GO:0035253]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; kinesin complex [GO:0005871]; lysosomal membrane [GO:0005765]; microtubule [GO:0005874]; neuron projection [GO:0043005] | kinesin binding [GO:0019894] | PF13374;PF13424; | 1.25.40.10; | Kinesin light chain family | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:Q9H0B6}. Lysosome membrane {ECO:0000250|UniProtKB:Q9H0B6}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q9H0B6}; Cytoplasmic side {ECO:0000250|UniProtKB:Q9H0B6}. | null | null | null | null | null | FUNCTION: Kinesin is a microtubule-associated force-producing protein that plays a role in organelle transport. The light chain functions in coupling of cargo to the heavy chain or in the modulation of its ATPase activity. Through binding with PLEKHM2 and ARL8B, recruits kinesin-1 to lysosomes and hence direct lysosome... | Mus musculus (Mouse) |
O88450 | DEAF1_RAT | MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAESEAEEPVLSRDEDSEEDADSEAERETRRVTAVAVMAAESGHMDMGTEALPSPDEAAAAAAFAEVTTVTVANVGSSADNVFTTSVANAASISGHVLSGRTALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKSRLGSGGRGRCIKQGENWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDDMTLSGPVRLFVPYKRRKKENELPTTPVKKDSPK... | null | null | behavioral fear response [GO:0001662]; embryonic skeletal system development [GO:0048706]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neural tube closure [GO:0001843]; positive regulation of DNA-templated transcription [GO:004... | cytoplasm [GO:0005737]; extracellular region [GO:0005576]; nucleus [GO:0005634]; RNA polymerase II transcription regulator complex [GO:0090575] | DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977] | PF01342;PF01753; | 6.10.140.2220;3.10.390.10; | null | PTM: May be phosphorylated by DNA-PK complex in a DNA independent manner (in vitro). {ECO:0000250}. | SUBCELLULAR LOCATION: Nucleus. Secreted. Note=Secreted in some cell types. | null | null | null | null | null | FUNCTION: Transcription factor that binds to sequence with multiple copies of 5'-TTC[CG]G-3' present in its own promoter and that of the HNRPA2B1 gene. Down-regulates transcription of these genes. Binds to the retinoic acid response element (RARE) 5'-AGGGTTCACCGAAAGTTCA-3'. Activates the proenkephalin gene independentl... | Rattus norvegicus (Rat) |
O88452 | STC2_MOUSE | MCAERLGQFVTLALVFATLDPAQGTDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR | null | null | calcium ion homeostasis [GO:0055074]; cellular response to hypoxia [GO:0071456]; decidualization [GO:0046697]; embryo implantation [GO:0007566]; endoplasmic reticulum unfolded protein response [GO:0030968]; intracellular calcium ion homeostasis [GO:0006874]; negative regulation of gene expression [GO:0010629]; negative... | endoplasmic reticulum [GO:0005783]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; perinuclear region of cytoplasm [GO:0048471] | enzyme binding [GO:0019899]; heme binding [GO:0020037]; hormone activity [GO:0005179]; protein homodimerization activity [GO:0042803] | PF03298; | null | Stanniocalcin family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. | null | null | null | null | null | FUNCTION: Has an anti-hypocalcemic action on calcium and phosphate homeostasis. | Mus musculus (Mouse) |
O88453 | SAFB1_RAT | MAETLSGLGDSGAASAAAVSSAASETGTRRLSDLRVIDLRAELRKRNLTSSGNKSVLMERLKKAIEEEGGNPDEIEVISEGNKKMPKRPSKGKKPEDEGVEDNGLEENSGDGQEDVETSLENLQDMDMMDISVLDEADIDNGSVADCVEEEEEATLPEGLGLLRIGRLQSKGLPEQLQELAIDDKEAINNVDTSSSDFTILQEMEEASLEPENEKILDILGETCKSEPVKEEGSELEQPFAQATSSVGPDRKLAEEEDLFESCGHPEEEEEEEEEEEQEEEQEEEGDLALASSSKSESSSTRCQWSEADALLAVVKREPA... | null | null | hormone metabolic process [GO:0042445]; intracellular estrogen receptor signaling pathway [GO:0030520]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of growth [GO:0040008]; regulation of mRNA processing [GO:0050684]; regulation of transcription by RNA polymerase II [GO:0006357] | nucleus [GO:0005634] | chromatin binding [GO:0003682]; RNA binding [GO:0003723]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565] | PF00076;PF02037; | 3.30.70.330;1.10.720.30; | null | PTM: Phosphorylated by CDC-like kinase 2 (CLK2). {ECO:0000269|PubMed:11118435}.; PTM: Sumoylated by PIAS1 with SUMO1 and SUMO2/3, desumoylated by SENP1. Sumoylation is required for transcriptional repressor activity. {ECO:0000250|UniProtKB:Q15424}. | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:9671816}. | null | null | null | null | null | FUNCTION: Binds to scaffold/matrix attachment region (S/MAR) DNA and forms a molecular assembly point to allow the formation of a 'transcriptosomal' complex (consisting of SR proteins and RNA polymerase II) coupling transcription and RNA processing (By similarity). Functions as an estrogen receptor corepressor and can ... | Rattus norvegicus (Rat) |
O88454 | KCNK4_MOUSE | MRSTTLLALLALVLLYLVSGALVFQALEQPHEQQAQKKMDHGRDQFLRDHPCVSQKSLEDFIKLLVEALGGGANPETSWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIVLHTDAGRLFCIFYALVGIPLFGMLLAGVGDRLGSSLRRGIGHIEAIFLKWHVPPGLVRSLSAVLFLLIGCLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGTGQNSPAYQPLVWFWILFGLAYFASVLTTIGNWLRAVSRRTRAEMGGLTAQAASWTGTVTARVTQRTGPSAPPPEKEQPLLPSSLPAPPAVVEPAG... | null | null | cellular response to alkaline pH [GO:0071469]; cellular response to fatty acid [GO:0071398]; cellular response to temperature stimulus [GO:0071502]; detection of mechanical stimulus involved in sensory perception of touch [GO:0050976]; potassium ion transmembrane transport [GO:0071805]; sensory perception of pain [GO:0... | plasma membrane [GO:0005886]; potassium channel complex [GO:0034705] | mechanosensitived potassium channel activity [GO:0098782]; outward rectifier potassium channel activity [GO:0015271]; potassium channel activity [GO:0005267]; potassium ion leak channel activity [GO:0022841]; temperature-gated cation channel activity [GO:0097604] | PF07885; | 1.10.287.70; | Two pore domain potassium channel (TC 1.A.1.8) family | PTM: N-glycosylated. {ECO:0000250|UniProtKB:Q9NYG8}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:9628867}; Multi-pass membrane protein {ECO:0000305}. | null | null | null | null | null | FUNCTION: Voltage-insensitive potassium channel (PubMed:9628867). Channel opening is triggered by mechanical forces that deform the membrane. Channel opening is triggered by raising the intracellular pH to basic levels (By similarity). The channel is inactive at 24 degrees Celsius (in vitro); raising the temperature to... | Mus musculus (Mouse) |
O88455 | DHCR7_MOUSE | MASKSQHNAPKVKSPNGKAGSQGQWGRAWEVDWFSLASIIFLLLFAPFIVYYFIMACDQYSCSLTAPALDIATGHASLADIWAKTPPVTAKAAQLYALWVSFQVLLYSWLPDFCHRFLPGYVGGVQEGAITPAGVVNKYEVNGLQAWLITHILWFVNAYLLSWFSPTIIFDNWIPLLWCANILGYAVSTFAMIKGYLFPTSAEDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTLINLSFAAKQQELYGHVTNSMILVNVLQAIYVLDFFWNETWYLKTIDICHDHFGWYLGWGDCVWLPYLYTLQGLY... | 1.3.1.21 | null | blood vessel development [GO:0001568]; brassinosteroid biosynthetic process [GO:0016132]; cholesterol biosynthetic process [GO:0006695]; lung development [GO:0030324]; lung epithelial cell differentiation [GO:0060487]; multicellular organism growth [GO:0035264]; post-embryonic development [GO:0009791]; regulation of ce... | endoplasmic reticulum membrane [GO:0005789] | 7-dehydrocholesterol reductase activity [GO:0047598]; NADP binding [GO:0050661] | PF01222; | 1.20.120.1630; | ERG4/ERG24 family | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q9UBM7}; Multi-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=cholesterol + NADP(+) = 7-dehydrocholesterol + H(+) + NADPH; Xref=Rhea:RHEA:23984, ChEBI:CHEBI:15378, ChEBI:CHEBI:16113, ChEBI:CHEBI:17759, ChEBI:CHEBI:57783, ChEBI:CHEBI:58349; EC=1.3.1.21; Evidence={ECO:0000305|PubMed:11230174}; PhysiologicalDirection=right-to-left; Xref=Rhea:RHEA:23986; ... | null | PATHWAY: Steroid biosynthesis; cholesterol biosynthesis. {ECO:0000269|PubMed:11230174}. | null | null | FUNCTION: 7-dehydrocholesterol reductase of the cholesterol biosynthetic pathway reducing the C7-C8 double bond of cholesta-5,7-dien-3beta-ol (7-dehydrocholesterol/7-DHC) and cholesta-5,7,24-trien-3beta-ol, two intermediates in that pathway. {ECO:0000269|PubMed:11230174}. | Mus musculus (Mouse) |
O88457 | SCNBA_RAT | MEERYYPVIFPDERNFRPFTSDSLAAIEKRIAIQKERKKSKDKAAAEPQPRPQLDLKASRKLPKLYGDIPPELVAKPLEDLDPFYKDHKTFMVLNKKRTIYRFSAKRALFILGPFNPLRSLMIRISVHSVFSMFIICTVIINCMFMANSMERSFDNDIPEYVFIGIYILEAVIKILARGFIVDEFSFLRDPWNWLDFIVIGTAIATCFPGSQVNLSALRTFRVFRALKAISVISGLKVIVGALLRSVKKLVDVMVLTLFCLSIFALVGQQLFMGILNQKCIKHNCGPNPASNKDCFEKEKDSEDFIMCGTWLGSRPCPNG... | null | null | action potential [GO:0001508]; action potential initiation [GO:0099610]; acute inflammatory response [GO:0002526]; artery development [GO:0060840]; axonogenesis [GO:0007409]; behavioral response to acetic acid induced pain [GO:0061367]; behavioral response to formalin induced pain [GO:0061368]; behavioral response to p... | axon [GO:0030424]; axonal growth cone [GO:0044295]; C-fiber [GO:0044299]; cell body [GO:0044297]; glutamatergic synapse [GO:0098978]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; presynaptic membrane [GO:0042734]; voltage-gated sodium channel complex [GO:0001518] | voltage-gated sodium channel activity [GO:0005248] | PF00520;PF06512; | 1.10.287.70;1.10.238.10;1.20.5.1190;1.20.120.350; | Sodium channel (TC 1.A.1.10) family, Nav1.9/SCN11A subfamily | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:10196578}; Multi-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=Na(+)(in) = Na(+)(out); Xref=Rhea:RHEA:34963, ChEBI:CHEBI:29101; Evidence={ECO:0000269|PubMed:10196578}; | null | null | null | null | FUNCTION: Sodium channel mediating the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which sodium ions may pass in accordance with their electrochem... | Rattus norvegicus (Rat) |
O88466 | ZN106_MOUSE | MVRERKCILCHIVYGSKKEMDEHMRSMLHHRELENLKGRDISHECRVCRVTEVGLSAYAKHISGQLHKDNVDAQEREDDGKEEEEEEYFDKELVQLIQERKEQSRQDEPPSNSQEVNSDDRQPQWRREDRIPYQDRESYSQPPRHHRGPPQRDWKWEKDGFNSTRKNSFPHSLRNSGGPRGSSVWHKGATRGSSTWFLNHSNSGGGWHSNNGMVDWNYNGTGRNSSWHSEGTGGFPSWHMNNSNGNWKSSVRGTNSWNYNGLGDKFQQGRNRNPNYQMEDMTKMWNKKSNKPSKYSQERCKWQRQDRDKAAKYRSPPEGY... | null | null | insulin receptor signaling pathway [GO:0008286] | cytosol [GO:0005829]; membrane [GO:0016020]; nuclear speck [GO:0016607]; nucleolus [GO:0005730] | metal ion binding [GO:0046872]; opioid peptide activity [GO:0001515]; RNA binding [GO:0003723]; SH3 domain binding [GO:0017124] | PF00400; | 2.130.10.10; | null | PTM: Phosphorylated by FYN in vitro. {ECO:0000269|PubMed:9507006}. | SUBCELLULAR LOCATION: Nucleus, nucleolus {ECO:0000269|PubMed:15833274, ECO:0000269|PubMed:27418600, ECO:0000269|PubMed:28072389, ECO:0000269|PubMed:9507006}. Nucleus speckle {ECO:0000269|PubMed:27418600, ECO:0000269|PubMed:28072389}. Note=Colocalizes with RBM39 in nuclear speckles. Inhibition of RNA synthesis, or overe... | null | null | null | null | null | FUNCTION: RNA-binding protein (PubMed:27418600, PubMed:28072389). Specifically binds to 5'-GGGGCC-3' sequence repeats in RNA (PubMed:28072389). Essential for maintenance of peripheral motor neuron and skeletal muscle function (PubMed:26604141, PubMed:27418600, PubMed:28072389). Required for normal expression and/or alt... | Mus musculus (Mouse) |
O88470 | FOXL2_MOUSE | MMASYPEPEDTAGTLLAPESGRAVKEAEASPPSPGKGGGTTPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGSGGAAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQ... | null | null | anatomical structure morphogenesis [GO:0009653]; apoptotic DNA fragmentation [GO:0006309]; cell differentiation [GO:0030154]; embryonic eye morphogenesis [GO:0048048]; extraocular skeletal muscle development [GO:0002074]; female gonad development [GO:0008585]; female somatic sex determination [GO:0019101]; granulosa ce... | Flemming body [GO:0090543]; nucleoplasm [GO:0005654]; nucleus [GO:0005634] | cysteine-type endopeptidase regulator activity involved in apoptotic process [GO:0043028]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II... | PF00250; | 1.10.10.10; | null | PTM: Sumoylated with SUMO1; sumoylation is required for transcriptional repression activity. {ECO:0000250}. | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00089, ECO:0000269|PubMed:19797124}. | null | null | null | null | null | FUNCTION: Transcriptional regulator. Critical factor essential for ovary differentiation and maintenance, and repression of the genetic program for somatic testis determination. Prevents trans-differentiation of ovary to testis through transcriptional repression of the Sertoli cell-promoting gene SOX9. Has apoptotic ac... | Mus musculus (Mouse) |
O88477 | IF2B1_MOUSE | MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQITQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTL... | null | null | CRD-mediated mRNA stabilization [GO:0070934]; dendrite arborization [GO:0140059]; mRNA transport [GO:0051028]; negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay [GO:1900152]; negative regulation of translation [GO:0017148]; nervous system development [GO:0007399]; neuronal... | axon [GO:0030424]; CRD-mediated mRNA stability complex [GO:0070937]; cytoplasm [GO:0005737]; cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; filopodium [GO:0030175]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; neuronal cell body [GO:0043025];... | mRNA 3'-UTR binding [GO:0003730]; mRNA 5'-UTR binding [GO:0048027]; mRNA binding [GO:0003729]; N6-methyladenosine-containing RNA reader activity [GO:1990247]; translation regulator activity [GO:0045182] | PF00013;PF00076; | 3.30.310.210;3.30.70.330;3.30.1370.10; | RRM IMP/VICKZ family | PTM: Phosphorylated. Phosphorylation may impair association with ACTB mRNA and hence abolishes translational repression (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Cytoplasm, perinuclear region {ECO:0000250}. Cytoplasm, P-body {ECO:0000250|UniProtKB:Q9NZI8}. Cytoplasm, Stress granule {ECO:0000250|UniProtKB:Q9NZI8}. Cell projection, lamellipodium {ECO:0000250}. Cell projection, dendrite {ECO:0000250}. Cell projection, dendritic spine {ECO:... | null | null | null | null | null | FUNCTION: RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from end... | Mus musculus (Mouse) |
O88480 | CABIN_RAT | MIRIAALNASSTIEDDHEGSFKSHKIQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEARLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLDSTDVNLWYKIGHVALRLIRLPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYFICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSVHEVSVNAAETQAIVDEALGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDLSDYQDPSQLLAPSIVVTPVS... | null | null | negative regulation of apoptotic process [GO:0043066]; nucleosome assembly [GO:0006334]; response to activity [GO:0014823] | cytoplasm [GO:0005737]; HIR complex [GO:0000417]; nucleus [GO:0005634] | nucleosome binding [GO:0031491]; protein domain specific binding [GO:0019904]; protein phosphatase 2B binding [GO:0030346]; protein phosphatase inhibitor activity [GO:0004864] | PF09047; | 1.25.40.10; | null | PTM: Activated through PKC-mediated hyperphosphorylation. {ECO:0000250}. | SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. Cytoplasm {ECO:0000269|PubMed:9660798}. | null | null | null | null | null | FUNCTION: May be required for replication-independent chromatin assembly (By similarity). May serve as a negative regulator of T-cell receptor (TCR) signaling via inhibition of calcineurin. {ECO:0000250, ECO:0000269|PubMed:9660798}. | Rattus norvegicus (Rat) |
O88483 | PDP1_RAT | MPAPTQLFFPLVRNCELSRIYGTACYCHHKHLCCSPPYIPQNRLRYTPHPAYATFCRPRENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESADIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNER... | 3.1.3.43 | COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:P35816}; Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:17532339, ECO:0000269|PubMed:9651365}; Note=Binds 2 Mn(2+) ions per subunit (By similarity). Binds 2 Mg(2+) ions per subunit (PubMed:17532339). Mn(2+) can substitute ... | null | mitochondrion [GO:0005739] | [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase activity [GO:0004741]; [pyruvate dehydrogenase (lipoamide)] phosphatase regulator activity [GO:0019909]; calcium ion binding [GO:0005509]; magnesium ion binding [GO:0000287]; protein serine/threonine phosphatase activity [GO:0004722]; protein-containing complex... | PF00481; | 3.60.40.10; | PP2C family | null | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:9651365}. | CATALYTIC ACTIVITY: Reaction=H2O + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = L-seryl-[pyruvate dehydrogenase E1 alpha subunit] + phosphate; Xref=Rhea:RHEA:12669, Rhea:RHEA-COMP:13689, Rhea:RHEA-COMP:13690, ChEBI:CHEBI:15377, ChEBI:CHEBI:29999, ChEBI:CHEBI:43474, ChEBI:CHEBI:83421; EC=3.1.3.43; Evide... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.5 mM for Mg(2+) (in absence of Ca(2+)) {ECO:0000269|PubMed:9651365}; KM=0.7 mM for Mg(2+) (in presence of Ca(2+)) {ECO:0000269|PubMed:9651365}; | null | null | null | FUNCTION: Mitochondrial enzyme that catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex (PDC), thereby stimulating the conversion of pyruvate into acetyl-CoA. {ECO:0000269|PubMed:15210124, ECO:0000269|PubMed:9651365}. | Rattus norvegicus (Rat) |
O88484 | PDP2_RAT | MSSTASYRIFNFARNRIAVLRGGRRLYSRAATSRNQVKWRLFSPASLAVNDSSPHGGFALRKAYRHTSTEEEDFHLQLSPEQVSDLLRAGESSHKVLDFNSGVPNSVLRFESNQLAANSPVEDRQGVASCVQTRGTMFGIFDGHGGHACAQAVSERLFYYMAVSLMSHKTLEQMEEAMENMKPLLPILQWLKHPGDSIYKDITSVHLDHLRVYWQELLDLHMETGLSTEEALMYSFQRLDSDISLEIQAPLEDEVTKNLSLQVAFSGATACMAHVDGVHLHIANAGDCRAILGVQGDNGAWSCLPLTCDHNAWNEAELSR... | 3.1.3.43 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:9651365}; Note=Binds 2 magnesium ions per subunit. {ECO:0000250|UniProtKB:P35816}; | peptidyl-threonine dephosphorylation [GO:0035970]; response to starvation [GO:0042594]; T-helper cell differentiation [GO:0042093] | mitochondrion [GO:0005739] | [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase activity [GO:0004741]; [pyruvate dehydrogenase (lipoamide)] phosphatase regulator activity [GO:0019909]; metal ion binding [GO:0046872]; protein serine/threonine phosphatase activity [GO:0004722] | PF00481; | 3.60.40.10; | PP2C family | null | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:9651365}. | CATALYTIC ACTIVITY: Reaction=H2O + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = L-seryl-[pyruvate dehydrogenase E1 alpha subunit] + phosphate; Xref=Rhea:RHEA:12669, Rhea:RHEA-COMP:13689, Rhea:RHEA-COMP:13690, ChEBI:CHEBI:15377, ChEBI:CHEBI:29999, ChEBI:CHEBI:43474, ChEBI:CHEBI:83421; EC=3.1.3.43; Evide... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=17.4 mM for Mg(2+) {ECO:0000269|PubMed:9651365}; | null | null | null | FUNCTION: Mitochondrial enzyme that catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex (PDC), thereby stimulating the conversion of pyruvate into acetyl-CoA (PubMed:14644048, PubMed:9651365). Acts as a crucial regulator of T cell m... | Rattus norvegicus (Rat) |
O88485 | DC1I1_MOUSE | MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSDAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVEPKIGHDSELENQEKKQETKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYPELMVASYSNNEDAPHEPDGVALVWNMKFKKTTPEYVF... | null | null | transport along microtubule [GO:0010970]; vesicle transport along microtubule [GO:0047496] | axon cytoplasm [GO:1904115]; cytoplasmic dynein complex [GO:0005868]; kinetochore [GO:0000776]; microtubule [GO:0005874]; perinuclear region of cytoplasm [GO:0048471]; spindle pole [GO:0000922]; vesicle [GO:0031982] | dynein heavy chain binding [GO:0045504]; dynein light chain binding [GO:0045503]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]; spectrin binding [GO:0030507] | PF11540;PF00400; | 2.130.10.10; | Dynein intermediate chain family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Chromosome, centromere, kinetochore {ECO:0000250}. Cytoplasm, cytoskeleton, spindle pole {ECO:0000250}. | null | null | null | null | null | FUNCTION: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organe... | Mus musculus (Mouse) |
O88487 | DC1I2_MOUSE | MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAAVSVQEESDLEKKRREAEALLQSMGLTTDSPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVTAQPKEDEEEEDDVATPKPPVEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPN... | null | null | negative regulation of neuron projection development [GO:0010977]; transport along microtubule [GO:0010970] | cytoplasmic dynein complex [GO:0005868]; dynein complex [GO:0030286]; microtubule [GO:0005874]; outer dynein arm [GO:0036157]; vesicle [GO:0031982] | dynein heavy chain binding [GO:0045504]; dynein light chain binding [GO:0045503]; protein-containing complex binding [GO:0044877] | PF11540;PF00400; | 2.130.10.10; | Dynein intermediate chain family | PTM: The phosphorylation status of Ser-84 appears to be involved in dynactin-dependent target binding. {ECO:0000250|UniProtKB:Q62871}.; PTM: Pyrophosphorylation by 5-diphosphoinositol pentakisphosphate (5-IP7) promotes interaction with DCTN1 (PubMed:27474409). Serine pyrophosphorylation is achieved by Mg(2+)-dependent,... | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000269|PubMed:28619825}. Cytoplasm {ECO:0000269|PubMed:28619825}. Note=Detected in the cytoplasm of pachytene spermatocytes. Localizes to the manchette in elongating spermatids. {ECO:0000269|PubMed:28619825}. | null | null | null | null | null | FUNCTION: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function (By similarity). Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of ves... | Mus musculus (Mouse) |
O88488 | PTPRQ_RAT | MMDFHFSFLFLLIGTSESQVDVSSSFDGTGYDITLSSVSATTYSSPVSRTLATNVTKPGPPVFLAGERVGSAGILLSWNTPPNPNGRIISYVVKYKEVCPWMQTAYTRARAKPDSLEVLLTNLNPGTTYEIKVAAENNAGIGVFSDPFLFQTAESAPGKVVNLTVEALNYSAVNLIWYLPRQPNGKITSFKISVKHARSGIVVKDVSLRVEDILSGKLPECNENSESFLWSTTSPSPTLGRVTPTVRTTQSSSTAARSKISSVWKEPISFVVTHLRPYTTYLFEVSAVTTEAGYIDSTIVRTPESVPEGPPQNCIMGNVT... | 3.1.3.-; 3.1.3.48 | null | dephosphorylation [GO:0016311]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; hematopoietic progenitor cell differentiation [GO:0002244]; inner ear morphogenesis [GO:0042472]; neuromuscular process controlling balance [GO:0050885]; regulation of fat cell differentiation [GO:0045... | apical plasma membrane [GO:0016324]; receptor complex [GO:0043235]; stereocilium base [GO:0120044]; stereocilium bundle [GO:0032421] | protein tyrosine phosphatase activity [GO:0004725] | PF00041;PF00102; | 2.60.40.10;3.90.190.10; | Protein-tyrosine phosphatase family, Receptor class 2A subfamily | null | SUBCELLULAR LOCATION: Cell projection, stereocilium {ECO:0000250|UniProtKB:P0C5E4}. Apical cell membrane {ECO:0000250|UniProtKB:P0C5E4}; Single-pass type I membrane protein {ECO:0000255}. Basal cell membrane {ECO:0000250|UniProtKB:Q9UMZ3}; Single-pass type I membrane protein {ECO:0000255}. Note=Detected at the stereoci... | CATALYTIC ACTIVITY: Reaction=H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate; Xref=Rhea:RHEA:10684, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620; EC=3.1.3.48; Evidence={ECO:0000255|PROSITE-ProRule:PRU10044, ECO:0000269|PubMe... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=125 uM for diC8-PI(3,4,5)P3 {ECO:0000269|PubMed:12802008}; Vmax=18.3 nmol/min/mg enzyme with diC8-PI(3,4,5)P3 as substrate {ECO:0000269|PubMed:12802008}; | null | null | null | FUNCTION: Phosphatidylinositol phosphatase required for auditory function. May act by regulating the level of phosphatidylinositol 4,5-bisphosphate (PIP2) level in the basal region of hair bundles. Can dephosphorylate a broad range of phosphatidylinositol phosphates, including phosphatidylinositol 3,4,5-trisphosphate a... | Rattus norvegicus (Rat) |
O88491 | NSD1_MOUSE | MDRTCELSRRNCLLSFSNPVNLDASEDKDSPFGNGQSNFSEPLNGCTMQLPTAASGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLSGSADGSESFQDPAKSDSRAQSPIVCTSLSPGGPTALAMKQEPTCNNSPELQLRVTKTTKNGFLHFENFTGVDDADVDSEMDPEQPVTEDESIEEIFEETQTNATCNYEPKSENGVEVAMGSEQDSMPESRHGAVERPFLPLAPQTEKQKNKQRSEVDGSNEKTALLPAPTSLGDTNVTVEEQFNSINLSFQDDPDSSPSPLGNMLEIPGTSSPSTSQELPFVPQKILSKWE... | 2.1.1.357 | null | gastrulation with mouth forming second [GO:0001702]; methylation [GO:0032259]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of DNA-templated transcription [GO:0006355]; regulation of peptidyl-serine phosphorylation [G... | chromatin [GO:0000785]; histone methyltransferase complex [GO:0035097]; nucleus [GO:0005634] | chromatin binding [GO:0003682]; histone H3K36 dimethyltransferase activity [GO:0140954]; histone H3K36 methyltransferase activity [GO:0046975]; histone H4K20 methyltransferase activity [GO:0042799]; histone methyltransferase activity [GO:0042054]; nuclear androgen receptor binding [GO:0050681]; nuclear estrogen recepto... | PF17907;PF17982;PF00628;PF00855;PF00856; | 2.30.30.140;2.170.270.10;3.30.40.10; | Class V-like SAM-binding methyltransferase superfamily | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:9628876}. Chromosome {ECO:0000305|PubMed:9628876}. | CATALYTIC ACTIVITY: Reaction=L-lysyl(36)-[histone H3] + 2 S-adenosyl-L-methionine = 2 H(+) + N(6),N(6)-dimethyl-L-lysyl(36)-[histone H3] + 2 S-adenosyl-L-homocysteine; Xref=Rhea:RHEA:60308, Rhea:RHEA-COMP:9785, Rhea:RHEA-COMP:9787, ChEBI:CHEBI:15378, ChEBI:CHEBI:29969, ChEBI:CHEBI:57856, ChEBI:CHEBI:59789, ChEBI:CHEBI:... | null | null | null | null | FUNCTION: Histone methyltransferase that dimethylates Lys-36 of histone H3 (H3K36me2). Transcriptional intermediary factor capable of negatively influencing transcription. May also positively influence transcription. Essential for early post-implantation development. {ECO:0000269|PubMed:12805229, ECO:0000269|PubMed:962... | Mus musculus (Mouse) |
O88495 | MTR1L_MOUSE | MATVPKSNMGPTKAVPTPFGCIGCKLPKPDYPPALIIFMFCAMVITVVVDLIGNSMVILAVTKNKKLRNSGNIFVASLSVADMLVAIYPYPLMLYAMSVGGWDLSQLQCQMVGLVTGLSVVGSIFNITAIAINRYCYICHSLQYKRIFSLRNTCIYLVVTWVMTVLAVLPNMYIGTIEYDPRTYTCIFNYVNNPAFTVTIVCIHFVLPLIIVGYCYTKIWIKVLAARDPAGQNPDNQFAEVRNFLTMFVIFLLFAVCWCPVNVLTVLVAVIPKEMAGKIPNWLYLAAYCIAYFNSCLNAIIYGILNESFRREYWTIFHAM... | null | null | G protein-coupled receptor signaling pathway [GO:0007186] | nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069] | G protein-coupled receptor activity [GO:0004930]; melatonin receptor activity [GO:0008502] | PF00001; | 1.20.1070.10; | G-protein coupled receptor 1 family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:19699797, ECO:0000269|PubMed:29572483}; Multi-pass membrane protein. Postsynaptic density {ECO:0000269|PubMed:19699797}. | null | null | null | null | null | FUNCTION: G protein-coupled receptor that plays a role in numerous physiological processes including regulation of energy metabolism, neurite outgrowth or cell migration (PubMed:17957037, PubMed:19699797). Promotes self-renewal and neuronal differentiation of neural progenitor cells through activation of the NOTCH and ... | Mus musculus (Mouse) |
O88496 | VKGC_RAT | MAVHRGSARAAPASDKVQKNKPAQTSGLEQGSRMARIFGFEWADLSSWQSVVTLLNRPTDPANLAVFRFLFAFLMLLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLWYRLSCMLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLSAQKKNAHVPLWNYTVLRGQIFIVYFIAGVKKLDADWVEGYSMEHLSRHWLFSPFKLVLSEELTSLLVVHWCGLLLDLSAGFLLFFDASRPIGLVFVSYFHCMNSQLFSIGMFPYVMLASSPLFCSAEWPRKLV... | 4.1.1.90 | null | lung growth [GO:0060437]; response to dexamethasone [GO:0071548]; response to manganese ion [GO:0010042]; response to oxygen levels [GO:0070482]; response to parathyroid hormone [GO:0071107]; response to Thyroglobulin triiodothyronine [GO:1904016]; response to vitamin D [GO:0033280]; response to vitamin K [GO:0032571];... | endoplasmic reticulum membrane [GO:0005789] | gamma-glutamyl carboxylase activity [GO:0008488]; peptide binding [GO:0042277]; vitamin binding [GO:0019842] | PF05090; | null | Vitamin K-dependent gamma-carboxylase family | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P38435}; Multi-pass membrane protein {ECO:0000250|UniProtKB:P38435}. | CATALYTIC ACTIVITY: Reaction=2,3-epoxyphylloquinone + 4-carboxy-L-glutamyl-[protein] + H(+) + H2O = CO2 + L-glutamyl-[protein] + O2 + phylloquinol; Xref=Rhea:RHEA:45140, Rhea:RHEA-COMP:10208, Rhea:RHEA-COMP:11094, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:15759, ChEBI:CHEBI:16526, ChEBI:CHEBI... | null | null | null | null | FUNCTION: Mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. Catalyzes gamma-carboxylation of various proteins, such as blood coagulation factors... | Rattus norvegicus (Rat) |
O88498 | B2L11_RAT | MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH | null | null | apoptotic process involved in embryonic digit morphogenesis [GO:1902263]; B cell homeostasis [GO:0001782]; cell-matrix adhesion [GO:0007160]; cellular response to amyloid-beta [GO:1904646]; cellular response to estradiol stimulus [GO:0071392]; cellular response to nerve growth factor stimulus [GO:1990090]; developmenta... | Bcl-2 family protein complex [GO:0097136]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; mitochondrion [GO:0005739] | dynein complex binding [GO:0070840]; microtubule binding [GO:0008017]; molecular adaptor activity [GO:0060090]; protein kinase binding [GO:0019901] | PF08945;PF06773; | null | Bcl-2 family | PTM: Phosphorylation at Ser-65 by MAPK1/MAPK3 leads interaction with TRIM2 and ubiquitination, followed by proteasomal degradation. Deubiquitination catalyzed by USP27X stabilizes the protein. {ECO:0000250|UniProtKB:O54918}.; PTM: Ubiquitination by TRIM2 following phosphorylation by MAPK1/MAPK3 leads to proteasomal deg... | SUBCELLULAR LOCATION: Membrane; Peripheral membrane protein. Mitochondrion {ECO:0000250}. Note=Associated with intracytoplasmic membranes. {ECO:0000250}. | null | null | null | null | null | FUNCTION: Induces apoptosis and anoikis. {ECO:0000269|PubMed:9731710}. | Rattus norvegicus (Rat) |
O88502 | PDE8A_MOUSE | MGCAPSIHTSENRTFSHSDGEDEDVDVDVPGPAPRSIQRWSTAPGLVEPQPRDNGASKVSVADVQFGPMRFHQDQLQVLLVFTKEDSQCNGFHRACEKAGFKCTVTKEVQTVLTCFQDKLHDIIIIDHRYPRQMDAETLCRSIRSSKFSENTVIVGVVRRVDKEESSLMPFLAAGFTRRFIENPNVMACYNELLQLACGEVRSQLKLRACNSVFTALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHTQKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIR... | 3.1.4.53 | COFACTOR: Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240; Evidence={ECO:0000250}; Note=Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions. {ECO:0000250}; | cAMP catabolic process [GO:0006198]; cAMP-mediated signaling [GO:0019933]; cellular response to epidermal growth factor stimulus [GO:0071364]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; regulation of DNA-templated transcription [GO:0006355] | cytosol [GO:0005829]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471] | 3',5'-cyclic-AMP phosphodiesterase activity [GO:0004115]; 3',5'-cyclic-GMP phosphodiesterase activity [GO:0047555]; kinase binding [GO:0019900]; metal ion binding [GO:0046872]; protein kinase activator activity [GO:0030295] | PF00989;PF00233; | 3.40.50.2300;1.10.1300.10;3.30.450.20; | Cyclic nucleotide phosphodiesterase family, PDE8 subfamily | PTM: Phosphorylated at Ser-355 by PKA under elevated cAMP conditions, this enhances catalytic activity. {ECO:0000250}. | null | CATALYTIC ACTIVITY: Reaction=3',5'-cyclic AMP + H2O = AMP + H(+); Xref=Rhea:RHEA:25277, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:58165, ChEBI:CHEBI:456215; EC=3.1.4.53; Evidence={ECO:0000269|PubMed:9671792}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:25278; Evidence={ECO:0000269|PubMed:9671792}; | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.15 uM for cAMP {ECO:0000269|PubMed:9671792}; | PATHWAY: Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1. | null | null | FUNCTION: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development. Binding to RAF1 reduces RAF1 'Ser-259' inhibitory-phosphorylation and stimulate... | Mus musculus (Mouse) |
O88506 | STK39_RAT | MAEPSGSPVHVQLPQQAAPVTAAAAAPAAATSAPAPAPAPAAPAAPAPAPAAAPAPAPAAQAVGWPICRDAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSFR... | 2.7.11.1 | COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250|UniProtKB:Q9Z1W9}; | cell volume homeostasis [GO:0006884]; cellular hyperosmotic response [GO:0071474]; cellular hypotonic response [GO:0071476]; cellular response to chemokine [GO:1990869]; cellular response to potassium ion [GO:0035865]; chemokine (C-X-C motif) ligand 12 signaling pathway [GO:0038146]; inflammatory response [GO:0006954];... | apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; cell body [GO:0044297]; cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleoplasm [GO:0005654] | ATP binding [GO:0005524]; kinase activity [GO:0016301]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF12202;PF00069; | 1.10.510.10; | Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily | PTM: Phosphorylation at Thr-240 by WNK kinases (WNK1, WNK2, WNK3 or WNK4) is required for activation (PubMed:16083423, PubMed:16263722). Autophosphorylation at Thr-240 positively regulates its activity (By similarity). Phosphorylated at Ser-318 by PRKCQ (By similarity). {ECO:0000250|UniProtKB:Q9UEW8, ECO:0000269|PubMed... | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. Nucleus {ECO:0000305}. Note=Nucleus when caspase-cleaved. {ECO:0000305}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000250|UniProtKB:Q9UEW8}; CATALYTI... | null | null | null | null | FUNCTION: Effector serine/threonine-protein kinase component of the WNK-SPAK/OSR1 kinase cascade, which is involved in various processes, such as ion transport, response to hypertonic stress and blood pressure (PubMed:22544747). Specifically recognizes and binds proteins with a RFXV motif (By similarity). Acts downstre... | Rattus norvegicus (Rat) |
O88507 | CNTFR_MOUSE | MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAPETTT... | null | null | brainstem development [GO:0003360]; ciliary neurotrophic factor-mediated signaling pathway [GO:0070120]; motor neuron apoptotic process [GO:0097049]; negative regulation of motor neuron apoptotic process [GO:2000672]; positive regulation of cell population proliferation [GO:0008284]; sex differentiation [GO:0007548]; s... | apical plasma membrane [GO:0016324]; ciliary neurotrophic factor receptor complex [GO:0070110]; CNTFR-CLCF1 complex [GO:0097059]; external side of plasma membrane [GO:0009897] | ciliary neurotrophic factor receptor activity [GO:0004897]; cytokine binding [GO:0019955]; cytokine receptor activity [GO:0004896]; signaling receptor binding [GO:0005102] | PF00041; | 2.60.40.10; | Type I cytokine receptor family, Type 3 subfamily | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Lipid-anchor, GPI-anchor {ECO:0000250}. | null | null | null | null | null | FUNCTION: Binds to CNTF. The alpha subunit provides the receptor specificity (By similarity). {ECO:0000250}. | Mus musculus (Mouse) |
O88508 | DNM3A_MOUSE | MPSSGPGDTSSSSLEREDDRKEGEEQEENRGKEERQEPSATARKVGRPGRKRKHPPVESSDTPKDPAVTTKSQPMAQDSGPSDLLPNGDLEKRSEPQPEEGSPAAGQKGGAPAEGEGTETPPEASRAVENGCCVTKEGRGASAGEGKEQKQTNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQASGESQKVEEASPPAVQQPTDPASPTVATTPEPVGGDAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEG... | 2.1.1.-; 2.1.1.37 | null | autosome genomic imprinting [GO:0141068]; cellular response to amino acid stimulus [GO:0071230]; cellular response to bisphenol A [GO:1903926]; cellular response to ethanol [GO:0071361]; cellular response to hypoxia [GO:0071456]; DNA methylation-dependent heterochromatin formation [GO:0006346]; genomic imprinting [GO:0... | catalytic complex [GO:1902494]; chromosome, centromeric region [GO:0000775]; cytoplasm [GO:0005737]; euchromatin [GO:0000791]; heterochromatin [GO:0000792]; nuclear matrix [GO:0016363]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; XY body [GO:0001741] | chromatin binding [GO:0003682]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA (cytosine-5-)-methyltransferase activity, acting on CpN substrates [GO:0051719]; DNA binding [GO:0003677]; identical protein binding [GO:0042802]; lncRNA binding [GO:0106222]; metal ion binding [GO:0046872]; protein-cysteine ... | PF17980;PF21255;PF00145;PF00855; | 2.30.30.140;1.10.720.50;3.40.50.150; | Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family | PTM: Auto-methylated at Cys-706: auto-methylation takes place in absence of DNA substrate and inactivates the DNA methyltransferase activity (PubMed:21481189). Inactivation by auto-methylation may be used to inactivate unused DNA methyltransferases in the cell (PubMed:21481189). {ECO:0000269|PubMed:21481189}.; PTM: Sum... | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:12138111, ECO:0000269|PubMed:15456878, ECO:0000269|PubMed:20547484}. Chromosome {ECO:0000269|PubMed:20547484}. Cytoplasm {ECO:0000250|UniProtKB:Q9Y6K1}. Note=Accumulates in the major satellite repeats at pericentric heterochromatin. {ECO:0000269|PubMed:20547484}. | CATALYTIC ACTIVITY: Reaction=a 2'-deoxycytidine in DNA + S-adenosyl-L-methionine = a 5-methyl-2'-deoxycytidine in DNA + H(+) + S-adenosyl-L-homocysteine; Xref=Rhea:RHEA:13681, Rhea:RHEA-COMP:11369, Rhea:RHEA-COMP:11370, ChEBI:CHEBI:15378, ChEBI:CHEBI:57856, ChEBI:CHEBI:59789, ChEBI:CHEBI:85452, ChEBI:CHEBI:85454; EC=2.... | null | null | null | null | FUNCTION: Required for genome-wide de novo methylation and is essential for the establishment of DNA methylation patterns during development (PubMed:10555141, PubMed:11399089, PubMed:11919202, PubMed:16567415, PubMed:17713477, PubMed:9662389). DNA methylation is coordinated with methylation of histones (PubMed:10555141... | Mus musculus (Mouse) |
O88509 | DNM3B_MOUSE | MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRA... | 2.1.1.37 | null | autosome genomic imprinting [GO:0141068]; cellular response to amino acid stimulus [GO:0071230]; DNA methylation-dependent heterochromatin formation [GO:0006346]; heterochromatin formation [GO:0031507]; methylation [GO:0032259]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of gen... | chromosome, centromeric region [GO:0000775]; heterochromatin [GO:0000792]; nucleoplasm [GO:0005654]; nucleus [GO:0005634] | chromatin binding [GO:0003682]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates [GO:0051718]; DNA (cytosine-5-)-methyltransferase activity, acting on CpN substrates [GO:0051719]; DNA binding [GO:0003677]; histone deacetylase binding [GO:0... | PF17980;PF21255;PF00145;PF00855; | 2.30.30.140;1.10.720.50;3.40.50.150; | Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family | PTM: Sumoylated. {ECO:0000250}.; PTM: Citrullinated by PADI4. {ECO:0000269|PubMed:24463520}. | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:15456878}. Note=Accumulates in the major satellite repeats at pericentric heterochromatin. | CATALYTIC ACTIVITY: Reaction=a 2'-deoxycytidine in DNA + S-adenosyl-L-methionine = a 5-methyl-2'-deoxycytidine in DNA + H(+) + S-adenosyl-L-homocysteine; Xref=Rhea:RHEA:13681, Rhea:RHEA-COMP:11369, Rhea:RHEA-COMP:11370, ChEBI:CHEBI:15378, ChEBI:CHEBI:57856, ChEBI:CHEBI:59789, ChEBI:CHEBI:85452, ChEBI:CHEBI:85454; EC=2.... | null | null | null | null | FUNCTION: Required for genome-wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. May preferentially methylates nucleosomal DNA within the nucleosome core region. May function as transcriptional co-r... | Mus musculus (Mouse) |
O88513 | GEMI_MOUSE | MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT | null | null | animal organ morphogenesis [GO:0009887]; DNA replication preinitiation complex assembly [GO:0071163]; negative regulation of cell cycle [GO:0045786]; negative regulation of DNA replication [GO:0008156]; negative regulation of DNA-templated DNA replication [GO:2000104]; negative regulation of DNA-templated transcription... | cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053] | chromatin binding [GO:0003682]; DNA-binding transcription factor binding [GO:0140297]; histone deacetylase binding [GO:0042826]; transcription corepressor activity [GO:0003714] | PF07412; | 1.20.5.1180; | Geminin family | PTM: Phosphorylated during mitosis. Phosphorylation at Ser-181 by CK2 results in enhanced binding to Hox proteins and more potent inhibitory effect on Hox transcriptional activity. {ECO:0000250|UniProtKB:O75496}. | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:O75496}. Nucleus {ECO:0000250|UniProtKB:O75496}. Note=Mainly cytoplasmic but can be relocalized to the nucleus. {ECO:0000250|UniProtKB:O75496}. | null | null | null | null | null | FUNCTION: Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC) (PubMed:12192004, PubMed:9635433). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle (Pub... | Mus musculus (Mouse) |
O88516 | DLL3_MOUSE | MVSLQVSPLSQTLILAFLLPQALPAGVFELQIHSFGPGPGLGTPRSPCNARGPCRLFFRVCLKPGVSQEATESLCALGAALSTSVPVYTEHPGESAAALPLPDGLVRVPFRDAWPGTFSLVIETWREQLGEHAGGPAWNLLARVVGRRRLAAGGPWARDVQRTGTWELHFSYRARCEPPAVGAACARLCRSRSAPSRCGPGLRPCTPFPDECEAPSVCRPGCSPEHGYCEEPDECRCLEGWTGPLCTVPVSTSSCLNSRVPGPASTGCLLPGPGPCDGNPCANGGSCSETSGSFECACPRGFYGLRCEVSGVTCADGPCF... | null | null | cell fate determination [GO:0001709]; compartment pattern specification [GO:0007386]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0007157]; in utero embryonic development [GO:0001701]; negative regula... | endosome membrane [GO:0010008]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991] | calcium ion binding [GO:0005509]; Notch binding [GO:0005112] | PF00008;PF12661;PF07657; | 2.60.40.3510;2.10.25.10; | null | PTM: Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation. {ECO:0000250}. | SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type I membrane protein {ECO:0000305}. | null | null | null | null | null | FUNCTION: Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. | Mus musculus (Mouse) |
O88522 | NEMO_MOUSE | MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGRIRAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQDYDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKE... | null | null | anoikis [GO:0043276]; B cell homeostasis [GO:0001782]; canonical NF-kappaB signal transduction [GO:0007249]; DNA damage response [GO:0006974]; negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902236]; positive regulation of canonical NF-kappaB signal transduction [G... | cytoplasm [GO:0005737]; IkappaB kinase complex [GO:0008385]; nucleus [GO:0005634] | identical protein binding [GO:0042802]; K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; linear polyubiquitin binding [GO:1990450]; metal ion binding [GO:0046872]; peroxisome proliferator activated receptor binding [GO:0042975]; protein heterodimerization activity [GO:0046982]; protein homo... | PF16516;PF11577;PF18414; | 1.20.5.390;1.20.5.990; | null | PTM: Phosphorylation at Ser-68 attenuates aminoterminal homodimerization. {ECO:0000250|UniProtKB:Q9Y6K9}.; PTM: Polyubiquitinated on Lys-278 via 'Lys-63'-linked ubiquitin; the ubiquitination is mediated downstream of NOD2 and RIPK2 and probably plays a role in signaling by facilitating interactions with ubiquitin domai... | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9Y6K9}. Nucleus {ECO:0000250|UniProtKB:Q9Y6K9}. Note=Sumoylated NEMO accumulates in the nucleus in response to genotoxic stress. {ECO:0000250|UniProtKB:Q9Y6K9}. | null | null | null | null | null | FUNCTION: Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor (PubMed:9927690). Its binding to scaffolding polyubiquitin plays a key role in IKK activation by multipl... | Mus musculus (Mouse) |
O88529 | BMAL1_MESAU | MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSATDYQESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRL... | null | null | circadian regulation of gene expression [GO:0032922]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of fat cell differentiation [GO:0045599]; negative regulation of glucocorticoid receptor signaling pathway [GO:2000323]; negative regulation of TOR signaling [GO:0032007]; oxidative... | aryl hydrocarbon receptor complex [GO:0034751]; chromatoid body [GO:0033391]; CLOCK-BMAL transcription complex [GO:1990513]; nucleus [GO:0005634]; PML body [GO:0016605]; transcription regulator complex [GO:0005667] | aryl hydrocarbon receptor binding [GO:0017162]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; E-box binding [GO:0070888]; Hsp90 protein binding [GO:0051879]; protein dimerization activity [GO:0046983]; RNA polymerase II cis-regulatory region sequence-speci... | PF00010;PF00989;PF14598; | 4.10.280.10;3.30.450.20; | null | PTM: Ubiquitinated, leading to its proteasomal degradation. Deubiquitinated by USP9X. {ECO:0000250|UniProtKB:Q9WTL8}.; PTM: O-glycosylated; contains O-GlcNAc. O-glycosylation by OGT prevents protein degradation by inhibiting ubiquitination. It also stabilizes the CLOCK-BMAL1 heterodimer thereby increasing CLOCK-BMAL1-m... | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00981}. Cytoplasm {ECO:0000250|UniProtKB:Q9WTL8}. Nucleus, PML body {ECO:0000250|UniProtKB:Q9WTL8}. Note=Shuttles between the nucleus and the cytoplasm and this nucleocytoplasmic shuttling is essential for the nuclear accumulation of CLOCK, target gene trans... | null | null | null | null | null | FUNCTION: Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism a... | Mesocricetus auratus (Golden hamster) |
O88531 | PPT1_MOUSE | MASSCSRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMSMGVIKKMVEKEIPGIYVLSLEIGKNMMEDVENSFFLNVNVQVNMVCQILEKDPKLQQGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKLVQERLVQAQYWHDPIKESVYRNYSIFLADINQERCVNESYKKNLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSGQAKETIPLQESTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHIIPFLK | 3.1.2.22 | null | adult locomotory behavior [GO:0008344]; associative learning [GO:0008306]; brain development [GO:0007420]; grooming behavior [GO:0007625]; lipid catabolic process [GO:0016042]; lysosomal lumen acidification [GO:0007042]; lysosome organization [GO:0007040]; macromolecule catabolic process [GO:0009057]; membrane raft org... | axon [GO:0030424]; cytosol [GO:0005829]; dendrite [GO:0030425]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; lysosome [GO:0005764]; membrane raft [GO:0045121]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; synaptic vesicle [GO:0008021] | long-chain fatty acyl-CoA hydrolase activity [GO:0052816]; lysophosphatidic acid binding [GO:0035727]; palmitoyl-(protein) hydrolase activity [GO:0008474]; sulfatide binding [GO:0120146] | PF02089; | 3.40.50.1820; | Palmitoyl-protein thioesterase family | PTM: Glycosylated. {ECO:0000269|PubMed:9685319}. | SUBCELLULAR LOCATION: Lysosome {ECO:0000269|PubMed:19941651, ECO:0000269|PubMed:9685319}. Secreted {ECO:0000269|PubMed:9685319}. | CATALYTIC ACTIVITY: Reaction=H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]; Xref=Rhea:RHEA:19233, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:7896, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:29950, ChEBI:CHEBI:74151; EC=3.1.2.22; Evidence={ECO:0000250|UniPr... | null | null | null | null | FUNCTION: Removes thioester-linked fatty acyl groups such as palmitate from modified cysteine residues in proteins or peptides during lysosomal degradation. Prefers acyl chain lengths of 14 to 18 carbons. {ECO:0000250|UniProtKB:P45478}. | Mus musculus (Mouse) |
O88533 | DDC_MOUSE | MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRT... | 4.1.1.28 | COFACTOR: Name=pyridoxal 5'-phosphate; Xref=ChEBI:CHEBI:597326; Evidence={ECO:0000250|UniProtKB:P20711}; | aminergic neurotransmitter loading into synaptic vesicle [GO:0015842]; amino acid metabolic process [GO:0006520]; carboxylic acid metabolic process [GO:0019752]; catecholamine metabolic process [GO:0006584]; dopamine biosynthetic process [GO:0042416]; gene expression [GO:0010467]; kidney development [GO:0001822]; respo... | axon [GO:0030424]; cytoplasm [GO:0005737]; neuronal cell body [GO:0043025]; synaptic vesicle [GO:0008021] | 5-hydroxy-L-tryptophan decarboxylase activity [GO:0036467]; amino acid binding [GO:0016597]; aromatic-L-amino-acid decarboxylase activity [GO:0004058]; enzyme binding [GO:0019899]; L-dopa decarboxylase activity [GO:0036468]; protein domain specific binding [GO:0019904]; pyridoxal phosphate binding [GO:0030170] | PF00282; | 3.90.1150.10;1.20.1340.10;3.40.640.10; | Group II decarboxylase family | null | null | CATALYTIC ACTIVITY: Reaction=H(+) + L-dopa = CO2 + dopamine; Xref=Rhea:RHEA:12272, ChEBI:CHEBI:15378, ChEBI:CHEBI:16526, ChEBI:CHEBI:57504, ChEBI:CHEBI:59905; EC=4.1.1.28; Evidence={ECO:0000250|UniProtKB:P80041}; CATALYTIC ACTIVITY: Reaction=5-hydroxy-L-tryptophan + H(+) = CO2 + serotonin; Xref=Rhea:RHEA:18533, ChEBI:C... | null | PATHWAY: Catecholamine biosynthesis; dopamine biosynthesis; dopamine from L-tyrosine: step 2/2. {ECO:0000250|UniProtKB:P80041}. | null | null | FUNCTION: Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine and L-5-hydroxytryptophan to serotonin. {ECO:0000250|UniProtKB:P80041}. | Mus musculus (Mouse) |
O88536 | FPR2_MOUSE | MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLRVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFRERFIHSLPYS... | null | null | cellular response to amyloid-beta [GO:1904646]; complement receptor mediated signaling pathway [GO:0002430]; inflammatory response [GO:0006954]; phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; positive chemotaxis [GO:0050918]; positive regulation of cytosolic calcium ion concentrat... | plasma membrane [GO:0005886] | amyloid-beta binding [GO:0001540]; complement receptor activity [GO:0004875]; N-formyl peptide receptor activity [GO:0004982]; RAGE receptor binding [GO:0050786]; signaling receptor activity [GO:0038023] | PF00001; | 1.20.1070.10; | G-protein coupled receptor 1 family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:P25090}; Multi-pass membrane protein {ECO:0000305}. Note=Associates with Amyloid-beta protein 42, product of APP, at the cell surface and the complex is then rapidly internalized. {ECO:0000250|UniProtKB:P25090}. | null | null | null | null | null | FUNCTION: High affinity receptor for N-formyl-methionyl peptides (FMLP), which are powerful neutrophil chemotactic factors (PubMed:10477558, PubMed:12218158, PubMed:19387439). Stimulates chemotaxis in immune cells to site of infection or tissue damage upon recognition of several ligands, such as FMLP, or ligand involve... | Mus musculus (Mouse) |
O88543 | CSN3_MOUSE | MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVKFSMPSVPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTSVHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVSKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQ... | null | null | in utero embryonic development [GO:0001701]; protein deneddylation [GO:0000338]; regulation of DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator [GO:1902162]; ubiquitin-dependent protein catabolic process [GO:0006511] | COP9 signalosome [GO:0008180]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471] | null | PF21215;PF01399; | 1.25.40.570; | CSN3 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9UNS2}. Nucleus {ECO:0000250|UniProtKB:Q9UNS2}. | null | null | null | null | null | FUNCTION: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes (By similarity). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leadi... | Mus musculus (Mouse) |
O88551 | CLD1_MOUSE | MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFLISGLATLVATAWYGNRIVQEFYDPLTPINARYEFGQALFTGWAAASLCLLGGVLLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV | null | null | bicellular tight junction assembly [GO:0070830]; calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules [GO:0016338]; cell adhesion [GO:0007155]; cell junction maintenance [GO:0034331]; cell-cell junction organization [GO:0045216]; cellular response to butyrate [GO:1903545]; cellular respons... | apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; bicellular tight junction [GO:0005923]; cell junction [GO:0030054]; cell-cell junction [GO:0005911]; lateral plasma membrane [GO:0016328]; membrane [GO:0016020]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; tight ju... | identical protein binding [GO:0042802]; structural molecule activity [GO:0005198]; virus receptor activity [GO:0001618] | PF00822; | 1.20.140.150; | Claudin family | null | SUBCELLULAR LOCATION: Cell junction, tight junction {ECO:0000269|PubMed:10508613, ECO:0000269|PubMed:10562289, ECO:0000269|PubMed:9647647}. Cell membrane {ECO:0000269|PubMed:11889141}; Multi-pass membrane protein {ECO:0000255}. Basolateral cell membrane {ECO:0000250|UniProtKB:O95832}. Note=Associates with CD81 and the ... | null | null | null | null | null | FUNCTION: Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family membe... | Mus musculus (Mouse) |
O88552 | CLD2_MOUSE | MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV | null | null | bicellular tight junction assembly [GO:0070830]; calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules [GO:0016338]; cell-cell adhesion [GO:0098609] | bicellular tight junction [GO:0005923]; membrane [GO:0016020]; plasma membrane [GO:0005886]; tight junction [GO:0070160] | channel activity [GO:0015267]; identical protein binding [GO:0042802]; structural molecule activity [GO:0005198] | PF00822; | 1.20.140.150; | Claudin family | PTM: The disulfide bond is necessary for pore formation, but is not required for correct protein trafficking. {ECO:0000250}. | SUBCELLULAR LOCATION: Cell junction, tight junction {ECO:0000269|PubMed:11934881, ECO:0000269|PubMed:32149733}. Cell membrane {ECO:0000269|PubMed:11934881}; Multi-pass membrane protein {ECO:0000269|PubMed:11934881}. | null | null | null | null | null | FUNCTION: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. {ECO:0000269|PubMed:10508613, ECO:0000269|PubMed:32149733}. | Mus musculus (Mouse) |
O88554 | PARP2_MOUSE | MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGGKDADRTKDNRDSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGKYDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKRAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTEKELSDKVKLLEALGDIEIAL... | 2.4.2.-; 2.4.2.30 | null | base-excision repair [GO:0006284]; decidualization [GO:0046697]; DNA ADP-ribosylation [GO:0030592]; DNA repair [GO:0006281]; DNA repair-dependent chromatin remodeling [GO:0140861]; double-strand break repair [GO:0006302]; extrinsic apoptotic signaling pathway [GO:0097191]; hippocampal neuron apoptotic process [GO:01100... | nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; site of DNA damage [GO:0090734] | chromatin binding [GO:0003682]; damaged DNA binding [GO:0003684]; NAD DNA ADP-ribosyltransferase activity [GO:0140294]; NAD+ ADP-ribosyltransferase activity [GO:0003950]; NAD+- protein-aspartate ADP-ribosyltransferase activity [GO:0140806]; NAD+-protein ADP-ribosyltransferase activity [GO:1990404]; NAD+-protein-glutama... | PF00644;PF02877;PF05406; | 3.90.228.10;1.20.142.10;2.20.140.10; | ARTD/PARP family | PTM: Auto poly-ADP-ribosylated on serine residues, leading to dissociation of the PARP2-HPF1 complex from chromatin (By similarity). Poly-ADP-ribosylated by PARP1 (PubMed:11948190). {ECO:0000250|UniProtKB:Q9UGN5, ECO:0000269|PubMed:11948190}.; PTM: Acetylation reduces DNA binding and enzymatic activity. {ECO:0000269|Pu... | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10364231}. Chromosome {ECO:0000250|UniProtKB:Q9UGN5}. Note=Recruited to DNA damage sites in a PARP1-dependent process: recognizes and binds poly-ADP-ribose chains produced by PARP1 at DNA damage sites via its N-terminus, leading to its recruitment. {ECO:0000250|UniProtK... | CATALYTIC ACTIVITY: Reaction=NAD(+) + (ADP-D-ribosyl)n-acceptor = nicotinamide + (ADP-D-ribosyl)n+1-acceptor + H(+).; EC=2.4.2.30; Evidence={ECO:0000269|PubMed:12065591}; CATALYTIC ACTIVITY: Reaction=L-seryl-[protein] + NAD(+) = H(+) + nicotinamide + O-(ADP-D-ribosyl)-L-seryl-[protein]; Xref=Rhea:RHEA:58232, Rhea:RHEA-... | null | null | null | null | FUNCTION: Poly-ADP-ribosyltransferase that mediates poly-ADP-ribosylation of proteins and plays a key role in DNA repair (PubMed:10364231, PubMed:12065591). Mediates glutamate, aspartate or serine ADP-ribosylation of proteins: the ADP-D-ribosyl group of NAD(+) is transferred to the acceptor carboxyl group of target res... | Mus musculus (Mouse) |
O88559 | MEN1_MOUSE | MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYQDEHIYP... | null | null | cell division [GO:0051301]; cell population proliferation [GO:0008283]; chromatin remodeling [GO:0006338]; embryonic skeletal system morphogenesis [GO:0048704]; fibroblast apoptotic process [GO:0044346]; fibroblast proliferation [GO:0048144]; hemopoiesis [GO:0030097]; leukocyte homeostasis [GO:0001776]; maternal proces... | chromatin [GO:0000785]; chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; histone methyltransferase complex [GO:0035097]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053] | chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-binding transcription activator activity [GO:0001216]; sequence-specific DNA binding [GO:0043565]; transcription cis-regulatory region binding [GO:0000976]; Y-form DNA binding [GO:0000403] | PF05053; | null | null | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:9824159}. Note=May be perinuclear in testis. {ECO:0000269|PubMed:9824159}. | null | null | null | null | null | FUNCTION: Essential component of a MLL/SET1 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3 (H3K4). Functions as a transcriptional regulator. Binds to the TERT promoter and represses telomerase expression. Plays a role in TGFB1-mediated inhibition of cell-proliferat... | Mus musculus (Mouse) |
O88561 | S27A3_MOUSE | MAALLLLLPLLLLLPLLLKLDVWPQLRWLPADLAFTVRALRCKRALRARALAAAAADPESSESGCSLAWRLAYLAREQPTHTFLIHGAQRFSYAEAERESNRIARAFLRARGWTGGRRGSGRGSTEEGARVAPPAGDAAARGTTAPPLAPGATVALLLPAGPDFLWIWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGASALVLATEFLESLEPDLPALRAMGLHLWATGPETNVAGISNLLSEAADQVDEPVPGYLSAPQNIMDTCLYIFTSGTTGLPKAARISHLKVLQCQGFYHLCGVHQEDVIYLALPLYHMSGSL... | 6.2.1.-; 6.2.1.15; 6.2.1.3 | null | acyl-CoA metabolic process [GO:0006637]; long-chain fatty acid metabolic process [GO:0001676] | endoplasmic reticulum membrane [GO:0005789]; mitochondrial matrix [GO:0005759]; mitochondrial membrane [GO:0031966]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886] | arachidonate-CoA ligase activity [GO:0047676]; ATP binding [GO:0005524]; fatty-acyl-CoA synthase activity [GO:0004321]; long-chain fatty acid transporter activity [GO:0005324]; long-chain fatty acid-CoA ligase activity [GO:0004467]; very long-chain fatty acid-CoA ligase activity [GO:0031957] | PF00501;PF13193; | 3.30.300.30;3.40.50.12780; | ATP-dependent AMP-binding enzyme family | null | SUBCELLULAR LOCATION: Mitochondrion membrane {ECO:0000269|PubMed:15469937}; Single-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=a fatty acid(in) = a fatty acid(out); Xref=Rhea:RHEA:38879, ChEBI:CHEBI:28868; Evidence={ECO:0000269|PubMed:15699031}; CATALYTIC ACTIVITY: Reaction=a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate; Xref=Rhea:RHEA:15421, ChEBI:CHEBI:30616, ChEBI:CHEBI:330... | null | null | null | null | FUNCTION: Mainly functions as an acyl-CoA ligase catalyzing the ATP-dependent formation of fatty acyl-CoA using LCFA and very-long-chain fatty acids (VLCFA) as substrates (PubMed:15469937, PubMed:15699031). Can mediate the levels of long-chain fatty acids (LCFA) in the cell by facilitating their transport across membra... | Mus musculus (Mouse) |
O88563 | MRP3_RAT | MDRLCGSGELGSKFWDSNLTVYTNTPDLTPCFQNSLLAWVPCIYLWAALPCYLFYLRHHRLGYIVLSCLSRLKTALGVLLWCISWVDLFYSFHGLVHGSSPAPVFFITPLLVGITMLLATLLIQYERLRGVRSSGVLIIFWLLCVICAIIPFRSKILLALAEGKILDPFRFTTFYIYFALVLCAFILSCFQEKPPLFSPENLDTNPCPEASAGFFSRLSFWWFTKLAILGYRRPLEDSDLWSLSEEDCSHKVVQRLLEAWQKQQTQASGPQTAALEPKIAGEDEVLLKARPKTKKPSFLRALVRTFTSSLLMGACFKLIQ... | 7.6.2.-; 7.6.2.2; 7.6.2.3 | null | bile acid and bile salt transport [GO:0015721]; canalicular bile acid transport [GO:0015722]; leukotriene transport [GO:0071716]; monoatomic anion transmembrane transport [GO:0098656]; response to estradiol [GO:0032355]; response to lipopolysaccharide [GO:0032496]; response to organic cyclic compound [GO:0014070]; resp... | basal plasma membrane [GO:0009925]; basolateral plasma membrane [GO:0016323]; membrane [GO:0016020]; plasma membrane [GO:0005886] | ABC-type bile acid transporter activity [GO:0015432]; ABC-type glutathione S-conjugate transporter activity [GO:0015431]; ABC-type xenobiotic transporter activity [GO:0008559]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; glucuronoside t... | PF00664;PF00005; | 1.20.1560.10;3.40.50.300; | ABC transporter superfamily, ABCC family, Conjugate transporter (TC 3.A.1.208) subfamily | null | SUBCELLULAR LOCATION: Basolateral cell membrane {ECO:0000269|PubMed:11897632}; Multi-pass membrane protein {ECO:0000255}. Basal cell membrane {ECO:0000250|UniProtKB:O15438}; Multi-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate; Xref=Rhea:RHEA:19121, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:90779, ChEBI:CHEBI:456216; EC=7.6.2.3; Evidence={ECO:0000250|UniProtKB:O15... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.36 uM for ATP (determined by measuring estradiol-17-beta-o-glucuronide transport) {ECO:0000269|PubMed:10644759}; KM=3.06 uM for taurolithocholate sulfate {ECO:0000269|PubMed:10644759}; KM=15.9 uM for taurocholate {ECO:0000269|PubMed:10644759}; Vmax=161.9 pmol/min... | null | null | null | FUNCTION: ATP-dependent transporter of the ATP-binding cassette (ABC) family that binds and hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants and endogenous compound across cell membranes. Transports glucuronide conjugates such as bilirubin diglucuronide, estradiol-17-beta-... | Rattus norvegicus (Rat) |
O88566 | AXIN2_MOUSE | MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQAVMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLKCKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVNPYHVGSGYVFAPATSANDSELSSDALTDDSMSMTDSSVD... | null | null | aortic valve morphogenesis [GO:0003180]; bone mineralization [GO:0030282]; canonical Wnt signaling pathway [GO:0060070]; cell development [GO:0048468]; cell population proliferation [GO:0008283]; cellular response to dexamethasone stimulus [GO:0071549]; chondrocyte differentiation involved in endochondral bone morphoge... | beta-catenin destruction complex [GO:0030877]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991] | beta-catenin binding [GO:0008013]; I-SMAD binding [GO:0070411]; molecular adaptor activity [GO:0060090]; protein kinase binding [GO:0019901]; ubiquitin protein ligase binding [GO:0031625] | PF16646;PF08833;PF00778;PF00615; | 1.10.196.10;2.40.240.130;1.10.167.10; | null | PTM: ADP-ribosylated by tankyrase TNKS and TNKS2. Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination and subsequent activation of the Wnt signaling pathway. {ECO:0000250|UniProtKB:Q9Y2T1}.; PTM: Ubiquitinated by RNF146 when poly-ADP-ribosylated, leading to its degradation and subsequent ac... | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9Y2T1}. | null | null | null | null | null | FUNCTION: Inhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B. {ECO:0000250|UniProtKB:O15169}. | Mus musculus (Mouse) |
O88569 | ROA2_MOUSE | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGN... | null | null | G-quadruplex DNA unwinding [GO:0044806]; miRNA transport [GO:1990428]; mRNA export from nucleus [GO:0006406]; mRNA processing [GO:0006397]; mRNA splicing, via spliceosome [GO:0000398]; mRNA transport [GO:0051028]; negative regulation of mRNA splicing, via spliceosome [GO:0048025]; negative regulation of transcription b... | Cajal body [GO:0015030]; catalytic step 2 spliceosome [GO:0071013]; chromatin [GO:0000785]; chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; neuronal cell body [GO:0043025]; neuronal ribonucleoprotein granule [GO:0071598]; nuclear... | DNA polymerase binding [GO:0070182]; G-rich strand telomeric DNA binding [GO:0098505]; miRNA binding [GO:0035198]; molecular condensate scaffold activity [GO:0140693]; mRNA 3'-UTR binding [GO:0003730]; mRNA CDS binding [GO:1990715]; N6-methyladenosine-containing RNA reader activity [GO:1990247]; pre-mRNA intronic bindi... | PF11627;PF00076; | 3.30.70.330; | null | PTM: Sumoylated in exosomes, promoting miRNAs-binding. {ECO:0000250|UniProtKB:P22626}.; PTM: Asymmetric dimethylation at Arg-266 constitutes the major methylation site (By similarity). According to a report, methylation affects subcellular location and promotes nuclear localization (By similarity). According to another... | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:31320558}. Nucleus, nucleoplasm {ECO:0000250|UniProtKB:P22626}. Cytoplasm {ECO:0000269|PubMed:31320558}. Cytoplasmic granule {ECO:0000250|UniProtKB:P22626}. Secreted, extracellular exosome {ECO:0000250|UniProtKB:P22626}. Note=Localized in cytoplasmic mRNP granules conta... | null | null | null | null | null | FUNCTION: Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging p... | Mus musculus (Mouse) |
O88572 | LRP6_MOUSE | MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEEAIKRTEFNKSESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTEIYWPNGLTLDYQERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLMENG... | null | null | anterior/posterior pattern specification [GO:0009952]; axis elongation [GO:0003401]; axis elongation involved in somitogenesis [GO:0090245]; bone remodeling [GO:0046849]; branching involved in mammary gland duct morphogenesis [GO:0060444]; canonical Wnt signaling pathway [GO:0060070]; cardiac muscle tissue morphogenesi... | early endosome [GO:0005769]; endoplasmic reticulum [GO:0005783]; membrane [GO:0016020]; membrane raft [GO:0045121]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; synapse [GO:0045202] | apolipoprotein binding [GO:0034185]; low-density lipoprotein particle receptor activity [GO:0005041]; toxin transmembrane transporter activity [GO:0019534]; Wnt receptor activity [GO:0042813]; Wnt-protein binding [GO:0017147] | PF14670;PF00057;PF00058; | 4.10.400.10;2.120.10.30; | LDLR family | PTM: Dual phosphorylation of cytoplasmic PPPSP motifs sequentially by GSK3 and CK1 is required for AXIN1-binding, and subsequent stabilization and activation of beta-catenin via preventing GSK3-mediated phosphorylation of beta-catenin. Phosphorylated, in vitro, by GRK5/6 within and outside the PPPSP motifs. Phosphoryla... | SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Membrane raft {ECO:0000250|UniProtKB:O75581}. Note=On Wnt signaling, undergoes a cycle of caveolin- or clathrin-mediated endocytosis and plasma membrane location. Released from the endoplasmic reticulum on palmitoylation. M... | null | null | null | null | null | FUNCTION: Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalosomes. Cell-surface coreceptor of Wnt/beta-catenin signaling, which plays a pivotal role in bone formation. The Wnt-induced Fzd/LRP6 coreceptor c... | Mus musculus (Mouse) |
O88574 | SAP30_MOUSE | MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH | null | null | modulation by host of symbiont transcription [GO:0052472]; negative regulation of cell migration [GO:0030336]; negative regulation of stem cell population maintenance [GO:1902455]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transforming growth factor beta receptor sig... | histone deacetylase complex [GO:0000118]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; Sin3-type complex [GO:0070822] | DNA binding [GO:0003677]; metal ion binding [GO:0046872]; transcription coregulator activity [GO:0003712]; transcription corepressor activity [GO:0003714] | PF13867;PF13866; | 6.10.160.20; | SAP30 family | null | SUBCELLULAR LOCATION: Nucleus. | null | null | null | null | null | FUNCTION: Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones. {ECO:00... | Mus musculus (Mouse) |
O88575 | S620B_MOUSE | MESPSAHAVSLPEDEELQPWGGAGGPGQHPGRPRSTECAHPGVVEKVRPKWDNPLQFLLVCISYAVGLGNVWRFPYLCQMYGGGNFLVPYIIMLIVEGMPLLYLELAVGQRMRQGSIGAWRTISPYLSGVGIASLVVSFLASVYFNVINTWALWYLFHSFQDPLPWSVCPLNSNHTGYDEECEKASSTQYFWYRKTLNISPSIQENGGVQWEPALCLTLAWLMVYLCILRGTESTGKVVYFTTSLPYFVLIIYLVRGLTLHGATNGLAYMFTPKIEQLANPKAWINAATQIFFSLGLGCGGLIAFASYNEPSNDCQKHAL... | null | null | glycine transport [GO:0015816]; L-proline import across plasma membrane [GO:1904271]; sodium ion transmembrane transport [GO:0035725] | apical plasma membrane [GO:0016324]; brush border membrane [GO:0031526]; plasma membrane [GO:0005886] | L-proline transmembrane transporter activity [GO:0015193]; proline:sodium symporter activity [GO:0005298] | PF00209; | null | Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A20 subfamily | null | SUBCELLULAR LOCATION: Apical cell membrane {ECO:0000269|PubMed:16174864}; Multi-pass membrane protein {ECO:0000269|PubMed:16174864}. Note=Located in the apical brush border membrane of kidney proximal tubule cells. | null | null | null | null | null | FUNCTION: Does not show transporter activity with a range of tested amino acids including proline, glutamine, glutamic acid, leucine, alanine, histidine, glycine and arginine. {ECO:0000269|PubMed:15689184}. | Mus musculus (Mouse) |
O88576 | S6A18_MOUSE | MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCFSVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYRQTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGR... | null | null | amino acid transmembrane transport [GO:0003333]; amino acid transport [GO:0006865]; neurotransmitter transport [GO:0006836]; neutral amino acid transport [GO:0015804]; renal amino acid absorption [GO:1990297]; sodium ion transmembrane transport [GO:0035725] | apical plasma membrane [GO:0016324]; brush border membrane [GO:0031526]; plasma membrane [GO:0005886] | neutral L-amino acid transmembrane transporter activity [GO:0015175]; neutral L-amino acid:sodium:chloride symporter activity [GO:0140931] | PF00209; | null | Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A18 subfamily | null | SUBCELLULAR LOCATION: Apical cell membrane {ECO:0000269|PubMed:19478081, ECO:0000269|PubMed:20377526}; Multi-pass membrane protein {ECO:0000255}. Cell membrane {ECO:0000269|PubMed:20377526, ECO:0000269|PubMed:26240152}; Multi-pass membrane protein {ECO:0000255}. Note=In kidneys localizes to the apical membrane in dista... | CATALYTIC ACTIVITY: Reaction=chloride(out) + L-alanine(out) + 2 Na(+)(out) = chloride(in) + L-alanine(in) + 2 Na(+)(in); Xref=Rhea:RHEA:71311, ChEBI:CHEBI:17996, ChEBI:CHEBI:29101, ChEBI:CHEBI:57972; Evidence={ECO:0000269|PubMed:19478081, ECO:0000269|PubMed:20377526, ECO:0000269|PubMed:26240152}; CATALYTIC ACTIVITY: Re... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.79 mM for L-alanine (in the presence of CLTRN) {ECO:0000269|PubMed:26240152}; KM=0.14 mM for L-alanine (in the presence of ACE2) {ECO:0000269|PubMed:26240152}; KM=0.99 mM for L-glycine (in the presence of CLTRN) {ECO:0000269|PubMed:26240152}; KM=0.27 mM for L-gly... | null | null | null | FUNCTION: Symporter that transports one amino acid molecule together with two sodium and one chloride ions in kidneys and plays a role in the neutral amino acids reabsorption (PubMed:19478081, PubMed:20377526, PubMed:26240152). Preferentially transports neutral amino acids such as L-glycine and L-alanine but also other... | Mus musculus (Mouse) |
O88582 | SOCS2_RAT | MTLRCLEPSGNGADRTRSQWGTAGSPEDQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLSINKCTGTIRGLPLPTRLKDYLEEYKFQV | null | null | cellular response to hormone stimulus [GO:0032870]; growth hormone receptor signaling pathway [GO:0060396]; intracellular signal transduction [GO:0035556]; lactation [GO:0007595]; mammary gland alveolus development [GO:0060749]; negative regulation of multicellular organism growth [GO:0040015]; negative regulation of r... | phosphatidylinositol 3-kinase complex [GO:0005942] | 1-phosphatidylinositol-3-kinase regulator activity [GO:0046935]; growth hormone receptor binding [GO:0005131]; insulin-like growth factor receptor binding [GO:0005159] | PF00017;PF07525; | 3.30.505.10;1.10.750.20; | null | PTM: Ubiquitinated; mediated by AREL1 and leading to its subsequent proteasomal degradation. Ubiquitination is dependent on phosphorylation at Ser-52, by PKC and is stimulated by LPS. {ECO:0000250|UniProtKB:O35717}.; PTM: Phosphorylation at Ser-52 by PKC facilitates its ubiquitination and proteasomal degradation. {ECO:... | null | null | null | PATHWAY: Protein modification; protein ubiquitination. | null | null | FUNCTION: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquiti... | Rattus norvegicus (Rat) |
O88583 | SOCS3_RAT | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL | null | null | animal organ regeneration [GO:0031100]; branching involved in labyrinthine layer morphogenesis [GO:0060670]; cell differentiation [GO:0030154]; cellular response to interleukin-17 [GO:0097398]; cellular response to leukemia inhibitory factor [GO:1990830]; cellular response to thyrotropin-releasing hormone [GO:1905229];... | cytoplasmic side of plasma membrane [GO:0009898]; phosphatidylinositol 3-kinase complex [GO:0005942] | 1-phosphatidylinositol-3-kinase regulator activity [GO:0046935]; miRNA binding [GO:0035198]; phosphotyrosine residue binding [GO:0001784]; protein tyrosine kinase inhibitor activity [GO:0030292] | PF00017; | 3.30.505.10;1.10.750.20; | null | PTM: Phosphorylated on tyrosine residues after stimulation by the cytokines, IL-2, EPO or IGF1. {ECO:0000250}. | null | null | null | PATHWAY: Protein modification; protein ubiquitination. | null | null | FUNCTION: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including IL6ST/gp13... | Rattus norvegicus (Rat) |
O88587 | COMT_MOUSE | MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGPGSSPVKS | 2.1.1.6 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProtKB:P22734}; Note=Binds 1 Mg(2+) ion per subunit. {ECO:0000250|UniProtKB:P22734}; | artery development [GO:0060840]; behavioral fear response [GO:0001662]; catecholamine catabolic process [GO:0042424]; catecholamine metabolic process [GO:0006584]; cellular response to cocaine [GO:0071314]; cellular response to phosphate starvation [GO:0016036]; cerebellar cortex morphogenesis [GO:0021696]; cholesterol... | axon [GO:0030424]; cell body [GO:0044297]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; glutamatergic synapse [GO:0098978]; membrane [GO:0016020]; mitochondrion [GO:0005739]; postsynapse [GO:0098794]; postsynaptic membrane [GO:0045211]; vesicle [GO:0031982] | catechol O-methyltransferase activity [GO:0016206]; L-dopa O-methyltransferase activity [GO:0102084]; magnesium ion binding [GO:0000287]; orcinol O-methyltransferase activity [GO:0102938] | PF01596; | 3.40.50.150; | Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family | null | SUBCELLULAR LOCATION: [Isoform Soluble]: Cytoplasm {ECO:0000250|UniProtKB:P22734}.; SUBCELLULAR LOCATION: [Isoform Membrane-bound]: Cell membrane {ECO:0000250|UniProtKB:P22734}; Single-pass type II membrane protein {ECO:0000255}; Extracellular side {ECO:0000250|UniProtKB:P22734}. | CATALYTIC ACTIVITY: Reaction=a catechol + S-adenosyl-L-methionine = a guaiacol + H(+) + S-adenosyl-L-homocysteine; Xref=Rhea:RHEA:17877, ChEBI:CHEBI:15378, ChEBI:CHEBI:33566, ChEBI:CHEBI:57856, ChEBI:CHEBI:59789, ChEBI:CHEBI:134251; EC=2.1.1.6; Evidence={ECO:0000250|UniProtKB:P21964}; PhysiologicalDirection=left-to-rig... | null | null | null | null | FUNCTION: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. {ECO:0000269|PubMed:18794526}. | Mus musculus (Mouse) |
O88593 | PGRP1_MOUSE | MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE | null | null | antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; apoptotic process [GO:0006915]; biological process involved in interaction with host [GO:0051701]; defense response to Gram-positive bacterium [GO:0050830]; detection of bacterium [GO:0016045]; innate immune response [GO:0045087]; kil... | cytoplasm [GO:0005737]; extracellular space [GO:0005615] | cytokine activity [GO:0005125]; Hsp70 protein binding [GO:0030544]; molecular adaptor activity [GO:0060090]; N-acetylmuramoyl-L-alanine amidase activity [GO:0008745]; peptidoglycan binding [GO:0042834]; peptidoglycan immune receptor activity [GO:0016019]; zinc ion binding [GO:0008270] | PF01510; | 3.40.80.10; | N-acetylmuramoyl-L-alanine amidase 2 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:9660837}. Secreted {ECO:0000269|PubMed:14585845, ECO:0000269|PubMed:9660837}. Note=Exists in both soluble and membrane-associated forms. | null | null | null | null | null | FUNCTION: Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity (PubMed:12649138, PubMed:9660837, PubMed:9707603). Forms an equi... | Mus musculus (Mouse) |
O88597 | BECN1_MOUSE | MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMG... | null | null | amyloid-beta metabolic process [GO:0050435]; angiogenesis [GO:0001525]; apoptotic process [GO:0006915]; autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; autophagy [GO:0006914]; cell division [GO:0051301]; cellular response to aluminum ion [GO:0071275]; cellular response to amino acid starvati... | autophagosome [GO:0005776]; cytoplasm [GO:0005737]; cytoplasmic side of mitochondrial outer membrane [GO:0032473]; cytoplasmic vesicle [GO:0031410]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; dendrite [GO:0030425]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; membrane [GO:0016020];... | GTPase binding [GO:0051020]; identical protein binding [GO:0042802]; phosphatidylinositol 3-kinase binding [GO:0043548]; protein kinase binding [GO:0019901]; protein-macromolecule adaptor activity [GO:0030674]; ubiquitin protein ligase binding [GO:0031625] | PF04111;PF17675;PF15285; | 6.10.250.3110;1.10.418.40; | Beclin family | PTM: Phosphorylation at Thr-117 by DAPK1 reduces its interaction with BCL2 and BCL2L1 and promotes induction of autophagy (By similarity). In response to autophagic stimuli, phosphorylated at serine residues by AMPK in an ATG14-dependent manner, and this phosphorylation is critical for maximally efficient autophagy. {E... | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12372286}. Golgi apparatus, trans-Golgi network membrane {ECO:0000250|UniProtKB:Q14457}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q14457}. Endosome membrane {ECO:0000250|UniProtKB:Q14457}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q14457}. Endoplasm... | null | null | null | null | null | FUNCTION: Plays a central role in autophagy (PubMed:10604474, PubMed:12372286, PubMed:19270693, PubMed:28445460). Acts as a core subunit of different PI3K complex forms that mediate formation of phosphatidylinositol 3-phosphate and are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is invo... | Mus musculus (Mouse) |
O88600 | HSP74_RAT | MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACVSFGPKNRSVGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPSFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKVRALLRLSQECEKLKKLMSANASDLPLSIECFMNDIDVSGTMNRGKFLEMCDDLLARVEPP... | null | null | chaperone-mediated protein complex assembly [GO:0051131]; kidney development [GO:0001822]; negative regulation of apoptotic process [GO:0043066]; negative regulation of gene expression [GO:0010629]; negative regulation of protein phosphorylation [GO:0001933]; neuron apoptotic process [GO:0051402]; positive regulation o... | cytosol [GO:0005829]; extracellular exosome [GO:0070062]; lipid droplet [GO:0005811]; mitochondrion [GO:0005739]; nucleus [GO:0005634] | adenyl-nucleotide exchange factor activity [GO:0000774]; ATP binding [GO:0005524]; ATP-dependent protein folding chaperone [GO:0140662]; protein-containing complex binding [GO:0044877]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629] | PF00012; | 1.20.1270.10;3.30.30.30;3.30.420.40; | Heat shock protein 70 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. | null | null | null | null | null | null | Rattus norvegicus (Rat) |
O88602 | CCG2_MOUSE | MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRT... | null | null | eye blink reflex [GO:0060082]; membrane depolarization [GO:0051899]; membrane hyperpolarization [GO:0060081]; nervous system process [GO:0050877]; neuromuscular junction development [GO:0007528]; neurotransmitter receptor internalization [GO:0099590]; neurotransmitter receptor localization to postsynaptic specializatio... | AMPA glutamate receptor complex [GO:0032281]; cell surface [GO:0009986]; cerebellar mossy fiber [GO:0044300]; glutamatergic synapse [GO:0098978]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; postsynaptic density membrane [GO:0098839]; Schaffer collateral - CA1 synapse [GO:0098685]; somatodendritic compartment [... | channel regulator activity [GO:0016247]; ionotropic glutamate receptor binding [GO:0035255]; voltage-gated calcium channel activity [GO:0005245] | PF00822; | 1.20.140.150; | PMP-22/EMP/MP20 family, CACNG subfamily | PTM: Phosphorylation of Thr-321 by PKA impairs interaction with DLG1 and DLG4. {ECO:0000269|PubMed:11805122}. | SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. Synapse, synaptosome {ECO:0000250|UniProtKB:Q71RJ2}. | null | null | null | null | null | FUNCTION: Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor ... | Mus musculus (Mouse) |
O88609 | LMX1B_MOUSE | MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIV... | null | null | camera-type eye development [GO:0043010]; cell population proliferation [GO:0008283]; central nervous system neuron development [GO:0021954]; cerebellum morphogenesis [GO:0021587]; collagen fibril organization [GO:0030199]; dopaminergic neuron differentiation [GO:0071542]; dorsal/ventral pattern formation [GO:0009953];... | nucleus [GO:0005634] | DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977] | PF00046;PF00412; | 2.10.110.10;1.10.10.60; | null | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00108}. | null | null | null | null | null | FUNCTION: Transcription factor involved in the regulation of podocyte-expressed genes. Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. {ECO:0000250|UniProtKB:O60663}. | Mus musculus (Mouse) |
O88618 | FTCD_RAT | MSQLVECVPNFSEGNNQEVIDAISQAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALSAARTASQLIDMRKHKGEHPRMGALDVCPFIPVRGVSMDECVLCAKAFGQRLAEELNVPVYLYGEAAQMPSRQTLPAIRAGEYEALPEKLKQAEWVPDFGPSSFVPSWGATVTGARKFLIAFNINLLSTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLEEKNLAQVSTNLLDFEVTALHTVYEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDKEKLFVLEEEHRIRLVVNRLGLDSLAPFDPKER... | 2.1.2.5; 4.3.1.4 | null | cytoskeleton organization [GO:0007010]; histidine catabolic process to glutamate and formamide [GO:0019556]; histidine catabolic process to glutamate and formate [GO:0019557] | centriole [GO:0005814]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; plasma membrane [GO:0005886]; smooth endoplasmic reticulum membrane [GO:0030868] | folic acid binding [GO:0005542]; formimidoyltetrahydrofolate cyclodeaminase activity [GO:0030412]; glutamate formimidoyltransferase activity [GO:0030409]; intermediate filament binding [GO:0019215]; microtubule binding [GO:0008017] | PF02971;PF04961;PF07837; | 1.20.120.680;3.30.70.670;3.30.990.10; | Cyclodeaminase/cyclohydrolase family; Formiminotransferase family | null | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q9YH58}. Golgi apparatus {ECO:0000269|PubMed:12160147, ECO:0000269|PubMed:9677387}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole {ECO:0000250|UniProtKB:O95954}. Note=More abundantly located around the mother centriole. {ECO... | CATALYTIC ACTIVITY: Reaction=5-formimidoyltetrahydrofolate + L-glutamate = (6S)-5,6,7,8-tetrahydrofolate + N-formimidoyl-L-glutamate; Xref=Rhea:RHEA:15097, ChEBI:CHEBI:29985, ChEBI:CHEBI:57453, ChEBI:CHEBI:57456, ChEBI:CHEBI:58928; EC=2.1.2.5; Evidence={ECO:0000269|PubMed:9677387}; PhysiologicalDirection=right-to-left;... | null | PATHWAY: Amino-acid degradation; L-histidine degradation into L-glutamate; L-glutamate from N-formimidoyl-L-glutamate (transferase route): step 1/1. {ECO:0000305|PubMed:9677387}. | null | null | FUNCTION: Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool. {ECO:0000269|PubMed:9677387}.; FUNCTION: Binds and promotes bundling of vimentin filaments originating from the Golgi. {ECO:0000269|PubMed:12160147}. | Rattus norvegicus (Rat) |
O88621 | FOXH1_MOUSE | MASGWDLASTYTPTTPSPQLALAPAQGYLPCMGPRDNSQLRPPEAESLSKTPKRRKKRYLRHDKPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFHKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGTHRAFAKDLSPYVLHGQPYQPPSPPPPPREGFSIKSLLGDPGKESTWPQHPGLPGQSTAAQAGTLSKGEEGMGTGPSSSSETPLWPLCSLPGPTIIEGESSQGEVIRPSPVTPDQGSWPLHLLEDSADSRGVPRRGSRASLWGQLPTSYLPIYT... | null | null | anterior/posterior pattern specification [GO:0009952]; aorta morphogenesis [GO:0035909]; axial mesoderm development [GO:0048318]; cardiac right ventricle morphogenesis [GO:0003215]; cellular response to cytokine stimulus [GO:0071345]; determination of left/right symmetry [GO:0007368]; embryonic heart tube anterior/post... | activin responsive factor complex [GO:0032444]; chromatin [GO:0000785]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667] | bHLH transcription factor binding [GO:0043425]; co-SMAD binding [GO:0070410]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; nuclear androgen receptor binding [GO:0050681]; protein domain specific b... | PF00250; | 1.10.10.10; | null | null | SUBCELLULAR LOCATION: Nucleus. | null | null | null | null | null | FUNCTION: Transcriptional activator. Recognizes and binds to the DNA sequence 5'-TGT[GT][GT]ATT-3'. Required for induction of the goosecoid (GSC) promoter by TGF-beta or activin signaling. Forms a transcriptionally active complex containing FOXH1/SMAD2/SMAD4 on a site on the GSC promoter called TARE (TGF-beta/activin r... | Mus musculus (Mouse) |
O88622 | PARG_MOUSE | MSAGPGWEPCTKRPRWGAAGTSAPTASDSRSFPGRQRRVLDPKDAPVQFRVPPSSPACVSGRAGPHRGNATSFVFKQKTITTWMDTKGPKTAESESKENNNTRIDSMMSSVQKDNFYPHKVEKLENVPQLNLDKSPTEKSSQYLNQQQTASVCKWQNEGKHAEQLLASEPPAGTPLPKQLSNANIGQSPHTDDHSDTDHEEDRDNQQFLTPIKLANTKPTVGDGQARSNCKCSGSRQSVKDCTGCQQEEVDVLPESPLSDVGAEDIGTGPKNDNKLTGQESSLGDSPPFEKESEPESPMDVDNSKNSCQDSEADEETSPV... | 3.2.1.143 | null | ATP generation from poly-ADP-D-ribose [GO:1990966]; carbohydrate metabolic process [GO:0005975]; detection of bacterium [GO:0016045]; DNA damage response [GO:0006974]; nucleotide-sugar metabolic process [GO:0009225]; positive regulation of DNA repair [GO:0045739]; regulation of DNA repair [GO:0006282] | chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634] | chromatin binding [GO:0003682]; poly(ADP-ribose) glycohydrolase activity [GO:0004649] | PF05028;PF20811; | null | Poly(ADP-ribose) glycohydrolase family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:Q86W56}. Note=Colocalizes with PCNA at replication foci. Relocalizes to the cytoplasm in response to DNA damage (By similarity). {ECO:0000250|UniProtKB:Q86W56}. | CATALYTIC ACTIVITY: Reaction=[(1''->2')-ADP-alpha-D-ribose](n) + H2O = [(1''->2')-ADP-alpha-D-ribose](n-1) + ADP-D-ribose; Xref=Rhea:RHEA:52216, Rhea:RHEA-COMP:16922, Rhea:RHEA-COMP:16923, ChEBI:CHEBI:15377, ChEBI:CHEBI:57967, ChEBI:CHEBI:142512; EC=3.2.1.143; Evidence={ECO:0000250|UniProtKB:Q86W56}; | null | null | null | null | FUNCTION: Poly(ADP-ribose) glycohydrolase that degrades poly(ADP-ribose) by hydrolyzing the ribose-ribose bonds present in poly(ADP-ribose). PARG acts both as an endo- and exoglycosidase, releasing poly(ADP-ribose) of different length as well as ADP-ribose monomers. It is however unable to cleave the ester bond between... | Mus musculus (Mouse) |
O88623 | UBP2_MOUSE | MSQLSSTLKRYTESSRYTDAPYAKPGYGTYTPSSYGANLAASFLEKEKLGFKPVSPTSFLPRPRTYGPSSILDCDRGRPLLRSDIIGSSKRSESQTRGNERPSGSGLNGGSGFSYGVSSNSLSYLPMNARDQGVTLSQKKSNSQSDLARDFSSLRTSDGYRTSDGYRTSEGFRIDPGNLGRSPMLARTRKELCALQGLYQAASRSEYLTDYLENYGRKGSAPQVLTQAPPPSRVPEVLSPTYRPSGRYTLWEKSKGQASGPSRSSSPGRDTMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLGH... | 3.4.19.12 | null | cell cycle [GO:0007049]; circadian behavior [GO:0048512]; circadian regulation of gene expression [GO:0032922]; entrainment of circadian clock by photoperiod [GO:0043153]; locomotor rhythm [GO:0045475]; muscle organ development [GO:0007517]; negative regulation of calcium ion transport [GO:0051926]; negative regulation... | centrosome [GO:0005813]; cytoplasm [GO:0005737]; membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471] | cyclin binding [GO:0030332]; cysteine-type deubiquitinase activity [GO:0004843]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; ubiquitin protein ligase binding [GO:0031625] | PF00443; | 3.90.70.10; | Peptidase C19 family, USP2 subfamily | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:14686789}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:14686789}. Note=Localizes in the spermatid head in late-elongating spermatids in the thin area between the outer acrosomal membrane and the plasma membrane. {ECO:0000250|UniProtKB:Q5U349}.; SUBCELLULAR LOCAT... | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; | null | null | null | null | FUNCTION: Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1 (By similarity). Isoform 1 and isoform 2 possess both ubiquitin-specific peptidase and isopeptidase activities (By similarity). Deubiquitinates MDM2 without reversing MDM2-mediated p53/TP53 ubiquitination and thus in... | Mus musculus (Mouse) |
O88627 | S28A2_MOUSE | MEKSKGRKSVSQATVENCMENPGLELMEGGNLEQRYTQEEVTQGHSLEDGLGHSSLWSRRIFQPFTKARSFFERHAGLFRKILLGLLCLAYAAYFLAACILNFQRALALFVITCLVIFILACHFLKKFFPKEQLRCLKPLENTHLNLWAKRVFVGLSVVGLILWLALDTAQRPEQLISFAGICMFILILFACSKHHSAVCWRTVFWGLGLQFIFGILVIRTEPGFNAFQWLGDQIQIFLAYTVEGSSFVFGDTLVQNVFAFQSLPIIIFFGCVMSILYYLGLVQWVIQKVAWFLQITMGTTAAETLAVAGNIFVGMTEAP... | null | null | nucleoside transmembrane transport [GO:1901642]; protein localization to cell surface [GO:0034394]; purine nucleoside transmembrane transport [GO:0015860]; retina homeostasis [GO:0001895] | apicolateral plasma membrane [GO:0016327]; brush border membrane [GO:0031526]; coated vesicle [GO:0030135]; plasma membrane [GO:0005886]; vesicle membrane [GO:0012506] | nucleoside transmembrane transporter activity [GO:0005337]; nucleoside:sodium symporter activity [GO:0005415]; purine nucleoside transmembrane transporter activity [GO:0015211] | PF07670;PF07662;PF01773; | null | Concentrative nucleoside transporter (CNT) (TC 2.A.41) family | null | SUBCELLULAR LOCATION: Membrane {ECO:0000250|UniProtKB:O43868}; Multi-pass membrane protein {ECO:0000255}. Apicolateral cell membrane {ECO:0000250|UniProtKB:O43868}; Multi-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=adenosine(out) + Na(+)(out) = adenosine(in) + Na(+)(in); Xref=Rhea:RHEA:69927, ChEBI:CHEBI:16335, ChEBI:CHEBI:29101; Evidence={ECO:0000250|UniProtKB:O43868}; CATALYTIC ACTIVITY: Reaction=inosine(out) + Na(+)(out) = inosine(in) + Na(+)(in); Xref=Rhea:RHEA:69931, ChEBI:CHEBI:17596, ChEBI:CHEB... | null | null | null | null | FUNCTION: Sodium-dependent and purine-selective transporter. Exhibits the transport characteristics of the nucleoside transport system cif or N1 subtype (N1/cif) (selective for purine nucleosides and uridine). Plays a critical role in specific uptake and salvage of purine nucleosides in kidney and other tissues. May co... | Mus musculus (Mouse) |
O88632 | SEM3F_MOUSE | MLVTAFILWASLLTGAWPATPIQDQLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECILSGKDGNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQALPWTQMQVVRGRGSRATDGADRPTPTAPRQDYIFYLEPEKLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQTAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGHCCLVNKWSTFLKA... | null | null | axon extension involved in axon guidance [GO:0048846]; axon guidance [GO:0007411]; branchiomotor neuron axon guidance [GO:0021785]; facial nerve structural organization [GO:0021612]; negative chemotaxis [GO:0050919]; negative regulation of axon extension involved in axon guidance [GO:0048843]; nerve development [GO:002... | extracellular space [GO:0005615]; glutamatergic synapse [GO:0098978]; plasma membrane [GO:0005886] | chemorepellent activity [GO:0045499]; semaphorin receptor binding [GO:0030215] | PF01403; | 2.60.40.10;3.30.1680.10;2.130.10.10; | Semaphorin family | null | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. | null | null | null | null | null | null | Mus musculus (Mouse) |
O88634 | PAR4_MOUSE | MCWPLLYPLVLGLSISLAEGIQTPSIYDDVESTRGSHEGPLGPTVELKEPKSSDKPNPRGYPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVPRLPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRMLCHDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTALVLFSAVASFTPSNVLLVLHYS... | null | null | platelet aggregation [GO:0070527]; positive regulation of release of sequestered calcium ion into cytosol [GO:0051281]; positive regulation of Rho protein signal transduction [GO:0035025] | plasma membrane [GO:0005886] | G protein-coupled receptor activity [GO:0004930]; protease binding [GO:0002020]; thrombin-activated receptor activity [GO:0015057] | PF00001; | 1.20.1070.10; | G-protein coupled receptor 1 family | PTM: A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand. | SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. | null | null | null | null | null | FUNCTION: Receptor for activated thrombin or trypsin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation. | Mus musculus (Mouse) |
O88643 | PAK1_MOUSE | MSNNGVDIQDKPPAPPMRNTSTMIGAGSKDTGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKREKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSKKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTPFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMR... | 2.7.11.1 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProtKB:Q13153}; | actin cytoskeleton organization [GO:0030036]; amygdala development [GO:0021764]; apoptotic process [GO:0006915]; branching morphogenesis of an epithelial tube [GO:0048754]; cell migration [GO:0016477]; cellular response to insulin stimulus [GO:0032869]; cellular response to organic cyclic compound [GO:0071407]; chromat... | axon [GO:0030424]; cell-cell junction [GO:0005911]; centrosome [GO:0005813]; chromosome [GO:0005694]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; focal adhesion [GO:0005925]; GABA-ergic synapse [GO:0098982]; glutamatergic synapse [GO:0098978]; growth cone [GO:0030426]; intercalated disc [GO:0014704]; lamellipodium [... | ATP binding [GO:0005524]; collagen binding [GO:0005518]; gamma-tubulin binding [GO:0043015]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00786;PF00069; | 3.90.810.10;1.10.510.10; | Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily | PTM: Autophosphorylated in trans, meaning that in a dimer, one kinase molecule phosphorylates the other one. Activated by autophosphorylation at Thr-423 in response to a conformation change, triggered by interaction with GTP-bound CDC42 or RAC1. Activated by phosphorylation at Thr-423 by BRSK2 and by PDPK1. Phosphoryla... | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q13153}. Cell junction, focal adhesion {ECO:0000250|UniProtKB:Q13153}. Cell projection, lamellipodium {ECO:0000250|UniProtKB:Q13153}. Cell membrane {ECO:0000250|UniProtKB:Q13153}. Cell projection, ruffle membrane {ECO:0000250|UniProtKB:Q13153}. Cell projection, inv... | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000250|UniProtKB:Q13153}; CATALYTI... | null | null | null | null | FUNCTION: Protein kinase involved in intracellular signaling pathways downstream of integrins and receptor-type kinases that plays an important role in cytoskeleton dynamics, in cell adhesion, migration, proliferation, apoptosis, mitosis, and in vesicle-mediated transport processes (PubMed:10611223, PubMed:12165471, Pu... | Mus musculus (Mouse) |
O88653 | LTOR3_MOUSE | MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEVS | null | null | cellular response to amino acid stimulus [GO:0071230]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of TOR signaling [GO:0032008]; positive regulation of TORC1 signaling [GO:1904263]; protein localization [GO:0008104]; protein localization to cell junction [GO:1902414]; TORC1 signaling [GO:0038... | FNIP-folliculin RagC/D GAP [GO:1990877]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; Ragulator complex [GO:0071986] | guanyl-nucleotide exchange factor activity [GO:0005085]; kinase activator activity [GO:0019209]; molecular adaptor activity [GO:0060090] | PF08923; | 3.30.450.30; | LAMTOR3 family | null | SUBCELLULAR LOCATION: Late endosome membrane {ECO:0000269|PubMed:15263099, ECO:0000269|PubMed:19177150}; Peripheral membrane protein {ECO:0000269|PubMed:15263099, ECO:0000269|PubMed:19177150}; Cytoplasmic side {ECO:0000269|PubMed:15263099, ECO:0000269|PubMed:19177150}. Note=Recruited to lysosome and endosome membranes ... | null | null | null | null | null | FUNCTION: As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed:15263099). Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulato... | Mus musculus (Mouse) |
O88658 | KIF1B_RAT | MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTSPEDPCFASQSRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEDMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKKTDFIPYRDSVLTWLLRENLG... | null | null | anterograde axonal transport [GO:0008089]; anterograde neuronal dense core vesicle transport [GO:1990048]; cellular response to nerve growth factor stimulus [GO:1990090]; cytoskeleton-dependent intracellular transport [GO:0030705]; lysosome localization [GO:0032418]; microtubule-based movement [GO:0007018]; mitochondri... | axon [GO:0030424]; axon cytoplasm [GO:1904115]; cytoplasmic vesicle [GO:0031410]; cytoplasmic vesicle membrane [GO:0030659]; dendrite [GO:0030425]; kinesin complex [GO:0005871]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; mitochondrion [GO:0005739]; neuron projection [GO:0043005]; synaptic ve... | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; kinase binding [GO:0019900]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]; plus-end-directed microtubule motor activity [GO:0008574]; scaffold protein binding [GO:0097110] | PF12473;PF00498;PF12423;PF00225;PF16183;PF00169; | 2.60.200.20;6.10.250.2520;3.40.850.10;2.30.29.30; | TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Unc-104 subfamily | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000250}. Mitochondrion {ECO:0000250|UniProtKB:O60333}. Cell projection, axon {ECO:0000250|UniProtKB:Q60575}.; SUBCELLULAR LOCATION: [Isoform 1]: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle {ECO:0000269|PubMed:12204119}. | null | null | null | null | null | FUNCTION: Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility (By similarity). {ECO:0000250}.; FUNCTION: [Isoform 1]: Mediates the transport of synaptic vesicles in neuronal cells. {ECO:0000269|PubMed:12204119}.; FUNCTION: [Isoform 2]: Involved in the translocation of lysosomes... | Rattus norvegicus (Rat) |
O88662 | EMP2_MOUSE | MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSFSADLWRVCTNSTNCTEINELTGPEAFEGYSVMQAVQATMILSTILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKLYYLLQEGSYGYSFILAWVAFAFTFISGLMYMILRKRK | null | null | actin filament organization [GO:0007015]; actin-mediated cell contraction [GO:0070252]; activation of protein kinase activity [GO:0032147]; apoptotic process [GO:0006915]; bleb assembly [GO:0032060]; blood vessel endothelial cell migration [GO:0043534]; cell adhesion [GO:0007155]; cell migration [GO:0016477]; cell-matr... | apical part of cell [GO:0045177]; apical plasma membrane [GO:0016324]; cell surface [GO:0009986]; cytoplasm [GO:0005737]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; membrane raft [GO:0045121]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471] | integrin binding [GO:0005178]; protein kinase binding [GO:0019901] | PF00822; | 1.20.140.150; | PMP-22/EMP/MP20 family | null | SUBCELLULAR LOCATION: Golgi apparatus membrane {ECO:0000269|PubMed:12189152, ECO:0000269|PubMed:14978215, ECO:0000269|PubMed:16487956, ECO:0000305}; Multi-pass membrane protein {ECO:0000255}. Cell membrane {ECO:0000269|PubMed:12189152}. Apical cell membrane {ECO:0000269|PubMed:16216233, ECO:0000269|PubMed:18400107}. Me... | null | null | null | null | null | FUNCTION: Functions as a key regulator of cell membrane composition by regulating protein surface expression. Also, plays a role in regulation of processes including cell migration, cell proliferation, cell contraction and cell adhesion. Regulates transepithelial migration of neutrophils into the alveolar lumen, potent... | Mus musculus (Mouse) |
O88664 | TAOK1_RAT | MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHMFVLRERPETVLIDLIQRTKDAVRELDNLQYRKMKKLLFQEA... | 2.7.11.1 | null | central nervous system neuron development [GO:0021954]; DNA damage response [GO:0006974]; DNA repair [GO:0006281]; execution phase of apoptosis [GO:0097194]; microtubule cytoskeleton organization [GO:0000226]; mitotic G2 DNA damage checkpoint signaling [GO:0007095]; negative regulation of microtubule depolymerization [... | cytoplasm [GO:0005737]; microtubule cytoskeleton [GO:0015630]; perinuclear region of cytoplasm [GO:0048471] | alpha-tubulin binding [GO:0043014]; ATP binding [GO:0005524]; beta-tubulin binding [GO:0048487]; kinase activity [GO:0016301]; myosin V binding [GO:0031489]; protein kinase activator activity [GO:0030295]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106... | PF00069; | 1.10.510.10; | Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily | PTM: Proteolytically processed by caspase-3 (CASP3). {ECO:0000250}.; PTM: Autophosphorylated (By similarity). Phosphorylated by ATM in response to DNA damage. Phosphorylated by LRRK2 (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:14517247}; CATALYTIC... | null | null | null | null | FUNCTION: Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylati... | Rattus norvegicus (Rat) |
O88665 | BRD7_MOUSE | MGKKHKKHKSDRHFYEEYVEKPLKLVLKVGGSEVTELSTGSSGHDSSLFEDRSDHDKHKDRKRKKRKKGEKQAPGEEKGRKRRRVKEDKKKRDRDRAENEVDRDLQCHVPIRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMSDLQKTRKQKERTDACQSGEDSGCWQREREDSGDAETQAFRSPAKDNKRKDKDVLEDKWRSSNSEREHEQIER... | null | null | cell cycle [GO:0007049]; chromatin remodeling [GO:0006338]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of G1/S transition of mitotic cell cycle [GO:2000134]; positive regulation of cell differentiation [GO:0045597]; positive regulation of double-strand break repair [GO:2000781]... | chromatin [GO:0000785]; kinetochore [GO:0000776]; nuclear matrix [GO:0016363]; nucleus [GO:0005634]; RSC-type complex [GO:0016586] | histone binding [GO:0042393]; lysine-acetylated histone binding [GO:0070577]; p53 binding [GO:0002039]; transcription coactivator activity [GO:0003713]; transcription corepressor activity [GO:0003714] | PF00439;PF12024; | 1.20.920.10; | null | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10526152, ECO:0000269|PubMed:19909775}. Chromosome {ECO:0000250|UniProtKB:Q9NPI1}. | null | null | null | null | null | FUNCTION: Acts both as coactivator and as corepressor. May play a role in chromatin remodeling. Transcriptional corepressor that down-regulates the expression of target genes. Binds to target promoters, leading to increased histone H3 acetylation at 'Lys-9' (H3K9ac). Binds to the ESR1 promoter. Recruits BRCA1 and POU2F... | Mus musculus (Mouse) |
O88667 | RAD_MOUSE | MTLNGGSGASGSRGAGGRERDRRRGSTPWGPAPPLHRRSMPVDERDLQAALAPGSLATTAAGTRTQGQRLDWPEGSSDSLSSGGSGSEEGVYKVLLLGAPGVGKSALARIFGGIEDGPEAEAAGHTYDRSITVDGEEASLLVYDIWEEDGGCWLPGHCMAMGDAYVIVYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEDNARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL | null | null | negative regulation of cell growth [GO:0030308] | plasma membrane [GO:0005886]; T-tubule [GO:0030315] | calcium channel regulator activity [GO:0005246]; calmodulin binding [GO:0005516]; GTP binding [GO:0005525]; GTPase activity [GO:0003924] | PF00071; | 3.40.50.300; | Small GTPase superfamily, RGK family | PTM: Phosphorylation at Ser-26, Ser-39, Ser-273 and Ser-301 may be involved in regulating inhibition of voltage-gated L-type Ca(2+) channels. {ECO:0000269|PubMed:36424916}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:17525370}. | null | null | null | null | null | FUNCTION: May regulate basal voltage-dependent L-type Ca(2+) currents and be required for beta-adrenergic augmentation of Ca(2+) influx in cardiomyocytes, thereby regulating increases in heart rate and contractile force (PubMed:36424916). May play an important role in cardiac antiarrhythmia via the strong suppression o... | Mus musculus (Mouse) |
O88668 | CREG1_MOUSE | MAARAPELARSLLAALLAPALVALLVSPASGRGGRDHGDWDVDRRLPPLPPREDGPRVARFVTHVSDWGSLATISTIKEVRGWPFADIISISDGPPGEGTGEPYMYLSPLQQAVSDLQENPEATLTMSLAQTVYCRNHGFDPQSPLCVHIMMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVLDYFGGPKVVTPEEYFNVTLQ | null | null | autophagy [GO:0006914]; endocytosis [GO:0006897]; lysosomal lumen acidification [GO:0007042]; lysosome organization [GO:0007040]; regulation of DNA-templated transcription [GO:0006355] | endosome [GO:0005768]; extracellular space [GO:0005615]; lysosome [GO:0005764]; transcription regulator complex [GO:0005667] | insulin-like growth factor receptor binding [GO:0005159] | PF13883; | null | CREG family | PTM: N-glycosylated. {ECO:0000250}. | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. | null | null | null | null | null | FUNCTION: May contribute to the transcriptional control of cell growth and differentiation. Antagonizes transcriptional activation and cellular transformation by the adenovirus E1A protein. The transcriptional control activity of cell growth requires interaction with IGF2R (By similarity). {ECO:0000250}. | Mus musculus (Mouse) |
O88671 | DLL3_RAT | MVSLQVSSLPQTLILAFLLPQALPAGVFELQIHSFGPGPGPGTPRSPCNARGPCRLFFRVCLKPGVSQEAAESLCALGAALSTSGPVYTEQPGVPAAALSLPDGLVRVPFLDAWPGTFSLIIETWREQLGERAAGPAWNLLARVAGRRRLAAGAPWARDVQRTGAWELHFSYRARCEPPAVGAACARLCRSRSAPSRCGPGLRPCTPFPDECEAPRESLTVCRAGCSPEHGYCEEPDECHCLEGWTGPLCTVPVSTSSCLNSRVSGPAGTGCLLPGPGPCDGNPCANGGSCSETPGSFECACPRGFYGPRCEVSGVTCAD... | null | null | cell fate determination [GO:0001709]; compartment pattern specification [GO:0007386]; negative regulation of astrocyte differentiation [GO:0048712]; negative regulation of neurogenesis [GO:0050768]; negative regulation of Notch signaling pathway [GO:0045746]; Notch signaling pathway [GO:0007219]; paraxial mesoderm deve... | plasma membrane [GO:0005886] | calcium ion binding [GO:0005509]; Notch binding [GO:0005112] | PF00008;PF12661;PF07657; | 2.60.40.3510;2.10.25.10; | null | PTM: Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation. {ECO:0000250}. | SUBCELLULAR LOCATION: Membrane {ECO:0000250}; Single-pass type I membrane protein {ECO:0000250}. | null | null | null | null | null | FUNCTION: Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm (By similarity). {ECO:0000250}. | Rattus norvegicus (Rat) |
O88673 | DGKA_MOUSE | MAKEKGLISPEDFAQLQKYIEYSTKRVSDVLKVFDDGEMNRFCQGDAIGYLGFEQFMKMYLEMEEVPHHLCWALFWSFHTSQVAAEKTKSKANVICLSDVYCYFTLLEGGRPEDKLEFTFKLYDMDRNGILDSTEVEKIILQMMRVAEYLDWDVSELRPILQEMMREMDQDGSGSVSLDEWVRAGATTVPLLVLLGMDVTMKDDGNHIWRPKRFTRLVYCNLCEQSISLGKQGLSCNFCKYIVHDHCAMKAQPCEVSTYAKSRKDIGVQSHLWVRGGCHSGRCDRCQKKIRTYHSLTGLHCVWCHLEIHDDCLQAVGPEC... | 2.7.1.107; 2.7.1.93 | null | diacylglycerol metabolic process [GO:0046339]; intracellular signal transduction [GO:0035556]; lipid phosphorylation [GO:0046834]; phosphatidic acid biosynthetic process [GO:0006654]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205] | cytosol [GO:0005829]; plasma membrane [GO:0005886] | alkylglycerol kinase activity [GO:0047649]; ATP binding [GO:0005524]; ATP-dependent diacylglycerol kinase activity [GO:0004143]; calcium ion binding [GO:0005509]; phospholipid binding [GO:0005543] | PF00130;PF14513;PF00609;PF00781;PF13499; | 2.60.200.40;3.30.60.20;1.10.238.110;1.10.238.10; | Eukaryotic diacylglycerol kinase family | null | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000250|UniProtKB:P23743}. | CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+); Xref=Rhea:RHEA:10272, ChEBI:CHEBI:15378, ChEBI:CHEBI:17815, ChEBI:CHEBI:30616, ChEBI:CHEBI:58608, ChEBI:CHEBI:456216; EC=2.7.1.107; Evidence={ECO:0000250|UniProtKB:P23743}; PhysiologicalDirection=left-to-righ... | null | PATHWAY: Lipid metabolism; glycerolipid metabolism. {ECO:0000250|UniProtKB:P23743}. | null | null | FUNCTION: Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids. Thereby, acts as a central switch between the signaling pathways activated by these second messengers with different cellular targets and opposite e... | Mus musculus (Mouse) |
O88676 | MMP23_MOUSE | MGCRACLRPEASGAVQGRWLGAALSGLCLLSALALLEWLGAPTETAWRAAQGNVDAPNVGSSTAQVPRLLTMSVTRRRRYTLTPARLRWDHFNLTYRVLSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSAVHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTNLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWKALSQDELWGLHRLYGCLDRIFVCASWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRLVREGRNMTF... | 3.4.24.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; | collagen catabolic process [GO:0030574]; extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]; reproduction [GO:0000003] | endoplasmic reticulum membrane [GO:0005789]; extracellular matrix [GO:0031012]; extracellular space [GO:0005615] | metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270] | PF00413;PF01549; | 1.10.10.1940;3.40.390.10;2.60.40.10; | Peptidase M10A family | PTM: N-glycosylated. {ECO:0000250}.; PTM: Proteolytic cleavage might yield an active form. | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Membrane {ECO:0000269|PubMed:10471791}; Single-pass type II membrane protein {ECO:0000269|PubMed:10471791}. Note=A secreted form produced by proteolytic cleavage may also exist. {ECO:0000250}. | null | null | null | null | null | FUNCTION: Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum (By similarity). {ECO:0000250}. | Mus musculus (Mouse) |
O88680 | C3AR_CAVPO | MESSSAETNSTGLHLEPQYQPETILAMAILGLTFVLGLPGNGLVLWVAGLKMRRTVNTVWFLHLTVADFVCCLSLPFSMAHLALRGYWPYGEILCKFIPTVIIFNMFASVFLLTAISLDRCLMVLKPIWCQNHRNVRTACIICGCIWLVAFVLCIPVFVYRETFTLENHTICTYNFSPGSFDYLDYAYDRDAWGYGTPDPIVQLPGEMEHRSDPSSFQTQDGPWSVTTTLYSQTSQRPSEDSFHMDSAKLSGQGKYVDVVLPTNLCGLPMEENRTNTLHNAAFLSSDLDVSNATQKCLSTPEPPQDFWDDLSPFTHEYRT... | null | null | calcium-mediated signaling [GO:0019722]; chemotaxis [GO:0006935]; inflammatory response [GO:0006954]; phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive ... | plasma membrane [GO:0005886] | complement component C3a receptor activity [GO:0004876]; complement component C5a receptor activity [GO:0004878]; G protein-coupled receptor activity [GO:0004930] | PF00001; | 1.20.1070.10; | G-protein coupled receptor 1 family | null | SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. | null | null | null | null | null | FUNCTION: Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production. | Cavia porcellus (Guinea pig) |
O88689 | PCDA4_MOUSE | MEFSWGSGQESQRLLLSFLLLAIWEAGNSQIHYSIPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVEVEVRDINDNPPRFPTTQKNLFIAESRPLDTWFPLEGASDADIGINAVLTYRLSPNDYFSLEKPSNDERVKGLGLVLRKSLDREETPEIILVLTVTDGGKPELTGSVQLLITVLDANDNAPVFDRSLYTVKLPENVPNGTLVVKVNASDLDEGVNGDIMYSFSTDISPNVKYKFHIDPVSGEIIVKGYIDFEECKSYEILI... | null | null | cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156] | endoplasmic reticulum [GO:0005783]; membrane [GO:0016020]; plasma membrane [GO:0005886]; synapse [GO:0045202] | calcium ion binding [GO:0005509]; identical protein binding [GO:0042802] | PF00028;PF08266;PF15974; | 2.60.40.60; | null | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:9655502}; Single-pass type I membrane protein {ECO:0000305|PubMed:27161523, ECO:0000305|PubMed:9655502}. Note=Detected in dendrites and synapses. {ECO:0000269|PubMed:9655502}. | null | null | null | null | null | FUNCTION: Calcium-dependent cell-adhesion protein involved in cells self-recognition and non-self discrimination (Probable). Thereby, it is involved in the establishment and maintenance of specific neuronal connections in the brain (PubMed:27161523). {ECO:0000305|PubMed:27161523}. | Mus musculus (Mouse) |
O88693 | CEGT_MOUSE | MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPAYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFM... | 2.4.1.80 | null | cell differentiation [GO:0030154]; cornified envelope assembly [GO:1903575]; establishment of skin barrier [GO:0061436]; glucosylceramide biosynthetic process [GO:0006679]; intestinal lipid absorption [GO:0098856]; keratinocyte differentiation [GO:0030216]; leptin-mediated signaling pathway [GO:0033210]; neuron develop... | Golgi membrane [GO:0000139]; membrane [GO:0016020] | ceramide glucosyltransferase activity [GO:0008120]; dihydroceramide glucosyltransferase activity [GO:0102769] | PF13506; | null | Glycosyltransferase 2 family | null | SUBCELLULAR LOCATION: Golgi apparatus membrane {ECO:0000305|PubMed:10430909}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q9R0E0}. | CATALYTIC ACTIVITY: Reaction=an N-acylsphing-4-enine + UDP-alpha-D-glucose = a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + H(+) + UDP; Xref=Rhea:RHEA:12088, ChEBI:CHEBI:15378, ChEBI:CHEBI:22801, ChEBI:CHEBI:52639, ChEBI:CHEBI:58223, ChEBI:CHEBI:58885; EC=2.4.1.80; Evidence={ECO:0000269|PubMed:10430909}; Physiologic... | null | PATHWAY: Lipid metabolism; sphingolipid metabolism. {ECO:0000269|PubMed:10430909, ECO:0000269|PubMed:16109770, ECO:0000269|PubMed:28373486, ECO:0000269|PubMed:33361282}. | null | null | FUNCTION: Participates in the initial step of the glucosylceramide-based glycosphingolipid/GSL synthetic pathway at the cytosolic surface of the Golgi. Catalyzes the transfer of glucose from UDP-glucose to ceramide to produce glucosylceramide/GlcCer (such as beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine) (PubMed:104309... | Mus musculus (Mouse) |
O88696 | CLPP_MOUSE | MWPRVLLGEARVAVDGCRALLSRLAVHFSPPWTAVSCSPLRRSLHGTATRAFPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGSPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPELVQKETATAPTDPPAPTST | 3.4.21.92 | null | membrane protein proteolysis [GO:0033619]; protein quality control for misfolded or incompletely synthesized proteins [GO:0006515]; proteolysis involved in protein catabolic process [GO:0051603] | endopeptidase Clp complex [GO:0009368]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739] | ATP-dependent peptidase activity [GO:0004176]; ATPase binding [GO:0051117]; identical protein binding [GO:0042802]; serine-type endopeptidase activity [GO:0004252] | PF00574; | null | Peptidase S14 family | null | SUBCELLULAR LOCATION: Mitochondrion matrix {ECO:0000269|PubMed:10754102, ECO:0000269|PubMed:22710082}. | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec, and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the... | null | null | null | null | FUNCTION: Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central h... | Mus musculus (Mouse) |
O88697 | STK16_MOUSE | MGHALCVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGAKHEAWLLLPFFKKGTLWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNELSIPQSPRHSSALRQLLSSMMTVDPQQRPHIPVLLSQLEALQPPAPGQHTTQI | 2.7.10.2; 2.7.11.1 | null | cellular response to transforming growth factor beta stimulus [GO:0071560]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of vacuole fusion, non-autophagic [GO:0032889]; vacuolar protein processing [GO:0... | cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; Golgi-associated vesicle [GO:0005798]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886] | ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] | PF00069; | 1.10.510.10; | Protein kinase superfamily, Ser/Thr protein kinase family | PTM: Mainly autophosphorylated on serine/threonine residues. Also autophosphorylated on Tyr-198 (By similarity). {ECO:0000250}. | SUBCELLULAR LOCATION: Cytoplasm, perinuclear region {ECO:0000269|PubMed:9712705}. Membrane {ECO:0000250}; Lipid-anchor {ECO:0000250}. Note=Associates with Golgi and Golgi-derived vesicles. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[pr... | null | null | null | null | FUNCTION: Membrane-associated protein kinase that phosphorylates on serine and threonine residues. In vitro substrates include DRG1, ENO1 and EIF4EBP1. Also autophosphorylates (By similarity). May be involved in secretory vesicle trafficking or intracellular signaling. May have a role in regulating stromal-epithelial i... | Mus musculus (Mouse) |
O88700 | BLM_MOUSE | MAAVPLNNLQEQLQRHSARKLNNQPSLSKPKSLGFTFKKKTSEGDVSVTSVSVVKTPALSDKDVNVSEAFSFTESPLHKPKQQAKIEGFFKHFPGRQQSKGTCSEPSLPATVQTAQDTLCTTPKTPTAKKLPVAVFKKLEFSSSADSLSDWADMDDFDMSASDAFASLAKNPATRVSTAQKMKKTKRNFFKPPPRKANAVKTDLTPPSPECLQVDLTKESEEEEEEEEEAEGADCLSRDVICIDNDSASEELTEKDTQESQSLKAHLGAERGDSEKKSHEDEAVFHSVQNTEYFEHNDNDYDIDFVPPSPEEIISTASSS... | 5.6.2.4 | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250|UniProtKB:P54132}; Note=Binds 1 zinc ion per subunit. {ECO:0000250|UniProtKB:P54132}; | alpha-beta T cell differentiation [GO:0046632]; alpha-beta T cell proliferation [GO:0046633]; cellular response to camptothecin [GO:0072757]; cellular response to hydroxyurea [GO:0072711]; cellular response to ionizing radiation [GO:0071479]; cellular response to xenobiotic stimulus [GO:0071466]; chromosome organizatio... | chromosome [GO:0005694]; chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; male germ cell nucleus [GO:0001673]; nuclear chromosome [GO:0000228]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; pronucleus [GO:0045120]; RecQ family helicase-topoisomerase III complex [GO:0031422]; replication fork [GO:000... | 3'-5' DNA helicase activity [GO:0043138]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; forked DNA-dependent helicase activity [GO:0061749]; four-way junction DNA binding [GO:0000400]; four-way junction helicase activity [GO:0009378]; isome... | PF08072;PF16204;PF16202;PF00270;PF00271;PF00570;PF16124;PF09382; | 1.10.150.80;3.40.50.300;1.10.10.10; | Helicase family, RecQ subfamily | PTM: Poly-ubiquitinated by TRIM25 at Lys-264. Deubiquitinated by USP37; leading to stabilization in order to sustain the DNA damage response (By similarity). {ECO:0000250|UniProtKB:P54132, ECO:0000269|PubMed:29125140}.; PTM: Phosphorylated in response to DNA damage. Phosphorylation requires the FANCA-FANCC-FANCE-FANCF-... | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:29125140}. Note=Localized to DNA replication forks, especially after DNA damage. {ECO:0000269|PubMed:29125140}. | CATALYTIC ACTIVITY: Reaction=Couples ATP hydrolysis with the unwinding of duplex DNA by translocating in the 3'-5' direction.; EC=5.6.2.4; Evidence={ECO:0000269|PubMed:9655940}; CATALYTIC ACTIVITY: Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616... | null | null | null | null | FUNCTION: ATP-dependent DNA helicase that unwinds single- and double-stranded DNA in a 3'-5' direction (PubMed:9840919). Participates in DNA replication and repair (By similarity). Involved in 5'-end resection of DNA during double-strand break (DSB) repair: unwinds DNA and recruits DNA2 which mediates the cleavage of 5... | Mus musculus (Mouse) |
O88703 | HCN2_MOUSE | MDARGGGGRPGDSPGTTPAPGPPPPPPPPAPPQPQPPPAPPPNPTTPSHPESADEPGPRARLCSRDSACTPGAAKGGANGECGRGEPQCSPEGPARGPKVSFSCRGAASGPSAAEEAGSEEAGPAGEPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYI... | null | null | cellular response to cAMP [GO:0071320]; cellular response to cGMP [GO:0071321]; potassium ion import across plasma membrane [GO:1990573]; potassium ion transmembrane transport [GO:0071805]; regulation of membrane depolarization [GO:0003254]; regulation of membrane potential [GO:0042391]; sodium ion import across plasma... | axon [GO:0030424]; dendrite [GO:0030425]; dendrite membrane [GO:0032590]; dendritic shaft [GO:0043198]; HCN channel complex [GO:0098855]; membrane [GO:0016020]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; somatodendritic compartment [GO:0036477] | cAMP binding [GO:0030552]; identical protein binding [GO:0042802]; intracellularly cAMP-activated cation channel activity [GO:0005222]; molecular adaptor activity [GO:0060090]; PDZ domain binding [GO:0030165]; protein-containing complex binding [GO:0044877]; voltage-gated potassium channel activity [GO:0005249]; voltag... | PF00027;PF00520;PF08412; | 1.10.287.70;1.10.287.630;2.60.120.10; | Potassium channel HCN family | PTM: Phosphorylation at Ser-641 by PRKG2 shifts the voltage-dependence to more negative voltages, hence counteracting the stimulatory effect of cGMP on gating. {ECO:0000269|PubMed:21347269}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:10962006, ECO:0000269|PubMed:11096117, ECO:0000269|PubMed:12034718, ECO:0000269|PubMed:12193608, ECO:0000269|PubMed:17562314, ECO:0000269|PubMed:23103389}; Multi-pass membrane protein {ECO:0000269|PubMed:10962006, ECO:0000269|PubMed:11096117, ECO:0000269|PubMed:12... | null | null | null | null | null | FUNCTION: Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Can also transport ammonium in the distal nephron. Produces a large instantaneous current. {ECO:0000269|PubMed:10962006, ECO:00002... | Mus musculus (Mouse) |
O88704 | HCN1_MOUSE | MEGGGKPNSASNSRDDGNSVFPSKAPATGPVAADKRLGTPPGGGAAGKEHGNSVCFKVDGGGGEEPAGSFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWV... | null | null | apical protein localization [GO:0045176]; cellular response to cAMP [GO:0071320]; general adaptation syndrome, behavioral process [GO:0051867]; negative regulation of action potential [GO:0045759]; neuronal action potential [GO:0019228]; positive regulation of membrane hyperpolarization [GO:1902632]; potassium ion tran... | apical dendrite [GO:0097440]; axon [GO:0030424]; axon terminus [GO:0043679]; basolateral plasma membrane [GO:0016323]; cell surface [GO:0009986]; dendrite [GO:0030425]; dendrite membrane [GO:0032590]; dendritic shaft [GO:0043198]; glutamatergic synapse [GO:0098978]; HCN channel complex [GO:0098855]; neuronal cell body ... | cAMP binding [GO:0030552]; identical protein binding [GO:0042802]; intracellular cAMP-activated cation channel activity involved in regulation of presynaptic membrane potential [GO:0140232]; intracellularly cAMP-activated cation channel activity [GO:0005222]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547... | PF00027;PF00520;PF08412; | 1.10.287.70;1.10.287.630;2.60.120.10; | Potassium channel HCN family | PTM: N-glycosylated. {ECO:0000269|PubMed:9405696}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:11459060, ECO:0000269|PubMed:22006928, ECO:0000269|PubMed:9630217}; Multi-pass membrane protein {ECO:0000269|PubMed:22006928}. | CATALYTIC ACTIVITY: Reaction=Na(+)(in) = Na(+)(out); Xref=Rhea:RHEA:34963, ChEBI:CHEBI:29101; Evidence={ECO:0000269|PubMed:9630217}; CATALYTIC ACTIVITY: Reaction=K(+)(in) = K(+)(out); Xref=Rhea:RHEA:29463, ChEBI:CHEBI:29103; Evidence={ECO:0000269|PubMed:9630217}; | null | null | null | null | FUNCTION: Hyperpolarization-activated ion channel that are permeable to sodium and potassium ions (PubMed:12034718, PubMed:22006928, PubMed:9630217). Exhibits weak selectivity for potassium over sodium ions (PubMed:11459060). Contributes to the native pacemaker currents in heart (If) and in neurons (Ih) (PubMed:1145906... | Mus musculus (Mouse) |
O88705 | HCN3_MOUSE | MEEEARPAAGAGEAATPARETPPAAPAQARAASGGVPESAPEPKRRQLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSMNRMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVG... | null | null | cellular response to dopamine [GO:1903351]; potassium ion transmembrane transport [GO:0071805]; regulation of membrane depolarization [GO:0003254]; sodium ion transmembrane transport [GO:0035725] | axon [GO:0030424]; cone cell pedicle [GO:0044316]; dendrite [GO:0030425]; HCN channel complex [GO:0098855]; membrane [GO:0016020]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886] | cAMP binding [GO:0030552]; voltage-gated potassium channel activity [GO:0005249]; voltage-gated sodium channel activity [GO:0005248] | PF00027;PF00520;PF08412; | 1.10.287.70;1.10.287.630;2.60.120.10; | Potassium channel HCN family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:15923185, ECO:0000269|PubMed:23382386}; Multi-pass membrane protein {ECO:0000269|PubMed:15923185}. | null | null | null | null | null | FUNCTION: Hyperpolarization-activated potassium channel. May also facilitate the permeation of sodium ions. {ECO:0000269|PubMed:15923185}. | Mus musculus (Mouse) |
O88708 | ORC4_MOUSE | MSSRKTKSNAHAECLSQVQRILRERFCHHSPHSNLFGVQVQYKHLIELLKRTAIYGESNSVLIVGPRGSGKTTLLNHALKELMEIEVSENVIQVHLNGLLQTNEKIALKEITRQLNLDNVVEDKVFGSFAENLSFLLEALQKGDRTSSCPVIFILDEFDIFAHQKNQTLLYNLFDISQSAQTPVAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEFPDKAFAERWNENVHCLSEDSTVLEVLQKHFSVNKNLQSLHMLLMLALNRVTVSHPFMTSADLMEAQHMCSLDSKANIVHGLSV... | null | null | DNA replication [GO:0006260]; DNA replication initiation [GO:0006270]; polar body extrusion after meiotic divisions [GO:0040038]; protein polymerization [GO:0051258] | chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nuclear origin of replication recognition complex [GO:0005664]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA replication origin binding [GO:0003688] | PF13191;PF14629; | 3.40.50.300; | ORC4 family | null | SUBCELLULAR LOCATION: Nucleus. | null | null | null | null | null | FUNCTION: Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3 (By similarity). Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is req... | Mus musculus (Mouse) |
O88712 | CTBP1_MOUSE | MGSSHLLNKGLPLGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYS... | 1.1.1.- | COFACTOR: Name=NAD(+); Xref=ChEBI:CHEBI:57540; Evidence={ECO:0000250}; Note=Cofactor binding induces a conformational change. {ECO:0000250}; | negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; presynapse to nucleus signaling pathway [GO:0099526]; regulation of cell cycle [GO:0051726]; regulation of transcription by RNA polymerase II [GO:0006357]; synaptic vesicle clustering... | cytoplasm [GO:0005737]; extrinsic component of presynaptic endocytic zone membrane [GO:0098894]; GABA-ergic synapse [GO:0098982]; glutamatergic synapse [GO:0098978]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; presynapse [GO:0098793]; presynaptic active zone cytoplasmic component [GO:0098831]; transcription repress... | chromatin binding [GO:0003682]; DNA-binding transcription factor binding [GO:0140297]; NAD binding [GO:0051287]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]; PDZ domain binding [GO:0030165]; protein homodimerization activity [GO:0042803]; RNA polymerase II-specific... | PF00389;PF02826; | 3.40.50.720; | D-isomer specific 2-hydroxyacid dehydrogenase family | PTM: ADP-ribosylated; when cells are exposed to brefeldin A. {ECO:0000250}.; PTM: The level of phosphorylation appears to be regulated during the cell cycle. Phosphorylation by HIPK2 on Ser-423 induces proteasomal degradation (By similarity). {ECO:0000250}.; PTM: Sumoylation on Lys-429 is promoted by the E3 SUMO-protei... | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q13363}. Nucleus {ECO:0000250|UniProtKB:Q13363}. | null | null | null | null | null | FUNCTION: Corepressor targeting diverse transcription regulators such as GLIS2 or BCL6. Has dehydrogenase activity. Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex. Functions in brown adipose tissue (BAT) differentiation. {ECO:0000269|PubMed:10369679, ECO:0000269|PubM... | Mus musculus (Mouse) |
O88713 | KLRG1_MOUSE | MADSSIYSTLELPEAPQVQDESRWKLKAVLHRPHLSRFAMVALGLLTVILMSLLMYQRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY | null | null | cell surface receptor signaling pathway [GO:0007166]; innate immune response [GO:0045087] | intracellular membrane-bounded organelle [GO:0043231]; plasma membrane [GO:0005886] | carbohydrate binding [GO:0030246] | PF00059; | 3.10.100.10; | null | PTM: Phosphorylated in response to monoclonal antibody G63 binding and antigenic stimulation. {ECO:0000250}. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:19604491}; Single-pass type II membrane protein {ECO:0000269|PubMed:19604491}. | null | null | null | null | null | FUNCTION: Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on targ... | Mus musculus (Mouse) |
O88721 | V2R_MOUSE | MILVSTTSAVPGALSSPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLGALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQRDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGPSERAGRRRRGHRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEAPLERPPFVLLMLLASLNSCT... | null | null | cellular response to hormone stimulus [GO:0032870]; G protein-coupled receptor signaling pathway [GO:0007186]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of urine volume [GO:0035811]; positive regulation of blood pressure [GO:0045777]; positive regulation of cell population p... | endocytic vesicle [GO:0030139]; endosome [GO:0005768]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886] | peptide binding [GO:0042277]; signaling receptor activity [GO:0038023]; vasopressin receptor activity [GO:0005000] | PF00001; | 1.20.1070.10; | G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:P30518}; Multi-pass membrane protein {ECO:0000250|UniProtKB:P30518}. | null | null | null | null | null | FUNCTION: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption (By similarity). {ECO:0000250|UniProtKB:P30518}. | Mus musculus (Mouse) |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.