Entry stringlengths 6 10 | Entry Name stringlengths 5 11 | Sequence stringlengths 2 35.2k | EC number stringlengths 7 118 ⌀ | Cofactor stringlengths 38 1.77k ⌀ | Gene Ontology (biological process) stringlengths 18 11.3k ⌀ | Gene Ontology (cellular component) stringlengths 17 1.75k ⌀ | Gene Ontology (molecular function) stringlengths 24 2.09k ⌀ | Pfam stringlengths 8 232 ⌀ | Gene3D stringlengths 10 250 ⌀ | Protein families stringlengths 9 237 ⌀ | Post-translational modification stringlengths 16 8.52k ⌀ | Subcellular location [CC] stringlengths 29 6.18k ⌀ | Catalytic activity stringlengths 64 35.7k ⌀ | Kinetics stringlengths 69 11.7k ⌀ | Pathway stringlengths 27 908 ⌀ | pH dependence stringlengths 64 955 ⌀ | Temperature dependence stringlengths 70 1.16k ⌀ | Function [CC] stringlengths 17 15.3k ⌀ | Organism stringlengths 8 196 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
O94236 | EIF3D_SCHPO | MATGFKLPELAPVKSAWGPPETEQIGGDIPYAPFSKGDRLGKIADWSVDQPKDGREQRGRQGAFAGRFRDQYQTYGYGASSIFGYQHSEDESSFSVIDRGSVNRTRTSARNGGTLLKVRGRGQNVQRGGRGGRYGSSGGRGAGDTVVSRSSGAGGARGRRFGWKDYDKHQRLRNASVTVGDDWQLLDEVEFSHLSKLNLAAAAPVTVDSYGYIYPYDKSFDKIHVKSEKPLQALDRVHYNPTTTEDPVIQKLALNSDANIFITDSILSLLMCSTRSVYPWDIVITHQSGKLFFDKREGGPFDYLTVNENAYDSPMDADNR... | null | null | cap-dependent translational initiation [GO:0002191]; formation of cytoplasmic translation initiation complex [GO:0001732]; translational initiation [GO:0006413] | cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; eukaryotic translation initiation factor 3 complex, eIF3e [GO:0071540]; eukaryotic transla... | mRNA cap binding [GO:0098808]; translation initiation factor activity [GO:0003743] | PF05091; | null | EIF-3 subunit D family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_03003, ECO:0000269|PubMed:9892665}. | null | null | null | null | null | FUNCTION: mRNA cap-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifica... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94244 | HAT2_SCHPO | MSEEVVQDAPLENNELNAEIDLQKTIQEEYKLWKQNVPFLYDLVITHALEWPSLTIQWLPDKKTIPGTDYSIQRLILGTHTSGNDQNYLQIASVQLPNFDEDTTEFTPSTIRRAQATGSYTIEISQKIPHDGDVNRARYMPQKPEIIATMGEGGNAYIFDTTCHDALTTGEALPQAVLKGHTAEGFGLCWNPNLPGNLATGAEDQVICLWDVQTQSFTSSETKVISPIAKYHRHTDIVNDVQFHPQHEALLASVSDDCTLQIHDTRLNPEEEAPKVIQAHSKAINAVAINPFNDYLLATASADKTVALWDLRNPYQRLHT... | null | null | CENP-A containing chromatin assembly [GO:0034080]; chromatin remodeling [GO:0006338]; regulation of DNA-templated transcription [GO:0006355] | CENP-A recruiting complex [GO:0098654]; chromosome, centromeric region [GO:0000775]; cytoplasm [GO:0005737]; ESC/E(Z) complex [GO:0035098]; kinetochore [GO:0000776]; nucleus [GO:0005634]; NuRD complex [GO:0016581]; Rpd3L complex [GO:0033698]; Rpd3L-Expanded complex [GO:0070210] | H3-H4 histone complex chaperone activity [GO:0000510]; histone binding [GO:0042393]; nucleosome binding [GO:0031491] | PF12265;PF00400; | 2.130.10.10; | WD repeat RBAP46/RBAP48/MSI1 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15369671}. Nucleus {ECO:0000269|PubMed:15369671}. Chromosome, centromere {ECO:0000269|PubMed:15369671}. Chromosome, centromere, kinetochore {ECO:0000269|PubMed:15369671}. | null | null | null | null | null | FUNCTION: Regulatory subunit of the histone acetylase B (HAT-B) complex (By similarity). The complex acetylates 'Lys-12' of histone H4 which is required for telomeric silencing (By similarity). Component of the CENP-A recruiting complex that ensures the integrity of mitotic spindles through maintenance of kinetochore f... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94267 | SPT16_SCHPO | MAEYEIDEITFHKRLGILLTSWKNEEDGKTLFQDCDSILVTVGAHDDTNPYQKSTALHTWLLGYEFPSTLILLEKHRITILTSVNKANMLTKLAETKGAAADVNILKRTKDAEENKKLFEKIIEYIRATNKKVGVFPKDKTQGKFINEWDSIFEPVKSEFNLVDASLGLAKCLAIKDEQELANIKGASRVSVAVMSKYFVDELSTYIDQGKKITHSKFSDQMESLIDNEAFFQTKSLKLGDIDLDQLEWCYTPIIQSGGSYDLKPSAITDDRNLHGDVVLCSLGFRYKSYCSNVGRTYLFDPDSEQQKNYSFLVALQKKL... | null | null | chromatin organization [GO:0006325]; constitutive heterochromatin formation [GO:0140719]; DNA repair [GO:0006281]; DNA replication [GO:0006260]; DNA replication-dependent chromatin assembly [GO:0006335]; nucleosome organization [GO:0034728]; transcription elongation by RNA polymerase II [GO:0006368]; transcription elon... | euchromatin [GO:0000791]; FACT complex [GO:0035101]; nucleus [GO:0005634] | H2A-H2B histone complex chaperone activity [GO:0000511]; histone chaperone activity [GO:0140713]; nucleosome binding [GO:0031491] | PF14826;PF00557;PF08512;PF08644;PF21091; | 2.30.29.150;3.90.230.10;3.40.350.10;2.30.29.210;2.30.29.30; | Peptidase M24 family, SPT16 subfamily | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:Q9Y5B9}. Chromosome {ECO:0000250|UniProtKB:Q9Y5B9}. | null | null | null | null | null | FUNCTION: Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94272 | ATG8_SCHPO | MRSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQFVYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFGTVFPF | null | null | autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; cellular response to nitrogen starvation [GO:0006995]; macroautophagy [GO:0016236]; membrane fusion [GO:0061025]; protein transport [GO:0015031]; vacuole organization [GO:0007033] | autophagosome membrane [GO:0000421]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; fungal-type vacuole [GO:0000324]; fungal-type vacuole membrane [GO:0000329]; nucleus [GO:0005634]; phagophore assembly site [GO:0000407] | phosphatidylethanolamine binding [GO:0008429]; ubiquitin protein ligase binding [GO:0031625] | PF02991; | null | ATG8 family | PTM: The C-terminal 5 residues are removed to expose Gly-116 at the C-terminus. The C-terminal Gly is then amidated with phosphatidylethanolamine by an activating system similar to that for ubiquitin. {ECO:0000250|UniProtKB:P38182}. | SUBCELLULAR LOCATION: Cytoplasmic vesicle, autophagosome membrane {ECO:0000250|UniProtKB:P38182}; Lipid-anchor {ECO:0000250|UniProtKB:P38182}. Vacuole membrane {ECO:0000269|PubMed:33138913}; Peripheral membrane protein {ECO:0000269|PubMed:33138913}. | null | null | null | null | null | FUNCTION: Ubiquitin-like modifier involved in autophagosomes formation. With atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial ... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94276 | YORS_SCHPO | MDFKSRKYKIKKHPKDCKLHAKKYRGTLNSKGKNDNDCLIMCMRCRKVKGIDSYSKTQWSKTFTFVRGRTVSVSDPKVICRTCQPKQHDSIWCTACQQTKGINEFSKAQRHVLDPRCQICVHSQRNDGDDNLESDKFVDPFIGDDSDLDDDIYIHDKQTINSEYADDVSDNTDEERTESKGQQESNSAEEYDDDDSDEDRMEEIFQQFKKEKQIV | null | null | meiotic cell cycle [GO:0051321]; regulatory ncRNA-mediated heterochromatin formation [GO:0031048]; silent mating-type cassette heterochromatin formation [GO:0030466]; siRNA-mediated pericentric heterochromatin formation [GO:0140727]; subtelomeric heterochromatin formation [GO:0031509] | chromosome, telomeric region [GO:0000781]; nucleolus [GO:0005730]; nucleus [GO:0005634]; pericentric heterochromatin [GO:0005721] | protein-macromolecule adaptor activity [GO:0030674] | PF12898; | 3.30.60.210; | null | null | SUBCELLULAR LOCATION: Nucleus, nucleolus {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Required for meiotic chromosome segregation. {ECO:0000269|PubMed:16169489}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94282 | CTU1_SCHPO | MSNKLCQLCNERRPALVRPKTGQKICKECFYYVFETEIHNVIIENKLFVRGERVGIGASGGKDSTVLAYVMKLLNERYDYGLELYLISVDEGIRGYRDDSLDTVKRNQQQYGLPMKIVSYADLYDGWTMDNVVARIGTKNNCTYCGVFRRQALDRAALSLDIHHLVTGHNADDIAETILMNLLRGDVARLPRSTEITTQSDSSPTKRSKPFKYSYEKEIVLYAHYKKLDYFSTECTYSPEAFRGTARAMIKQLENIRPSSILDIIYSGESMQLASSVQEQLPQQTTCERCGFISSNRICKACMLLEGLNKGITGLGLGSD... | 2.7.7.- | null | protein urmylation [GO:0032447]; tRNA thio-modification [GO:0034227]; tRNA wobble position uridine thiolation [GO:0002143]; tRNA wobble uridine modification [GO:0002098] | cytosol [GO:0005829]; cytosolic tRNA wobble base thiouridylase complex [GO:0002144]; mitochondrion [GO:0005739] | ATP binding [GO:0005524]; nucleotidyltransferase activity [GO:0016779]; tRNA binding [GO:0000049] | PF01171;PF16503; | 3.40.50.620; | TtcA family, CTU1/NCS6/ATPBD3 subfamily | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_03053, ECO:0000269|PubMed:16823372}. | null | null | PATHWAY: tRNA modification; 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis. {ECO:0000255|HAMAP-Rule:MF_03053}. | null | null | FUNCTION: Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur f... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94284 | HMT2_SCHPO | MLTLNSTIKSVTGSFQSASMLARFASTHHKVLVVGGGSAGISVAHQIYNKFSKYRFANDQGKDTSLKPGEIGIVDGAKYHYYQPGWTLTGAGLSSVAKTRRELASLVPADKFKLHPEFVKSLHPRENKIVTQSGQEISYDYLVMAAGIYTDFGRIKGLTEALDDPNTPVVTIYSEKYADAVYPWIEKTKSGNAIFTQPSGVLKCAGAPQKIMWMAEDYWRRHKVRSNIDVSFYTGMPTLFSVKRYSDALLRQNEQLHRNVKINYKDELVEVKGSERKAVFKNLNDGSLFERPFDLLHAVPSMRSHEFIAKSDLADKSGFV... | 1.8.5.- | COFACTOR: Name=FAD; Xref=ChEBI:CHEBI:57692; Evidence={ECO:0000269|PubMed:10224084}; Note=Binds 1 FAD per subunit. {ECO:0000269|PubMed:10224084}; | cellular detoxification of cadmium ion [GO:0098849]; cellular response to cadmium ion [GO:0071276]; glutathione biosynthetic process [GO:0006750]; phytochelatin biosynthetic process [GO:0046938]; sulfide oxidation, using sulfide:quinone oxidoreductase [GO:0070221] | mitochondrion [GO:0005739] | FAD binding [GO:0071949]; quinone binding [GO:0048038]; sulfide:quinone oxidoreductase activity [GO:0070224] | null | 3.50.50.60; | SQRD family | null | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:10224084}. | null | null | null | null | null | FUNCTION: Catalyzes the oxidation of hydrogen sulfide, with the help of a quinone. {ECO:0000269|PubMed:10224084}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94296 | ATC3_SCHPO | MARDVDNKQNAKRISRDEDEDEFAGESMVGRTLDNPFLGEDEFEDIFGSESQYISSSGQNSTNPFLADTRIENSPLGSESKANQLNKQGTNVNHIEIPLRDFNDPTQPESFLPPPKNTFTSRIKKIKNLFKKEKKQVKPEDLGPRQIILNDYSANHFLHNAVSTCKYSAFTFLPKFLKEQFSKYANLFFLFTAVVQQIPGITPVNRYTTIGPMLIVLSVSGIKEIMEDIKRKKQDQELNESPCYVLQGTGFVEKQWKDVVVGDIVKIVSETFFPADLVLLSSSEPEGLCYIETANLDGETNLKIKQALPETAGLLKPVEL... | 7.6.2.1 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProtKB:P39524}; | endocytic recycling [GO:0032456]; phospholipid translocation [GO:0045332]; post-Golgi vesicle-mediated transport [GO:0006892] | endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; plasma membrane [GO:0005886]; trans-Golgi network [GO:0005802] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; magnesium ion binding [GO:0000287]; phosphatidylethanolamine flippase activity [GO:0090555]; phosphatidylinositol-4-phosphate binding [GO:0070273]; phosphatidylserine flippase activity [... | PF13246;PF00702;PF16212;PF16209; | 3.40.1110.10;2.70.150.10;3.40.50.1000; | Cation transport ATPase (P-type) (TC 3.A.3) family, Type IV subfamily | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:16823372}; Multi-pass membrane protein {ECO:0000269|PubMed:16823372}. Golgi apparatus, trans-Golgi network membrane {ECO:0000250|UniProtKB:P39524}; Multi-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.; EC=7.6.2.1; Evidence={ECO:0000250|UniProtKB:P39524}; CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycero-3-phospho-L-serine(out) + ATP + H2O = a 1,2-diacyl-sn-glycero-3-phospho-L-serine(in) + ADP + H(+) + phosphate; Xr... | null | null | null | null | FUNCTION: Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of phosphatidylserine and small amounts of ethanolamine from the lumen to the cytosolic leaflet of the trans-Golgi network and ensures the maintenance of asymmetric distribution of phospholipids.... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94313 | CARB_SCHPO | MALWATSMRRAIPGISKAFLGSNRVLETAGVSQLSKHLLPQWSGVPHRKISASATNFNDKVKESNTPDANAYIRSGHIKAAEHEKVKKVVVVGSGGLSIGQAGEFDYSGAQAIKALRESSVHTILINPNIATIQSSHSLADEIYFLPVTAEYLTHLIERENPDGILLTFGGQTALNVGIQLDDMGVFARNHVKVLGTPISTLKTSEDRDLFAKALNEINIPIAESVAVSTVDEALQAAEKVSYPVIIRSAYSLGGLGSGFANNKEELQSMAAKSLSLTPQILVEKSLKGWKEVEYEVVRDAANNCITVCNMENFDPLGIH... | 6.3.4.16; 6.3.5.5 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000255|PROSITE-ProRule:PRU00409}; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000255|PROSITE-ProRule:PRU00409}; Note=Binds 4 Mg(2+) or Mn(2+) ions per subunit. {ECO:0000255|PROSITE-ProRule:PRU00409}; | 'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; arginine biosynthetic process [GO:0006526]; citrulline biosynthetic process [GO:0019240]; glutamine metabolic process [GO:0006541]; urea cycle [GO:0000050]; UTP biosynthetic process [GO:0006228] | carbamoyl-phosphate synthase complex [GO:0005951]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrion [GO:0005739] | aspartate carbamoyltransferase activity [GO:0004070]; ATP binding [GO:0005524]; carbamoyl-phosphate synthase (ammonia) activity [GO:0004087]; carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity [GO:0004088]; dihydroorotase activity [GO:0004151]; metal ion binding [GO:0046872] | PF02786;PF02787; | 3.40.50.20;3.30.1490.20;3.30.470.20;1.10.1030.10;3.40.50.1380; | CarB family | null | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:16823372, ECO:0000269|PubMed:200419}. | CATALYTIC ACTIVITY: Reaction=2 ATP + H2O + hydrogencarbonate + L-glutamine = 2 ADP + carbamoyl phosphate + 2 H(+) + L-glutamate + phosphate; Xref=Rhea:RHEA:18633, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17544, ChEBI:CHEBI:29985, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:58228, ChEBI:CHEBI:58359, ChEBI... | null | PATHWAY: Amino-acid biosynthesis; L-arginine biosynthesis; carbamoyl phosphate from bicarbonate: step 1/1. {ECO:0000305|Ref.3}. | null | null | FUNCTION: Large subunit of the arginine-specific carbamoyl phosphate synthase (CPSase). CPSase catalyzes the formation of carbamoyl phosphate from the ammonia moiety of glutamine, hydrogencarbonate, and phosphate donated by ATP, the first step of the arginine biosynthetic pathway (Ref.3). The large subunit (synthetase)... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94316 | SN114_SCHPO | MMEEDLYDEFGNYIGPENEEDEEELFPQAPSPTIAQVPSFEEVIPDEELEDVERAEEMALSHLEPQNAVVLHEDKQYYPSAEEVYGSNVDIMVQEQDTQPLSQPIIEPIRHKRIAIETTNVPDTVYKKEFLFGLLTGTDDVRSFIVAGHLHHGKSALLDLLVYYTHPDTKPPKRRSLRYTDTHYLERERVMSIKSTPLTLAVSDMKGKTFAFQCIDTPGHVDFVDEVAAPMAISDGVVLVVDVIEGVMINTTRIIKHAILHDMPIVLVLNKVDRLILELRLPPNDAYHKLRHVIDEVNDNICQISKDLKYRVSPELGNVC... | null | null | mRNA splicing, via spliceosome [GO:0000398]; spliceosomal tri-snRNP complex assembly [GO:0000244] | cytosol [GO:0005829]; nucleus [GO:0005634]; post-mRNA release spliceosomal complex [GO:0071014]; Prp19 complex [GO:0000974]; spliceosomal complex [GO:0005681]; U2-type catalytic step 2 spliceosome [GO:0071007]; U4/U6 x U5 tri-snRNP complex [GO:0046540]; U5 snRNP [GO:0005682] | GTP binding [GO:0005525]; GTPase activity [GO:0003924]; U5 snRNA binding [GO:0030623] | PF00679;PF03764;PF16004;PF00009;PF03144; | 3.30.230.10;3.30.70.240;3.30.70.870;3.40.50.300;2.40.30.10;3.90.1430.10; | TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EF-G/EF-2 subfamily | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Component of the U5 snRNP complex required for pre-mRNA splicing. Binds GTP. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94360 | MOB1_SCHPO | MFGFSNKTAKTFRVRKTEAGTKHYQLRQYAEATLGSGSLMEAVKLPKGEDLNEWIAMNTMDFYTQINMLYGTITEFCTAASCPQMNAGPSYEYYWQDDKIYTKPTRMSAPDYINNLLDWTQEKLDDKKLFPTEIGVEFPKNFRKVIQQIFRRLFRIYAHIYCSHFHVMVAMELESYLNTSFKHFVFFCREFGLMDNKEYAPMQDLVDSMV | null | null | cell division [GO:0051301]; division septum assembly [GO:0000917]; hippo signaling [GO:0035329]; positive regulation of mitotic actomyosin contractile ring contraction [GO:1903473]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of septation initiation signaling [GO:0031031]; protein l... | cell division site [GO:0032153]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; medial cortex [GO:0031097]; mitotic spindle pole body [GO:0044732]; new mitotic spindle pole body [GO:0071958]; nucleus [GO:0005634]; old mitotic spindle pole body [GO:0071957]; Sid2-Mob1 complex [GO:0034973] | protein kinase activator activity [GO:0030295] | PF03637; | 1.20.140.30; | MOB1/phocein family | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body {ECO:0000269|PubMed:10769201}. Note=Spindle pole body throughout mitosis, relocates to the medial ring during interphase. | null | null | null | null | null | FUNCTION: Has a role in promoting the onset of septum formation during the latter stages of mitosis. {ECO:0000269|PubMed:10769201}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94363 | RHB1_SCHPO | MAPIKSRRIAVLGSRSVGKSSLTVQYVENHFVESYYPTIENTFSKNIKYKGQEFATEIIDTAGQDEYSILNSKHSIGIHGYVLVYSITSKSSFEMVKIVRDKILNHTGTEWVPIVVVGNKSDLHMQRAVTAEEGKALANEWKCAWTEASARHNENVARAFELIISEIEKQANPSPPGDGKGCVIA | null | null | positive regulation of L-arginine import across plasma membrane [GO:1905589]; positive regulation of TORC1 signaling [GO:1904263]; small GTPase-mediated signal transduction [GO:0007264] | cytosol [GO:0005829]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; nucleus [GO:0005634]; plasma membrane [GO:0005886] | GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein serine/threonine kinase activator activity [GO:0043539] | PF00071; | 3.40.50.300; | Small GTPase superfamily, Rheb family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Lipid-anchor {ECO:0000305}; Cytoplasmic side {ECO:0000305}. | null | null | null | null | null | FUNCTION: Regulates entry into stationary phase when extracellular nitrogen levels are adequate for growth. {ECO:0000269|PubMed:10835385}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94364 | WAPL_SCHPO | MKRGKCKEKDNGLKRISSESEVWNFLDVTVSELNKQKRSPGQTVSKRLHKKQRVVSNPDLSLPSSPVKQILRNGLQNSKYGSHKTGLERSASCSSIDASANHSSTTYREQRSYLMEEGLDTQPIVPREVSSGRELDSTNHTIGTERAFLIEEDVSEDDEIQMKSIHELRFAGEQQRIVDEIEYLVDGVTFSGNSSASRYLSLIGIAEKMFDNSFRLCLKSIRDVFLRIFEEIDPKDTLHTFLQIYIFATMANEMDCMSSLLDAYSNNVKLLLQTAITLEPQVPVSILAKSLPKSVKGAVQEFVIKAELTFSFSNESLASS... | null | null | cell division [GO:0051301]; chromatin looping [GO:0140588]; homologous chromosome pairing at meiosis [GO:0007129]; mitotic sister chromatid cohesion [GO:0007064]; regulation of cohesin loading [GO:0071922] | nuclear chromosome [GO:0000228]; nucleus [GO:0005634]; Wpl/Pds5 cohesin loading/unloading complex [GO:0090695] | ATP hydrolysis activity [GO:0016887]; ATP-dependent protein binding [GO:0043008]; cohesin unloader activity [GO:0140670]; DNA binding [GO:0003677] | PF07814; | 1.25.10.10; | WAPL family | null | SUBCELLULAR LOCATION: Nucleus. Chromosome. | null | null | null | null | null | FUNCTION: Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. {ECO:0000269|PubMed:18079700, ECO:0000269|PubMed:21300781}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94374 | IMA2_SCHPO | MESRYLSDRRSRFKSKGVFKADELRRQREEQQIEIRKQKREESLNKRRNLNAVLQNDIDVEEEADQSQVQMEQQMKDEFPKLTADVMSDDIELQLGAVTKFRKYLSKETHPPIDQVIACGVVDRFVQFLESEHHLLQFEAAWALTNIASGTTDQTRIVVDSGAVPRFIQLLSSPEKDVREQVVWALGNIAGDSSACRDYVLGNGVLQPLLNILQSSASDVSMLRNATWTLSNLCRGKNPPPNWSTISVAVPILAKLLYSEDVEIIVDACWAISYLSDGPNEKIGAILDVGCAPRLVELLSSPSVNIQTPALRSVGNIVTG... | null | null | cell division [GO:0051301]; mitotic nuclear pore complex disassembly [GO:0140516]; NLS-bearing protein import into nucleus [GO:0006607]; protein import into nucleus [GO:0006606]; regulation of mitotic nuclear envelope disassembly [GO:1905557] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitotic spindle midzone [GO:1990023]; nuclear envelope [GO:0005635]; nuclear periphery [GO:0034399]; nuclear pore [GO:0005643]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634] | GTP binding [GO:0005525]; nuclear import signal receptor activity [GO:0061608]; nuclear localization sequence binding [GO:0008139] | PF00514;PF16186;PF01749; | 1.20.5.690;1.25.10.10; | Importin alpha family | null | SUBCELLULAR LOCATION: Cytoplasm. Nucleus, nucleolus. Note=Nucleus; nucleolus; nuclear rim. | null | null | null | null | null | FUNCTION: Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured ... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94383 | SMC1_SCHPO | MGRLLRLEVENFKSYRGHQIIGPFEDFTSIIGPNGAGKSNLMDAISFVLGVKSSHLRSTNVKELIYRGKILQRDNTDFTDSSNPTTAYVKLMYELDNGEQREYKRAITPSGATEYKIDEEIVTFSEYCGSLQKENILVRARNFLVFQGDVETIASQSPLELSKLVEQISGSLEYKSEYDKSKDEQDKAVNLSAHSFNKKRGINAELRQYQEQKTEAERYQSQKEKRDSAQLVYLLWKLFHLEKSISSNMAEVTRLKADSIQLIERRDENTKEIEKLKEKEGSIRRNLLAFDRKVRKQEKLIASKRPELISIAEKALESKS... | null | null | cell division [GO:0051301]; chromatin looping [GO:0140588]; mitotic sister chromatid cohesion [GO:0007064]; sister chromatid cohesion [GO:0007062] | chromosome [GO:0005694]; cohesin complex [GO:0008278]; condensed chromosome, centromeric region [GO:0000779]; meiotic cohesin complex [GO:0030893]; mitotic cohesin complex [GO:0030892]; nucleus [GO:0005634] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677] | PF06470;PF02463; | 1.20.1060.20;3.30.70.1620;3.40.50.300; | SMC family, SMC1 subfamily | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:11069892}. Chromosome {ECO:0000269|PubMed:11069892}. Note=Associates with chromatin. Before prophase it is scattered along chromosome arms. At anaphase, the rad21 subunit of the cohesin complex is cleaved, leading to the dissociation of the complex from chromosomes, all... | null | null | null | null | null | FUNCTION: Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped.... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94395 | KU70_SCHPO | MENDEQIDETENFAIGKYAILFVIEVSPSMLDPVDEFTPSSLQMALICAYQLAAQRVITNPSDIMGVLLYGTESSTGRFANQMMLLDIDPPDAERIKSLQSFEKDFQFSKEKFKPCSCQVSLSSVLYHCSVIFTTKAENFEKRLFLITDNDHPAWDATERDIILQRAKDLRDLDIQVHPVFLDPPTHSFRINIFYSDFLYIVYGRQDVSNLVNRGQAQLQHMLNMITALQKPKRAHFHLKMDLGNDVRIGVEAFILLKRLESAKTNWVYAKGERFAVAVPQSKQVSFATKKELKKDEIRRSYSYGGSSVVFGSDELNKVR... | 3.6.4.12 | null | DNA recombination [GO:0006310]; double-strand break repair via nonhomologous end joining [GO:0006303]; replication fork processing [GO:0031297]; stalled replication fork localization to nuclear periphery [GO:0120290]; telomere maintenance [GO:0000723] | chromosome, subtelomeric region [GO:0099115]; chromosome, telomeric repeat region [GO:0140445]; heterochromatin [GO:0000792]; Ku70:Ku80 complex [GO:0043564]; nucleus [GO:0005634]; pericentric heterochromatin [GO:0005721]; site of double-strand break [GO:0035861] | 3'-5' DNA helicase activity [GO:0043138]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; damaged DNA binding [GO:0003684]; double-stranded DNA binding [GO:0003690]; telomeric DNA binding [GO:0042162] | PF02735;PF03730;PF03731;PF02037; | 1.10.1600.10;2.40.290.10;4.10.970.10;1.10.720.30;3.40.50.410; | Ku70 family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000305}. Chromosome, telomere {ECO:0000269|PubMed:12424244}. | CATALYTIC ACTIVITY: Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.12; | null | null | null | null | FUNCTION: Single-stranded DNA-dependent ATP-dependent helicase. Involved in non-homologous end joining (NHEJ) DNA double strand break repair. DNA-binding is sequence-independent but has a high affinity to nicks in double-stranded DNA and to the ends of duplex DNA. Binds to naturally occurring chromosomal ends, and ther... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94396 | PUS1_SCHPO | MGRGGKRTWYNGDRREAKRNRPNSIYNGEGRPENLVVGEKKPKRKVACLVGYCGSGYHGMQLNPPSKTIEGDLFDAFVKAGAVSSYNADDPKKVALARAARTDKGVHAAGNVISLKLIMEDEKLIEKVNEHLPPSIRLWDVIRTINSFNPRTYCESRIYEYMVPTYAFVPPKPSSILGNCIMKNSPMPAEPINKENINQLSRSLFYEEGKEFWDDYDIAAKEILSLYEQDPEGFVNPYSKRGAAALANSENNKGSEAGVSAKTNPDMDSDSSAIVNEFLKPDSVEDESAGSKIDPSYRLERALKHIEVLKLKNYRISADR... | 5.4.99.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250|UniProtKB:Q12211}; Note=Binds 1 zinc ion per subunit. {ECO:0000250|UniProtKB:Q12211}; | mRNA processing [GO:0006397]; mRNA pseudouridine synthesis [GO:1990481]; snRNA pseudouridine synthesis [GO:0031120]; tRNA pseudouridine synthesis [GO:0031119] | nucleus [GO:0005634] | metal ion binding [GO:0046872]; pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]; snRNA pseudouridine synthase activity [GO:0106032]; tRNA pseudouridine synthase activity [GO:0106029] | PF01416; | 3.30.70.660;3.30.70.580; | TRNA pseudouridine synthase TruA family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:11095668}. | CATALYTIC ACTIVITY: Reaction=a uridine in tRNA = a pseudouridine in tRNA; Xref=Rhea:RHEA:54572, Rhea:RHEA-COMP:13339, Rhea:RHEA-COMP:13934, ChEBI:CHEBI:65314, ChEBI:CHEBI:65315; Evidence={ECO:0000269|PubMed:11095668}; CATALYTIC ACTIVITY: Reaction=uridine in snRNA = pseudouridine in snRNA; Xref=Rhea:RHEA:51124, Rhea:RHE... | null | null | null | null | FUNCTION: Formation of pseudouridine at positions 27 and 28 in the anticodon stem and loop of transfer RNAs; at positions 34 and 36 of intron-containing precursor tRNA(Ile) and at position 35 in the intron-containing tRNA(Tyr) (PubMed:11095668). Catalyzes pseudouridylation at position 44 in U2 snRNA (By similarity). Al... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94399 | TWF1_SCHPO | MSASVELKPTEKFSKFLEEYSSVPVRAAIISISNENSFDVKTMVEKSESIESDFKKVRECLLGSEEPAFVLVYDDSKKNLLQLISYVPENANVRRKMLYASSRAAFVRCVTLAKLDESYFASTPEELDYQQIMKSLSKQEDQSPLRQDELERKEYNESMQSSVTHKRPLVTRGVAMSIDDKALKALSDLKSSTENNLVILSIDKEVISLSQEKQNIPPSDVKSFFSSTEPNFAFYSLPKDGSSKILFIYICPMQATVKHRMVYSSSKLGLLDSIKAELGIVIDGKIESNDAADITEKEILHAAGISSPQAETSTTKTGFS... | null | null | actin filament depolymerization [GO:0030042]; barbed-end actin filament capping [GO:0051016]; conjugation with cellular fusion [GO:0000747]; mating projection actin fusion focus assembly [GO:1904600]; positive regulation of neuron projection development [GO:0010976]; regulation of lamellipodium assembly [GO:0010591]; s... | actin cortical patch [GO:0030479]; actin filament [GO:0005884]; cell division site [GO:0032153]; cell tip [GO:0051286]; cytoplasm [GO:0005737]; mating projection tip [GO:0043332]; myofibril [GO:0030016] | actin filament binding [GO:0051015]; actin monomer binding [GO:0003785] | PF00241; | 3.40.20.10; | Actin-binding proteins ADF family, Twinfilin subfamily | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000250}. | null | null | null | null | null | FUNCTION: Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin. Prevents actin filament assembly by forming a 1:1 complex with actin monomers, and inhibits the nucleotide exchange reaction of actin monomers (By similarity). {ECO:0000250}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94421 | SNF22_SCHPO | MFAVQGNQKFPKGLTKDNIQSLYQQWQVMRNQGATEENNPEFAQISSILRMVQRAHYARMQQMRNQSSEFPDAENTNLRKQQDTLPTTGFNNLPEGKAGMQTLPGRPASNGPTPPNPGNGNVGLNNPSYMNSQASPNIMNAPLQRDTSVPPAPSMVHPHTNTNANSNNLKVYANQLSQQNTSNPTYHNAYDMASMMKNGSRMNNSFPPTTPYPPANDTTVNSSLPHSFASPSSTFEQPHTVQSRAPSVDTTSSSHSFSARNIPANVSMQQQMGRRGSIPVNPSTFSASSPPSGSMLASPYNGYQNDAASFAHSKLPSSAN... | 3.6.4.- | null | chromatin remodeling [GO:0006338]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]; transcription initiation-coupled chromatin remodeling [GO:0045815] | chromatin [GO:0000785]; mitotic spindle [GO:0072686]; nucleus [GO:0005634]; SWI/SNF complex [GO:0016514] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; DNA binding [GO:0003677]; helicase activity [GO:0004386]; histone binding [GO:0042393]; histone octamer slider activity [GO:0140751] | PF00439;PF00271;PF08880;PF14619;PF00176; | 1.20.5.170;1.20.920.10;3.40.50.300;3.40.50.10810; | SNF2/RAD54 helicase family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00549, ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Helicase. Component of the SWI/SNF complex, an ATP-dependent chromatin remodeling complex, required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nuc... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94436 | TAF14_SCHPO | MTTVKRTVRLITDQNVLPGGEAAVLNDQSFPVREWSIKLVCLNPQGEETDASFVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYADKGGEHRFLHYLHFQQEHYHEDIELNINATRPGLLKALTATGEVPGYSDEGEEARKDKRKNESEVGAGKKKAKAKPVDMDKLAEGLQKLQEDDLLQVVQMVNENKTPDMYVRNDIEGGEFHIDLYTLPDNLLLLLYSFCAKRVTM | null | null | chromatin remodeling [GO:0006338]; DNA damage response [GO:0006974]; regulation of transcription by RNA polymerase II [GO:0006357]; transcription initiation-coupled chromatin remodeling [GO:0045815] | chromatin [GO:0000785]; Ino80 complex [GO:0031011]; nucleus [GO:0005634]; SWI/SNF complex [GO:0016514]; transcription factor TFIID complex [GO:0005669]; transcription factor TFIIF complex [GO:0005674] | histone binding [GO:0042393]; RNA polymerase II general transcription initiation factor activity [GO:0016251] | PF17035;PF03366; | 1.20.1270.220;2.60.40.1970; | TAF14 family | null | SUBCELLULAR LOCATION: Nucleus, nucleoplasm {ECO:0000269|PubMed:15616156, ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Functions as a component of the DNA-binding general transcription factor complex TFIID, and the RNA polymerase II associated general transcription factor complex TFIIF. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94446 | ESA1_SCHPO | MSNDVDDESKIETKSYEAKDIVYKSKVFAFKDGEYRKAEILMIQKRTRGVVYYVHYNDYNKRLDEWITIDNIDLSKGIEYPPPEKPKKAHGKGKSSKRPKAVDRRRSITAPSKTEPSTPSTEKPEPSTPSGESDHGSNAGNESLPLLEEDHKPESLSKEQEVERLRFSGSMVQNPHEIARIRNINKICIGDHEIEPWYFSPYPKEFSEVDIVYICSFCFCYYGSERQFQRHREKCTLQHPPGNEIYRDDYISFFEIDGRKQRTWCRNICLLSKLFLDHKMLYYDVDPFLFYCMCRRDEYGCHLVGYFSKEKESSENYNLA... | 2.3.1.-; 2.3.1.48 | null | DNA repair [GO:0006281]; DNA repair-dependent chromatin remodeling [GO:0140861]; negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of heterochromatin formation [GO:0031453]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA poly... | NuA4 histone acetyltransferase complex [GO:0035267]; nucleus [GO:0005634]; pericentric heterochromatin [GO:0005721]; site of double-strand break [GO:0035861]; Swr1 complex [GO:0000812] | chromatin binding [GO:0003682]; histone H3K4 acetyltransferase activity [GO:0044016]; histone H4K16 acetyltransferase activity [GO:0046972]; metal ion binding [GO:0046872]; peptide 2-hydroxyisobutyryltransferase activity [GO:0106226]; peptide butyryltransferase activity [GO:0140065]; peptide crotonyltransferase activit... | PF01853;PF11717;PF17772; | 2.30.30.140;3.40.630.30;3.30.60.60;1.10.10.10; | MYST (SAS/MOZ) family | PTM: Autoacetylation at Lys-279 is required for proper function. {ECO:0000250|UniProtKB:Q08649}. | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10759889, ECO:0000269|PubMed:16199868}. Chromosome {ECO:0000269|PubMed:20299449, ECO:0000269|PubMed:33723569}. Note=Localizes to pericentric heterochromatin (PubMed:20299449). Following DNA damage, localizes to sites of DNA damage, such as double stand breaks (DSBs) (Pu... | CATALYTIC ACTIVITY: Reaction=acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]; Xref=Rhea:RHEA:21992, Rhea:RHEA-COMP:9845, Rhea:RHEA-COMP:11338, ChEBI:CHEBI:15378, ChEBI:CHEBI:29969, ChEBI:CHEBI:57287, ChEBI:CHEBI:57288, ChEBI:CHEBI:61930; EC=2.3.1.48; Evidence={ECO:0000269|PubMed:20299449}; P... | null | null | null | null | FUNCTION: Catalytic component of the NuA4 histone acetyltransferase (HAT) complex which is involved in epigenetic transcriptional activation of selected genes principally by acetylation of nucleosomal histones H4, H3, H2B, H2A and H2A variant H2A.Z (PubMed:16199868). Acetylates histone H4 to form H4K5ac, H4K8ac, H4K12a... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94449 | RFC4_SCHPO | MSNAVSSSVFGEKNNSVAYELPWVEKYRPIVLDDIVGNEETIDRLKVIAKEGNMPHLVISGMPGIGKTTSILCLAHALLGPAYKEGVLELNASDERGIDVVRNRIKAFAQKKVILPPGRHKIIILDEADSMTAGAQQALRRTMEIYSNTTRFALACNQSNKIIEPIQSRCAILRYSRLTDQQVLQRLLNICKAEKVNYTDDGLAALIMTAEGDMRQAVNNLQSTVAGFGLVNGENVFRVADQPSPVAIHAMLTACQSGNIDVALEKLQGIWDLGFSAVDIVTNMFRVVKTMDSIPEFSRLEMLKEIGQTHMIILEGVQTL... | null | null | DNA repair [GO:0006281]; DNA strand elongation involved in DNA replication [GO:0006271]; DNA-templated DNA replication [GO:0006261]; mitotic DNA replication leading strand elongation [GO:1903460]; UV-damage excision repair [GO:0070914] | chromatin [GO:0000785]; Ctf18 RFC-like complex [GO:0031390]; cytosol [GO:0005829]; DNA replication factor C complex [GO:0005663]; Elg1 RFC-like complex [GO:0031391]; nucleus [GO:0005634]; Rad17 RFC-like complex [GO:0031389] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; DNA clamp loader activity [GO:0003689]; DNA clamp unloader activity [GO:0061860] | PF00004;PF08542; | 1.10.8.60;1.20.272.10;3.40.50.300; | Activator 1 small subunits family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. | null | null | null | null | null | FUNCTION: The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. {ECO:0000269|PubMed:16040599}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94451 | PLI1_SCHPO | MNQANFLQELPNVLKRLETGLIIPQLKDILRVFGLRLSGTKAELITRIKQLIERIAIENNTTSWEALKKAIDGDVTSAVCILKYNTYQIYSAAAPIAPPSSASGNRSYSRPFAPVVHSRIRFRKSPFYDILEQFNAPFVVPACVGTRNTISFSFHVTPPALSKLLNDPKQYRVYLFSTPSETIGFGNCLMEFPTPQMELRINNQVAHANYRRLKGKPGTTNPADITDLVSKYAGPPGNNVVIYYMNSTKSYSVVVCFVKVYTIENLVDQIKSRKAESKEKIIERIKNDNQDADIIATSTDISLKCPLSFSRISLPVRSVF... | 2.3.2.- | null | linear element assembly [GO:0030999]; non-recombinational interstrand cross-link repair [GO:0036299]; protein sumoylation [GO:0016925]; reciprocal meiotic recombination [GO:0007131]; regulation of transcription by RNA polymerase II [GO:0006357]; replication fork processing [GO:0031297]; stalled replication fork localiz... | nucleus [GO:0005634]; site of double-strand break [GO:0035861] | SUMO ligase activity [GO:0061665]; transcription coregulator activity [GO:0003712]; zinc ion binding [GO:0008270] | PF14324;PF02037;PF02891; | 2.60.120.780;1.10.720.30;3.30.40.10; | PIAS family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10759889, ECO:0000269|PubMed:15359282}. | null | null | PATHWAY: Protein modification; protein sumoylation. | null | null | FUNCTION: Acts as an E3 ligase mediating SUMO/Smt3 attachment to other proteins. Involved in the maintenance of the centromere and in telomere length. Regulates recombination, via extension sumoylation, particularly within the heterochromatin repeats. {ECO:0000269|PubMed:15359282}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94457 | ERG3A_SCHPO | MDYLLNYADQYALDSIYNAVYPLARDNIVRQSISLFFLTWFGGMFLYLTFASLSYQFVFDKSLMDHPKFLKNQVFMEVLTALQNLPGMALLTVPWFLAELHGYSYLYDNISDYGLKYFLCSLPLFVMFSDFGIYWAHRFLHHRYVYPRLHKLHHKWIICTPYASHAFKSADGFLQSLPYHLFPFFFPLHKLTYLALFTFVNFWSIMIHDGKYISNNPIINGAAHHNGHHIYFNYNYGQFTTLFDRLGNSFRAPDEAWFDKDLRQNEDVLRVELMEYEAIRNEVEGDDDREYIANSAKKNH | 1.14.19.20 | COFACTOR: Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250|UniProtKB:P53045}; | ergosterol biosynthetic process [GO:0006696]; sterol biosynthetic process [GO:0016126] | endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; membrane [GO:0016020] | C-5 sterol desaturase activity [GO:0000248]; delta7-sterol 5(6)-desaturase activity [GO:0050046]; iron ion binding [GO:0005506] | PF04116; | null | Sterol desaturase family | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=episterol + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = 5-dehydroepisterol + 2 Fe(III)-[cytochrome b5] + 2 H2O; Xref=Rhea:RHEA:46560, Rhea:RHEA-COMP:10438, Rhea:RHEA-COMP:10439, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:23929, ChEBI:CHEBI:29033, ChEBI:CHEBI:29034, Ch... | null | PATHWAY: Steroid metabolism; ergosterol biosynthesis. {ECO:0000269|PubMed:18310029}. | null | null | FUNCTION: C-5 sterol desaturase; part of the third module of ergosterol biosynthesis pathway that includes by the late steps of the pathway (PubMed:18310029). Erg31 and erg32 catalyze the introduction of a C-5 double bond in the B ring to produce 5-dehydroepisterol (By similarity). The third module or late pathway invo... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94459 | SCC4_SCHPO | MTGLNETDARILVTSRHLFLWPLAETYFKNAEKVLQDCGVCDSFGRLLSTGLQCLYSVLMDTKMEPRVELLTRKRICEVLLSHTVEYADVEAILNRALIIAEQHNLTEYKFSLQLLLSRVFCRTSPKAAKVLLTRCVREAEEYAKVAEIYHSNNQSNPHRWVYEFLLATLEFQNVSQVANSIHNYANHHKHQHLQLLAMILNQSLPMDEISTDSDQISILCLVTQIAQCLRKGEILLAREILPKIHSKLESETFVWPSSYIDFFIDDTSKISIKWMSINQLYLLIYLISGFCYISDSTSGRASRFLQEGLRITGDFKHQE... | null | null | cell division [GO:0051301]; chromatin looping [GO:0140588]; chromosome segregation [GO:0007059]; maintenance of mitotic sister chromatid cohesion [GO:0034088]; mitotic sister chromatid cohesion [GO:0007064] | chromatin [GO:0000785]; cytosol [GO:0005829]; nucleus [GO:0005634]; Scc2-Scc4 cohesin loading complex [GO:0090694]; SMC loading complex [GO:0032116] | ATP hydrolysis activity [GO:0016887]; cohesin loader activity [GO:0061775]; double-stranded DNA binding [GO:0003690] | PF10345; | null | SCC4/mau-2 family | null | SUBCELLULAR LOCATION: Nucleus. Note=Associates with chromatin. {ECO:0000305}. | null | null | null | null | null | FUNCTION: Involved in sister chromatid cohesion. Forms a complex with mis4, which is required for the association of the cohesin complex with chromosomes. {ECO:0000269|PubMed:16682348}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94466 | RGA7_SCHPO | MLSAPSSSTTPASPPTSPPNTTSSDDFAVLKEPKVEAILNSELGLAILNDRIKDYLLTCKELAGFFKKRSILEEESGKNLQKLAKSYLETFQSKHHSPQSFSASVITSMEIHEQLANHSLTLQKTLSAFSDQVIEFHKNAERKRKSIKEYAKKQENAYLEAVMQMDKSKSRFKGAETEYNRALDNKNTGDSQKKVGFFKPKSNAQLTKLEDEARLKAENAESDMHSKIENAQNVQKQLLCIHRPNYIKQFFSLQREIESSLIANYLRYTKLCESNTLLNGLTIRPQKPTPTNCGLQHALDNINANTDFVQYVLHASIKHE... | null | null | actin cytoskeleton organization [GO:0030036]; Golgi to plasma membrane protein transport [GO:0043001]; mitotic division septum assembly [GO:0140278]; negative regulation of cell wall integrity MAPK cascade [GO:1903138]; positive regulation of mitotic division septum assembly [GO:0140281]; signal transduction [GO:000716... | actin cortical patch [GO:0030479]; cell cortex of cell tip [GO:0051285]; cell division site [GO:0032153]; cell tip [GO:0051286]; cleavage furrow [GO:0032154]; cytoplasm [GO:0005737]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; mitotic actomyosin contractile ring... | GTPase activator activity [GO:0005096] | PF00611;PF00620; | 1.20.1270.60;1.10.555.10; | null | null | null | null | null | null | null | null | null | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94477 | MYO52_SCHPO | MTSGIYYKGLQCWIPDEQSQWIPGSIKDCRVEGEKAFLTVQDENENETVITVKPDDLNYEGRNGLPFLRSINSDADDLTDLSYLNEPSVLDALSTRYNQLQIYTYSGIVLIAVNPFQRLPNLYTHEIVRAYSEKSRDELDPHLYAIAEDSYKCMNQEHKNQTIIISGESGAGKTVSARYIMRYFASVQALIQSTDSNFHEAPQLTAVENEILATNPIMEAFGNSKTSRNDNSSRFGKYIQILFDGNATIIGAKIQTYLLERSRLVFQPNQERNYHIFYQILAGSSSEQLEKWKLVENSQEFNYLKQGNCSTIEGVNDKEE... | null | null | actin filament bundle organization [GO:0061572]; actin filament bundle retrograde transport [GO:0061573]; actin filament organization [GO:0007015]; establishment or maintenance of cell polarity [GO:0007163]; formin-nucleated actin cable assembly [GO:0070649]; mitotic cytokinesis [GO:0000281]; protein localization to ce... | actin cortical patch [GO:0030479]; actin cytoskeleton [GO:0015629]; cell cortex of cell tip [GO:0051285]; cell cortex of growing cell tip [GO:1902716]; cell division site [GO:0032153]; cell tip [GO:0051286]; cortical dynamic polarity patch [GO:0090726]; cytoplasm [GO:0005737]; lateral cell cortex [GO:0097575]; mating p... | actin filament binding [GO:0051015]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; calmodulin binding [GO:0005516]; microfilament motor activity [GO:0000146] | PF01843;PF00612;PF00063; | 1.10.10.820;1.20.5.190;1.20.5.4820;1.20.58.530;3.40.850.10;1.20.120.720; | TRAFAC class myosin-kinesin ATPase superfamily, Myosin family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10759889, ECO:0000269|PubMed:11112691}. Note=Localized at the cell poles and septum. | null | null | null | null | null | FUNCTION: Involved in cell wall deposition where it has a role in the localization of mok1. {ECO:0000269|PubMed:11112691}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94487 | PPK35_SCHPO | MDLLGLKELDNNKLVSKAKENGVEFSDLFLLSSGYLRDRENASASVSSKNERMVLNEERQNCWTKRNDPKGLTYYQLLKPSEVEILSRPETRRKRMACQVFFLNYYISTIEYHKLRKERLEEFTACTSSLKQSKQKRLWKEHCGRERAFLRKKRTKIQCSHFDLLVKLGQGGYGSVWLAKKRNTHELLAMKMMKKSTLQQLNEVKHILNERDILTNTNSEWLVKLYYAFQDKEKVYLAMEYVPGGDFRTFLTTKGLLHENQTRFYLAEMVAAISAVHKLGYMHRDLKPENFLIDQKGHIKLSDFGLSTAIVTSNQVNRLQ... | 2.7.11.1 | null | ascospore-type prospore membrane formation [GO:0032120]; intracellular signal transduction [GO:0035556]; lipid droplet localization to prospore membrane leading edge [GO:0140043]; phosphorylation [GO:0016310] | cytosol [GO:0005829]; meiotic spindle pole body [GO:0035974]; nucleolus [GO:0005730]; nucleus [GO:0005634]; prospore membrane [GO:0005628]; spindle pole body [GO:0005816] | ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00069;PF00433; | 1.10.510.10; | Protein kinase superfamily, Ser/Thr protein kinase family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus, nucleolus {ECO:0000269|PubMed:16823372}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[pr... | null | null | null | null | FUNCTION: Has a role in meiosis. {ECO:0000269|PubMed:16303567}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94488 | MBO1_SCHPO | MEENSSELDSNNFNVLVDNLAGLSLTDEEVRRILSPRKEGSRQLPSSTSKDEDSEEASHKYDFEIDRDSLKSDSGSPRLHQNATAPTSSTPLQSPDESVNKLNSEDEEGNSSVAPFFLDTTNFDRLNDNITTDDEQLSPVLTANQGFQSQEQYEEDSYNNYDYTSDPSSPNYISSSLDQLPHLDDEDDLQLTPIKEERNYLHSQDAPTTNALSKKISDILIPASAMKDLKDRKNALAKEFEESQPGSSLTLKEQANVIDNLRKEVFGLKLKCYFLYDQLNKFHDQEVQDIMKQNIDLKTLTMELQRAVAGYEKKISGLES... | null | null | astral microtubule nucleation [GO:0030954]; centromere clustering at the mitotic interphase nuclear envelope [GO:0072766]; dynein-driven meiotic oscillatory nuclear movement [GO:0030989]; establishment of mitotic spindle orientation [GO:0000132]; karyogamy involved in conjugation with cellular fusion [GO:0000742]; micr... | equatorial microtubule organizing center [GO:0000923]; half bridge of mitotic spindle pole body [GO:0061496]; interphase microtubule organizing center [GO:0031021]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; microtubule organizing center [GO:0005815]; mitotic actomyosin contractile ring, proximal ... | calmodulin binding [GO:0005516] | PF07989;PF12808; | 1.10.287.1490; | null | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body {ECO:0000269|PubMed:15004232, ECO:0000269|PubMed:15120067, ECO:0000269|PubMed:15659644, ECO:0000269|PubMed:16823372, ECO:0000269|PubMed:19001497}. Cytoplasm, cytoskeleton, microtubule organizing center {ECO:0000269|PubMed:15... | null | null | null | null | null | FUNCTION: Spindle pole body (SPB) component that acts as the gamma-tubulin complex-binding protein of the SPB outer plaque (PubMed:15120067, PubMed:15659644, PubMed:19001497). Promotes nucleation of all cytoplasmic microtubules by recruiting the gamma-tubulin complex to the spindle pole body (SPB), to the interphase mi... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94489 | EF3_SCHPO | MSAKSENKQSVKALEELLKHLTVCDAAEEADAAKALASFVNGPIEEQDAPSQVFSAISKQLNDKNATARERVLKGLEAVANHGSVAADVEPYLVELLPAVIAKVADKQNAVRDAAIAASKAIVRCTTPYAVKAIVPSVLESIHTTGKWNEKMNSLQLLDVLVEVAPSQLSYSLPQIIPVVSESMWDTKAEVKKQSKETMTKVCTLIANADIDRFIPELINCIAHPEEVPETIHSLGATTFVTEVQAPTLSIMVPLLARGLNERSTPIKRKTAVIIDNMSKLVEDPQVVAPFLPKLLPGLYHIKDTIGDPECRSVVQRAIT... | 3.6.4.- | null | cytoplasmic translation [GO:0002181]; cytoplasmic translational elongation [GO:0002182] | cytosol [GO:0005829] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; RNA binding [GO:0003723]; translation elongation factor activity [GO:0003746] | PF17947;PF00005;PF21040; | 1.20.1390.20;2.40.50.990;1.25.10.10;3.40.50.300; | ABC transporter superfamily, ABCF family, EF3 subfamily | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. | CATALYTIC ACTIVITY: Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; Evidence={ECO:0000250|UniProtKB:P16521}; | null | PATHWAY: Protein biosynthesis; polypeptide chain elongation. {ECO:0000305}. | null | null | FUNCTION: Ribosome-dependent ATPase that functions in cytoplasmic translation elongation (PubMed:29300771). Required for the ATP-dependent release of deacylated tRNA from the ribosomal E-site during protein biosynthesis (By similarity). Stimulates the eEF1A-dependent binding of aminoacyl-tRNA to the ribosomal A-site, w... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94504 | TRX2_SCHPO | MRGFIANSLKPHMRSFALRRSFTSSRILRKVNAVESFGDYNTRISADKVTVVDFYADWCGPCKYLKPFLEKLSEQNQKASFIAVNADKFSDIAQKNGVYALPTMVLFRKGQELDRIVGADVKTLSSLLAKYQE | null | null | cell redox homeostasis [GO:0045454]; cellular detoxification [GO:1990748] | mitochondrion [GO:0005739] | protein-disulfide reductase activity [GO:0015035] | PF00085; | 3.40.30.10; | Thioredoxin family | null | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Disulfide reductase which serves multiple functions in mitochondria, protecting mitochondrial components against thiol-oxidative damage as a thiol-disulfide oxidoreductase, and supporting urea cycle and respiration in mitochondria in a manner independent of active site thiols. {ECO:0000269|PubMed:12020831, EC... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94505 | DPNP_SCHPO | MSFDAEKQLAIAAVRRASYLTEKVFNQLIKEKSAAGALTKDDKSPVTIGDFGAQAIVISMLKDAFPNDPIVGEEDSDFLRENTQTCSRVWELVQETIQHATEYKELGQIKSAEEMMSIIDQGSYHGGRNGRMWTLDPIDGTKGFLRGAQYAICLALIENGKPVVSAIGCPNLPYDFNQPETSPKGIIMSAVRNHGCFQYSLHNEKLEPVQVHMQDVQNTKDSKFCEGVEAGHSMQGTQEEIAKYLGITRGPTKMDSQAKYASLARGDGDIYLRLPTKMTFEEKIWDHAGGSLLVEEAGGVVSDMFGKPLDFGVGRTLKNN... | 3.1.3.57; 3.1.3.7 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:10850973}; Note=Binds 3 Mg(2+) ions per subunit. {ECO:0000250|UniProtKB:P32179}; | methionine biosynthetic process [GO:0009086]; phosphatidylinositol phosphate biosynthetic process [GO:0046854]; sulfate assimilation [GO:0000103] | cytosol [GO:0005829]; nucleus [GO:0005634] | 3'(2'),5'-bisphosphate nucleotidase activity [GO:0008441]; inositol-1,3,4-trisphosphate 1-phosphatase activity [GO:0052829]; inositol-1,4-bisphosphate 1-phosphatase activity [GO:0004441]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166] | PF00459; | 3.40.190.80;3.30.540.10; | Inositol monophosphatase superfamily | null | null | CATALYTIC ACTIVITY: Reaction=3'-phosphoadenylyl sulfate + H2O = adenosine 5'-phosphosulfate + phosphate; Xref=Rhea:RHEA:77639, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:58243, ChEBI:CHEBI:58339; EC=3.1.3.7; Evidence={ECO:0000269|PubMed:10850973}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:77640; Evide... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=77 uM for 1D-myo-inositol 1,4-bisphosphate {ECO:0000269|PubMed:10850973}; Note=KM for adenosine 3',5'-bisphosphate is below 10 uM. {ECO:0000269|PubMed:10850973}; | null | null | null | FUNCTION: Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP. May regulate the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS. Is also able to hydrolyze inositol 1,4-bisphosphate ... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94510 | AGN2_SCHPO | MASLTTALPNKAVVAHFMMGLTYNYAQSDFQNDIQNAISLGLDGFVLNFGNDSWMMSKLTLMYNAADALNLQFLLYLNLDMSEMSTVPASTLVTYVQTFANRGHQARINNNVVVGTFLGQDINFGQSSVNQGWQVAFKNALASAGINIFFMPTWPLDASTIYQTYPVADGFCKWNCWPYYTSSPTSDAEDLVYIQNSKATNKKYMATVSPIFYTHFTSKNYSFFSEGLWFTRWMQLIKDQPNYVQVLTWNDYGESTYIGPTNYAADFPVIGSNSHEWVDSFTHAPLSYSLPLFIQMYKQNTTGLPSNFSGISQLYVTYRV... | 3.2.1.59 | null | alpha-glucan catabolic process involved in ascospore release from ascus [GO:0072316]; ascospore release from ascus [GO:0071998]; cell division [GO:0051301]; extracellular polysaccharide catabolic process involved in ascospore release from ascus [GO:0072000]; fungal-type cell wall disassembly involved in conjugation wit... | ascus epiplasm [GO:0072324]; cytosol [GO:0005829]; mating projection actin fusion focus [GO:1990819]; nucleus [GO:0005634] | glucan endo-1,3-alpha-glucosidase activity [GO:0051118] | PF03659; | 3.20.20.80; | Glycosyl hydrolase 71 family | null | SUBCELLULAR LOCATION: Ascus epiplasm {ECO:0000269|PubMed:15194814, ECO:0000269|PubMed:19542306}. | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->3)-alpha-D-glucosidic linkages in isolichenin, pseudonigeran and nigeran.; EC=3.2.1.59; | null | null | null | null | FUNCTION: Promotes the release of ascospores from asci by hydrolyzing 1,3-alpha-glucan in the ascus wall. {ECO:0000269|PubMed:15194814, ECO:0000269|PubMed:19542306}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94513 | EIF3E_SCHPO | MGSELKSTSPLAVKYDLSQKIMQHLDRHLIFPLLEFLSLRQTHDPKELLQAKYDLLKDTNMTDYVANLWTNLHGGHTDEDMANAFAEKRRSVLQELSELEEEVQGILGVLENPDLIAALRQDKGQNLQHLQEHYNITPERIAVLYKFAQFQYNCGNYGGASDLLYHFRAFSKDPELNASATWGKFASEILTVDWDGAMEELGKLREMVDSKSFKDSAVQLRNRTWLLHWSLFPLFNHANGCDTLCDLFFYTPYLNTIQTSCPWLLRYLTVAVVTNQNNANQKPRNPRQSYQRRMRDLVRIISQENYEYSDPVTSFISALY... | null | null | eukaryotic translation initiation factor 3 complex assembly [GO:0070196]; formation of cytoplasmic translation initiation complex [GO:0001732]; translational initiation [GO:0006413] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; eukaryotic translation initiation factor 3 complex, eIF3e [GO:0071540]; nucleus [GO:0005634] | translation initiation factor activity [GO:0003743] | PF09440; | null | EIF-3 subunit E family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_03004, ECO:0000269|PubMed:11071922, ECO:0000269|PubMed:11071923, ECO:0000269|PubMed:11134033, ECO:0000269|PubMed:15904532}. | null | null | null | null | null | FUNCTION: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and i... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94529 | POB3_SCHPO | MAAKTVQYDNIYLNLSEKPGKLRIAPSGLGWKSPSLAEPFTLPISEIRRFCWSRFARGYELKIILKSKDPVSLDGFSQEDLDDLINVIKQNFDMGIEQKEFSIKGWNWGEANFLGSELVFDVNSRPAFEIPISAVTNTNLSGKNEVALEFSTTDDKQIPSAQVDELVEMRLYVPGTTAKEDAADGEEVEQNAANLFYESLKERADIGQAAGDAIVSFSEILLLTPRGRYDIDMYETCMRLRGKTYDYKVEYSSINSLFLLPKPDEQHVVFVIGLEPPLRQGQTRYPFLVTQFVRDEDMEVDLNIEETVLKEKYADKVKAS... | null | null | constitutive heterochromatin formation [GO:0140719]; DNA repair [GO:0006281]; DNA replication [GO:0006260]; DNA replication-dependent chromatin assembly [GO:0006335]; nucleosome organization [GO:0034728]; regulation of chromatin organization [GO:1902275]; transcription elongation-coupled chromatin remodeling [GO:014067... | cytosol [GO:0005829]; euchromatin [GO:0000791]; FACT complex [GO:0035101]; nuclear replication fork [GO:0043596]; nucleus [GO:0005634] | DNA binding [GO:0003677]; H2A-H2B histone complex chaperone activity [GO:0000511]; histone binding [GO:0042393]; nucleosome binding [GO:0031491] | PF21103;PF17292;PF08512;PF03531; | 2.30.29.150;2.30.29.30;2.30.29.220; | SSRP1 family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:Q04636}. Chromosome {ECO:0000250|UniProtKB:Q04636}. Note=Colocalizes with RNA polymerase II on chromatin. Recruited to actively transcribed loci. {ECO:0000250|UniProtKB:Q04636}. | null | null | null | null | null | FUNCTION: Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94532 | FOR3_SCHPO | MASKMPEGSPPTSRSIQSRNSSYSTSSNERIGTPSTISLSENSDLSKLQSTNDFESREDLSLTSDDNNDPEYVMCYNTVYHQKTKINDKLLSETEQLRKIYPLESRVFPKPTIVKEITNERTKRYTFYDDDAPLTNQHTVLDEATYNRILKRIDFFIEKVVEVPPTYHFLSLLNVQLRIQPIWWMDEFAERNGIESLLSALRNLGHYPERASKTPLESQIIQSLFHCLNSENCRRRYQSSAKCSVPGFNALGTIAETVLSKSLNSARMATFLLKFLCNKKGLSYFKAVIRAFEWLVEQKLSKTRFSAWMHSFNDVITGVR... | null | null | actin cytoskeleton organization [GO:0030036]; actin filament bundle assembly [GO:0051017]; actin filament bundle organization [GO:0061572]; barbed-end actin filament capping [GO:0051016]; establishment or maintenance of bipolar cell polarity [GO:0061245]; mitotic actomyosin contractile ring assembly [GO:1903475]; prote... | cell cortex of cell tip [GO:0051285]; cell cortex of growing cell tip [GO:1902716]; cell division site [GO:0032153]; cell tip [GO:0051286]; cytoplasm [GO:0005737]; mating projection tip [GO:0043332]; medial cortex [GO:0031097]; medial cortex septin ring [GO:0036391]; mitotic actomyosin contractile ring [GO:0110085] | actin binding [GO:0003779]; small GTPase binding [GO:0031267] | PF06367;PF02181; | 1.20.58.2220;1.25.10.10; | Formin homology family | null | SUBCELLULAR LOCATION: Cytoplasm, cell cortex {ECO:0000269|PubMed:11696322, ECO:0000269|PubMed:12415007, ECO:0000269|PubMed:15809031, ECO:0000269|PubMed:16823372}. Cell tip {ECO:0000269|PubMed:11696322, ECO:0000269|PubMed:12415007, ECO:0000269|PubMed:15809031, ECO:0000269|PubMed:16823372}. Note=Found at the cell cortex ... | null | null | null | null | null | FUNCTION: Involved in controlling polarized cell growth. Required for interphase actin cable formation and microtubule organization. {ECO:0000269|PubMed:11696322, ECO:0000269|PubMed:12415007, ECO:0000269|PubMed:15809031}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94534 | ALP14_SCHPO | MSQDQEEDYSKLPLESRIVHKVWKVRLSAYEECSKSFSLSADGSDNCFELWNNQSELWKSVLTDSNVAAQEAGTAAFVAYCRFSDPSHLLKAREISVLSISEKCLTSPRAGTRENALEALMLLVEADSAAPVIESIIPSLSARSPKVIASNVAAIASLVEQFGAKVIPSKMIIPHISNLFGHADKNVRKEASRLTVNIYRWTGDPLKDLLFKDLRPVQTKELESLFAELPTEPPKQTRFLKSQQPTSEPNVETQVEEQPALENEESEPEPSDDQFDLVEEVDVLPNVDPNLETLMASSKWKDRKEALDKLLPVLSQPKIK... | null | null | attachment of mitotic spindle microtubules to kinetochore [GO:0051315]; cell division [GO:0051301]; cytoplasmic microtubule organization [GO:0031122]; establishment or maintenance of microtubule cytoskeleton polarity [GO:0030951]; meiotic centromere clustering [GO:1990571]; microtubule nucleation by spindle pole body [... | cytoplasmic microtubule [GO:0005881]; cytoplasmic microtubule plus-end [GO:1904511]; cytosol [GO:0005829]; kinetochore [GO:0000776]; meiotic spindle [GO:0072687]; microtubule cytoskeleton [GO:0015630]; mitotic spindle [GO:0072686]; mitotic spindle microtubule [GO:1990498]; mitotic spindle pole body [GO:0044732]; nucleu... | microtubule binding [GO:0008017]; microtubule plus end polymerase [GO:0061863]; microtubule plus-end binding [GO:0051010] | PF21041; | 1.25.10.10; | TOG/XMAP215 family | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Chromosome, centromere, kinetochore. Note=Kinetochore periphery. Spindle localization is alp7-dependent. | null | null | null | null | null | FUNCTION: Required for bipolar spindle formation and proper chromosome segregation. Has a role in connecting the kinetochores and the plus end of pole to chromosome microtubules. Also required for the activation of the spindle checkpoint pathway. {ECO:0000269|PubMed:11432827, ECO:0000269|PubMed:14742702}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94537 | IRE1_SCHPO | MKSLKGRLLFLRKFVFFSLLILLFAHGASSSSSSFNYFDKRTNGKANNELALFSPTADSPSSVDGVLELPSAENVFAESSLYNAFIVATVDGSLHSYDRITGQELWSLFTNANPGLSYTKDENSLLSSKFLSQSNFKSYNSTHGEFYSDSTLNISYLSDDDTVWFVEPIDGGILYAFNLQTGLVRLPHSIKDLVHASPIRLLNNNVFVGSKNTTLFTIDVSNGDIVSQYPSGHRYETHHSVHNLGTKRDSVPSGADSDLSFKDPSGKKLSESLDLLDDFNYQVTVSNKSFVDIARTEYFITIYSDSNVILDLVYIDWTPT... | 2.7.11.1; 3.1.26.- | null | IRE1-mediated unfolded protein response [GO:0036498]; mRNA processing [GO:0006397]; phosphorylation [GO:0016310]; positive regulation of gene expression [GO:0010628]; positive regulation of reticulophagy [GO:0140501] | endoplasmic reticulum [GO:0005783]; IRE1-TRAF2-ASK1 complex [GO:1990604] | ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA endonuclease activity [GO:0004521]; unfolded protein binding [GO:0051082] | PF00069;PF06479; | 1.20.1440.180;1.10.510.10;2.130.10.10; | Protein kinase superfamily, Ser/Thr protein kinase family | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:16823372}; Single-pass type I membrane protein {ECO:0000269|PubMed:16823372}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000305|PubMed:15821139}; CATALYTIC... | null | null | null | null | FUNCTION: Endoplasmic reticulum (ER) membrane-resident kinase/endoribonuclease involved in unfolded protein response (UPR) (PubMed:23066505). Initiates the selective decay of a subset of ER-localized-mRNAs that is required to survive ER stress (PubMed:23066505). Rather than relying on a transcriptional program to up-re... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94544 | LKHA4_SCHPO | MKLRLDPSTQSNYHDVSISKLDWHARIDFDQELLHGKVSFVIQSARVSQALSHIILDTSYLEIKNVTINDIPTPFRVDKRRGFLGSALHIVPADEIPSSKSCILTILYSTTKDCTALQFLKPEQTIGGKFPYVFSECQAIHARSFIPCQDTPSVKVPCTFKIRSKLPVIASGIPCGTANFCNGSLEYLFEQKNPIPSYLFCILSGDLASTNIGPRSSVYTEPGNLLACKYEFEHDMENFMEAAEQLTLPYCWTRYDFVILPPSFPYGGMENPNATFATPTLIAGDRSNVNVIAHELAHSWSGNLVTNESWQCFWLNEGMT... | 3.3.2.10; 3.4.11.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250|UniProtKB:Q10740}; Note=Binds 1 zinc ion per subunit. {ECO:0000250|UniProtKB:Q10740}; | cytoplasm to vacuole targeting by the NVT pathway [GO:0120113]; peptide catabolic process [GO:0043171]; protein catabolic process [GO:0030163]; proteolysis [GO:0006508] | cytosol [GO:0005829]; fungal-type vacuole lumen [GO:0000328]; multivesicular body [GO:0005771]; nucleus [GO:0005634]; NVT complex [GO:0061957] | aminopeptidase activity [GO:0004177]; epoxide hydrolase activity [GO:0004301]; leukotriene-A4 hydrolase activity [GO:0004463]; metalloaminopeptidase activity [GO:0070006]; zinc ion binding [GO:0008270] | PF09127;PF01433;PF17900; | 3.30.2010.30;1.10.390.10;1.25.40.320;2.60.40.1730; | Peptidase M1 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. | CATALYTIC ACTIVITY: Reaction=an epoxide + H2O = an ethanediol; Xref=Rhea:RHEA:19037, ChEBI:CHEBI:15377, ChEBI:CHEBI:32955, ChEBI:CHEBI:140594; EC=3.3.2.10; Evidence={ECO:0000250|UniProtKB:Q10740}; | null | null | null | null | FUNCTION: Aminopeptidase that preferentially cleaves di- and tripeptides. Also has low epoxide hydrolase activity (in vitro). Can hydrolyze the epoxide leukotriene LTA(4) but it forms preferentially 5,6-dihydroxy-7,9,11,14-eicosatetraenoic acid rather than the cytokine leukotriene B(4) as the product compared to the ho... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94547 | SRK1_SCHPO | MRFKSIQQNIEDEGKVNVREVNPDSYAERDHGYTAGIFSDAEENFGITQQVADSTQNPTSKPKSRHAHFHETVHENPSEYSRSKCKQPTNEKEYDKAIEALVAKAIVEEHSGQQFPVYKGLEQYTLLQKMGDGAFSNVYKAIHNRTGEKVAIKVVQRAQPNTDPRDPRKRQGVESHNILKEVQIMRRVKHPNIIQLLEFIQTPEYYYLVLELADGGELFHQIVRLTYFSEDLSRHVITQVAHAIRYLHEDCGVVHRDIKPENLLFDSIDFVPSRVRKYRAGDDPDKVDEGEFIPGVGAGTIGRIRLADFGLSKVVWDSHT... | 2.7.11.1 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:15629716}; | cellular response to osmotic stress [GO:0071470]; cellular response to oxidative stress [GO:0034599]; meiotic cell cycle [GO:0051321]; mitotic DNA damage checkpoint signaling [GO:0044773]; negative regulation of G2/M transition of mitotic cell cycle [GO:0010972]; negative regulation of induction of conjugation with cel... | ascospore-type prospore [GO:0042764]; cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleus [GO:0005634] | ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; calmodulin-dependent protein kinase activity [GO:0004683]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00069; | 1.10.510.10; | Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily | PTM: Phosphorylated by sty1. {ECO:0000269|PubMed:12080074, ECO:0000269|PubMed:12589433}. | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12080074, ECO:0000269|PubMed:12589433}. Nucleus, nucleolus {ECO:0000269|PubMed:12080074, ECO:0000269|PubMed:15629716}. Spore core {ECO:0000269|PubMed:12589433}. Note=Translocates from the cytoplasm to the nucleus during environmental stress in a sty1-dependent manner.... | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:15629716}; CATALYTIC... | null | null | null | null | FUNCTION: Delays the mitotic G2/M transition by promoting nuclear exclusion of cdc25 (PubMed:12080074, PubMed:15629716). During osmotic stress, inhibits the G2/M transition in a sty1 stress-activated MAPK pathway-dependent manner (PubMed:12080074, PubMed:12589433, PubMed:15629716). {ECO:0000269|PubMed:12080074, ECO:000... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94561 | PRX_SCHPO | MDAPRRSSRLAAKIANVLDSKGTIIPEAAPVMLKKPAKDESVDSTIQVGDVIPDITLPDEDGTSIRLRDITANKGLVIFAYPKASTPGCTKQGCGFRDNYPKIQASDYEVLGLSFDTSKAQKAFKDKQNFPYHLLSDPKGELIKKLGAEKPGGGKLFRSHWIFEKGTGKCIVKEIDISPLVSVDKAFAVITDSEP | 1.11.1.24 | null | cell redox homeostasis [GO:0045454]; cellular detoxification of hydrogen peroxide [GO:0061692]; cellular response to oxidative stress [GO:0034599]; hydrogen peroxide catabolic process [GO:0042744]; removal of superoxide radicals [GO:0019430] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634] | thioredoxin peroxidase activity [GO:0008379]; thioredoxin-dependent peroxiredoxin activity [GO:0140824] | PF00578; | 3.40.30.10; | Peroxiredoxin family, BCP/PrxQ subfamily | PTM: The active site is a conserved redox-active cysteine residue, the peroxidatic cysteine (C(P)), which makes the nucleophilic attack on the peroxide substrate. The peroxide oxidizes the C(P)-SH to cysteine sulfenic acid (C(P)-SOH), which then reacts with another cysteine residue, the resolving cysteine (C(R)), to fo... | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtK... | null | null | null | null | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events (By similarity). Acts as a ... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94580 | WSS2_SCHPO | MELKFSCRGNVIALSFNENDTVLDAKEKLGQEIDVSPSLIKLLYKGNLSDDSHLQDVVKNESKIMCLIRQDKDIVNQAISQLKVPDYSTNTYSLKPKKPHTTPKPASIYTFNELVVLDYPHKDRALRYLERLRDDTGIKKIMDSHRWTVPLLSEMDPAEHTRHDSKTLGLNHNQGAHIELRLRTDRYDGFRDYKTVKSTLIHELTHNVHGEHDSSFWELFRQLTKEADAADLLGKPGSYVSDRASYTPQQDNDDEDQKNHRRDLLLAAAERRKQSGSKVQKE | 3.4.24.- | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000305|PubMed:27871365}; | DNA repair [GO:0006281]; protein sumoylation [GO:0016925]; proteolysis [GO:0006508] | cytosol [GO:0005829]; nucleus [GO:0005634] | double-stranded DNA binding [GO:0003690]; metallopeptidase activity [GO:0008237]; proteasome binding [GO:0070628]; single-stranded DNA binding [GO:0003697]; transition metal ion binding [GO:0046914]; zinc ion binding [GO:0008270] | PF00240;PF08325; | null | Peptidase M3 family, WSS1-like metalloprotease (WLM) subfamily | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Metalloendopeptidase that acts selectively on DNA-binding proteins. DNA is needed to bring the protease and substrates together to enable proteolysis. Involved in the repair of toxic DNA-protein cross-links (DPCs) such as covalently trapped topoisomerase 1 (TOP1) adducts on DNA lesions or DPCs induced by reac... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94584 | PSS_SCHPO | MVRSRVSPGLKLQSDASNQSNDKENKLLAYVNDNRHFSLIRALHLADLITLMNGFCGVMSIFSSLRYCLSGQQSAFHLWNAMYFMPFALFFDFLDGKVARWRGKSSLMGQELDSLADLISFGVSPAVFAFCCGFQTFLDTVILSLFVLCGLTRLARFNVSVNSIPKDGSGKSQFFEGTPIPTTLSLVTVCGVCILKGKTHENLPWGEWCGNTPFAFHPLVVLFVLSGIAMTSKKLKVPKI | 2.7.8.8 | null | CDP-diacylglycerol biosynthetic process [GO:0016024]; phosphatidylethanolamine biosynthetic process [GO:0006646]; phosphatidylserine biosynthetic process [GO:0006659]; phosphatidylserine metabolic process [GO:0006658]; plasma membrane organization [GO:0007009] | cytoplasm [GO:0005737]; cytoplasmic vesicle membrane [GO:0030659]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789] | CDP-diacylglycerol-serine O-phosphatidyltransferase activity [GO:0003882] | PF01066; | 1.20.120.1760; | CDP-alcohol phosphatidyltransferase class-I family | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Note=During log-phase growth, concentrates at the cell and nuclear peripheries as well endoplasmic reticulum membranes, while in stationary-phase cells, is redistributed to unusual cytoplasmic structures of ... | CATALYTIC ACTIVITY: Reaction=a CDP-1,2-diacyl-sn-glycerol + L-serine = a 1,2-diacyl-sn-glycero-3-phospho-L-serine + CMP + H(+); Xref=Rhea:RHEA:16913, ChEBI:CHEBI:15378, ChEBI:CHEBI:33384, ChEBI:CHEBI:57262, ChEBI:CHEBI:58332, ChEBI:CHEBI:60377; EC=2.7.8.8; Evidence={ECO:0000269|PubMed:17905925}; | null | PATHWAY: Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from CDP-diacylglycerol: step 1/2. | null | null | FUNCTION: Phosphatidylserine synthase involved in the regulation of processes such as cell morphology, cytokinesis, actin cytoskeleton, and cell wall remodeling and integrity. Also plays a role in the physiological adaptations required for stationary-phase survival. {ECO:0000269|PubMed:17905925, ECO:0000269|PubMed:1936... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94603 | JHD1_SCHPO | MDSWLEYDDIINQDIDIPSNDLSGSGTLCVGVHSSLLENSLNSIDSFISSKEEISWCGNQSTPIATKSHLSCINPQYVNPFDTSPVSVDTEFQDTYLLDAPSFAQPHFSERQSVDKTRSRCLSRNRRRKRHPNLHKNHQRLLGMSFPQDGFRRMPAESVNFSYFRDTGFNEPTIFPSSDTQNTRQLNLSKIATLIGYDCPLALVDVVTQKQIPNKMDMESWVKYMSLEPSKRGRIYDVLSLEVSTTKLAYYVRKPNIVRDLDLVNTVWPPGSFALGEYPHVDTYCLMSAENSYTEFHIEFGGSSAYYNILDGCKIFYLIP... | 1.14.11.27 | COFACTOR: Name=Fe(2+); Xref=ChEBI:CHEBI:29033; Evidence={ECO:0000250}; Note=Binds 1 Fe(2+) ion per subunit. {ECO:0000250}; | heterochromatin boundary formation [GO:0033696]; regulation of regulatory ncRNA-mediated heterochromatin formation [GO:0010964]; regulation of siRNA-independent facultative heterochromatin formation [GO:1902801]; regulation of transcription by RNA polymerase II [GO:0006357] | heterochromatin [GO:0000792]; heterochromatin island [GO:1990342]; nucleus [GO:0005634] | histone demethylase activity [GO:0032452]; histone H3K36me/H3K36me2 demethylase activity [GO:0140680]; histone H3K9 demethylase activity [GO:0032454]; metal ion binding [GO:0046872]; transcription coregulator activity [GO:0003712] | PF17811;PF02373; | 2.60.120.650; | JHDM1 histone demethylase family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:12773576}. | CATALYTIC ACTIVITY: Reaction=2 2-oxoglutarate + N(6),N(6)-dimethyl-L-lysyl(36)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + L-lysyl(36)-[histone H3] + 2 succinate; Xref=Rhea:RHEA:42032, Rhea:RHEA-COMP:9785, Rhea:RHEA-COMP:9787, ChEBI:CHEBI:15379, ChEBI:CHEBI:16526, ChEBI:CHEBI:16810, ChEBI:CHEBI:16842, ChEBI:CHEBI:29... | null | null | null | null | FUNCTION: May be a histone demethylase that specifically demethylates 'Lys-36' of histone H3, thereby playing a central role in histone code (By similarity). Represses transcriptional silencing by negatively affecting heterochromatin stability. {ECO:0000250|UniProtKB:P40034, ECO:0000269|PubMed:12773576}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94609 | UBA1_SCHPO | MSNNMNIDQTDQNTIDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAGVKSVTLYDPQPTRIEDLSSQYFLTEDDIGVPRAKVTVSKLAELNQYVPVSVVDELSTEYLKNFKCVVVTETSLTKQLEINDFTHKNHIAYIAADSRGLFGSIFCDFGENFICTDTDGNEPLTGMIASITDDGVVTMLEETRHGLENGDFVKFTEVKGMPGLNDGTPRKVEVKGPYTFSIGSVKDLGSAGYNGVFTQVKVPTKISFKSLRESLKDPEYVYPDFGKMMRPPQYHIAFQALSAFADAHEGSLPRPRNDIDAAE... | 6.2.1.45 | null | DNA damage response [GO:0006974]; protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; magnesium ion binding [GO:0000287]; ubiquitin activating enzyme activity [GO:0004839] | PF16191;PF16190;PF09358;PF00899;PF10585; | 3.40.50.720;2.40.30.180;3.50.50.80;3.40.50.12550;1.10.10.2660;3.10.290.60; | Ubiquitin-activating E1 family | null | SUBCELLULAR LOCATION: Cytoplasm. Nucleus. | CATALYTIC ACTIVITY: Reaction=ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.; EC=6.2.1.45; Evidence={ECO:0000269|PubMed:23416107}; | null | PATHWAY: Protein modification; protein ubiquitination. {ECO:0000269|PubMed:23416107}. | null | null | FUNCTION: Catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation through the ubiquitin-proteasome system. Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a u... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94614 | CHR4_SCHPO | MDSASSMRNRSPLGVPEFSYSSQSVNNIRGIKSRNRSSIGHSITDPQVASRINAFYLSNVQSSIPFETDAIGPAYGIGDMIAPEMNDTQSLSASVTNMKKENFYSRPNVSSSSILLTIKRATSSQETKRDRPLPNIRNSAPSATRSHSTPCVAPGYLRTSNEAADVVFPHEEAHFSNHNPKPNNGSPLQKQVVADLPFPLPVSDEEQLDWIRANEDLVHSQDIDEALEWAEYVLRFTQSHLPYLQTYESENLHEINYLESMCENALYKIREFSELENAKAMYFDAYVYETGAFDVESDIQRAWDLYSSSANLGYTRSLYR... | null | null | fungal-type cell wall beta-glucan biosynthetic process [GO:0070880]; mitotic division septum assembly [GO:0140278] | 1,3-beta-D-glucan synthase complex [GO:0000148]; cell cortex of cell tip [GO:0051285]; cell division site [GO:0032153]; cell tip [GO:0051286]; cytosol [GO:0005829]; division septum [GO:0000935]; nucleus [GO:0005634] | null | PF08238;PF13181; | 1.25.40.10; | null | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15449309}. Note=Localizes to the cell tips and septum during vegetative growth. | null | null | null | null | null | FUNCTION: Involved in septum formation. Required for the proper localization of chs2 at the septum. {ECO:0000269|PubMed:15449309}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94623 | REV1_SCHPO | MAFNQRKRRRPVGIADFDEANDEAYESVGFHDYADYFSRKQRKLQNQNAALYKSIDEDSKSDLFHGLAIAINGYTKPSYTELRQMIVSNGGTFIQYVDGKTSISYLVCSFLTPSKARQWKHQKVVKPEWIVDCIKQKKILPWINYRTFQASSAQATLSFVASKPSQPEGNLEDIQTSSQEEEHDNEKDKTKESKAKGFLDDLSGLSASSLHNYQLLKNPNVRNSTTQNQDFLENFFSSSRLHHLSTWKADFKNEIQAMTTASEPVRPIMKDKSKKSRFLLHVDFDCFFASVSTRFSHELRLKPVAVAHGIKNSEIASCNY... | 2.7.7.- | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 2 magnesium ions. {ECO:0000250}; | error-free translesion synthesis [GO:0070987]; error-prone translesion synthesis [GO:0042276]; mitochondrial DNA repair [GO:0043504] | mitochondrial chromosome [GO:0000262]; mitotic spindle [GO:0072686]; nucleolus [GO:0005730]; nucleus [GO:0005634]; site of double-strand break [GO:0035861] | damaged DNA binding [GO:0003684]; deoxycytidyl transferase activity [GO:0017125]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872] | PF16589;PF00817;PF11799;PF16727; | 3.30.70.270;3.40.1170.60;6.10.250.1490;1.10.150.20;3.40.50.10190;3.30.1490.100;1.20.58.1280; | DNA polymerase type-Y family | null | SUBCELLULAR LOCATION: Nucleus, nucleolus {ECO:0000269|PubMed:16823372}. Mitochondrion {ECO:0000269|PubMed:16823372}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Deoxycytidyl transferase involved in DNA repair. Transfers a dCMP residue from dCTP to the 3'-end of a DNA primer in a template-dependent reaction. May assist in the first step in the bypass of abasic lesions by the insertion of a nucleotide opposite the lesion. Required for normal induction of mutations by p... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94632 | EGT1_SCHPO | MTEIENIGALEVLFSPESIEQSLKRCQLPSTLLYDEKGLRLFDEITNLKEYYLYESELDILKKFSDSIANQLLSPDLPNTVIELGCGNMRKTKLLLDAFEKKGCDVHFYALDLNEAELQKGLQELRQTTNYQHVKVSGICGCFERLLQCLDRFRSEPNSRISMLYLGASIGNFDRKSAASFLRSFASRLNIHDNLLISFDHRNKAELVQLAYDDPYRITEKFEKNILASVNAVFGENLFDENDWEYKSVYDEDLGVHRAYLQAKNEVTVIKGPMFFQFKPSHLILIEESWKNSDQECRQIIEKGDFKLVSKYESTIADYS... | 1.21.3.10; 2.1.1.44 | COFACTOR: Name=Fe(2+); Xref=ChEBI:CHEBI:29033; Evidence={ECO:0000250|UniProtKB:Q7RX33}; Note=Binds 1 Fe(2+) ion per monomer. {ECO:0000250|UniProtKB:Q7RX33}; | ergothioneine biosynthetic process [GO:0052699]; hercynylcysteine sulfoxide biosynthetic process [GO:1903253]; hercynylselenocysteine biosynthetic process [GO:1903255]; meiotic cell cycle [GO:0051321]; methylation [GO:0032259]; N-alpha,N-alpha,N-alpha-trimethyl-L-histidine biosynthesis from histidine [GO:0052707]; sele... | cytosol [GO:0005829]; nucleus [GO:0005634] | calcium ion binding [GO:0005509]; dimethylhistidine N-methyltransferase activity [GO:0030745]; hercynylcysteine sulfoxide synthase activity [GO:0061686]; hercynylselenocysteine synthase [GO:0044876]; histidine N-methyltransferase activity [GO:0052706]; monooxygenase activity [GO:0004497] | PF03781;PF10017; | 3.90.1580.10;3.40.50.150; | Methyltransferase superfamily, EgtD family; EgtB family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. | CATALYTIC ACTIVITY: Reaction=L-histidine + 3 S-adenosyl-L-methionine = 3 H(+) + hercynine + 3 S-adenosyl-L-homocysteine; Xref=Rhea:RHEA:38471, ChEBI:CHEBI:15378, ChEBI:CHEBI:15781, ChEBI:CHEBI:57595, ChEBI:CHEBI:57856, ChEBI:CHEBI:59789; EC=2.1.1.44; Evidence={ECO:0000250|UniProtKB:Q7RX33}; CATALYTIC ACTIVITY: Reaction... | null | PATHWAY: Amino-acid biosynthesis; ergothioneine biosynthesis. {ECO:0000269|PubMed:24828577}. | null | null | FUNCTION: Catalyzes the SAM-dependent triple methylation of the alpha-amino group of histidine to form hercynine and subsequent conjugation with cysteine and oxygen to form hercynylcysteine sulfoxide, the first two steps in the biosynthesis pathway of ergothioneine (PubMed:24828577). May play a role in meiosis (PubMed:... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94640 | SIR2_SCHPO | MASNPLDNNMPTTPVEEKIPVASYSPSSSGSSSGASLLVDIMCGSKETEDEEVDSDEWDKPETENISDLDERSEMVRYLRASGYAKFLEKYLIEEELPVRSILKKLGINLPSALEEFEDIDLLPLLKEVLKREVARRIKLPHFNTFEDVVNLLKKAKNVVVLVGAGISTSLGILDFRSDNGFYARLARHGLSEPSEMFDIHTFRENPEIFYTFARDLLPETNHYSPSHAFIRLLEKKNKLSTLFTQNIDNLEKKTGLSDNKIIQCHGSFATATCIKCKHKVDGSELYEDIRNQRVSYCNECGKPPLKLRRVGQNKKEKHY... | 2.3.1.286 | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250}; Note=Binds 1 zinc ion per subunit. {ECO:0000250}; | DNA repair [GO:0006281]; epigenetic regulation of gene expression [GO:0040029]; heterochromatin formation [GO:0031507]; negative regulation of transcription by RNA polymerase II [GO:0000122] | chromatin [GO:0000785]; chromosome, subtelomeric region [GO:0099115]; mating-type region heterochromatin [GO:0031934]; nuclear inner membrane [GO:0005637]; nucleus [GO:0005634]; pericentric heterochromatin [GO:0005721]; rDNA heterochromatin [GO:0033553]; Set3 complex [GO:0034967]; subtelomeric heterochromatin [GO:01407... | histone deacetylase activity [GO:0004407]; histone H3K14 deacetylase activity [GO:0031078]; histone H3K4 deacetylase activity [GO:1990162]; histone H3K9 deacetylase activity [GO:0032129]; histone H4K16 deacetylase activity [GO:0034739]; metal ion binding [GO:0046872]; NAD+ binding [GO:0070403]; NAD-dependent histone H3... | PF04574;PF02146; | 3.30.1600.10;3.40.50.1220; | Sirtuin family, Class I subfamily | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:15545655}. Chromosome, centromere {ECO:0000269|PubMed:15545655}. Chromosome, telomere {ECO:0000269|PubMed:15545655}. Note=Nuclear throughout the cell cycle. Binds to centromeres, telomeric sites and sites between the silent mating-type loci. | CATALYTIC ACTIVITY: Reaction=H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide; Xref=Rhea:RHEA:43636, Rhea:RHEA-COMP:9752, Rhea:RHEA-COMP:10731, ChEBI:CHEBI:15377, ChEBI:CHEBI:17154, ChEBI:CHEBI:29969, ChEBI:CHEBI:57540, ChEBI:CHEBI:61930, ChEBI:CHEBI:83767; EC=... | null | null | null | null | FUNCTION: Involved in silencing within the mating-type region, at the telomeres, and according to PubMed:12867036 also within centromeric DNA regions. Required for the localization of swi6 to the telomeres, silent mating type region, and according to PubMed:12867036 to the centromeric DNA regions. According to PubMed:1... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94641 | HS104_SCHPO | MADYPFTDKAAKTLSDAYSIAQSYGHSQLTPIHIAAALLSDSDSNGTTLLRTIVDKAGGDGQKFERSVTSRLVRLPAQDPPPEQVTLSPESAKLLRNAHELQKTQKDSYIAQDHFIAVFTKDDTLKSLLAEAGVTPKAFEFAVNNVRGNKRIDSKNAEEGFDALNKFTVDLTELARNGQLDPVIGREDEIRRTIRVLSRRTKNNPVLIGEPGVGKTSIAEGLARRIIDDDVPANLSNCKLLSLDVGSLVAGSKFRGEFEERIKSVLKEVEESETPIILFVDEMHLLMGAGSGGEGGMDAANLLKPMLARGKLHCIGATTL... | null | null | cellular heat acclimation [GO:0070370]; cellular response to misfolded protein [GO:0071218]; chaperone cofactor-dependent protein refolding [GO:0051085]; protein refolding [GO:0042026]; protein unfolding [GO:0043335] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; nuclear envelope [GO:0005635]; nucleolar peripheral inclusion body [GO:0140602]; nucleus [GO:0005634]; protein aggregate center [GO:0140453] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent protein disaggregase activity [GO:0140545]; misfolded protein binding [GO:0051787]; protein-folding chaperone binding [GO:0051087]; unfolded protein binding [GO:0051082] | PF00004;PF07724;PF17871;PF02861;PF10431; | 1.10.8.60;1.10.1780.10;3.40.50.300; | ClpA/ClpB family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Required, in concert with Hsp40 and Hsp70 and small Hsps, for the dissociation, resolubilization and refolding of aggregates of damaged proteins after heat or other environmental stresses. Extracts proteins from aggregates by unfolding and threading them in an ATP-dependent process through the axial channel o... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94649 | ATG2_SCHPO | MRLPSWLKNSSSWLWTAALSRTVQRRLLAFALRKLIGSILLENVQPEDIDILFSKGVLMLSNLQLNCSFLNAVVSLPMINFTKGTLRRLILRLNVTDIVNLNVELEVNGLSLEIELVPPDESLSSTTYEDAPSQLDILDNVVEYMNKTASQDFEDEVINEGLESEIDGSSHNLLDSILQKCLASTSVLMQDALVYIGTANMSTRLEAKLDFMSFSSVKSNSTSRLLNINGITVSMVRPISKSNAGSSSPPRSEESFVSMDSSSSIVEGFENDLSPSQVTLNESSIISSNREEESFYSVHDSVTQKKTRTSWLIFQCSGEF... | null | null | autophagosome assembly [GO:0000045]; glycophagy [GO:0061723]; intermembrane phospholipid transfer [GO:0120010]; macroautophagy [GO:0016236]; meiotic cell cycle [GO:0051321]; piecemeal microautophagy of the nucleus [GO:0034727]; reticulophagy [GO:0061709]; sporulation resulting in formation of a cellular spore [GO:00304... | endoplasmic reticulum membrane [GO:0005789]; phagophore [GO:0061908]; phagophore assembly site [GO:0000407]; phagophore assembly site membrane [GO:0034045] | lipid transfer activity [GO:0120013]; phosphatidylinositol-3-phosphate binding [GO:0032266]; protein-membrane adaptor activity [GO:0043495] | PF09333;PF13329;PF12624; | null | ATG2 family | null | SUBCELLULAR LOCATION: Preautophagosomal structure membrane {ECO:0000269|PubMed:23950735}; Peripheral membrane protein {ECO:0000269|PubMed:23950735}. Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P53855}; Peripheral membrane protein {ECO:0000250|UniProtKB:P53855}. Note=Localizes to the IM-ERES contact site. {ECO... | CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out); Xref=Rhea:RHEA:38571, ChEBI:CHEBI:57643; Evidence={ECO:0000269|PubMed:30911189}; CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycero-3-phospho-L-serine(in) = a 1,2-diacyl-sn-glycero-3-phospho-L-se... | null | null | null | null | FUNCTION: Lipid transfer protein required for autophagosomes completion and peroxisome degradation (PubMed:16303567, PubMed:30911189). Tethers the edge of the isolation membrane (IM) to the endoplasmic reticulum (ER) and mediates direct lipid transfer from ER to IM for IM expansion (PubMed:30911189). Atg2 binds to the ... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94652 | GLE1_SCHPO | MDTKTTPLIHAKLDEKIISSYNDANGLDIDDLWDIYNEKTRRMIHIISQRYKPKKQSPFPVIADENVRIFPPLHKTIDWAKKRNVEEQNLIEQSITESQRIFSEKQRLEQERFNRELLEKKRIEAERQRLKDEEERRKKELMEKEKKEKERIRLIEEQKHKENEQRRLKQEQIDAKRKEEEAREKRMKETFKDDPEEDSNMAWSIIHKIKTEVVAPISEKKELKNYCFTQKRKITPRLGQITKSNSQIMKITQLLQQTFQEARNTDPLVYKWVLNFFCKSVVKQAEAEVAVNPISAYPLAKVCLLLQTQNADLKDLLFAR... | null | null | poly(A)+ mRNA export from nucleus [GO:0016973]; protein transport [GO:0015031] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; nuclear envelope [GO:0005635]; nuclear membrane [GO:0031965]; nuclear periphery [GO:0034399]; nuclear pore [GO:0005643]; nuclear pore cytoplasmic filaments [GO:0044614]; nucleus [GO:0005634] | inositol hexakisphosphate binding [GO:0000822]; phospholipid binding [GO:0005543]; translation initiation factor binding [GO:0031369] | PF07817; | 1.25.40.510; | GLE1 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus, nuclear pore complex {ECO:0000250}. Nucleus membrane {ECO:0000269|PubMed:16823372}; Peripheral membrane protein {ECO:0000269|PubMed:16823372}; Cytoplasmic side {ECO:0000269|PubMed:16823372}. Nucleus membrane {ECO:0000269|PubMed:16823372}; Periphera... | null | null | null | null | null | FUNCTION: Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. It is specifically involved in a termina... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94655 | YPT7_SCHPO | MAGKKKHLLKVIILGESGVGKTSIMNQYVNRKFSKDYKATIGADFLTKEVLVDDKVVTLQLWDTAGQERFQSLGVAFYRGADCCVLVYDVNNSKSFETLDSWRDEFLIQASPSNPETFPFILLGNKVDVEEQKRMVSKSKALAFCQARGEIPYFETSAKEAINVQEAFETVAKLALENMDSDDIAADFTDPIHLDMESQKTSCYC | null | null | endocytosis [GO:0006897]; endosome to lysosome transport [GO:0008333]; Golgi to vacuole transport [GO:0006896]; intracellular protein transport [GO:0006886]; positive regulation of vacuole fusion, non-autophagic [GO:0061191]; regulation of vacuole fusion, non-autophagic [GO:0032889]; signaling [GO:0023052]; vacuole fus... | cytosol [GO:0005829]; fungal-type vacuole membrane [GO:0000329]; late endosome [GO:0005770]; phagocytic vesicle [GO:0045335]; vacuolar membrane [GO:0005774]; vacuole [GO:0005773] | GTP binding [GO:0005525]; GTPase activity [GO:0003924] | PF00071; | 3.40.50.300; | Small GTPase superfamily, Rab family | null | SUBCELLULAR LOCATION: Vacuole membrane {ECO:0000250|UniProtKB:P32939}. | null | null | null | null | null | FUNCTION: Ypt/Rab-type GTPases are key regulators of membrane trafficking and intracellular vesicular transport. They act as molecular switches that convert between GTP-bound and GDP-bound states, and regulate virtually all steps of membrane traffic from the formation of the transport vesicle at the donor membrane to i... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94679 | CND1_SCHPO | MSLDLLSRLKKYIHDEENSDLDSIYAECENAGLTAVVNDVIDTLLLGTSSCFDEDCLEKLFAICSHFADLSSSVRNKVYDLLTSNISSESAILEDMISANATDFTVPQTNLETTGIAFQLTVNSLSSSNQLSVIRSSTNTVKGRKKNPTTNSNWNGISHVNALLDAIITLFQKKLSRVWTTSSERDMFLSLFLKPIYTLMESEINIKNASFRSRLFNIIGLAVQFHNHTTAAETNIIQNLQYFEHLSEYAADLVHIVTVQFNSVTLAEGIIRTLCSLEFNDNDVKGPKQVALFLVRLSSLIPNLCLKQLTQLVKLLDSES... | null | null | cell division [GO:0051301]; meiotic chromosome condensation [GO:0010032]; mitotic chromosome condensation [GO:0007076] | condensed chromosome, centromeric region [GO:0000779]; condensin complex [GO:0000796]; cytoplasm [GO:0005737]; euchromatin [GO:0000791]; kinetochore [GO:0000776]; nucleolar peripheral inclusion body [GO:0140602]; nucleolus [GO:0005730]; nucleus [GO:0005634] | double-stranded DNA binding [GO:0003690]; histone binding [GO:0042393] | PF12717;PF12922; | 1.25.10.10; | CND1 (condensin subunit 1) family | null | SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Chromosome. Note=In interphase cells, the majority of the condensin complex is found in the cytoplasm, while a minority of the complex is associated with chromatin. A subpopulation of the complex however remains associated with chromosome foci in interphase cells. During mitosi... | null | null | null | null | null | FUNCTION: Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted f... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94680 | PDAT_SCHPO | MASSKKSKTHKKKKEVKSPIDLPNSKKPTRALSEQPSASETQSVSNKSRKSKFGKRLNFILGAILGICGAFFFAVGDDNAVFDPATLDKFGNMLGSSDLFDDIKGYLSYNVFKDAPFTTDKPSQSPSGNEVQVGLDMYNEGYRSDHPVIMVPGVISSGLESWSFNNCSIPYFRKRLWGSWSMLKAMFLDKQCWLEHLMLDKKTGLDPKGIKLRAAQGFEAADFFITGYWIWSKVIENLAAIGYEPNNMLSASYDWRLSYANLEERDKYFSKLKMFIEYSNIVHKKKVVLISHSMGSQVTYYFFKWVEAEGYGNGGPTWVN... | 2.3.1.158 | null | diacylglycerol metabolic process [GO:0046339]; lipid droplet formation [GO:0140042]; lipid storage [GO:0019915]; triglyceride biosynthetic process [GO:0019432] | cortical endoplasmic reticulum [GO:0032541]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; extracellular space [GO:0005615]; perinuclear endoplasmic reticulum [GO:0097038] | O-acyltransferase activity [GO:0008374]; phospholipid:diacylglycerol acyltransferase activity [GO:0046027]; triglyceride lipase activity [GO:0004806] | PF02450; | 3.40.50.1820; | AB hydrolase superfamily, Lipase family | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:12963726, ECO:0000269|PubMed:16823372}; Single-pass type II membrane protein {ECO:0000255}. | CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycerol + a glycerophospholipid = a monoacylglycerophospholipid + a triacyl-sn-glycerol; Xref=Rhea:RHEA:14057, ChEBI:CHEBI:17815, ChEBI:CHEBI:64615, ChEBI:CHEBI:136912, ChEBI:CHEBI:136913; EC=2.3.1.158; Evidence={ECO:0000269|PubMed:12963726}; | null | PATHWAY: Glycerolipid metabolism; triacylglycerol biosynthesis. {ECO:0000305|PubMed:12963726}. | null | null | FUNCTION: Catalyzes triacylglycerol (TAG) formation by an acyl-CoA independent pathway. The enzyme specifically transfers acyl groups from the sn-2 position of a phospholipid to diacylglycerol (DAG), thus forming an sn-1-lysophospholipid. Plays a major role in triacylglycerol formation at log phase (PubMed:12963726, Pu... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94684 | TFB3_SCHPO | MDDEGARKVDEKCPLCQADRYLNPNMKLLINPECYHKMCESCVDRIFTTGPAQCPTPGCNKILRKAKFREQTFEDAQIEREVDVRKRISRIFNKGQQEFDSLQAYNDYLEEVEILTFNLIYKIDVEETEEKVKQYEKQNRDSIAANSARAAAEARILAQNEILLKRQKQEAREAAIREHQKEKERREQVEQQIIFDLATSGKDPNKIIQLSDSLKKQQENIASSVSNISRSSSILLSDVQQVAEDTTPFSPLAGEKDGSKYFSYSKNTYQDLYLEKVSHEPGRKCGFRIEDCHLRCLYEAFSGIDYDLESLKKLEVAS | null | null | DNA repair [GO:0006281]; nucleotide-excision repair [GO:0006289]; regulation of transcription by RNA polymerase II [GO:0006357]; transcription initiation at RNA polymerase II promoter [GO:0006367] | cytosol [GO:0005829]; nucleotide-excision repair factor 3 complex [GO:0000112]; nucleus [GO:0005634]; transcription factor TFIIH holo complex [GO:0005675]; transcription factor TFIIK complex [GO:0070985] | cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575]; RNA polymerase II general transcription initiation factor activity [GO:0016251]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270] | PF06391;PF17121; | 3.30.40.10; | null | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Acts as a component of the general transcription and DNA repair factor IIH (TFIIH or factor B), which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase activity and DNA-dependent ATPase activity, and is essential f... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94687 | TAS3_SCHPO | MEKGIKKYLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVDFPQQLKNSPAKAKATHTSSGVTKEVRASKKYTSSNVEFPLVTDGKEKPVKSKQLRKNSVTEFEKPIETKKSKHRKSRNKFLDKSSGSMEIESWDNSTSDSIIESSSRLHESISLRENDIRSSDSKSVGWDDNSTGFRESSKSLDHTDTSMFMELDSNSDPQFRPKYQAKSSWFAPDDPEASWGNLDDGWGETNGSWSSTDDTKHYKNEWAESINLDNFNRPSQQEDYDKPKNTQVSR... | null | null | chromosome segregation [GO:0007059]; heterochromatin formation [GO:0031507]; pericentric heterochromatin formation [GO:0031508]; regulatory ncRNA-mediated heterochromatin formation [GO:0031048]; silent mating-type cassette heterochromatin formation [GO:0030466]; siRNA-mediated pericentric heterochromatin formation [GO:... | chromosome, subtelomeric region [GO:0099115]; cytoplasm [GO:0005737]; mating-type region heterochromatin [GO:0031934]; nucleus [GO:0005634]; pericentric heterochromatin [GO:0005721]; RITS complex [GO:0030958]; spindle pole body [GO:0005816] | molecular adaptor activity [GO:0060090] | PF21487; | 1.20.920.40;6.10.140.1690; | null | null | SUBCELLULAR LOCATION: Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. | null | null | null | null | null | FUNCTION: Has a role in the RNA interference (RNAi) pathway which is important for heterochromatin formation and accurate chromosome segregation. A member of the RNA-induced transcriptional silencing (RITS) complex which is involved in the biosynthesis of dsRNA from primer siRNAs provided by the RNA-directed RNA polyme... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94701 | INN1_SCHPO | MSKNPLGTLVVRIWKAKNLPNKALVGKQSPYCVCRVGEVVKRTQTDKRSGQEPSWNAVLEFNIPSESYHIMKITVFHEGFRKHPHLIGDTVLSFEKAMKEELQSEWYELKNEFQFAGELSVQFKFIPTDPLYFDRASSKPVLQFPYSSVAALTPVPKKPSKPSKPRKKVPVSHPLPPTPPSREEHVSVPRESSLFTYEDDPLPSFPSPYMVDDYYTQDVFVSDNVNDYSYGVQNPTNPRLSVEDYDANHSSLPPVPPPHLILPTASSSQIFH | null | null | actin cortical patch localization [GO:0051666]; establishment or maintenance of bipolar cell polarity [GO:0061245]; mitotic actomyosin contractile ring assembly [GO:1903475]; mitotic cytokinesis [GO:0000281] | cell cortex of cell tip [GO:0051285]; cell division site [GO:0032153]; cell tip [GO:0051286]; mitotic actomyosin contractile ring [GO:0110085]; mitotic actomyosin contractile ring, intermediate layer [GO:0120105]; nucleus [GO:0005634] | cytoskeletal protein-membrane anchor activity [GO:0106006]; phospholipid binding [GO:0005543] | PF00168; | 2.60.40.150; | INN1/fic1 family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. Note=Localizes at the barrier septum and the cell tip. {ECO:0000269|PubMed:19139265}. | null | null | null | null | null | FUNCTION: Involved in the ingression of the plasma membrane during cytokinesis, leading to the separation of the daughter cells. Unlike its S.cerevisiae ortholog INN1, it does not play an essential role, probably because the actinomyosin ring is connected to the cell cortex by many more proteins. {ECO:0000269|PubMed:19... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94720 | FIL1_SCHPO | MNYNDTTEFCFPFGQPSFPTSAMTEGSFDGQFSEFDPTFTSPADTALSDIANLPIDLHKDALFANAPGKGDVDFDSVSMLQLLSDYPLAFNSTENNQKLQTNPSARWSLLDSMDFDNQRQCSDLESAQLGDSGLLKSTILSNSHIDIAALSSSKTSEPTPPFSYVQTPCIPTPSSALIDTPFPGALDSEFGFDESQAPLFPASDGDCQRAFASISYPTNYGCKLSNLGFMSPQSPVKRELNDSTSPSKLSESSSSLTGSSSALLSQSEFLGSVPSLSDSIATVDPFFSFESFETDEKARSLLMDASLKLPQFSTPNLSSN... | null | null | negative regulation of TORC1 signaling [GO:1904262]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of autophagy [GO:0010508]; positive regulation of transcription by RNA polymerase II [GO:0045944] | cytosol [GO:0005829]; nucleus [GO:0005634] | DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; zinc ion binding [GO:0008270] | PF00320; | 3.30.50.10; | null | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:16823372, ECO:0000305|PubMed:29432178}. Cytoplasm {ECO:0000269|PubMed:16823372}. | null | null | null | null | null | FUNCTION: Activates genes required for amino acid biosynthesis and acts as a master transcriptional regulator during amino acid starvation (PubMed:29432178). Binds variations of the DNA sequence 5'-GAT[AC]GC-3' (PubMed:29432178). {ECO:0000269|PubMed:29432178}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94737 | MAPK1_PNECA | MDSKHSVFNVMGQEFVLQKGYEVIKGLGKGSYGVVCSAKNIEVEDNNKVAIKKITNIFSKKMLAKRALREIMLLQHFRNHKNITTLYDMDIVDPSKFNELYLYEELMQANLNSIIRSDQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPSNLLINADCKLKICDFGLSRGISVNQGQGTEYMTEYVTTRWYRAPEVMLSFQSYSKAIDLWSVGCILAELLGRKPFFKGSNYVDQLNQIFCILGTPNENIISKIKSASAQSYIRSLPTLPKMPYSKIFPYANPDALDLLNCLLTFDPYDRISCEEALEHPYLIIWHDP... | 2.7.11.24 | null | cellular component organization [GO:0016043]; MAPK cascade [GO:0000165]; phosphorylation [GO:0016310]; positive regulation of growth rate [GO:0040010]; response to oxidative stress [GO:0006979] | cytoplasm [GO:0005737]; nucleus [GO:0005634] | ATP binding [GO:0005524]; ATP-dependent protein binding [GO:0043008]; MAP kinase activity [GO:0004707]; protein serine kinase activity [GO:0106310] | PF00069; | 1.10.510.10; | Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily | PTM: Dually phosphorylated on Thr-186 and Tyr-188, which activates the enzyme. | null | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.24; Evidence={ECO:0000269|PubMed:10564487}; CATALYTI... | null | null | null | null | FUNCTION: Serine-threonine protein kinase which may be involved in maintenance of cell integrity. Functionally complements SLT2 null mutant in S.cerevisiae. {ECO:0000269|PubMed:10564487}. | Pneumocystis carinii |
O94740 | CDC37_SCHPO | MAIDYSKWDKLELSDDSDIEVHPNVDKKSFIRWRQRDIHEKRAVRKQKMEDIKGAMAMNRRLLSRISEMETVLEKESPSDPYVLLGSFLEAKKSEDMDSAIPGGMSYHHMLMSLLKVIKDAEDTTEEKSMDDSDKCLRRLKSHKERLLKLLEDAQKEYDTLEAESKNYITSEDLHLGFDSTYVQKKEPEKPKKTKTKKETIQVIESLNNPTPPTDFPGAKEQASTGNAPKNPVNENESEDEEGLSLSEDGKKFANIDFGDYSSSEEFLKEHLNILADEEESDAILLEAFNAELEGKPSLAKQYVHQALLISYCRQLGPNG... | null | null | cell cycle [GO:0007049]; cell division [GO:0051301]; protein folding [GO:0006457]; protein stabilization [GO:0050821] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634] | heat shock protein binding [GO:0031072]; protein kinase binding [GO:0019901]; protein-folding chaperone binding [GO:0051087]; unfolded protein binding [GO:0051082] | PF08564;PF08565;PF03234; | 1.20.58.610; | CDC37 family | null | SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=When in the nucleus associated with chromatin. | null | null | null | null | null | FUNCTION: Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. {ECO:0000269|PubMed:12861001, ECO:0000269|PubMed:14652737}. | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94742 | SEM1_YEAST | MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ | null | null | double-strand break repair via homologous recombination [GO:0000724]; filamentous growth [GO:0030447]; maintenance of DNA trinucleotide repeats [GO:0035753]; mRNA export from nucleus [GO:0006406]; positive regulation of transcription by RNA polymerase II [GO:0045944]; proteasome assembly [GO:0043248]; proteasome-mediat... | cytosol [GO:0005829]; proteasome complex [GO:0000502]; proteasome regulatory particle, lid subcomplex [GO:0008541]; proteasome storage granule [GO:0034515]; transcription export complex 2 [GO:0070390] | molecular adaptor activity [GO:0060090]; protein folding chaperone [GO:0044183] | PF05160; | 6.10.250.1210; | DSS1/SEM1 family | null | null | null | null | null | null | null | FUNCTION: Versatile protein that might stabilize multiple protein complexes involved in diverse pathways. Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis. Associates also with the TREX-2 complex that is required for transcription-coupled mRNA export, and the COP9 signalosome, which i... | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
O94751 | BUB1_SCHPO | MSDWRLTENVLDQNIPETKPRESKTRLEEIQRLALFQEELDIIEELDDPVDVWYRCIEWLLETRFLGMETVNKMLDDAIQYLERCRFALNDVRHLLIQLAKIKQSYETPDELQQAAKQFYQLASKGIGLELALFYEEYGSLLIRMQRWKEASEVFHAAVSREARPLVRLLRNAAEFSRAYDLHNAHPSIHDAPYSSPFPPPRIVLGSKPVSSSTLPSKPKSFQVFSDASSSRDSQNASDLPQAKSLESEANTPNLPLLYDKSSGKRVEYSAFNFLALYENGEERSMEECRAQRYLSSIQPNTAASFPKVVPKNEISVHHD... | 2.7.11.1 | null | attachment of mitotic spindle microtubules to kinetochore [GO:0051315]; cell division [GO:0051301]; homologous chromosome segregation [GO:0045143]; meiosis I spindle assembly checkpoint signaling [GO:1905318]; meiotic centromeric cohesion protection in anaphase I [GO:1990813]; meiotic sister chromatid cohesion, centrom... | bub1-bub3 complex [GO:1990298]; chromosome, centromeric core domain [GO:0034506]; chromosome, centromeric region [GO:0000775]; inner kinetochore [GO:0000939]; kinetochore [GO:0000776]; mitotic spindle pole body [GO:0044732]; nucleus [GO:0005634]; old mitotic spindle pole body [GO:0071957]; outer kinetochore [GO:0000940... | ATP binding [GO:0005524]; histone H2AS121 kinase activity [GO:0072371]; identical protein binding [GO:0042802]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310] | PF08311;PF00069; | 1.25.40.430;1.10.510.10; | Protein kinase superfamily, Ser/Thr protein kinase family, BUB1 subfamily | PTM: Autophosphorylated. {ECO:0000250}. | SUBCELLULAR LOCATION: Nucleus. Chromosome, centromere, kinetochore. Chromosome, centromere. Note=Associates with kinetochores and centromeres during the early stages of mitosis. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[pr... | null | null | null | null | FUNCTION: Involved in cell cycle checkpoint enforcement. Acts to stabilize the spindle during mitosis. Required for the correct localization of bub3 and mad3 to the kinetochore. Appears to have a role in chromosome segregation. Catalyzes the phosphorylation of bub3. {ECO:0000269|PubMed:15509783, ECO:0000269|PubMed:1552... | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
O94753 | VPL2_PLEER | MSFKTLSALALALGAAVQFASAAVPLVQKRATCDDGRTTANAACCILFPILDDIQENLFDGAQCGEEVHESLRLTFHDAIGFSPTLGGGGADGSIIAFDTIETNFPANAGIDEIVSAQKPFVAKHNISAGDFIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPFDSVDSILARMGDAGFSPVEVVWLLASHSIAAADKVDPSIPGTPFDSTPGVFDSQFFIETQLKGRLFPGTADNKGEAQSPLQGEIRLQSDHLLARDPQTACEWQSMVNNQPKIQNRFAATMSKMALLGQDKTKLIDCSDVIPTPPALVG... | 1.11.1.16 | COFACTOR: Name=heme b; Xref=ChEBI:CHEBI:60344; Evidence={ECO:0000255|PROSITE-ProRule:PRU00297, ECO:0000269|PubMed:12884090}; Note=Binds 1 heme b (iron(II)-protoporphyrin IX) group per subunit. {ECO:0000255|PROSITE-ProRule:PRU00297, ECO:0000269|PubMed:12884090}; COFACTOR: Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={E... | cellular response to oxidative stress [GO:0034599]; hydrogen peroxide catabolic process [GO:0042744]; lignin catabolic process [GO:0046274]; response to reactive oxygen species [GO:0000302] | extracellular region [GO:0005576] | heme binding [GO:0020037]; manganese peroxidase activity [GO:0016689]; metal ion binding [GO:0046872]; reactive-black-5:hydrogen-peroxide oxidoreductase activity [GO:0052750] | PF00141;PF11895; | 1.10.520.10;1.10.420.10; | Peroxidase family, Ligninase subfamily | null | SUBCELLULAR LOCATION: Secreted {ECO:0000255|PROSITE-ProRule:PRU00297, ECO:0000269|PubMed:9987124}. | CATALYTIC ACTIVITY: Reaction=1-(4-hydroxy-3-methoxyphenyl)-2-(2-methoxyphenoxy)propane-1,3-diol + H2O2 = glycolaldehyde + guaiacol + H2O + vanillin; Xref=Rhea:RHEA:22396, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:17071, ChEBI:CHEBI:18346, ChEBI:CHEBI:28591, ChEBI:CHEBI:53650; EC=1.11.1.16; Evidence={ECO:0000269... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=19 uM for manganese {ECO:0000269|PubMed:12884090}; KM=3000 uM for veratryl alcohol {ECO:0000269|PubMed:12884090}; KM=4 uM for reactive black 5 {ECO:0000269|PubMed:12884090}; KM=3 uM for 2,2'-azinobis(3-ethylbenzothiazoline-6-sulfonate) (ABTS) {ECO:0000269|PubMed:12... | null | null | null | FUNCTION: A versatile ligninolytic peroxidase that combines the substrate specificity characteristics of the two other ligninolytic peroxidases, manganese peroxidase and lignin peroxidase. {ECO:0000269|PubMed:9987124}. | Pleurotus eryngii (Boletus of the steppes) |
O94759 | TRPM2_HUMAN | MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLSSWIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVA... | null | null | calcium ion import across plasma membrane [GO:0098703]; calcium ion transmembrane import into cytosol [GO:0097553]; calcium ion transmembrane transport [GO:0070588]; calcium ion transport [GO:0006816]; calcium-mediated signaling using intracellular calcium source [GO:0035584]; cellular response to calcium ion [GO:00712... | cell projection [GO:0042995]; cytoplasmic vesicle membrane [GO:0030659]; ficolin-1-rich granule membrane [GO:0101003]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821] | calcium channel activity [GO:0005262]; calcium ion binding [GO:0005509]; intracellularly gated calcium channel activity [GO:0015278]; ligand-gated calcium channel activity [GO:0099604]; manganese ion transmembrane transporter activity [GO:0005384]; mono-ADP-D-ribose binding [GO:0072571]; monoatomic cation channel activ... | PF00520;PF18139; | 3.40.50.450;3.90.79.10; | Transient receptor (TC 1.A.4) family, LTrpC subfamily, TRPM2 sub-subfamily | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:11385575, ECO:0000269|PubMed:11509734, ECO:0000269|PubMed:11804595, ECO:0000269|PubMed:12594222, ECO:0000269|PubMed:15561722, ECO:0000269|PubMed:16601673, ECO:0000269|PubMed:19171771, ECO:0000269|PubMed:20650899, ECO:0000269|PubMed:20660597, ECO:0000269|PubMed:224... | null | null | null | null | null | FUNCTION: [Isoform 1]: Nonselective, voltage-independent cation channel that mediates Na(+) and Ca(2+) influx, leading to increased cytoplasmic Ca(2+) levels (PubMed:11385575, PubMed:11509734, PubMed:11804595, PubMed:11960981, PubMed:12594222, PubMed:15561722, PubMed:16601673, PubMed:19171771, PubMed:20660597, PubMed:2... | Homo sapiens (Human) |
O94760 | DDAH1_HUMAN | MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS | 3.5.3.18 | null | arginine catabolic process [GO:0006527]; arginine metabolic process [GO:0006525]; citrulline metabolic process [GO:0000052]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cellular response to hypoxia [GO:1900038]; negative regulation of vascular permeability [GO:0043116]; nit... | cytosol [GO:0005829]; extracellular exosome [GO:0070062] | amino acid binding [GO:0016597]; catalytic activity [GO:0003824]; dimethylargininase activity [GO:0016403]; metal ion binding [GO:0046872] | PF19420; | null | DDAH family | null | null | CATALYTIC ACTIVITY: Reaction=H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline; Xref=Rhea:RHEA:17305, ChEBI:CHEBI:15377, ChEBI:CHEBI:57743, ChEBI:CHEBI:58040, ChEBI:CHEBI:58326; EC=3.5.3.18; Evidence={ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506, ECO:0000269|PubMed:21493890, ECO:000... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=69 uM for asymmetric dimethylarginine (ADMA) {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; KM=54 uM for monomethyl-L-arginine (MMA) {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; KM=3.1 uM for S-methyl-L-thiocitrulline {ECO:0000269|PubMed... | null | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.5. {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506}; | null | FUNCTION: Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. {ECO:0000269|PubMed:18171027, ECO:0000269|PubMed:19663506, ECO:0000269|PubMed:21493890, ECO:0000269|PubMed:37296100}. | Homo sapiens (Human) |
O94761 | RECQ4_HUMAN | MERLRDVRERLQAWERAFRRQRGRRPSQDDVEAAPEETRALYREYRTLKRTTGQAGGGLRSSESLPAAAEEAPEPRCWGPHLNRAATKSPQSTPGRSRQGSVPDYGQRLKANLKGTLQAGPALGRRPWPLGRASSKASTPKPPGTGPVPSFAEKVSDEPPQLPEPQPRPGRLQHLQASLSQRLGSLDPGWLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGESAVLGPGAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYH... | 5.6.2.4 | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:28653661, ECO:0000312|PDB:5LST}; Note=Binds a Zn(2+) ion per subunit. {ECO:0000269|PubMed:28653661, ECO:0000312|PDB:5LST}; | DNA duplex unwinding [GO:0032508]; DNA repair [GO:0006281]; DNA replication [GO:0006260]; DNA unwinding involved in DNA replication [GO:0006268]; double-strand break repair via homologous recombination [GO:0000724]; telomere maintenance [GO:0000723]; telomeric D-loop disassembly [GO:0061820] | chromosome [GO:0005694]; chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; bubble DNA binding [GO:0000405]; DNA/DNA annealing activity [GO:1990814]; four-way junction helicase activity [GO:0009378]; helicase activity [GO:0004386]; isomerase activity [GO:0016853]; metal ion binding [GO:0046872]; oxidized purine DNA binding [GO:003... | PF00270;PF11719;PF00271; | 1.10.10.1460;3.40.50.300; | Helicase family, RecQ subfamily | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15317757}. Nucleus {ECO:0000269|PubMed:10552928}. | CATALYTIC ACTIVITY: Reaction=Couples ATP hydrolysis with the unwinding of duplex DNA by translocating in the 3'-5' direction.; EC=5.6.2.4; Evidence={ECO:0000269|PubMed:28653661}; CATALYTIC ACTIVITY: Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:3061... | null | null | null | null | FUNCTION: An ATP-dependent DNA helicase which unwinds dsDNA with a 3'-overhang in a 3'-5' direction (PubMed:28653661). Does not unwind more than 18 bp of dsDNA (PubMed:28653661). May modulate chromosome segregation. The N-terminal domain (residues 1-54) binds DNA Y-shaped DNA better than ss- or dsDNA (PubMed:22730300).... | Homo sapiens (Human) |
O94762 | RECQ5_HUMAN | MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSLCYQLPALLAKGITIVVSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQERKELLADLEREKPQTKILYITPEMAASSSFQPTLNSLVSRHLLSYLVVDEAHCVSQWGHDFRPDYLRLGALRSRLGHAPCVALTATATPQVQEDVFAALHLKKPVAIFKTPCFRANLFYDVQFKELISDPYGNLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAYHAGLKASERTLVQNDWMEEKVPVIVATISFG... | 5.6.2.4 | COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:28100692, ECO:0007744|PDB:5LB3, ECO:0007744|PDB:5LB5, ECO:0007744|PDB:5LB8}; Note=Binds a Zn(2+) ion per subunit. {ECO:0000269|PubMed:28100692, ECO:0007744|PDB:5LB3, ECO:0007744|PDB:5LB5, ECO:0007744|PDB:5LB8}; | cell division [GO:0051301]; cellular response to camptothecin [GO:0072757]; cellular response to xenobiotic stimulus [GO:0071466]; chromosome separation [GO:0051304]; DNA metabolic process [GO:0006259]; DNA repair [GO:0006281]; DNA replication [GO:0006260]; DNA unwinding involved in DNA replication [GO:0006268]; double... | chromosome [GO:0005694]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; replication fork [GO:0005657]; transcription preinitiation complex [GO:0097550] | 3'-5' DNA helicase activity [GO:0043138]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; four-way junction helicase activity [GO:0009378]; helicase activity [GO:0004386]; identical protein binding [GO:0042802]; isomerase activity [GO:0016853... | PF00270;PF00271;PF06959;PF16124; | 6.10.250.2460;6.10.250.3140;3.40.50.300; | Helicase family, RecQ subfamily | PTM: Phosphorylated by CDK1 at Ser-727; this phosphorylation is required for RECQL5-mediated disruption of RAD51 filaments on stalled replication forks. {ECO:0000269|PubMed:28575661}. | SUBCELLULAR LOCATION: [Isoform Beta]: Nucleus, nucleoplasm {ECO:0000269|PubMed:10710432, ECO:0000269|PubMed:23180761, ECO:0000269|PubMed:23715498}. Nucleus {ECO:0000269|PubMed:23180761}. Note=Recruited to sites of DNA damage, such as single-strand breaks and inter-strand cross-links, and at stalled replication forks. R... | CATALYTIC ACTIVITY: Reaction=Couples ATP hydrolysis with the unwinding of duplex DNA by translocating in the 3'-5' direction.; EC=5.6.2.4; Evidence={ECO:0000305|PubMed:28100692}; CATALYTIC ACTIVITY: Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:3061... | null | null | null | null | FUNCTION: DNA helicase that plays an important role in DNA replication, transcription and repair (PubMed:20643585, PubMed:22973052, PubMed:28100692). Probably unwinds DNA in a 3'-5' direction (Probable) (PubMed:28100692). Binds to the RNA polymerase II subunit POLR2A during transcription elongation and suppresses trans... | Homo sapiens (Human) |
O94763 | RMP_HUMAN | MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDN... | null | null | cellular response to growth factor stimulus [GO:0071363]; cellular response to steroid hormone stimulus [GO:0071383]; negative regulation of intrinsic apoptotic signaling pathway [GO:2001243]; negative regulation of phosphatase activity [GO:0010923]; negative regulation of transcription by RNA polymerase II [GO:0000122... | cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein folding chaperone complex [GO:0101031]; RPAP3/R2TP/prefoldin-like complex [GO:1990062] | chromatin binding [GO:0003682]; phosphatase inhibitor activity [GO:0019212]; phosphoprotein binding [GO:0051219]; protein phosphatase inhibitor activity [GO:0004864]; RNA polymerase II complex binding [GO:0000993]; transcription corepressor activity [GO:0003714] | PF02996; | 1.10.287.370; | RNA polymerase II subunit 5-mediating protein family | PTM: Phosphorylated. Phosphorylation occurs essentially on serine residues. Phosphorylation occurs in response to androgen treatment in prostate cancer cells in a mTOR-dependent manner. Phosphorylated; hyperhosphorylated in mitochondria in a mTORC-dependent signaling pathway. Phosphorylated at Ser-372 by RPS6KB1 in a g... | SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Mitochondrion. Cell projection, dendrite {ECO:0000250}. Note=Colocalizes with PFDN2, PFDN4, PPP1CC, RPS6KB1 and STAP1 at mitochondrion. | null | null | null | null | null | FUNCTION: Involved in gene transcription regulation. Acts as a transcriptional repressor in concert with the corepressor UXT to regulate androgen receptor (AR) transcription. May act as a tumor suppressor to repress AR-mediated gene transcription and to inhibit anchorage-independent growth in prostate cancer cells. Req... | Homo sapiens (Human) |
O94766 | B3GA3_HUMAN | MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHLESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPKMKQEE... | 2.4.1.135 | COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; | carbohydrate metabolic process [GO:0005975]; chondroitin sulfate proteoglycan biosynthetic process [GO:0050650]; dermatan sulfate proteoglycan biosynthetic process [GO:0050651]; glycosaminoglycan biosynthetic process [GO:0006024]; heparan sulfate proteoglycan biosynthetic process [GO:0015012]; positive regulation of ca... | cis-Golgi network [GO:0005801]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; membrane [GO:0016020] | galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity [GO:0015018]; glucuronosyltransferase activity [GO:0015020]; metal ion binding [GO:0046872]; protein phosphatase activator activity [GO:0072542] | PF03360; | null | Glycosyltransferase 43 family | PTM: N-glycosylated. | SUBCELLULAR LOCATION: Golgi apparatus membrane {ECO:0000269|PubMed:21763480}; Single-pass type II membrane protein {ECO:0000269|PubMed:21763480}. Golgi apparatus, cis-Golgi network {ECO:0000269|PubMed:21763480, ECO:0000269|PubMed:25893793}. | CATALYTIC ACTIVITY: Reaction=3-O-(beta-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-xylosyl)-L-seryl-[protein] + UDP-alpha-D-glucuronate = 3-O-(beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl)-L-seryl-[protein] + H(+) + UDP; Xref=Rhea:RHEA:24168, Rhea:RHEA-COMP:12571, Rhea:RHEA-COMP:12573, ChEB... | null | PATHWAY: Protein modification; protein glycosylation. | null | null | FUNCTION: Glycosaminoglycans biosynthesis (PubMed:25893793). Involved in forming the linkage tetrasaccharide present in heparan sulfate and chondroitin sulfate. Transfers a glucuronic acid moiety from the uridine diphosphate-glucuronic acid (UDP-GlcUA) to the common linkage region trisaccharide Gal-beta-1,3-Gal-beta-1,... | Homo sapiens (Human) |
O94768 | ST17B_HUMAN | MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRS... | 2.7.11.1 | null | apoptotic process [GO:0006915]; intracellular signal transduction [GO:0035556]; positive regulation of apoptotic process [GO:0043065]; positive regulation of fibroblast apoptotic process [GO:2000271]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468] | actin cytoskeleton [GO:0015629]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; Flemming body [GO:0090543]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886] | ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00069; | 1.10.510.10; | Protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily | PTM: Autophosphorylated. | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:9786912}. Cell membrane {ECO:0000250}. Endoplasmic reticulum-Golgi intermediate compartment {ECO:0000250}. Note=Colocalizes with STK17B at the plasma membrane. {ECO:0000250}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[pr... | null | null | null | null | FUNCTION: Phosphorylates myosin light chains (By similarity). Acts as a positive regulator of apoptosis. {ECO:0000250, ECO:0000269|PubMed:9786912}. | Homo sapiens (Human) |
O94769 | ECM2_HUMAN | MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLPIVNFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGDSSEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEEDTEQKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGEEGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGC... | null | null | cell-matrix adhesion [GO:0007160]; extracellular matrix organization [GO:0030198]; positive regulation of cell-substrate adhesion [GO:0010811] | extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; interstitial matrix [GO:0005614] | collagen V binding [GO:0070052]; heparin binding [GO:0008201]; integrin binding [GO:0005178] | PF12799;PF13855;PF00093; | 6.20.200.20;3.80.10.10; | Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily | null | SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix {ECO:0000250|UniProtKB:Q5FW85}. | null | null | null | null | null | FUNCTION: Promotes matrix assembly and cell adhesiveness. {ECO:0000250|UniProtKB:Q5FW85}. | Homo sapiens (Human) |
O94776 | MTA2_HUMAN | MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQK... | null | null | chromatin organization [GO:0006325]; chromatin remodeling [GO:0006338]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of transcription by RNA po... | chromatin [GO:0000785]; chromosome, telomeric region [GO:0000781]; histone deacetylase complex [GO:0000118]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; NuRD complex [GO:0016581]; protein-containing complex [GO:0032991]; transcription regulator complex [GO:0005667] | chromatin binding [GO:0003682]; histone deacetylase activity [GO:0004407]; histone deacetylase binding [GO:0042826]; metal ion binding [GO:0046872]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; sequence-specific DNA binding [GO:0043565]; transcription coactivator activity [GO:000371... | PF01426;PF01448;PF00320;PF17226;PF00249; | 2.30.30.490;4.10.1240.50;1.10.10.60; | null | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00512, ECO:0000255|PROSITE-ProRule:PRU00624, ECO:0000269|PubMed:28977666, ECO:0000269|PubMed:33283408}. | null | null | null | null | null | FUNCTION: May function as a transcriptional coregulator (PubMed:16428440, PubMed:28977666). Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440, PubMed:28977666). {ECO:0000269|PubMed:16428440, ECO:0000269|PubMed:28977666}. | Homo sapiens (Human) |
O94777 | DPM2_HUMAN | MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ | null | null | dolichol metabolic process [GO:0019348]; GPI anchor biosynthetic process [GO:0006506]; protein O-linked mannosylation [GO:0035269]; regulation of protein stability [GO:0031647] | dolichol-phosphate-mannose synthase complex [GO:0033185]; endoplasmic reticulum membrane [GO:0005789]; glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex [GO:0000506] | enzyme activator activity [GO:0008047]; enzyme regulator activity [GO:0030234] | PF07297; | null | DPM2 family | null | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Multi-pass membrane protein. | null | null | PATHWAY: Protein modification; protein glycosylation. {ECO:0000269|PubMed:10835346}. | null | null | FUNCTION: Regulates the biosynthesis of dolichol phosphate-mannose (PubMed:10835346). Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1 (PubMed:10835346). Part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (... | Homo sapiens (Human) |
O94778 | AQP8_HUMAN | MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRLILKAR | null | null | ammonium import across plasma membrane [GO:0140157]; ammonium transmembrane transport [GO:0072488]; B cell differentiation [GO:0030183]; cellular detoxification [GO:1990748]; cellular response to cAMP [GO:0071320]; hydrogen peroxide transmembrane transport [GO:0080170]; methylammonium transport [GO:0015843]; regulation... | apical part of cell [GO:0045177]; apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; brush border membrane [GO:0031526]; intracellular canaliculus [GO:0046691]; intracellular vesicle [GO:0097708]; mitochondrial inner membrane [GO:0005743]; mitochondrial membrane [GO:0031966]; mitochondrion [... | ammonium transmembrane transporter activity [GO:0008519]; methylammonium channel activity [GO:0015264]; urea channel activity [GO:0015265]; water channel activity [GO:0015250] | PF00230; | 1.20.1080.10; | MIP/aquaporin (TC 1.A.8) family | PTM: Sulfenylation at Cys-53(C53-SOH) when hydrogen peroxide flows through the AQP8 channel, making it susceptible to hydrogen sulfide produced by CBS. {ECO:0000269|PubMed:29732408}.; PTM: Persulfidation at Cys-53 is required to gate AQP8 channel; under stress condition, hydrogen peroxide accumulates in the cell leadin... | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:18948439}; Multi-pass membrane protein {ECO:0000255}. Mitochondrion inner membrane {ECO:0000269|PubMed:22622463, ECO:0000269|PubMed:34292591, ECO:0000305|PubMed:28042826}; Multi-pass membrane protein {ECO:0000255}. Apical cell membrane {ECO:0000250|UniProtKB:P5640... | CATALYTIC ACTIVITY: Reaction=H2O(in) = H2O(out); Xref=Rhea:RHEA:29667, ChEBI:CHEBI:15377; Evidence={ECO:0000269|PubMed:15948717, ECO:0000269|PubMed:18948439, ECO:0000269|PubMed:26972385}; CATALYTIC ACTIVITY: Reaction=H2O2(out) = H2O2(in); Xref=Rhea:RHEA:74375, ChEBI:CHEBI:16240; Evidence={ECO:0000269|PubMed:23541115, E... | null | null | null | null | FUNCTION: Channel that allows the facilitated permeation of water and uncharged molecules, such as hydrogen peroxide and the neutral form of ammonia (NH3), through cellular membranes such as plasma membrane, inner mitochondrial membrane and endoplasmic reticulum membrane of several tissues (PubMed:15948717, PubMed:1894... | Homo sapiens (Human) |
O94779 | CNTN5_HUMAN | MASSWKLMLFLSVTMCLSEYSKSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDIIFPTDSDEKKVALNCEVRGNPVPSYRWLRNGTEIDLESDYRYSLIDGTFIISNPSEAKDSGHYQCLATNTVGSILSREATLQFAYLGNFSGRTRSAVSVREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQETGNLYISKVQTSDVGSYICLVKNTVTNARVLSPPTPLTLRNDGVMGEYEPKIEVHFPFTVTAAKGTTVKM... | null | null | axon guidance [GO:0007411]; brain development [GO:0007420]; cell-cell adhesion [GO:0098609]; presynapse assembly [GO:0099054]; sensory perception of sound [GO:0007605] | axon [GO:0030424]; extracellular region [GO:0005576]; GABA-ergic synapse [GO:0098982]; plasma membrane [GO:0005886]; presynaptic membrane [GO:0042734]; side of membrane [GO:0098552] | cell-cell adhesion mediator activity [GO:0098632] | PF00041;PF07679;PF13927; | 2.60.40.10; | Immunoglobulin superfamily, Contactin family | null | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Lipid-anchor, GPI-anchor {ECO:0000250}. | null | null | null | null | null | FUNCTION: Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity in the cerebral cortical neurons but not in hippocampal neurons. Probably involved in neuronal activity in the auditory system (By similarity). {ECO:0000250}. | Homo sapiens (Human) |
O94782 | UBP1_HUMAN | MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQVVPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNMKKKVKLSKEHQSLEENQRQTRSKRKATSDTLESPPKIIPK... | 3.4.19.12 | null | DNA repair [GO:0006281]; monoubiquitinated protein deubiquitination [GO:0035520]; positive regulation of error-prone translesion synthesis [GO:1904333]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; protein deubiquitination [GO:0016579]; proteolysis [GO:0006508]; regulation of DNA repair ... | cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634] | cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; peptidase activity [GO:0008233] | PF00443; | 3.90.70.10; | Peptidase C19 family | PTM: Autocatalytic cleavage of USP1 following UV irradiation inactivates it, leading to an increase in ubiquitinated PCNA, recruitment of POLH and translesion synthesis. {ECO:0000269|PubMed:15694335, ECO:0000269|PubMed:16531995}.; PTM: [Ubiquitin carboxyl-terminal hydrolase 1, N-terminal fragment]: Ubiquitinated by the... | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:15694335}. | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000269|PubMed:15694335, ECO:0000269|PubMed:16531995, ... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.7 uM for ubiquitin vinyl sulfone (in presence of WDR48) {ECO:0000269|PubMed:18082604}; KM=1.4 uM for ubiquitin vinyl sulfone (in absence of WDR48) {ECO:0000269|PubMed:18082604}; | null | null | null | FUNCTION: Negative regulator of DNA damage repair which specifically deubiquitinates monoubiquitinated FANCD2 (PubMed:15694335). Also involved in PCNA-mediated translesion synthesis (TLS) by deubiquitinating monoubiquitinated PCNA (PubMed:16531995, PubMed:20147293). Has almost no deubiquitinating activity by itself and... | Homo sapiens (Human) |
O94788 | AL1A2_HUMAN | MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCC... | 1.2.1.36 | null | 9-cis-retinoic acid biosynthetic process [GO:0042904]; blood vessel development [GO:0001568]; cardiac muscle tissue development [GO:0048738]; cell population proliferation [GO:0008283]; cellular response to retinoic acid [GO:0071300]; determination of bilateral symmetry [GO:0009855]; embryonic camera-type eye developme... | cytoplasm [GO:0005737]; cytosol [GO:0005829]; perinuclear region of cytoplasm [GO:0048471] | 3-chloroallyl aldehyde dehydrogenase activity [GO:0004028]; aldehyde dehydrogenase (NAD+) activity [GO:0004029]; retinal binding [GO:0016918]; retinal dehydrogenase activity [GO:0001758] | PF00171; | null | Aldehyde dehydrogenase family | null | SUBCELLULAR LOCATION: Cytoplasm. | CATALYTIC ACTIVITY: Reaction=H2O + NAD(+) + retinal = 2 H(+) + NADH + retinoate; Xref=Rhea:RHEA:16177, ChEBI:CHEBI:15035, ChEBI:CHEBI:15036, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:57540, ChEBI:CHEBI:57945; EC=1.2.1.36; Evidence={ECO:0000269|PubMed:29240402, ECO:0000269|PubMed:33565183}; PhysiologicalDirectio... | null | PATHWAY: Cofactor metabolism; retinol metabolism. {ECO:0000269|PubMed:29240402}. | null | null | FUNCTION: Catalyzes the NAD-dependent oxidation of aldehyde substrates, such as all-trans-retinal and all-trans-13,14-dihydroretinal, to their corresponding carboxylic acids, all-trans-retinoate and all-trans-13,14-dihydroretinoate, respectively (PubMed:29240402, PubMed:33565183). Retinoate signaling is critical for th... | Homo sapiens (Human) |
O94804 | STK10_HUMAN | MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEEIED... | 2.7.11.1 | null | cell cycle [GO:0007049]; lymphocyte aggregation [GO:0071593]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of lymphocyte migration [GO:2000401] | cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579] | ATP binding [GO:0005524]; identical protein binding [GO:0042802]; protein homodimerization activity [GO:0042803]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00069;PF12474; | 1.10.510.10; | Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily | PTM: Autophosphorylates following homodimerization, leading to activation of the protein. | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:19255442}; Peripheral membrane protein {ECO:0000269|PubMed:19255442}. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:18239682}; CATALYTIC... | null | null | null | null | FUNCTION: Serine/threonine-protein kinase involved in regulation of lymphocyte migration. Phosphorylates MSN, and possibly PLK1. Involved in regulation of lymphocyte migration by mediating phosphorylation of ERM proteins such as MSN. Acts as a negative regulator of MAP3K1/MEKK1. May also act as a cell cycle regulator b... | Homo sapiens (Human) |
O94805 | ACL6B_HUMAN | MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTML... | null | null | chromatin organization [GO:0006325]; chromatin remodeling [GO:0006338]; dendrite development [GO:0016358]; negative regulation of cell differentiation [GO:0045596]; nervous system development [GO:0007399]; neuron maturation [GO:0042551]; positive regulation of cell differentiation [GO:0045597]; positive regulation of c... | bBAF complex [GO:0140092]; brahma complex [GO:0035060]; chromatin [GO:0000785]; GBAF complex [GO:0140288]; kinetochore [GO:0000776]; nBAF complex [GO:0071565]; NuA4 histone acetyltransferase complex [GO:0035267]; nuclear matrix [GO:0016363]; nucleus [GO:0005634]; RSC-type complex [GO:0016586]; SWI/SNF complex [GO:00165... | chromatin binding [GO:0003682]; structural constituent of cytoskeleton [GO:0005200]; transcription coactivator activity [GO:0003713] | PF00022; | 3.30.420.40; | Actin family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000303|PubMed:26601204}. | null | null | null | null | null | FUNCTION: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome ... | Homo sapiens (Human) |
O94806 | KPCD3_HUMAN | MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSENILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPEYVALPSEESHVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRD... | 2.7.11.13 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; | intracellular signal transduction [GO:0035556]; phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]; protein phosphorylation [GO:0006468]; sphingolipid biosynthetic process [GO:0030148] | cytosol [GO:0005829]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886] | ATP binding [GO:0005524]; diacylglycerol-dependent serine/threonine kinase activity [GO:0004697]; kinase activity [GO:0016301]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | PF00130;PF00169;PF00069; | 3.30.60.20;2.30.29.30;1.10.510.10; | Protein kinase superfamily, CAMK Ser/Thr protein kinase family, PKD subfamily | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:18076381}. Membrane {ECO:0000269|PubMed:18076381}. Note=Translocation to the cell membrane is required for kinase activation. | CATALYTIC ACTIVITY: Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.13; CATALYTIC ACTIVITY: Reaction=ATP + L-threonyl-[p... | null | null | null | null | FUNCTION: Converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. Involved in resistance to oxidative stress (By similarity). {ECO:0000250}. | Homo sapiens (Human) |
O94808 | GFPT2_HUMAN | MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKRGKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMKG... | 2.6.1.16 | null | cellular response to leukemia inhibitory factor [GO:1990830]; energy reserve metabolic process [GO:0006112]; fructose 6-phosphate metabolic process [GO:0006002]; glutamine metabolic process [GO:0006541]; protein N-linked glycosylation [GO:0006487]; UDP-N-acetylglucosamine biosynthetic process [GO:0006048]; UDP-N-acetyl... | cytosol [GO:0005829] | carbohydrate derivative binding [GO:0097367]; glutamine-fructose-6-phosphate transaminase (isomerizing) activity [GO:0004360] | PF13522;PF01380; | 3.60.20.10; | null | null | null | CATALYTIC ACTIVITY: Reaction=D-fructose 6-phosphate + L-glutamine = D-glucosamine 6-phosphate + L-glutamate; Xref=Rhea:RHEA:13237, ChEBI:CHEBI:29985, ChEBI:CHEBI:58359, ChEBI:CHEBI:58725, ChEBI:CHEBI:61527; EC=2.6.1.16; Evidence={ECO:0000250|UniProtKB:P82808}; | null | PATHWAY: Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D-glucosamine biosynthesis; alpha-D-glucosamine 6-phosphate from D-fructose 6-phosphate: step 1/1. {ECO:0000250|UniProtKB:P82808}. | null | null | FUNCTION: Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins. | Homo sapiens (Human) |
O94810 | RGS11_HUMAN | MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERWGFSFRELLEDPVGRAHFMDF... | null | null | G protein-coupled receptor signaling pathway [GO:0007186]; intracellular signal transduction [GO:0035556]; negative regulation of signal transduction [GO:0009968]; regulation of G protein-coupled receptor signaling pathway [GO:0008277] | cytoplasm [GO:0005737]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991] | G-protein beta-subunit binding [GO:0031681]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924] | PF00610;PF00631;PF00615;PF18148; | 1.10.1240.60;1.10.167.10;4.10.260.10;1.10.10.10; | null | null | null | null | null | null | null | null | FUNCTION: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. | Homo sapiens (Human) |
O94811 | TPPP_HUMAN | MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK | 3.6.5.- | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:21316364}; | astral microtubule organization [GO:0030953]; cell division [GO:0051301]; microtubule bundle formation [GO:0001578]; microtubule nucleation by microtubule organizing center [GO:0051418]; microtubule polymerization [GO:0046785]; myelin assembly [GO:0032288]; negative regulation of tubulin deacetylation [GO:1904428]; oli... | cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; microtubule [GO:0005874]; microtubule organizing center [GO:0005815]; mitochondrion [GO:0005739]; mitotic spindle [GO:0072686]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; postsynaptic Golgi apparatus [GO:0150051] | GTPase activity [GO:0003924]; magnesium ion binding [GO:0000287]; microtubule binding [GO:0008017]; microtubule nucleator activity [GO:0140490]; protein dimerization activity [GO:0046983]; protein homodimerization activity [GO:0042803]; tubulin binding [GO:0015631] | PF05517; | 1.10.238.10; | TPPP family | PTM: Phosphorylated by LIMK1 on serine residues; phosphorylation may alter the tubulin polymerization activity (PubMed:17693641, PubMed:18028908). Phosphorylation by LIMK2, but not LIMK1, regulates astral microtubule organization at early stage of mitosis (PubMed:22328514). Phosphorylation by ROCK1 at Ser-32, Ser-107 a... | SUBCELLULAR LOCATION: Golgi outpost {ECO:0000250|UniProtKB:D3ZQL7}. Cytoplasm, cytoskeleton, microtubule organizing center {ECO:0000250|UniProtKB:D3ZQL7}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:17105200}. Nucleus {ECO:0000269|PubMed:18028908}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:22328514}. Note=Sp... | CATALYTIC ACTIVITY: Reaction=GTP + H2O = GDP + H(+) + phosphate; Xref=Rhea:RHEA:19669, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:37565, ChEBI:CHEBI:43474, ChEBI:CHEBI:58189; Evidence={ECO:0000269|PubMed:21316364, ECO:0000269|PubMed:21995432}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:19670; Evidence=... | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: Note=kcat is 0.018 min(-1) for GTP. {ECO:0000269|PubMed:21316364}; | null | null | null | FUNCTION: Regulator of microtubule dynamics that plays a key role in myelination by promoting elongation of the myelin sheath (PubMed:31522887). Acts as a microtubule nucleation factor in oligodendrocytes: specifically localizes to the postsynaptic Golgi apparatus region, also named Golgi outpost, and promotes microtub... | Homo sapiens (Human) |
O94812 | BAIP3_HUMAN | MRPRGAAFAAGPPGDLHLGTAIGFAGAIWRSRSPAMSTLLDIKSSVLRQVQVCPSFRRRTEQDPGSASADPQEPATGAWKPGDGVEFFAHMRLMLKKGEGRQGLPCLEVPLRSGSPAPPEPVDPSLGLRALAPEEVEMLYEEALYTVLYRAGTMGPDQVDDEEALLSYLQQVFGTSLEEHTEAIERVRKAKAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPASDATREPRAQKEQRFGFRKGSKRGGPLPAKCIQVTEVKSSTLNPVWKEHFLFEIEDVSTDQLHLDIWDHDDDVSLVEACRKLNEVIGLKGMGR... | null | COFACTOR: Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000255|PROSITE-ProRule:PRU00041}; Note=Binds 3 Ca(2+) ions per C2 domain. {ECO:0000255|PROSITE-ProRule:PRU00041}; | dense core granule maturation [GO:1990502]; exocytosis [GO:0006887]; G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]; positive regulation of neurotransmitter secretion [GO:0001956]; regulation of behavior ... | cytosol [GO:0005829]; GABA-ergic synapse [GO:0098982]; late endosome membrane [GO:0031902]; plasma membrane [GO:0005886]; presynapse [GO:0098793]; recycling endosome membrane [GO:0055038]; secretory vesicle [GO:0099503]; trans-Golgi network membrane [GO:0032588] | calcium ion binding [GO:0005509]; phospholipid binding [GO:0005543]; SNARE binding [GO:0000149]; syntaxin binding [GO:0019905] | PF00168;PF06292; | 1.10.357.50;2.60.40.150; | Unc-13 family | null | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:28626000}. Recycling endosome membrane {ECO:0000269|PubMed:28626000}; Peripheral membrane protein {ECO:0000305|PubMed:28626000}. Late endosome membrane {ECO:0000269|PubMed:28626000}; Peripheral membrane protein {ECO:0000305|PubMed:28626000}. Golgi apparatus, ... | null | null | null | null | null | FUNCTION: Functions in endosome to Golgi retrograde transport. In response to calcium influx, may interact with SNARE fusion receptors and membrane phospholipids to mediate endosome fusion with the trans-Golgi network. By promoting the recycling of secretory vesicle transmembrane proteins, it indirectly controls dense-... | Homo sapiens (Human) |
O94813 | SLIT2_HUMAN | MRGVGWQMLSLSLGLVLAILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAF... | null | null | aortic valve morphogenesis [GO:0003180]; apoptotic process involved in luteolysis [GO:0061364]; axon extension involved in axon guidance [GO:0048846]; axon guidance [GO:0007411]; branching morphogenesis of an epithelial tube [GO:0048754]; cell migration involved in sprouting angiogenesis [GO:0002042]; cellular response... | cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; membrane [GO:0016020] | calcium ion binding [GO:0005509]; GTPase inhibitor activity [GO:0005095]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; laminin-1 binding [GO:0043237]; protein homodimerization activity [GO:0042803]; proteoglycan binding [GO:0043394]; Roundabout binding [GO:0048495] | PF00008;PF12661;PF00054;PF00560;PF13855;PF01463;PF01462; | 2.60.120.200;2.10.25.10;3.80.10.10; | null | null | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:10102268}. Note=The C-terminal cleavage protein is more diffusible than the larger N-terminal protein that is more tightly cell associated. | null | null | null | null | null | FUNCTION: Thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tube and projection of axons to different regions. SLIT1 and SLIT2 ... | Homo sapiens (Human) |
O94817 | ATG12_HUMAN | MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG | null | null | autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; glycophagy [GO:0061723]; macroautophagy [GO:0016236]; negative regulation of defense response to virus [GO:0050687]; negative regulation of innate immune response [GO:0045824]; negative regulation of type I interferon production [GO:0032480]; p... | Atg12-Atg5-Atg16 complex [GO:0034274]; autophagosome [GO:0005776]; autophagosome membrane [GO:0000421]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; phagocytic vesicle membrane [GO:0030670]; phagophore assembly site membrane [GO:0034045]; protein-containing comp... | null | PF04110; | null | ATG12 family | PTM: Acetylated by EP300. {ECO:0000269|PubMed:19124466}. | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Preautophagosomal structure membrane {ECO:0000269|PubMed:22342342}; Peripheral membrane protein {ECO:0000269|PubMed:22342342}. Note=TECPR1 recruits the ATG12-ATG5 conjugate to the autolysosomal membrane. | null | null | null | null | null | FUNCTION: Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme w... | Homo sapiens (Human) |
O94818 | NOL4_HUMAN | MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEVRGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSAVNSDLSSNLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGGTHSREMGDSNSDGKTGLEQDEQPLNLSDSPLSAQLTSEYR... | null | null | null | nucleolus [GO:0005730] | RNA binding [GO:0003723] | null | null | null | null | SUBCELLULAR LOCATION: Nucleus, nucleolus {ECO:0000269|PubMed:9813152, ECO:0000269|PubMed:9853615}. | null | null | null | null | null | null | Homo sapiens (Human) |
O94822 | LTN1_HUMAN | MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPAIQGAEEIDSLVDSDFRMVLRKLSKKDVTTKLKAMQEFGTMCTERDTETVKGVLPYWPRIFCKISLDHDRRVREATQQAFEKLILKVKKQLAPYLKSLMGYWLMAQCDTYTPAAFAAKDAFEAAFPPSKQPEAIAFCKDEITSVLQDHLIKETPDTLSDPQTVPEEEREAKFYRVVTCSLLALKRLLCLLPDNELDSLEEKFKSLLSQNKFWKYGKHSVPQIRSAYFELVSALCQRIPQLMKEEASKVSPSVLLSIDDSDPIVCPALWEAV... | 2.3.2.27 | null | protein autoubiquitination [GO:0051865]; rescue of stalled ribosome [GO:0072344]; ribosome-associated ubiquitin-dependent protein catabolic process [GO:1990116] | cytosol [GO:0005829]; cytosolic ribosome [GO:0022626]; RQC complex [GO:1990112] | ribosomal large subunit binding [GO:0043023]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270] | null | 1.25.10.10;3.30.40.10; | LTN1 family | PTM: Autoubiquitinated. {ECO:0000250|UniProtKB:Q6A009}. | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:28757607}. | CATALYTIC ACTIVITY: Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27; Evidence={ECO:0000305|PubMed:25578875}; | null | PATHWAY: Protein modification; protein ubiquitination. {ECO:0000269|PubMed:25578875}. | null | null | FUNCTION: E3 ubiquitin-protein ligase component of the ribosome quality control complex (RQC), a ribosome-associated complex that mediates ubiquitination and extraction of incompletely synthesized nascent chains for proteasomal degradation (PubMed:23685075, PubMed:25132172, PubMed:25578875, PubMed:28757607). Within the... | Homo sapiens (Human) |
O94823 | AT10B_HUMAN | MALSVDSSWHRWQWRVRDGFPHCPSETTPLLSPEKGRQSYNLTQQRVVFPNNSIFHQDWEEVSRRYPGNRTCTTKYTLFTFLPRNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITMLPLAIVLFVIMIKDGMEDFKRHRFDKAINCSNIRIYERKEQTYVQKCWKDVRVGDFIQMKCNEIVPADILLLFSSDPNGICHLETASLDGETNLKQRCVVKGFSQQEVQFEPELFHNTIVCEKPNNHLNKFKGYMEHPDQTRTGFGCESLLLRGCTIRNTEMAVGIVIYAGHETKAMLNNSGPRYKRSKIERRMNIDIFFC... | 7.6.2.1 | COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250|UniProtKB:Q9Y2Q0}; | lysosomal membrane organization [GO:0097212]; phospholipid translocation [GO:0045332] | endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; phospholipid-translocating ATPase complex [GO:1990531]; plasma membrane [GO:0005886] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; glycosylceramide flippase activity [GO:0140351]; magnesium ion binding [GO:0000287]; phosphatidylcholine flippase activity [GO:0140345] | PF13246;PF16212;PF16209; | 3.40.1110.10;2.70.150.10;1.20.1110.10;3.40.50.1000; | Cation transport ATPase (P-type) (TC 3.A.3) family, Type IV subfamily | PTM: Autophosphorylated at the conserved aspartate of the P-type ATPase signature sequence. {ECO:0000269|PubMed:32172343}. | SUBCELLULAR LOCATION: Late endosome membrane {ECO:0000269|PubMed:25947375, ECO:0000269|PubMed:32172343}; Multi-pass membrane protein {ECO:0000255}. Lysosome membrane {ECO:0000269|PubMed:25947375, ECO:0000269|PubMed:32172343}; Multi-pass membrane protein {ECO:0000255}. Endoplasmic reticulum membrane {ECO:0000269|PubMed:... | CATALYTIC ACTIVITY: Reaction=ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.; EC=7.6.2.1; Evidence={ECO:0000269|PubMed:32172343}; CATALYTIC ACTIVITY: Reaction=a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine(out) + ATP + H2O = a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine(in) + ADP + H(+) + phos... | null | null | null | null | FUNCTION: Catalytic component of a P4-ATPase flippase complex, which catalyzes the hydrolysis of ATP coupled to the transport of glucosylceramide (GlcCer) from the outer to the inner leaflet of lysosome membranes. Plays an important role in the maintenance of lysosome membrane integrity and function in cortical neurons... | Homo sapiens (Human) |
O94826 | TOM70_HUMAN | MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLKAKQYMEEENYDKIISECSKE... | null | null | activation of innate immune response [GO:0002218]; cellular response to virus [GO:0098586]; negative regulation of cell growth involved in cardiac muscle cell development [GO:0061052]; positive regulation of defense response to virus by host [GO:0002230]; positive regulation of interferon-beta production [GO:0032728]; ... | extracellular exosome [GO:0070062]; membrane [GO:0016020]; mitochondrial membrane [GO:0031966]; mitochondrial outer membrane [GO:0005741]; mitochondrial outer membrane translocase complex [GO:0005742]; mitochondrion [GO:0005739]; TOM complex [GO:0140596] | mitochondrion targeting sequence binding [GO:0030943]; molecular adaptor activity [GO:0060090]; protein transmembrane transporter activity [GO:0008320] | PF00515;PF13181; | 1.25.40.10; | Tom70 family | null | SUBCELLULAR LOCATION: Mitochondrion outer membrane {ECO:0000269|PubMed:20628368, ECO:0000269|PubMed:25609812, ECO:0000269|PubMed:33723040}; Single-pass membrane protein {ECO:0000255}.; SUBCELLULAR LOCATION: Note=(Microbial infection) During parasite T.gondii-mediated infection, enriched at the interface between the hos... | null | null | null | null | null | FUNCTION: Acts as a receptor of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) (PubMed:12526792). Recognizes and mediates the translocation of mitochondrial preproteins from the cytosol into the mitochondria in a chaperone dependent manner (PubMed:12526792, PubMed:35025629). Mediat... | Homo sapiens (Human) |
O94827 | PKHG5_HUMAN | MHYDGHVRFDLPPQGSVLARNVSTRSCPPRTSPAVDLEEEEEESSVDGKGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRVKAPAKPGDEGKVEQGMKDSKSLSLPILRPAGTGPPALERVDAQSRRESLDILAPGRRRKNMSEFLGEASIPGQEPPTPSSCSLPSGSSGSTNTGDSWKNRAASRFSGFFSSGPSTSAFGREVDKMEQLEGKLHTYSLFGLPRLPRGLRFDHDSWEEEYDEDEDEDNACLRLEDSW... | null | null | endothelial cell chemotaxis [GO:0035767]; endothelial cell migration [GO:0043542]; positive regulation of canonical NF-kappaB signal transduction [GO:0043123]; regulation of small GTPase mediated signal transduction [GO:0051056]; Rho protein signal transduction [GO:0007266] | axon [GO:0030424]; cell-cell junction [GO:0005911]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endocytic vesicle [GO:0030139]; lamellipodium [GO:0030027]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886] | guanyl-nucleotide exchange factor activity [GO:0005085] | PF00621; | 1.20.900.10;2.30.29.30; | null | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q66T02}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q66T02}. Cell membrane {ECO:0000250|UniProtKB:Q66T02}. Cell junction {ECO:0000250|UniProtKB:Q66T02}. Cell projection, lamellipodium {ECO:0000250|UniProtKB:Q66T02}. Note=Predominantly cytoplasmic, however... | null | null | null | null | null | FUNCTION: Functions as a guanine exchange factor (GEF) for RAB26 and thus regulates autophagy of synaptic vesicles in axon terminal of motoneurons (By similarity). Involved in the control of neuronal cell differentiation (PubMed:11704860). Plays a role in angiogenesis through regulation of endothelial cells chemotaxis.... | Homo sapiens (Human) |
O94829 | IPO13_HUMAN | MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWHFSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVLTRLCVALASLALSMMPDAWPCAVADMVRLFQAEDSPVDGQGRCLALLELLTVLPEEFQTSRLPQYRKGLVRTSLAVECGAVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCEALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNGDMETSHGICRIAVALGENHS... | null | null | protein import into nucleus [GO:0006606] | cytoplasm [GO:0005737]; nucleus [GO:0005634] | small GTPase binding [GO:0031267] | PF03810;PF18773;PF18786;PF18806;PF08389; | 1.25.10.10; | Importin beta family | null | SUBCELLULAR LOCATION: Cytoplasm. Nucleus. | null | null | null | null | null | FUNCTION: Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently tra... | Homo sapiens (Human) |
O94830 | DDHD2_HUMAN | MSSVQSQQEQLSQSDPSPSPNSCSSFELIDMDAGSLYEPVSPHWFYCKIIDSKETWIPFNSEDSQQLEEAYSSGKGCNGRVVPTDGGRYDVHLGERMRYAVYWDELASEVRRCTWFYKGDKDNKYVPYSESFSQVLEETYMLAVTLDEWKKKLESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACDLRFRSIVQCVNDFRSVSLNLLQTHFKKAQENQQIGRVEFLPVNWHSPLHSTGVDVDLQRITLPSINRLRHFTNDTILDVFFYNSPTYCQTIV... | 3.1.1.- | null | lipid droplet organization [GO:0034389]; locomotory behavior [GO:0007626]; mitochondrial fission [GO:0000266]; positive regulation of mitochondrial fission [GO:0090141]; triglyceride catabolic process [GO:0019433]; visual learning [GO:0008542] | centriolar satellite [GO:0034451]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; cytosol [GO:0005829]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; Golgi apparatus [GO:0005794]; membrane [GO:0016020] | metal ion binding [GO:0046872]; phospholipase activity [GO:0004620]; triglyceride lipase activity [GO:0004806] | PF02862;PF00536;PF02825; | 1.10.150.50; | PA-PLA1 family | null | SUBCELLULAR LOCATION: Cytoplasm, cytosol. Endoplasmic reticulum-Golgi intermediate compartment. Golgi apparatus, cis-Golgi network. Note=Cycles between the Golgi apparatus and the cytosol. DDHD2 recruitment to the Golgi/endoplasmic reticulum-Golgi intermediate compartment (ERGIC) is regulated by the levels of phosphoin... | CATALYTIC ACTIVITY: Reaction=1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphate + H2O = (9Z)-octadecenoate + 2-(9Z-octadecenoyl)-sn-glycero-3-phosphate + H(+); Xref=Rhea:RHEA:45128, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30823, ChEBI:CHEBI:74546, ChEBI:CHEBI:77593; Evidence={ECO:0000269|PubMed:22922100}; Physio... | null | null | null | null | FUNCTION: Phospholipase that hydrolyzes preferentially phosphatidic acid, including 1,2-dioleoyl-sn-phosphatidic acid, and phosphatidylethanolamine. Specifically binds to phosphatidylinositol 3-phosphate (PI(3)P), phosphatidylinositol 4-phosphate (PI(4)P), phosphatidylinositol 5-phosphate (PI(5)P) and possibly phosphat... | Homo sapiens (Human) |
O94832 | MYO1D_HUMAN | MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTV... | null | null | actin filament organization [GO:0007015]; actin filament-based movement [GO:0030048]; cellular localization [GO:0051641]; early endosome to recycling endosome transport [GO:0061502]; endocytosis [GO:0006897]; protein transport [GO:0015031]; vesicle transport along actin filament [GO:0030050] | actin cytoskeleton [GO:0015629]; apical dendrite [GO:0097440]; axolemma [GO:0030673]; axon [GO:0030424]; basolateral plasma membrane [GO:0016323]; brush border [GO:0005903]; cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; early endosome [GO:0005769]; endosome [GO:0005768]; extracellu... | actin filament binding [GO:0051015]; ATP binding [GO:0005524]; calcium-dependent protein binding [GO:0048306]; calmodulin binding [GO:0005516]; microfilament motor activity [GO:0000146]; protein domain specific binding [GO:0019904] | PF00612;PF00063;PF06017; | 1.10.10.820;1.20.5.4820;1.20.58.530;3.40.850.10;1.20.120.720; | TRAFAC class myosin-kinesin ATPase superfamily, Myosin family | null | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q63357}. Perikaryon {ECO:0000250|UniProtKB:Q63357}. Cell projection, dendrite {ECO:0000250|UniProtKB:Q63357}. Early endosome {ECO:0000250|UniProtKB:F1PRN2}. Cytoplasm, cell cortex {ECO:0000250|UniProtKB:Q63357}. Note=Colocalizes with the actin cytoskeleton in the c... | null | null | null | null | null | FUNCTION: Unconventional myosin that functions as actin-based motor protein with ATPase activity (By similarity). Plays a role in endosomal protein trafficking, and especially in the transfer of cargo proteins from early to recycling endosomes (By similarity). Required for normal planar cell polarity in ciliated trache... | Homo sapiens (Human) |
O94842 | TOX4_HUMAN | MEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQECQATVETVELDPAPPSQTPSPPPMA... | null | null | regulation of transcription by RNA polymerase II [GO:0006357] | chromatin [GO:0000785]; nucleus [GO:0005634]; PTW/PP1 phosphatase complex [GO:0072357] | chromatin DNA binding [GO:0031490] | PF00505; | 1.10.30.10; | null | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000305|PubMed:20516061}. Note=Associated with chromatin. | null | null | null | null | null | FUNCTION: Transcription factor that modulates cell fate reprogramming from the somatic state to the pluripotent and neuronal fate (By similarity). Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into int... | Homo sapiens (Human) |
O94844 | RHBT1_HUMAN | MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGCQLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFAHRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDF... | null | null | actin filament organization [GO:0007015]; Cdc42 protein signal transduction [GO:0032488]; cortical cytoskeleton organization [GO:0030865]; endocytosis [GO:0006897]; engulfment of apoptotic cell [GO:0043652]; establishment or maintenance of cell polarity [GO:0007163]; regulation of actin cytoskeleton organization [GO:00... | cell projection [GO:0042995]; cytoskeleton [GO:0005856]; endosome membrane [GO:0010008]; plasma membrane [GO:0005886] | GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein kinase binding [GO:0019901] | PF00651;PF00071; | 3.40.50.300; | Small GTPase superfamily, Rho family | null | null | null | null | null | null | null | null | Homo sapiens (Human) |
O94850 | DEND_HUMAN | MLDGPLFSEGPDSPRELQDEESGSCLWVQKSKLLVIEVKTISCHYSRRAPSRQPMDFQASHWARGFQNRTCGPRPGSPQPPPRRPWASRVLQEATNWRAGPLAEVRAREQEKRKAASQEREAKETERKRRKAGGARRSPPGRPRPEPRNAPRVAQLAGLPAPLRPERLAPVGRAPRPSAQPQSDPGSAWAGPWGGRRPGPPSYEAHLLLRGSAGTAPRRRWDRPPPYVAPPSYEGPHRTLGTKRGPGNSQVPTSSAPAATPARTDGGRTKKRLDPRIYRDVLGAWGLRQGQGLLGGSPGCGAARARPEPGKGVVEKSLGL... | null | null | positive regulation of transcription by RNA polymerase II [GO:0045944] | cell projection [GO:0042995]; cytoplasm [GO:0005737]; dendritic spine membrane [GO:0032591]; endoplasmic reticulum membrane [GO:0005789]; nucleus [GO:0005634]; perikaryon [GO:0043204]; postsynaptic membrane [GO:0045211] | DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] | PF15498; | null | null | null | SUBCELLULAR LOCATION: Cell projection, dendritic spine membrane; Peripheral membrane protein. Cytoplasm. Endoplasmic reticulum membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}. Perikaryon {ECO:0000250}. Nucleus {ECO:0000250}. Note=Enriched at the cytoplasmic insertion of... | null | null | null | null | null | FUNCTION: Promotes apoptosis of kidney glomerular podocytes. Podocytes are highly specialized cells essential to the ultrafiltration of blood, resulting in the extraction of urine and the retention of protein (By similarity). {ECO:0000250}. | Homo sapiens (Human) |
O94851 | MICA2_HUMAN | MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTWKAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGWRAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFVMTAKKQSLLDKGVIINDYID... | 1.14.13.225 | COFACTOR: Name=FAD; Xref=ChEBI:CHEBI:57692; Evidence={ECO:0000250|UniProtKB:Q8TDZ2}; | actin filament depolymerization [GO:0030042]; cytoskeleton organization [GO:0007010]; heart development [GO:0007507]; heart looping [GO:0001947]; positive regulation of transcription by RNA polymerase II [GO:0045944]; sulfur oxidation [GO:0019417] | actin filament [GO:0005884]; cytoplasm [GO:0005737]; nucleus [GO:0005634] | actin binding [GO:0003779]; FAD binding [GO:0071949]; metal ion binding [GO:0046872]; mitogen-activated protein kinase binding [GO:0051019]; monooxygenase activity [GO:0004497]; NAD(P)H oxidase H2O2-forming activity [GO:0016174]; oxidoreductase activity [GO:0016491]; oxidoreductase activity, acting on paired donors, wi... | PF12130;PF00307;PF01494;PF00412; | 1.10.418.10;2.10.110.10;3.50.50.60; | Mical family | null | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:24440334}. Cytoplasm {ECO:0000250|UniProtKB:Q8BML1}. | CATALYTIC ACTIVITY: Reaction=H(+) + L-methionyl-[F-actin] + NADPH + O2 = H2O + L-methionyl-(R)-S-oxide-[F-actin] + NADP(+); Xref=Rhea:RHEA:51308, Rhea:RHEA-COMP:12953, Rhea:RHEA-COMP:12956, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:16044, ChEBI:CHEBI:45764, ChEBI:CHEBI:57783, ChEBI:CHEBI:5834... | null | null | null | null | FUNCTION: Methionine monooxygenase that promotes depolymerization of F-actin by mediating oxidation of residues 'Met-44' and 'Met-47' on actin to form methionine-sulfoxide, resulting in actin filament disassembly and preventing repolymerization (PubMed:24440334, PubMed:29343822). Regulates the disassembly of branched a... | Homo sapiens (Human) |
O94854 | K0754_HUMAN | MGKPLSRPDCLRRNPSCLGKGEEEDGYIEDCYVPQRSIYDTMRINEQIDQGSKLNQTSKSTMEKMEGSTISSNGTLGAASNVFESRAPEGKKLDERIIFDALKLSSDVQKSAPVPPRRRPNAERKDNVNRRSWKSFMPPNFPEFAERIEASLSEVSEAGASNPSLQEKKESSSALTESSGHLDHREPQSESVTLEHVSKSIGIPEVQDFKNLSGDCQDFRFQQHSANPPHEFQPVESEAVATSGNTDVMQESRFSSATWPRATKSLAKGGFSEKQHPLGDTACTVEMPPLSPCLSEELLDPELHVLITPSLREKTESELK... | null | null | intermediate filament cytoskeleton organization [GO:0045104]; regulation of focal adhesion assembly [GO:0051893]; regulation of microtubule-based process [GO:0032886]; wound healing [GO:0042060] | actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; intermediate filament [GO:0005882]; membrane [GO:0016020]; microtubule [GO:0005874] | cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; microtubule binding [GO:0008017]; structural molecule activity [GO:0005198] | PF13499;PF02187;PF00435; | 1.20.58.60;1.10.238.10;3.30.920.20; | null | null | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000255|PROSITE-ProRule:PRU00792}. | null | null | null | null | null | null | Homo sapiens (Human) |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.