ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
Q37704
MIKWLCLFFSYILMVSSHSWLGLWLSMEMNSLSFIPIMIEESKENSLKYFLIQSVASVIFLASILNQSFSFLIPFALLIKIGAAPFHMWLVSISKSMSWKVLSLLMTFQKIGPLLGLAMLQFTNSFFIFISAFIGGLGGINQSNLRLIMAFSSVSHLSWLMVNMSSFFLMLVYYVTYLAILYFAVILLQQSGMYSLAQMNSNASLIYKASISFNLLSLAGLPPFLGFFIKWMSLEMNILSPLLVLALVVSSCFSVYFYFSIAMSSLLFPSEVKSKKMEIPGILSMGFNIFLPLFFL
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 33448 Sequence Length: 296 Subcellular Location: Mitochondrion inner membrane EC: 7.1.1.2
P15688
MLSLTIKGKARRRKERAFGDRDFLTFSSKTKKTENVNLSFEKGTRFFDRGGMIFGPSPRSARWPIGIAAFGLCLLFLIKNSGSARESAGNNRKEGVHVAAASAPFLVNRAAGSATTTKERIHFKITNASAMAACGMAGSDLFGYIIQVESGVTGTAGLMENNFHGSVQRALFSLRILRSLRVNSLARIQNFWGPSIPSSSPAKTPLPFGLNIFFDSYMWAPDIYEGSPTPVTAFFSIAPERSISANILRVFIYGSYGATLQQIFFFCSIALRLRSTGAMANEGKASSSIGQLDYGGLYFVLVLMWNREGIQSLLIGLFIYASMDDRCFAIVSALRQTRVKYIADLGALAKTNPISAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCWAAGRLPRVSQFGDRRQFSVHRTRSLPNQLRHGWECMLRKIGSSLIHQPSVYSISLYESTITTRDEPWFGEFELALGVIGLPVTAHDRILRCSPPVVGTTRAGPGLNSER
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 56275 Sequence Length: 515 Subcellular Location: Mitochondrion inner membrane EC: 7.1.1.2
P19044
MFLLHEYDIFWTFLIIASLIPILVFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS
Function: NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Catalytic Activity: a plastoquinone + (n+1) H(+)(in) + NADH = a plastoquinol + n H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 13860 Sequence Length: 120 Subcellular Location: Plastid EC: 7.1.1.-
B2J6S7
MFVLSGYEYLLGFFIICSLVPALALSASKLLRPSGYAPERRTTYESGMEPIGGAWIQFNIRYYMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALVYAWRKGALEWS
Function: NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. Catalytic Activity: a plastoquinone + (n+1) H(+)(in) + NADH = a plastoquinol + n H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 13644 Sequence Length: 120 Subcellular Location: Cellular thylakoid membrane EC: 7.1.1.-
P48913
MLNYFVYPYGIENDIGIKFYMILVPIISIVLIIINYIITNKSDNNINKTGPYECGFDSFRQSRTTYSIKFILIAILFLPFDLELTSILPYTLSIYNLNIYGLFILLYFLLPLIIGFIIEINLKAIYITKIFNRNVKSITSYVKYNNKI
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 17312 Sequence Length: 148 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q9B6C7
MNTFIIFIILIPIVGFALLAVNILLAVYKPYNEKLGAFECGLTSFNQTRLAFNAAFILVAILFLPFDLEISTLLPYVMSIYLVSNYGFTIVLLFLLILIIGFVYEINTNALKINKHNKPNTDSLIYKL
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 14470 Sequence Length: 128 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q00244
MQLQYFLLIAAALFCIGVYGLVTSRNAVRVLMSIELMLNAVNLNLMAFSNYLDPQEIKGQMFTIFVITIAAAEAAVGLAIVLAIYRNRDTVDMEQFNLLKW
Function: NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. Catalytic Activity: a plastoquinone + (n+1) H(+)(in) + NADH = a plastoquinol + n H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 11336 Sequence Length: 101 Subcellular Location: Cellular thylakoid membrane EC: 7.1.1.-
P48914
MTYLILLGASICLFPFWEVTMLTLAFIIPMSLTYLNINFTFSFSSELIWLTPIGTALIFLTLMVTLLVLIGTYNIKNYKYIGCLSSLNLVLMMAFCVCDFLTFYVMFEVSLIPTLLLILLWGYQPERMQAGFYLMLYTVTASLPLLLLLLYLYYTVGSLNFYIIMVYYSFNNNPLMLVGLMMAFLVKLPIYTCHLWLPKAHVEAPLGGSMVLAGVLLKLGGYGLYMLINFIISKSSSLVISVIITLSLWGAVIASIICIQQVDIKALVAYSSVAHMSLVSAGILMMSNWSYTCAKMTMIAHGYTSSALFVLANLSYLKIKSRSLMFMKGLLAIFPAMAFYWFLFSCMNMAAPPTLNFIGELLIIPSMYIASYMLLILMCIIMFISAGYSLYMYMTVNHGELGLYITPSIQLKNVDYHVLTAHLLPTFILLIPQLFSV
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 49160 Sequence Length: 437 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
P51898
SLVGGVLISLVCLRQTDLKALIAYSSVAHMGIVLSGLLTMTYWGLTGSYALMIAHGLCSSGLFCLANISYERMGSRSLLINKGLLNFMPTLSLWWFLLCSGNMAAPPTLNLLGEISLLNSIVSWSWITMIMLSFLSFFSAAYSLYLFAYSQHGKIYSGVYFFSVGTTREFLLLMLHWLPLNLLILKSNFCMLWIYLNSLKKMLICGVNDMKLFILDRELFS
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 24798 Sequence Length: 221 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
P34852
MLKFIFMLMFMFPLSFLKNFYWTVQNLIFLLTFMFMINLSSLNYFNYISYYFGLDMVSYGLILLSFWICGLMLMASEKVFSTNNYEKLFVFMILFLLFMLVLTFSSMSVFMFYLFFEASLIPTLFLILGWGYQPERLQAGVYLLFYTLLASLPLLIGIFYILNSKNTLSFTLLLNYSFSNFNLLYLSLVFAFLVKMPMFLVHLWLPKAHVEAPVSGSMILAGILLKLGGYGLLRMFSLLQISGVKYNYWWISISLVGGVLISLVCLRQTDLKALIAYSSVAHMGIVLSGLLTMTYWGLTGSYALMIAHGLCSSGLFCLANISYERMGSRSLLINKGLLNFMPTLSLWWFLLCSGNMAAPPTLNLLGEISLLNSIVSWSWITMIMLSFLSFFSAAYSLYLFAYSQHGKIYSGVYFFSVGTTREFLLLMLHWLPLNLLILKSNFCMLWI
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51280 Sequence Length: 447 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
P34853
MYLLLLLIMLNMLMMSMIYLFMLFMNKMKNNLNLIIGNLIIINLLLNLFNLNWIDWIYIFCNLSFNMYSYGLIMLTLWIFGLIFISLNNNSLNCLFMNLLLMISLLLVFLSMNLLLFYLFYEFGLLLIFYLVVKWGYSENRWLSGFYLMFYTMIFSLPMLYIIYYIYLIDYSLNFMLMEMLNLNLNMMLFIYLLMSFLVKIPIYLFHGWLLKAHVEAPYYGSMILASIMLKLGGYGMLRLMIIYKNEFILIQKILVMINSFGVLILSLMCLSQFDMKSIIAISSIVHMGLMIMSMMTFLKISLIGGYLMMISHGLSSSGLFFLVNVIYSQTNSRLMFINKGMINFMPSMSLLWFMLCSSNMGSPVSLNLISEVMLLIGMISWLKFMMLILMMYCLFSFIYSIYLFMFINHGKIFIMFKIKNGILVEYFVLLLHWIPLNLMFLKLYFI
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 52896 Sequence Length: 447 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
P93313
MLEHFCECYFNLSGLILCPVLGSIILLFIPNSRIRLIRLIGLCASLITFLYSLVLWIQFDSSTAKFQFVESLRWLPYENINFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFLMIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSLFMLLAILLILFQTGTTDLQILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKFGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGVVWMGVYPKVFLDCMHTSVSNLVQHGKFH
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 55942 Sequence Length: 495 Subcellular Location: Mitochondrion inner membrane EC: 7.1.1.2
P19046
LFVLLWLTFTTQSFILFYVFFECSLIPTIILILGWGYQPERLPASYYFLFYTLLSSLPLLFIIMLTRVFIR
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 8524 Sequence Length: 71 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q37711
MLMYKLMSEFHLEWGITLLTLNFSYFLFNSYQIKANWPLSYSTILVSLFVLLWLTFTTQSFILFYVFFECSLIPTIILILGWGYQPERLPASYYFLFYTLLSSLPLLFIIIAHTSIYSSSFLQFWGNFMDKMIFLLAILSFLVKLPVYFAHIWLPKAHVEAPVTGSMVLAAILLKLGGYGLYLVQVLNIYSETTLMGVCLMGGIFSCLICLRQSDVKSLIAYSSVAHMSFVILGMLMSCTYTNMSSILMMVSHGICSSGLFYLSYLFYARIWSRSFLLTRSMISLFPYLCFWWLSLSFLNMGLPPSLNFFSEMYFFIGAFSLDWMVVGLSGILCFLSSCYCIYLYSSTSHGESLYIFKLISMQLKGMYNRKSSSDSVTDFNFRLLL
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 44425 Sequence Length: 386 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
P85928
SGSIIHSMEANVGYSPDKSQNMVLMGGLK
Function: NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a plastoquinone + (n+1) H(+)(in) + NADH = a plastoquinol + n H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 3051 Sequence Length: 29 Subcellular Location: Plastid EC: 7.1.1.-
Q6L3E3
MEHTYQYAWVIPLLPLPVIMLMGFGLFLIPTATKNLRRIWAFPSILLLSIAMVFSLHLSIQQINGSSIYQYLWSWTINNDFSLEFGYLVDPLTSIMLILITTVGILVLIYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVTNRVGDFGLLLGILGFFWITGSLEFRDLFKIANNWIPNNGINSLLTTLCAFLLFLGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLLPLFISLPLLMSFISLVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLITHAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYVPITRTTFLCGTLSLCGIPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTFDGYLRVHFQNYSSTKEGSLYSISLWGKSISKGVNRDFVLSTMKSGVSFFSQNIPKIPANTRNKIGSFSTPFGAKKTFVYPHETGNTMLFPLLILLLFTLFIGSIGIPFDNGVKDNRILELTILSKWLTPSINLFQENSNSSINSYEFLTNAISSVSLAIFGLFIAYIFYGSAYSFFQNLNFQNSLVKKNPKKSFLDEVKKKIYSWSYNRGYIDFFYTRVFILGIRRLAELTHFFDKGVIDGIINGVGLAGFCIGEEIKYVGGGRISSYLFFFLCYVSLFLFFIP
Function: NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a plastoquinone + (n+1) H(+)(in) + NADH = a plastoquinol + n H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 82930 Sequence Length: 738 Subcellular Location: Plastid EC: 7.1.1.-
Q32516
MEQTYEYAWIIPFIPLPVPMLIGAGLILFPTATKRFRRMWAFQSVLLLSIVMIFSIYLSIQQINSSSVYQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVTNRVGDFGLLLGILGFYWITGSFEFRDLFEIFNNLIYNNELNFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFRVIPYIMYLISVIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETIVGYSPAKSQNMGLMGGLRKHVPITKITFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAIIAWATAGLTAFYMFRIYLLTFEGHLNAHFQNYGGKQKIPFYSISLWGKNGVKKNSCLLTMNNNESTYFLSKTKYPIAKNGRKMTRPFMTIAHFKHKAVSSYPYESDNTMLFPIFVLGLFTLFVGAIGIPFNQEGVNLDILSKWLAPSINLLHPKSNNSLDWNEFLKDAVVSVSIAYFGIFIASFLYKPIYSSLKNLEFINSFVKKGPKRILWDKILNGIYDWSYNRAYIDAFYTRFFVGGIRGLAEFTHFVDRRVIDGMTNGVGVISFIVGEGIKYIGGGRISSYLFLYLAYVSVFLLVYYLLF
Function: NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a plastoquinone + (n+1) H(+)(in) + NADH = a plastoquinol + n H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 83283 Sequence Length: 737 Subcellular Location: Plastid EC: 7.1.1.-
P48922
MMSLTFMAGLIFPVFMMLKGINPMSLLLALLTLSLCAVLWLGSFMSSWYAYILFIVYIGGILVLFIYVCMISSNYIASQHMYKSLLYAWGAVMLMSLTMETDTFIILGSNMMYTSVNIPMTILIFLSIYLLIVFFAVVNLMVNMTSILMVESSQV
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 17496 Sequence Length: 155 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q08084
MMSLSFMLGLIFPVFFMFTLANPMSLLLLLLIMSLCAVLWLGSIMSSWFAYILFIVYIGGILVLFIYVCMISSNYITGLYKYKTLLYVGMVVALMS
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 10896 Sequence Length: 96 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q06059
MTYFVFFLGICFVVGVLGVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVALVLFMVYFGGMLVVFVYSVALAAEPFPEA
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 8511 Sequence Length: 81 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q33635
MTKLIIMTLCLIMSFIFMQMKHPLSMGLMLLIQTFLTCLITSIYVKTFWFSYVLFLIFLGGMLILFIYVTSLSSNEMFSMSFSLTLISLIIFSIFTIVFFMIDKSLIEQFITNMEMEKLSNMNNLINENILSLNKMYNFPTNLITLLLINYLFLTLLVTVKITKKFYGPLRPMN
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 20357 Sequence Length: 174 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
P34857
MMLTIIMLSKIFMSSLISMILTIYLNNIFNSPSMLLIYLISYSIYMSLMMFTMCSMNSLLILMILIVFLSGMLIMFSYFISLINEPLKLKMKPFIQTLFLIIITMKIYNKLSQNEHYFNYFKNIDLMYLYMKMNSTLFFIMILMLIITLILMTKITYIEKKTLRKKK
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 19971 Sequence Length: 167 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
P60497
MILSVLSSLALVSGLMVVRAKNPVHSVLFFILVFCDTSGLLLLLGLDFFAMIFLVVYIGAIAVLFLFVVMMFHIQIAEIHEEVLRYLPVSGIIGLIFWWEMFFILDNESIPLLPTQRNTTSLRYTVYAGKVRSWTNLETLGNLLYTYYFVWFLVSSLILLVAMIGAIVLTMHRTTKVKRQDVFRRNAIDFRRTIMRRTTDPLTIY
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 23669 Sequence Length: 205 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q37712
MLGSIVVISMFMLLMNHPLAFTLSLFVQTLLICVMLKNVSLWISLILFLIFLGGILVMFIYVSSLSANEKFAVDLTSFMWVVPTIVLSFLVLNKNFMFMSPSSGYLYPTDFVIINFNVNSLTMLAYSFMVVYLFLALLLVIDFLNSNKKPLRSMI
Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). Catalytic Activity: a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 17624 Sequence Length: 155 Subcellular Location: Mitochondrion membrane EC: 7.1.1.2
Q7QGS3
MLDKVKHIILVLSGKGGVGKSTVSTQLALTLAEADHKVGLLDIDLCGPSVPYLLGLEDRDVHQCDEGWVPVYTSAEKRLAVMSIGFLLKNRSDAVIWRGPKKTAMIKQFLEDVNWDELDYLIIDTPPGTSDEHITVMECLKTVRTEGAIIVTTPQEMALEDVRKEVTFCKKTGIPILGIVENMSGFVCPNCSECTNIFSSGGGHSLAELAKVPHLGTLPIDPRVGELAGTGKACVKELPDCTTSEVLRELVRTLTTVGQ
Cofactor: Binds 4 [4Fe-4S] clusters per heterotetramer. Contains two stable clusters in the N-termini of Nubp1 and two labile, bridging clusters between subunits of the Nubp1-Nubp2 heterotetramer. Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The Nubp1-Nubp2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Sequence Mass (Da): 28057 Sequence Length: 259 Subcellular Location: Cytoplasm
Q5ZKV4
MEEVVAERSNLGGVRHILLVLSGKGGVGKSTISTELALSLRHSGKKVGILDVDLCGPSIPRMFKVQDNDVHQCDAGWVPVFVDQEKSISLMSIGFLLEKPDDAVVWRGPKKNALIKQFVADVAWGELDFLIVDTPPGTSDEHISTVEALRPYKPLGAILVTTPQAVSVGDVRRELTFCKKTGLRVLGIVENMSGFVCPHCSECTNIFSKGGGEELAKHAGVPFLGSVPLDPQLSQSLEEGRDFIQEFPKSSAFPALTRIAQQILDGALQRSS
Cofactor: Binds 4 [4Fe-4S] clusters per heterotetramer. Contains two stable clusters in the N-termini of NUBP1 and two labile, bridging clusters between subunits of the NUBP1-NUBP2 heterotetramer. Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Sequence Mass (Da): 29359 Sequence Length: 272 Subcellular Location: Cytoplasm
Q76NZ7
MDKIKHKILVLSGKGGVGKSTVSSQLALYLSHIGYKVGLLDVDLCGPSIPKMMGLESKDVHKSTKGWVPVYTDESQKLGVISIQFLLGDKDTPVIWRGPKKNSMIKQFIDDVNWGEIDFLIIDTPPGTSDEHISVTEELLKHNPDGAILVTTPQAVSISDVKKEISFCNAMKLPIIGIIENMSGYVCPHCSECTNIFSSEGGKLLAEQCNIKFLGKLPIDPNLSICSERGINYFTEYPNSSTLASLKSFVDNFNFKSSTTTTATN
Cofactor: Binds 4 [4Fe-4S] clusters per heterotetramer. Contains two stable clusters in the N-termini of nubp1 and two labile, bridging clusters between subunits of the nubp1-nubp2 heterotetramer. Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The nubp1-nubp2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Sequence Mass (Da): 28962 Sequence Length: 265 Subcellular Location: Cytoplasm
Q9VPD2
MLDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTMLVS
Cofactor: Binds 4 [4Fe-4S] clusters per heterotetramer. Contains two stable clusters in the N-termini of Nubp1 and two labile, bridging clusters between subunits of the Nubp1-Nubp2 heterotetramer. Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The Nubp1-Nubp2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Sequence Mass (Da): 28250 Sequence Length: 260 Subcellular Location: Cytoplasm
B4KY56
MLDKVKNVIVVLSGKGGVGKSTVSTQLALALRATGHKVGLLDIDLCGPSVPHLLGLEGRDIYQCDDGWVPIYTDESKTLAVMSIGFLLKNRNDPVIWRGPKKTMMIKQFLTDVKWEDLDYLIIDTPPGTSDEHITVMECMREVPCNGAIIVTTPQGVALDDVRKELTFCKKTGIKVLGIVENMSGFVCPHCSDCTNIFSSFGGAELAQLAQVPLLGTLPIDPRVGVLAGSTASVLNELADSSTAQVLRSIVQHLDGLTALPTSA
Cofactor: Binds 4 [4Fe-4S] clusters per heterotetramer. Contains two stable clusters in the N-termini of Nubp1 and two labile, bridging clusters between subunits of the Nubp1-Nubp2 heterotetramer. Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The Nubp1-Nubp2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Sequence Mass (Da): 28272 Sequence Length: 264 Subcellular Location: Cytoplasm
Q9Y5Y2
MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDEHMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKILDATPACLP
Cofactor: Binds 4 [4Fe-4S] clusters per heterotetramer. Contains two stable clusters in the N-termini of NUBP1 and two labile, bridging clusters between subunits of the NUBP1-NUBP2 heterotetramer. Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Negatively regulates cilium formation and structure. Sequence Mass (Da): 28825 Sequence Length: 271 Subcellular Location: Nucleus
Q9R061
MEAAAGERAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHMLRAQGKAVHQCDNGWVPVFVDQEQSISLMSVGFLLENPDEAVVWRGPKKHALIKQFVSDVAWGQLDYLVVDTPPGTSDEHMATMEALRPYRPLGALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENMSGFTCPHCAECTNVFSSGSGEELARLAGVPFLGSVPLDSQLTRSLEEGRDFIQEFPKSTAYSALTSIAQRVVHRMSALCS
Cofactor: Binds 4 [4Fe-4S] clusters per heterotetramer. Contains two stable clusters in the N-termini of NUBP1 and two labile, bridging clusters between subunits of the NUBP1-NUBP2 heterotetramer. Function: Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Negatively regulates cilium formation and structure . Sequence Mass (Da): 29518 Sequence Length: 275 Subcellular Location: Nucleus
A4WD46
MSLKIEIIKDKILSDNYFVLRNITYDLTRKNGEVIRHKREVYDRGNGATILLYNREKQSVVLIRQFRVATWVNGNPDGRLIETCAGLLDNDAPEVCIRKEAIEETGFAVGEVKKLFELYMSPGGVTELVYFFIAEYTDAQRANAGGGVEDEDIDVLEIPFEQALEMIKTGEIQDGKALILLQYLQISGLMA
Function: Nucleoside diphosphate sugar hydrolase that hydrolyzes GDP-mannose as its preferred substrate, yielding GMP and mannose-1-phosphate. Catalytic Activity: GDP-alpha-D-mannose + H2O = alpha-D-mannose 1-phosphate + GMP + 2 H(+) Sequence Mass (Da): 21553 Sequence Length: 191 Domain: In the dimer, the N-terminal domains are swapped between the two monomers, such that residues of both chains contribute to the active site. EC: 3.6.1.-
Q6D8X4
MSSPIDIVEKKLLSDHWFILHKYVFDLKRKNGGVVRQIREVYDRGDGATILLYNRAKGTVILTRQFRIPTYVNGNESGMLLEACAGLLDDYSPEECIRNEAIEETGYAVGNVEKLFDAYMSPGGVTERLHFFAAEYDESLRDNSGGGVEDEDIEVLELPFSEAIAMMNDGRIKDGKTIMLLQHAIIRGWFAKG
Function: Nucleoside diphosphate sugar hydrolase that hydrolyzes GDP-mannose as its preferred substrate, yielding GMP and mannose-1-phosphate. Catalytic Activity: GDP-alpha-D-mannose + H2O = alpha-D-mannose 1-phosphate + GMP + 2 H(+) Sequence Mass (Da): 21713 Sequence Length: 193 Domain: In the dimer, the N-terminal domains are swapped between the two monomers, such that residues of both chains contribute to the active site. EC: 3.6.1.-
A9MHR4
MSQNITLIKDKILSDNYFTLRNITYDLTRRNGKVIRHKREVYDRGNGATILLYNSTKKTVVLVRQFRVATWVNGNEDGMLIETCAGLLDNDEPEVCIRKEAIEETGYDVGEVRKIFELYMSPGGVTELIHFFIAEYRDSERASTGGGVEDEDIEVLELPFSRALEMARSGEIRDGKTVLLLNYLHMSHLMG
Function: Nucleoside diphosphate sugar hydrolase that hydrolyzes GDP-mannose as its preferred substrate, yielding GMP and mannose-1-phosphate. Catalytic Activity: GDP-alpha-D-mannose + H2O = alpha-D-mannose 1-phosphate + GMP + 2 H(+) Sequence Mass (Da): 21769 Sequence Length: 191 Domain: In the dimer, the N-terminal domains are swapped between the two monomers, such that residues of both chains contribute to the active site. EC: 3.6.1.-
A6H1R4
MQSNQLDYLPIFMQMGLAVGFVVLTIIGSSFLGPKRSSVNKDKNFESGIESIGNARVPFSVKYFLVAILFVLFDVEVIFLYPWAINFQELGMQGMIKMVIFMSLLLVGFFYIIKKKALEWD
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 13804 Sequence Length: 121 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A9HNA0
MLAMSDFCTQHPLFSYAVAIVVLLAAMLGLGAVSGTRRVGAARGRSMDLPFESGVLPVGSAHLRIPVQYYLVAMLFVIFDVESVFLFSWAPVAVGAGWRGYGAVVVFVASLAAALAYVWRWGALDWGPVPRRRIDYRRAGDASCAGR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 15854 Sequence Length: 147 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A9B477
MLTNYAFIGIFALAAITFPLLPLVLSAFLRPNRPTPVKLSTYECGLEAIGDIWVQFKVQYYLYALAFVIFDIETVFLYPWAVAYGQLGLFALFEMVVFLAILTIGLVYAWKKGALEWI
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 13397 Sequence Length: 118 Subcellular Location: Cell membrane EC: 7.1.1.-
Q67P21
MSADGVFRDQGGFVTTTVDSFLRWAQSNSIWPLTFGLACCAIEMMNLASGPRYDIARFGSEAFRASPRQADLIFISGRVSNKMAPVIKRVYSQMLEPKWVVAFGACASSGGIFDNYAIMQGVDNLLPVDIYVPGCPPTPEAVIYAVQKLRDRIRKEDPRGGIIVRG
Cofactor: Binds 1 [4Fe-4S] cluster. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 18213 Sequence Length: 166 Subcellular Location: Cell membrane EC: 7.1.1.-
B5YKI3
MIHVVDTVTEPVEIEQGIKIVPAANTIITTLDKIASWGRCSSLWPLTFGLACCAIEMMATAASHYDLDRFGIIMRATPRQADVMIIAGTVTKKMAPVIVNLYHQMPEPRYVIAMGSCACSGGIFNTYSTVQGVDEILPVDVYIPGCPPRPEALIEGLLKLQEKIKTEPHKKTGCLSGVCLIDKSQRRCSYESCRDNKKD
Cofactor: Binds 1 [4Fe-4S] cluster. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 21846 Sequence Length: 199 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q2IL09
MAARMDPGIGGEVTLLHTSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADLMRFGAIPRASPRQADFMIVAGTLTYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLLRLQEIVRSEPWSTKRRPAAQAEGA
Cofactor: Binds 1 [4Fe-4S] cluster. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 18786 Sequence Length: 173 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A1K3P1
MQTPTLHGDGFLLTRLDTLCDMVRSNSMWYLTFGLACCAVEMMQAAASRYDMDRFGMIPRASPRQADLIIVAGTLTNKMAPAIRKIYDQMAEPRYVISMGSCANGGGYYHYSYSVARGCDRILPVDIYIPGCPPTAEALLYGLIQLQNKLKRPPAVIAR
Cofactor: Binds 1 [4Fe-4S] cluster. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 17621 Sequence Length: 159 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A3MFR5
MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP
Cofactor: Binds 1 [4Fe-4S] cluster. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 18469 Sequence Length: 167 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q3JNA0
MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLARCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYGYSVVRGCDRIVPVDVYVPGCPPTAEALVYDLMQLQRKVAERSTHSRPKLFARP
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 18550 Sequence Length: 167 Subcellular Location: Cell inner membrane EC: 7.1.1.-
B9L170
MGMSAAQSHPNIITTTADWLFSWARRSSLWWLQFGLACCAIEMISSAMPRFDLAERFGMLYRASPRQADLMIVAGTVTKKMAPVVRQLYDQMADPKWVISMGSCANVGGPFDTYAVVQGVDQVIPVDIYVPGCPPVPEALYYGVLELQNRIIRYERLKERYGPEAAEAYREEERQAARSALGPRS
Cofactor: Binds 1 [4Fe-4S] cluster. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 20729 Sequence Length: 185 Subcellular Location: Cell membrane EC: 7.1.1.-
A9AFY9
MASKIETLKANLEAALGARVVSLTEAIGELTLVVKASDYLDVATTLRDDPKLRFEQLIDLCGVDYQTYGDGAYDGPRFAAVTHLLSVTNNWRLRLRVFAPDDDLPIVPSLVDIWNSANWYEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVEMRYDPEEKRVVYQPVTIEPREITPRVIREDRYGGLKH
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 22879 Sequence Length: 200 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q9A6X2
MSEALELLGQDIVARAPGVLGHSVAFGELTIVARAASVIDTLTFLRDDAACRFHQLIDLTGVDYPERAARFDVVYHLLSLVKNHRIRLKVSTDEDTPVPSVTPVFPVADWFEREAFDMYGIFFDGHPDLRRILTDYGFHGHPLRKDFPMTGYVEVRYDDELKRVVYEPVKITEFRAFDFLSPWEGAKYALPGDEKAQ
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 22435 Sequence Length: 197 Subcellular Location: Cell inner membrane EC: 7.1.1.-
B1ZUJ2
MIASKESNSAATPATSAPTLRTTAEIAATAAMGHAPHETFTINLGPQHPAAHGVLRVLMRMDGEWVENAEPVIGYIHRMHEKMGENRTWAKFLPNTSRIDYLSAMHYTHAWVGVVERGLKIEVPERAEYIRVITSELNRIASHQVWWGALLLDLGGFTPILYAFDDREKILDLLEGLCGARLTYCYYRFGGLYNDADDDFLKGTREFVKYMRPRLKMYRDLVTDNVILRQRLTGIGPISADTCRKYGATGPVIRGSGVAYDVRRAEPYSVYPKLQFKIPTYPECDSMARYLVRMDEMEESLNIIEQCLDLIQPGPFMAPKVPRVIRLPAGDYTYAVEAARGRFMVRVVSDGKENPYRARLRTPSFGNLSLFEETSRGMLLPDALAMMGSLDLVIPDIDR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 45035 Sequence Length: 399 Subcellular Location: Cell inner membrane EC: 7.1.1.-
P56908
MTEVTELMRPEGEALNTKEVLLNLGPQHPSTHGVLRLVLQLDGEYVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLAFALAVEKLLGIEAPIRAQYIRVMMAELARISGHLLITGALPMDLGAMTALLYAMREREMIMDLLEMITGARMHTSYCRVGGVREDLPDGFLPKIREFCEIFPNRIRDYERLIENNRVFLSRTQGVGVISATDAIDLGLSGPNLRASGVDWDIRRDEPYEIYDRLDFDVITREEGDCYSRWLCRVDEMRESIRLIEQCMEQMPEGPFQVDIPTIAFPVDKERVHCSMEALIQHFDLSAYGFDVPAGEVYSVIEAPKGELGFYIISDGSPKPFRMKVRAPSFVNLQALFGVTNARYLADMIAVLGSLDPVMAEVDK
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 45702 Sequence Length: 404 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A7NL07
MLQTQELQINIGPQHPSTHGVFRMIVTVDGETIIDLKPVFGYLHRNHEQLAEVSTYIQSMPYTDRLDYFNSMANNHALALAVEKLAGISVPQRAEYIRVLMVELTRILNHASAVGFLLNDMGAWQTPLMFGMREREKILDLFEMASGARMMCNYFRFGGVWRDLPPEFIPQLKELMQGLPSFFDEFERLLRENEILLSRTVNVGILPKEVAVSYSVTGPVLRASGIPYDVRRAEPYSVYGDLDFDIPIGSVGDVYDRFLIRIEEMRQSYRILQQVIERLPDTTGGHINPAMANIGKQKALRPPPGDAYARIESPKGELGFYLVSDGSERPYRYKVRAPSFINLTPLGDMCRGHKVADVVVILGSIDIVMGEVDR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 42313 Sequence Length: 374 Subcellular Location: Cell membrane EC: 7.1.1.-
A9G9T3
MSQVIFSVDRGGAEPGAEMDDEMTLNMGPHHPSTHGVLRFVISTDGEIIRKAVPDVGYLHRSIEKIGERCTYSGFMPYTDRVDYIAAMFANEAWASACEKLMGIEVPKRAQYLRVISCELNRIGSHMIALGAMAMDVGAVTPFPWALREREYINDFIEELCGARLTFNYHRIGGVSFDMPKGWADKVKHWLDRFEPIMVEFDRLISLNDIFIKRLANVAVVTAEEAKDWGLVGPNLRGSGVKWDLRKEDAYSVYPELEFDVPVGRGRYGTVGDCWDRFYVRVEECRESAKILRQALDKIDEHPEDDILGKLPKKMRPDGEAYARIESARGDMGCYVIGRGAEEAYRARFRTGSFTAMAMIEAKSPGLFLADLVALIASFDVVAPEIDR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 43669 Sequence Length: 388 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q67KN9
MNVERTQELLVNMGPQHPSTHGVLRLMIKLDGEQVTWCEPDIGYLHRCFEKLAEQKTYPQVIPFTDRTDYLAAMLNELCYVEAVEKLFGDAIQVPERAQYIRVMLAELQRITSHLLALGSMAMDLGATTPFLYCWRDREKLYSLFERITGGRMLYNYLRIGGVRNDLPEGILGTPQDGEDKADKTIWGFINYFDSYVYPEWKALVTGNRIFQYRTKNIGVLTAEQAIAYSCSGAVLRGSGVKWDLRKNLPYAIYDRFEFDIPVGQNGDSFDRWWVRQEEMYQSSRIVKQCLEWLAENPGPVMAPKMPRVLKPPKGEVYHRIEGARGEVACYVVSDGSTNPYKVKWRSPAFTHLQLMPLLCPGHKIADIIAILGSIDVVLGEVDR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 43902 Sequence Length: 384 Subcellular Location: Cell membrane EC: 7.1.1.-
B5YL34
MGETEIEKVSDTTFVLQMGPHHPATHGVLKLLCEFEGERVINIKPDVGYLHRGVEKLSESKTYPGAMTLTDRLDYISSMTNNIGYCLAVERLMGIEPPPRAKFIRTMVSEMTRLSSHLLWLATHALDIGAMTVFLYAFREREQILQFFEKICGARLTVSYPRIGGVRVDIKEHVLDEIYKFMDLMLIRVDEYETLLTENRIWIARTRGVGVIAPEDAVLLGLTGPALRGSGVYYDIRKQIPYDAYSEIDFEVPLGEKGDTYDRYLCRIREMRQSVLIVKQCIEKMPEGKILSDKSPDIDLPHQAKRKIEPGDSLWNGFIAFSEEKQEIMPKGEIYSAIEAPKGELGFYIVSDGSGRPYRMRVRAPSFIHISAIPKLCEGHLLADVIAIIGTLDIVMGEADR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 45377 Sequence Length: 401 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q9EV66
MELIVALGVIVFKVALVIAILLLLPLPLTWLERKIAGHMQQRMGPMRVGWHGLLQPVADGIKLLTKEDHIPAEADRFLFKLAPILALAPPFVVFAAIPFGESVSVLGNEITLYISNLNVALLFVFAVIGLEVYGVIFGGWAANSKYAVLGSLRTCAQMISYEIPMGFAVIGVVMLAQSMSLLDIVRAQTDVWNVVYQPIGFFVFFVAGLAEAQRIPFDLAEAEGDLGAGFHTEYSGIRFALFMVSEYVVMVLVSVLTVILFFGGWNGVLIPLPPLLWFLLKVAFFVYLFMWFRFTFPRYRYDQLMAIGWKVLLPLSLANIIISGVVFS
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 36387 Sequence Length: 328 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q6N1Z4
MIGMIITATISVALIMVLLVLAGTFTWVERRLLGFVQERYGPNRVGPFGSLQWVADTVKILTKEDRPPPGADKLLYILAPAVAATPVLAGFGVVAIGDGWALSSVDVGLLFLLGMLGLTAYAAVLGAWASNNRFSLLGGMRAAAQMLAYEVFLGLSLMGVVMIAGSFSMAEIVEAQRGVWFVVLQPLGMALFTIAGIAAAHRLPFDLPESENDLIAGFITEYTGMSFGLFFLGEYLAVLLVSALAVTLFFGGWLGPWLPGPVWFGLKTAVIAVAFVWIRATLPRPRYDQLLSFAWKVALPLSLLNLMLTGIVVVARSAS
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 34127 Sequence Length: 319 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q01UN2
METVLNHPLFMPVLVTLVIIAAFPLVAGYIVLVERKVLADFQVRLGPMRCGPHGLLQPIADALKLLLKEDIIPTDSDKAIFWFAPCISTITGLVAFAVIPFARKIYVADVNVGLLVISATSAVGILGIILGGWSSNSHYSLLGALRSAAQLVSYEVALAFALLSGVMVAGTLSMQGIVQSQADRGVWGIFANYGFMVVPFVLYIIAATAETNRAPFDLPEAESELVAGFHTEYSGFRWALYFLAEYANIFVISSVAVTLFWGGWLRPFSSVAWLEKPLNYGVPVILFVGSGLLTFTLIRKVVDPMQQKVLLGVVVLLVLIGAIMAIPMVNDAMIGLFWFLVKVSVIIYTMIWFRGTFPRYRYDQLMNIGWKIAIPVGMASVMVNAVLGMLGKH
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 42911 Sequence Length: 393 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q67KP0
MMEWWNSLSPTVQVWLGGVLKASLILVWGLINFYLCLMLERKLSAWMQNRVGPWRVGLWGWIQPVADLIKLWVKEYIRPNNVDKWLYLIAPFIGFVSANLVWLIVPFGDKLIATDFEIGIIFIAAVMGYDVIATFMAGWGSNNKYSMLGAMRGAAQLISYEVTMVMAVIGVVMMAGSLRLSDIVLAQQQRGFLGWFLFPQIIGFIVYLIASLAELNRAPFDLAEAEQELVAGHHTEYSGFRWAMFMLAEYIHLAAWSAIAATLFLGGWSGPTLGQVAAGLGNVLNGFGAFTNPVGTAVLNWGLAISGSTILNWVAGVFWLVLKTYFFVFLAMWIRWTLPRVRIDQLMDLGWKFLLPVSMFNIFLTGTLRYLAVAFDGVPISIGSFTLRLLGWWL
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 44177 Sequence Length: 394 Subcellular Location: Cell membrane EC: 7.1.1.-
Q5YWD4
MPDLSLFGHDPFWLVVAKSVFLFVYIILIPLVAVLAERKVVARMQMRVGPNRVGPFGSLQSIADGVKMAFKEDLVPAIVDKPIYLLAPVVSVIPAFMAFAVIPLGGEVSVAGNTTALQLTDMPVGVLYILAITSIGVYGIVLAGWASGSTYPLLGGLRSTAQVISYEIAMALCFAAVFLHAGTMATSGIVGAQHPTWFVFLLLPSFLIYCVSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMGTVSALATTLFLGGWSAPWPFNLIPGADAGWWGLLWFTAKVWTFMFVFVWLRGTLPRLRYDQFMRLGWQLLIPVSLLWVMLVATARLLRADGHAWATGAQVVVGVALTAAMIGLFLRAGRRPAAPPEPEPEPSGEAVFLGFPTPPVPADAHRVDNPKGGLLEPLAGFAVTAATMFKKPNTEFYPEQKVPTAPRYHGRHQLNRHPDGLEKCIGCELCAWACPADAIYVEGADNTEDERYSPGERYGRVYQINYLRCIGCGLCIEACPTRALTMTNDYELTDDNRADLIYEKDRLLAPLAPGMVAPPPAMAPGTTEADYYLGAVTGGAPAAEQPAPAGAKGGAR
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 64393 Sequence Length: 597 Subcellular Location: Cell membrane EC: 7.1.1.-
A0QU29
MTHPDPTLFGHDPWWLMLAKAVAIFVFLLLTVLSAILIERKLLGRMQMRFGPNRVGPAGLLQSLADGIKLALKEGLVPAGVDKPIYLLAPVISVIPAFVAFSVIPLGGAVSVFGHRTPLQLTDLPVAVLFILAATSIGVYGIVLAGWASGSTYPLLGGLRSSAQVVSYEIAMGLSFVAVFLYAGTMSTSGIVAAQDRTWFVFLLLPSFLVYVVSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYVNMTTVSALATTMFLGGWHAPFPFNLIDGANSGWWPLLWFTAKVWTFMFLYFWLRATLPRLRYDQFMALGWKVLIPVSLLWIMVVAITRSLRQHGEGTWAAWLLTAAVVVVVALIWGLATSLRRRTVQPPPPQSTGAYPVPPLPSVGTKETADA
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 44447 Sequence Length: 408 Subcellular Location: Cell membrane EC: 7.1.1.-
Q82TV0
MDSLQPLFEQLFGSEWGGPLFLLIKNLLLILAIVIPLLLAVAYLTFAERKIIAYMQVRVGPNRVTFFDIPWLRGWGQPIADAVKAIMKEIIIPTGANKFLFLLAPVLAIGPALAAWAVVPFSPELVLADINAGLLYILAMTSLGVYGVIIAGWASNSKYAFLGAMRSAAQVVSYELAMGFALVCVLMMSSSLNLGDIVAGQQGGSFLNWYLIPLFPMFLVYFISGVAETNRAPFDVAEGESEIVAGFHVDYSGMAFTVFFLAEYANMILVATLASIMFLGGWLPPVDIAPFNLIPGMVWLLLKIAFMLFFFLWFRATFPRYRYDQIMRLGWKVFIPLTLVWIVVLGMVMQLPEVVRQSFPLNLWFN
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 40726 Sequence Length: 366 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q01ZR8
MANPIEEILGTAAAIAKGMGITFKEMMGPTVTDDYPDAPPKFEERFRGVHVLQRDVNGMEKCVACFLCAAACPSNCIYIEAAENTDKIRMSGGERYAKVYNIDYNRCIFCGYCVEACPTDAITHGHGFEAASYNTSTLVKRKEDMLVPVPPGAKPPSMADEVPAGAH
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 18088 Sequence Length: 167 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q9XAR2
MDHKGTDPGFMNPVAGFGVTFKAMFKKRLTEQYPEQQKTTAPRFHGRHQLNRHPDGLEKCVGCELCAWACPADAIYVEGADNTDEERYSPGERYGRVYQINYARCILCGLCIEACPTRALTMTNEFELADSSRANLIFTKEQLLAGLEEGMVDSPHAIYPGTDEQDYYRGLVTEAAPGTVQQVAHSKGEVVQEGDSTFGATEPASEEVIRR
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 23403 Sequence Length: 211 Subcellular Location: Cell membrane EC: 7.1.1.-
Q67P14
MNGVAAIAKGMATTLKVLFRKPVTVDYPYVKRPRAPRFRGRHELRTYENGLEMCVGCELCQVACPAAAITVQAAENDPDNPHSPGERYGYKYQVDLLRCIFCGMCEEACPTDCLHLTQEFELADFTRESLILQKEQLVNRNPSGFKVPMNVYPPFRRKAVNA
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 18288 Sequence Length: 162 Subcellular Location: Cell membrane EC: 7.1.1.-
A0LEQ3
MGNLKEILEGGWSLVEGMRVTFRRLLRPVVTVQYPREVVTLSPAFRGHIELKSFADTGTHKCIACGTCERMCPSNVIKVQGTKAQPKGAKVATHYVIDFTRCSLCGICVESCPTGTLQYSTEYELAGESRWDGVIDLMQRFEARRPQSL
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 16615 Sequence Length: 149 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q2IL14
MPQTVRAYTGAIRDTVKSFWHGLSITLSYLARRPTTVQYPDRTPMPVRDMLPPRYRGFLEVDSGICTGCQACERACPIGCIQISLEKDAANPKQRVVTQFDIDEAKCMFCGLCVEPCPTGSIQHTREFEGTHKHIRNLVFRWADPMNPFPVYKVDKNAEYYPRVPLGSLVRQRLETMAWDRSAPQFLPPEPPKPAEAKPAAKAAPAAKPAAAAPAAPAAAAPAAAPAPAKPAAAPAPAAAAAPAAPAAEAPAAPAAPAANPESK
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 28065 Sequence Length: 264 Subcellular Location: Cell inner membrane EC: 7.1.1.-
O67386
MIKKVAAKPLSWLERIFFIDFIKGLRITLKNALRKTITTHYPYEKITPPKRFRGYFAHKVVDGTEPQPAFQEWVNRYNILVEYGKSRCVVCLRCKRACPVPQLFEIEGKKLPNGKRVVSVFNMNMLLCTYCGFCVDACPVDCLYQTDIHENASYTRKDAVLTLEILEQIGRDWQRRREREPDRIWIDDEQRMKLWGENNVKLPKPEEV
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 24572 Sequence Length: 208 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q3J1Q2
MKGILDSILRVGRMIFAPTKTVQYPEEKLPLAPRTRGRIVLTRDPDGQERCVACNLCAAACPVDCIDVVKAETPDGRWYPESFRINFARCIFCGYCEEACPTSAIQLTPDVELADYRRGFLQYEKEDLLISGEGKHPGYRYWDVAGKAIAGKAQDPVDPKDLCP
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 18316 Sequence Length: 164 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q92YN8
MSRALDKAGRWIGWAFFADLANGLALTFGYMFSRPVTMQYPDKEKWLPYSRYRGHHFLKRDDEGEIKCVACELCARICPCDCIEVVPYEDEKGNRRPAKFEIDTARCLFCGLCEDACPADAIALGQQYEFSSFSSRDLVIGRDDLLAKPGKAMTGGGVVAARLNTERDVLVEASEPRGYNWWRNIRRK
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 21361 Sequence Length: 188 Subcellular Location: Cell inner membrane EC: 7.1.1.-
O25858
MAKQEYKQLPKRAEVHSATEQFKDTVKTSLGLDLFKGLGLTIKEFFSPSVTIHYPMEQLPLSPRYRAVHNLQRLLDSGSERCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFENASTQRSQYGSKSEFLTSEQDAKNCSHAEFLGFGAVSPNYNERMQATPLDYVQEPSKEESQEETPTNPESNKGDENV
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 24715 Sequence Length: 220 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q5ZRU6
MKKVYHYIIHYVRTYLLLELLAGLWLTVKYFFRKKITVQFPEEQTPLSPRFRGLLALRRYPNGEERCIACKLCEAVCPALAITIESEQRDDGSRRTTRYDIDMFKCINCGLCEESCPVDSIVVTPIHHYHISERGQNIMTKEKLLAVGDLMESQLAADRAADEKYR
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 19291 Sequence Length: 166 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q72VZ9
MGTVNVVRVASRHKLSWYEKFYFYSIGKGLWITLKHFIKAAILRKAVTIEFPEKKRKYSTRFRGMHTMKRDEQGRERCTSCFCCMWICPADAIYIEAAEVTPEIQHLHPEDKYAKKFEIDLLRCIFCGMCEEACPKGAIYLDGPGEMATDNREDLILTKERMMQLVGGPIIGERQ
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 20324 Sequence Length: 175 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q5LPS9
MTQIDYTRAAKYFLLQDFWVGMKLGLKYFFSPKATINYPHEKGPLSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIDAEPREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATETREELFYDKEKLLSNGDRWEAEIARNLELDAPYR
Cofactor: Binds 2 [4Fe-4S] clusters per subunit. Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 19042 Sequence Length: 164 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q8KEB6
MLTQQLLSIGVNHFLTISVILFGLGMFAVMTRKNAIVILMGVELILNAANINFLTFSKYNGGMEGVMFSLFVIVLAAAEAAIALAIVINIFKTFKTVDVSSVDTMKE
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 11590 Sequence Length: 107 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q0KCS0
MLSLAHFLVLGAILFAISIVGIFLNRKNVIVLLMAIELMLLAVNINFVAFSHYLGDLAGQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDMDTLKG
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 10951 Sequence Length: 101 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q9RU97
MPEMVPTSYYLALSGVLFALGLIGVMTRRTAILIFLSVELMLNAANIALVAFARSWGDLMGQTAVFIVMTLAAAEVAIGLAIIVAIFRGRETTNVDDLAQLRG
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 11002 Sequence Length: 103 Subcellular Location: Cell membrane EC: 7.1.1.-
P57262
MSIIFFIILFPLIGFLFLSTIQDFIFKRYTLNIGIFSIFISFFITCFYGVSILKNNNQVFTQILWKWLSINEFKIDFGFFLDGLSLSMLFVITGVGLLIHIFSSWYMRYKEGQSRFFAYTNLFIASMSVLVLADNFLFMYLGWEGVSVCSYLLIGFYYTELKNNLCAFKAFILTRVSDVFLMIGMFLIYREFNSFNFQEIKFLSSFLNVENFYYLDYITLFLLLGVIGKSAQLPLQTWLSDAMVGPTPVSALIHAATMVTAGVYLIARTHFLFLLTPGILYLVGLIGTLTILVSSISALVQKDIKRILAYSTMSQIGYMFLALGVKAWSAAITHLIMHAIFKALLFLSAGSLIKSCKNEKNIFKMGGLRKQLPFLYISFIVGGASLVSFPLITAGFYSKGNILFSVLKSGCIDFFIIGLFCSFLTAIYTFRMIFVIFHGKNIHTADSSTNLQHNIPLFVLLLLSTVFGSYISPPLSDVFPLSYTPIDHKFAFEIICSILSLSGIYLSYYIWIKNLYVLDKIFQFKFMRYLYYFFLKGWGFNWFYKISFVYFYLYISKRLSADPLNKIINYFLKVTQIFNFYLLKTSNGYVRWYVASMILGINFIFLLMLFFYFN
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 70882 Sequence Length: 614 Subcellular Location: Cell membrane EC: 7.1.1.-
Q89AT6
MNFVYLVVLCPLVSFCLLLFFIDYLPKMLVKKIGIVSIFISMIITFYSLFDFLNCGKQCVFYIPLWVWISIDYLKIDFNFMLDGLSITMLTMTTSIGFLIHLFSSWYIKLQDEYTRFFSYMNLFIASMVLLLLADNLLVMYIGWEGVGLCSYLLVGFYYSKINSGYAAIKGFIITRIGDIFLILAIFFIYKNFGTLNFRELKLIFETTNVVENFKFLNYVSLFLLIAAIAKSAQVPLQTWLIDAMAGPTPASALIHSSTMVTAGVYLIARMNFLFSLSPIILYILGIISCLTIIMSCLSALVQKNIKCILAYSTMGQVGYMFLALAMKEWTLAINHLVTHAIFKTLLFLSAGAVIILLNNEKNIFNMGGLRKKFPMLYFSFLIGGASLASFPILTSGFYSKGNILFSALENNYYLFLVLGLLGSVLTSIYTFRMIFLVFCGAQKYRAHYVFFSRTLANTLPLLILILLSTVIFVLIHLPLSSVFSKTTPSFLINNNKLLFEIGCSVLSLLGMFISYYLFLVNRMLVDLLLNTKLGNFIYNFWYDSWGFNSLYNILCVNPYLYVAKRLKHDPINIFMSIPITFCFFVSKNLKYIHNGYLRVYVFSIMFGLFLFILMAIRLYK
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 71078 Sequence Length: 621 Subcellular Location: Cell membrane EC: 7.1.1.-
Q9PMA7
MQNLALISLFSPFVAFLFASCFALSEKKQFVGIICSLLVALSAFCSLYLLFCNEAFNVSLFEWFAGVNFGFDIDAISLTMMSVVGIVATCVHFYSIFYMAHDEGFNKFFAYLGLFVFSMLFLVMSDNFLGLFVGWEGVGLCSWLLIGFWYKNDTYSFAANEAFIMNRIADLGMLLGIFWLYLQAGTLKYDEVFSMAQSLDHNALILIATCLFIGAMGKSAQFPFHTWLADAMAGPTPVSALIHAATMVTAGVYLVIRASTLYDLVPEVSYIIALLGAFVAIFAASMALVVRDLKRIIAYSTLSQLGYMFVAAGLGAYGIALFHLATHAFFKSLLFLGAGNVMHAMNDKLDIKKMGGLFKPLKITAILMCIGSLALAGIYPFAGFFSKDLILGYSFISFHHGIFLVLLIAAFLTAFYSFRLLMLVFFTPARHDEHPHEASKIALLAMSPLMVLAIIAGFFEHSFFEYLSTKLVFIDAQNQIVMICASVAAILGAILAIFAYKNSWFKESIEENKIHKLLSNDYFIPQFYHQFIVSKYESLCAILKHCDLYIFDRIVEKIALYSQNISQKMIMPNSLNLMLRFLVAAFVILLILVWMV
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 66528 Sequence Length: 596 Subcellular Location: Cell membrane EC: 7.1.1.-
P33607
MNMLALTIILPLIGFVLLAFSRGRWSENVSAIVGVGSVGLAALVTAFIGVDFFANGEQTYSQPLWTWMSVGDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFFAYTNLFIASMVVLVLADNLLLMYLGWEGVGLCSYLLIGFYYTDPKNGAAAMKAFVVTRVGDVFLAFALFILYNELGTLNFREMVELAPAHFADGNNMLMWATLMLLGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEVLHLVGIVGAVTLLLAGFAALVQTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLASGSVILACHHEQNIFKMGGLRKSIPLVYLCFLVGGAALSALPLVTAGFFSKDEILAGAMANGHINLMVAGLVGAFMTSLYTFRMIFIVFHGKEQIHAHAVKGVTHSLPLIVLLILSTFVGALIVPPLQGVLPQTTELAHGSMLTLEITSGVVAVVGILLAAWLWLGKRTLVTSIANSAPGRLLGTWWYNAWGFDWLYDKVFVKPFLGIAWLLKRDPLNSMMNIPAVLSRFAGKGLLLSENGYLRWYVASMSIGAVVVLALLMVLR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 66438 Sequence Length: 613 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q9K1B0
MNDMTLYLIIALVPLAGSLIAGLFGNKIGRAGAHTVTILGVAVSAVLSAYVLWGFIDGSRAKFDENVYTWLTMGGLDFSVGFLVDTMTAMMMVVVTGVSLMVHIYTIGYMHDEKVGYQRFFSYISLFTFSMLMLIMSNNFIQLFFGWEAVGLVSYLLIGFYFKRPSATFANLKAFLINRVGDFGFLLGIGLVLAYFGGSLRYQDVFAYLPNVQNATIQLFPGVEWSLITVTCLLLFVGAMGKSAQFPLHVWLPDSMEGPTPISALIHAATMVTAGLFMVSRMSPIYEMSSTALSVIMVIGAITALFMGFLGVIQNDIKRVVAYSTLSQLGYMTVALGASAYSVAMFHVMTHAFFKALLFLAAGSAIIGMHHDQDMRHMGNLKKYMPVTWLTMLIGNLSLIGTPFFSGFYSKDSIIEAAKYSTLPGSGFAYFAVLASVFVTAFYAFRQYFMVFHGEEKWRSLPEHHSDGHGEEHHGLGKNDNPHESPLVVTLPLILLAVPSVIIGYIAIEPMLYGDFFKDVIFVNADAHPTIHIMKEEFHGALAMVSHSLHSPVLYLAIAGVLSAWLLYVKLPHLPAKIAQTFRPIYVLFENKYYLDALYFNVFAKGTRALGTFFWKVGDTAIIDNGIVNGSAKLVGAIAAQVRKAQTGFIYTYAAAMVFGVLVLLGMTFWGLFR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 74229 Sequence Length: 674 Subcellular Location: Cell membrane EC: 7.1.1.-
P50939
MTTIILLAPLLGALIGGFGWRLITEKGALVVTTGLLFLSCILSWVVFLTLPAETQHIHLLDWIRSGALDTSWGIRLDRLTAIMLIVVTTVSALVHLYSWGYMAHDENWTHHEAYKARFFAYLSFFTFAMLMLVTSDNLVQMFFGWEGVGVASYLLIGFYYKKPSANAAAIKAFVVNRVGDFGFALGIMGLFFLTDSIDMDVIFASAPELAKTELHFLAWEFNAANLLAVLLFIGAMGKSAQLFLHTWLPDAMEGPTPVSALIHAATMVTAGVFLVCRMSPLFEYAPEAKMMVVYVGAVTAFFAATVGLVQNDIKRVIAYSTCSQLGYMFVAAGSGVYSVAMFHLLTHAFFKAMLFLGAGSVIHAMHHEQDMRNYGGLRKKIPFTFAIMMIGTLAITGVGIPFFSIGGVPVGFAGYLSKDAIIESAFASGNGFAFYVLVAAAGMTSFYSWRLIFLTFYGEARGDHHKHDHAHESPAVMLAPLALLAVGSVLAGMVWYHSFFGDKVASFFNLPAAAHGEAHGTEHATEGHVPEAAMTAEAAHEAAMAGTMAMAEPAAEHAVAKAPQGAIFMAETNHVIHDAHGVPDWVKLSPFGAMVTGFFFAWLYYIGDKPLPGRTARALPGLYRFLLNKWYFDELFDLLFVNPAKSLGRKLWKGGDGAVIDGAINGLALGWIPFFTRVAGRIQSGYLFHYAFAMVLGIVALMFWVVRTGGMN
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 77532 Sequence Length: 712 Subcellular Location: Cellular chromatophore membrane EC: 7.1.1.-
Q92G97
MMYQNICIMIIMLPLASSIINGLFLRVIDKKLAQVIATGFLSLSALFSLIIFCDTGLDGNIIHIKLLPWIEVGTFKVNWSIYIDQLTSIMFIAVTWVSSIVHIYSLGYMAEDKGIIRFLSFLSLFTFFMLMLVSSDNFLQLFFGWEGVGVCSYLLIGFWYSKESANKAAIKAFIINRASDFAFILGVITIIVYCGSANYKDVLSSAELLSNIKIFLHFSILDIICLLLFIGCMGKSAQIGLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARCSYLFEYSPLILQFITIIGGVTCLFAASIAIMHSDIKKIIAYSTCSQLGYMFMACGVSAYNSGIFHLVTHAFFKALLFLSAGSVIHAVHEQDIFKMGDLRNKMPVTYGNFLIGSLALIGIYPLAGFYSKDSILEAAYSSGSFMFIFGIAAAILTAIYSMKIIMLVFHGKTKLEKDVFEHAHEPAKVMNNPLILLVVGSFFSGMIGYYLLAMDKPNGYFHASLFNLHIYKLLISHPPLYIKLLPMAVGIVGIVTGIYLYKSSTVMSFPQKRKSSKNIKNAWILRSSRGMTPLVLISNILRNKYYFDEIYNCLIVKPINCLASLFYLGDQQIIDRFGPNGFSRVVNCFSVLTGKIQTGYVFNYALYIVSFIVVTISYFVWKNIMY
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity). Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 73327 Sequence Length: 657 Subcellular Location: Cell membrane EC: 7.1.1.-
A7HY36
MENAISTVPEFLPALPEILLAVGAMALLMYGVFRKDCDARETSLGALALFALVGAFLIIEPNAYVETFGGMFVIDGFTKFMKLLILLAAAAAIVMSLTFIRREGMDRFEYPVLIILATLGMFMMVSANGLISLYMGLELQSLSLYVIAAFHRDNTRATEAGLKYFVLGALASGMLLYGASLIYGFTGSVQFGSIATVLQADGTNIGVIFGIVFVLAGLAFKISAVPFHMWTPDVYEGAPTPVTAFFAGAPKVAAMALILRVLFVAFPSMESEWQQIIVFIAIASMVLGAFAAIGQSNIKRLMAYSSISHMGFAMVGLAAGTPEGVRGVLIYLVIYVVMNAGVFCCILAMQRKEGYVENISDLAGLSRNQPMVAFMMAMLMFSLAGVPPLAGFFGKFYVFMAAVEAGLYPLAVIGVLASVVGAFYYLRIVKIMYFDEAAEPFIQPMPGELTAVLGISGVFTLFFFVYPAPLILASQAAVRALLP
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51828 Sequence Length: 483 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q6MDQ3
MNPTLTLTDFISIGPLLIVLMTALIIILIESFSENCSKKWSSLISIGGLTLSIFAVWGGISSNHSSLLNPWIHFDTLARFFTVFFLVIGIGASLLATAFFQRFKASHGEYFFLLQSAVFGLILIGAAADLLTLFLGIETLSISLYVLCGYMKKWEISHESSFKYFLMGSIVAGFLLYGIALVYGAIGTTRLDVLLSSYQTISLTTEKVLFFSGIAMITLGLAFKAALVPFHTWSPDVYAGASNPVTAFMAVGTKVGVFAAFVRLFFEALPQFDAAWNQVIDTLVYATLIYANFVALKQIQLRRFFAYSSISHAGFLMIPVVIGNQEALSALTFYLVIYAIATFGCFAVLAYLDQNQEGVHFSDLHGLFSRSPWLASLLSICLLTLAGIPPTAGFLAKFYVFKVAFQAGYYGLVIVGLLTTILSSYYYLRIIGILFSESKNDEKLPYSMPAAIVGTTSFIAIIILSFYPAPFLKVLSHLSN
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 52626 Sequence Length: 480 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A1ALQ2
MATDLLYGLLPEHILLGLILVLMLLEILSVDKRAGSALFIASLLAGAGVLVMQLQTGYTADIVMNEIRIDRFSEIGRLIIVSCGAILGVYSLSSEAGHKYWILIASSLLGAMIILDSAGFISLFMGIEILSLPGFALMVLNNGKSTASEGSIKYLLLSSVATALVLFGLSLVYGSTGNLNISSFTAAVATGGVQNLAASVMILSGFFLKASVFPFHGWAPDAYSSARLPVTAFLASIVKAAVVLGLVRILGNAVLNPEAVTVIALLSMLSMFYGNITAIHQTAFKKMLAYSSISHAGYMMFALVDNTGARTEALLYYVAVYAVTTITACACFSILSGEDDNLDNLNGIFRKKPVAAILLSLCVLSLAGIPPLPGFLAKFFVFKTVIASGHLTVAVLAFVASYIGTFFYLGVVLRMFRSDAETVEQPANATCLCWTWGGALLGTLALALFMLLPNIFHWVMTGI
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 49096 Sequence Length: 463 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q4FM78
MDNLNFILPEIFISLSIMFLLLLGVYKKNSSNIVHNLAVGSLLITGILIFNNPLDQNISLFNDGYVVDNLSSFMKILTILGGAFVLSISTRYLKIFKIFLIEYPVLILSSILGMMVMISSNDLMVFYIGLELQSLALYVLASFNRDQLKSSESGLKYFVLSALSSGLLLYGCSLVYGFSGSTNFNVIGDLMNSSHYGLTFGIVFILVGLAFKISAVPFHMWAPDVYEGSPTAVTLFFAIVPKVAALTVFIRFLYIPFVNMIDQWQPILIFLSIASMIFGAIAAIGQNNLKRLIAYSSIGHMGYALAGLSTGSNEGIQSSIVYMSIYLVMNLAFFSCLLMLKRNDAYYETIDDLSGLSKNHPILSLSLLAILFSLAGIPPLAGFFAKFYIFKAVIEQSMYFLAIVGLLSTVIAAFYYLKIIKVIYFDKEKESYDTDHNIWLKGSLTFSTLLILLYFIFPSKLLEIVSRINII
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 52378 Sequence Length: 471 Subcellular Location: Cell inner membrane EC: 7.1.1.-
C0QR92
MSILQQLVSGIGVPNFGVILPEIIILITAFILLVVELLIRSRVVISAITVTGLILAAASVFLIKKGDVTFYGLYVVDMFSLIFKLFLILTTLFVVINLKPYLDSKKSYYGEYYYIILFALIGMMIMVSSPNLVTFYIGLELSAVSIYILAGTFRKDYRSKEGAFKYLIMGGMGTAIISYAIALIYGRTGSFDFYTIASLINSNNIDVGISGALILLIIGLALKAAAVPFHFWTPDAYEGAPTPITAFMAVAAKIATFAVILRVMVEAFPFISKEWSFAWAILAAASMIIGNIIALRQENVKRMLAYSSVAHTGYILAAIAAPTGMGFSALIFYSLIYIFMGIGGFILLSALEKNHNWSNHIDDFKGLAKRSPMMALFMLIFMFSMLGIPPTVGFMGKLGVFLALIGSDIWWLAVTLVVMSIVSAGYYLRVVIYMYMYEPVSKARLNFAMTEMFTVAFMAVFVLILGIYPTVFWGISTTLSSLLIAGIGR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 53710 Sequence Length: 489 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A1VM73
MIDKLSWIAVYPELVLLVMACLIALVDLGVKSPRRTLTYALTLLTLGAVAVMEASYALGGQTFYGFGNMVVVDPMGSWLKCFSSIALMITVVYGRPYAADRDMLRGGEFFTLSLFALLGMFVMISGHNFLVLYMGLELMTLCSYALVALRRDDAQATEAAMKYFVLGALASGFLLYGLSMLYGATGSLNINEVFNAIASRQVKHQVLVFGLVFIVAGLAFKLGAVPFHMWLPDVYQGAPTAVTLIIGGAPQLAAFAMTIRLLVEGLLPLAIDWQQMLALMAIGSLVIGNLAAVAQTNLKRMLAFSTISQMGFLLLGLLAGVVNGNQLHTESAYGAAMFYALTYVLTTLAAFGIILLLARAGHESEEITDLSGLNQRSPLYAGVMAMSMFSLAGLPPLVGFYAKLGVLQALISSGQTSYLVLAVFAVFMSLIGAFYYLRVIKVMYFDAPHSHNAQPISAPADAQIVLAINGALLLVLGIAPSSLMTLCAQSINSIVNSLGV
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 53393 Sequence Length: 500 Subcellular Location: Cell inner membrane EC: 7.1.1.-
B1XUL1
MQAFDLYAILPELVLLIATCLLLVASVYVPERVTPTLGVEQDVFHTPRGVGFVYFFTIIMLVYLVFAFVGRMGDPALVAMNGLFQSDPFSNLLKACSCIAVLISLIYSKQYLMDRDLFRSDFIVLALLALLGQFVLISGANLLTLYLGLELMALPTYALVAMRHNSEKSVEAGIKYFILGALASGFLLYGMSMLYGVTGSLDLIEIFKVVADPRVNHLVMAFGLVFIVAGLAFKLSVVPFHMWVPDVYQGTPTAVTLMIAAAPKLAAFALLFRLLVNTLLPLLGDWQPMLVLLAVLSLVVGNVTAIAQTNVKRMLAYSAIAQMGFVLLGMLSVFDDHAFSASMFYAITYVLTTLGTFGLLMVLSRKGYDCETLDGLKGLNKKHPWFAFISLVMMFSLAGIPPTVGFVAKLGVLEALVDAEHSFIAVIAVIASLIGAFYYLRVIKVMYFDEPEHEVTVSGSGFAKGVLSLNSILVLAIGIVPAGLMSLCLDAMRRTLLGS
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 54192 Sequence Length: 499 Subcellular Location: Cell inner membrane EC: 7.1.1.-
B4EZ47
MTITPEQLIAMLPLLVVILTVVVVMLSIAWRRDHFTIATLTATGFIIALGSLYYVNALGVVDVTTLYHVDGYSSFFTALTIIAGLGTVAFAYPWLEGYQDNKEEFYMLVAIAVIGGILLSSAHHLASMFIGIELLTLPLFGLIGYAFQQRPSLEASIKYMLLSAAASSFLLFGMALLYAEAGNLSFTAMGQSLSDSNIHKPLVLAGLGMMLVGIGFKLSLFPFQLWTPDVYQGAPAPTGAFLATASKIGIFAVVMRLFLEAPAADSETLRMILGFMAIASILFGNIMALTQKNVKRLLGYSSVSHLGYLLVALIVLQYSPILAQETAEIYLAGYLFASLGAFGAIAVASSPYNKGELESLEDYRGLFWRRPVAAVVMSLMMLSLAGVPITLGFIGKLYVILAGIDSSLWWLTGMVVLGSAIGLFYYLRAAAIVFLRKPDNDNAPAVTTTSQNMATLITLVCAIIVIVLGVWPQPLIELTRFAIIAPAIN
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 52650 Sequence Length: 489 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q9I0I9
MTFTIQHFIALLPLLITSATLVVVMLAVAWKRNHSFTATLSVIGLNLALLSLLPVLGVTPIEVTPLVLVDNYACFYMALVLVSALACVTLAHAYMESYPGNREELYLLLLLATAGGLVLVSAQHLASLFIGLELLSVPVYGMVAYAFFNKRSLEAGIKYTVLSAAGSAFLLFGMALLYAESGTLGFAGLGAKVAEHVLSGPLVSVGVGMMLVGLGFKLSLVPFHLWTPDVYEGAPAPVSAFLATASKVAVFAVLLRLFQIAPAALDNQLLNISLSVIAVASILFGNLLALTQSNIKRLLGYSSIAHLGYLLVALIASKGMAVEAVGVYLATYVLTSLGAFGVITLMSTPYSGRDADALFEYRGLFWRRPVLTAVMTVMMLSLAGIPLTAGFIGKFYVIAVGVESHLWWLIGALVLGSAIGLYYYLRVMVTLFLVEPGIRQHDAPFNWGQRAGGIMLVAIALLAFFLGVYPQPLLEILQHSGLALAG
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51720 Sequence Length: 486 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q4FU52
MNDFTMNDLMGLLPYAPIIAVVITVLVVMIAITMKRSHMVTGTISVVGLNIGLFILLGQMAGIIDSGSLVPAAEQLFVIDNFAQFNMVIIFICALACCTLSYAYLADLKDHKEELYLLMLLSTVGALLMVCAQHLASFFMSLEMLSIPLYGMLSYTYMRTRSLESGLKYLVLSATASATLLMGMAFIYAEVGSLAFKPISLTLADTFESPLLILGAAMMMFGIAFKLSAAPFHIWTPDVYEGAPAPIATYLASVSKVAMMALAVRFLIDTSLLALPSVQMLLMVMATLSILLGNLLAVRQTSLKRLLGYSSIAHMGYVLIVIVSIGSAADSISSMYMAIYAFTSIGAFGVVTLMSSPYRLSGEADELTHYQGLFWRRPVLTAVMTIMMLSLAGIPLTAGFITKLFAILAAVQGTNWFLAAMIILGSAIGLFYYLRVLLTLFKRPKQFIEFDVSKQWGLRTGGIMVIAVTAIIVFFGVLPNSMIEWASLARIW
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 53521 Sequence Length: 492 Subcellular Location: Cell inner membrane EC: 7.1.1.-
Q2K9R9
MTAETILLSLHLSAPELILAVGALVLLMVGVFSGERSGLVVTGLAIVLLLASGLWLLFVPAEGLAFGGVYMADGFSRFMKLVALIGSLVALFMTMGHARENQLDKFEFPVLLVLATLGILLMISANDLISLYLALELQSLALYVVAAINRDSLKSTEAGLKYFVLGALSSGMLLYGMSLVYGFTGHTHFTEIAQALSVEGARSLGLIFGLVFILAGIAFKISAVPFHMWTPDVYEGAPTPVTAFFAAAPKVAAMAMLTRIVITAFQPVLADWQQVVVFISIASMLLGSFAAIGQKNIKRLMAYSSIGHMGYALVGLAAGNQTGVSGVMLYMVIYMIMTLGTFAIIMSMRRKDGTVVEDVNDLAGLSATNPFMAVVLTALMFSLAGIPPLAGFFAKYFVFVAAIEAKLYALAIIGVLASVVGAYYYLRVIKLMWFDEATGEFARVSSALRLVFGLSGLFVTAYVLIGGPIGGAAELAAATLF
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 50999 Sequence Length: 481 Subcellular Location: Cell inner membrane EC: 7.1.1.-
A5VAN3
MSMTASLALTVPELILSVGALLLLLVAAFGGDGFARAIGWGAVALFAAAGFSLTGPAGNGGPGFDGLYIADSFAAFAKLLIYIAAAVSVAVAPGFFSRTGGGYRAEYPVLILLSGVGMGMMVSAGDLLTLYVGLELQSLSAYVLASFMRRDTRSAEAGLKYFVLGALASGILLYGISLLYGFTGTTLFAGISDSLAKGMGTGQMFGMVFVFAGLAFKISAVPFHMWTPDVYEGAPTPVTAFFASAPKVAGMALLLRVAIEAMGSGTDTWRQIVVFAALASTILGAVAAIGQTSMKRLLAYSSINNVGFALFGLAAGSADGVAATMTYMAVYVAMTLGSFICVLQMRGQDGQPVETIASLSGLSRSRPGLAAAFAIFMFSLAGIPPLFGFWPKFLVFDALVRAGFWPLAMVGIATSVIGAFYYLKIVKTIYFDDPAPAEFAPAASKLEGGLITLAALAVSPLGYLAIPLLDATSMAAARSLF
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 49576 Sequence Length: 481 Subcellular Location: Cell inner membrane EC: 7.1.1.-
P50973
MTKAEFSLVLPEVLLAIYAMGVLLFGVWTGKDRVAKPILWASAVTMLALALIIGLGTGNDTAFGGLFIADGFARFSKVVILVSAAAVLAMSSDYMGRRGLLRFEYPILIVLAVVGMMMMVSAGDLMSLYIGLELQSLALYVVAALRRDSAVSSEAGLKYFVLGSLSSGLLLYGASLVYGFAGTTTFSGIITVVEQGHLPIGLLFGLVFLLAGLAFKVSAVPFHMWTPDVYEGSPTPVTAFFATAPKLAAMALIARVVHDAFGQVPGEWGQILAALALASMYLGAIAGIGQRDIKRLMAYSSISHMGFGLLGLAAGTAAGVESMLLYMTIYIVMNVGTFAFILSMERDGKPVTEIAALNMLSKTDPVKAFALLVLLFSLAGVPPMLGFFAKFAVIKAAIGAGFVWVPVAAVVASVIGAFYYLRIVYFMYFGEKSAPLDGRMPALQFAFLVLAAVAMLGGAINMAGVEGAAQAAAASLVN
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 50128 Sequence Length: 478 Subcellular Location: Cellular chromatophore membrane EC: 7.1.1.-
B6ISW8
MVAIPDFLPALPEMFLACAAMALLMLGVFRGADSTRLVSWLAVGAALVAGVLVLAASGDRAVTFAGMFIADDFAVFAKVLILTATALTVVLSVNYLEREQMDRFEYPVLMLLATVGMMLMVSANDLISLYVGLELQSLSLYVIAAFRRDYAKSSEAGLKYFLLGSLSSCILLYGASLIYGFSGTTNFERLAVMFSSDVPAATGVVVGLVFVAAGLAFKISAVPFHMWTPDVYEGAPTSVTAFFAVAPKVAALALFVRVLVDPFGELLAQWQQVVWFSAVASMLLGSLAAIQQRNIKRMMAYSSIGHIGYALVGLAAGTEEGVRGVLIYLAIYLAMNVGTFAVILSMRVNGRMVENIDDLSGLSRSHPMMALAMAFFMFSLGGVPPMAGFFGKLYVFMAAIEAQLYVLAVIGVLTSVISLFYYLRIVKVMWFDDLMETIERPARASALVIGGTALFVFPVFYVFSEGILNGAAAAASTLFLR
Function: NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. Catalytic Activity: a quinone + 5 H(+)(in) + NADH = a quinol + 4 H(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51636 Sequence Length: 481 Subcellular Location: Cell inner membrane EC: 7.1.1.-
O60356
MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPGGHERKLVTKLQNSERKKRGARR
Function: Transcription regulator that converts stress signals into a program of gene expression that empowers cells with resistance to the stress induced by a change in their microenvironment. Thereby participates in regulation of many process namely cell-cycle, apoptosis, autophagy and DNA repair responses . Controls cell cycle progression and protects cells from genotoxic stress induced by doxorubicin through the complex formation with TP53 and EP300 that binds CDKN1A promoter leading to transcriptional induction of CDKN1A . Protects pancreatic cancer cells from stress-induced cell death by binding the RELB promoter and activating its transcription, leading to IER3 transactivation . Negatively regulates apoptosis through interaction with PTMA . Inhibits autophagy-induced apoptosis in cardiac cells through FOXO3 interaction, inducing cytoplasmic translocation of FOXO3 thereby preventing the FOXO3 association with the pro-autophagic BNIP3 promoter . Inhibits cell growth and facilitates programmed cell death by apoptosis after adriamycin-induced DNA damage through transactivation of TP53 (By similarity). Regulates methamphetamine-induced apoptosis and autophagy through DDIT3-mediated endoplasmic reticulum stress pathway (By similarity). Participates in DNA repair following gamma-irradiation by facilitating DNA access of the transcription machinery through interaction with MSL1 leading to inhibition of histone H4' Lys-16' acetylation (H4K16ac) . Coactivator of PAX2 transcription factor activity, both by recruiting EP300 to increase PAX2 transcription factor activity and by binding PAXIP1 to suppress PAXIP1-induced inhibition on PAX2 . Positively regulates cell cycle progression through interaction with COPS5 inducing cytoplasmic translocation of CDKN1B leading to the CDKN1B degradation . Coordinates, through its interaction with EP300, the assiociation of MYOD1, EP300 and DDX5 to the MYOG promoter, leading to inhibition of cell-cycle progression and myogenic differentiation promotion . Negatively regulates beta cell proliferation via inhibition of cell-cycle regulatory genes expression through the suppression of their promoter activities (By similarity). Also required for LHB expression and ovarian maturation (By similarity). Exacerbates CNS inflammation and demyelination upon cuprizone treatment (By similarity). PTM: Phosphorylated in vitro by PKA and CK. Phosphorylation promotes DNA-binding activity. Sequence Mass (Da): 8873 Sequence Length: 82 Subcellular Location: Nucleus
Q9WTK0
MATLPPTANPSQQPLNLEDEDGILDEYDQYSLAHPCVVGGGRKGRTKREAAANTNRPSPGGHERKLLTKFQNSERKKAWR
Function: Transcription regulator that converts stress signals into a program of gene expression that empowers cells with resistance to the stress induced by a change in their microenvironment. Thereby participates in regulation of many process namely cell-cycle, apoptosis, autophagy and DNA repair responses . Controls cell cycle progression and protects cells from genotoxic stress induced by doxorubicin through the complex formation with TP53 and EP300 that binds CDKN1A promoter leading to transcriptional induction of CDKN1A (By similarity). Protects pancreatic cancer cells from stress-induced cell death by binding the RELB promoter and activating its transcription, leading to IER3 transactivation . Negatively regulates apoptosis through interaction with PTMA (By similarity). Inhibits autophagy-induced apoptosis in cardiac cells through FOXO3 interaction, inducing cytoplasmic translocation of FOXO3 thereby preventing the FOXO3 association with the pro-autophagic BNIP3 promoter . Inhibits cell growth and facilitates programmed cell death by apoptosis after adriamycin-induced DNA damage through transactivation of TP53 . Regulates methamphetamine-induced apoptosis and autophagy through DDIT3-mediated endoplasmic reticulum stress pathway (By similarity). Participates in DNA repair following gamma-irradiation by facilitating DNA access of the transcription machinery through interaction with MSL1 leading to inhibition of histone H4' Lys-16' acetylation (H4K16ac) (By similarity). Coactivator of PAX2 transcription factor activity, both by recruiting the EP300 cofactor to increase PAX2 transcription factor activity and by binding PAXIP1 to suppress PAXIP1-induced inhibition on PAX2 (By similarity). Positively regulates cell cycle progression through interaction with COPS5 inducing cytoplasmic translocation of CDKN1B leading to the CDKN1B degradation (By similarity). Coordinates, through its interaction with EP300, the assiociation of MYOD1, EP300 and DDX5 to the MYOG promoter, leading to inhibition of cell-cycle progression and myogenic differentiation promotion . Negatively regulates beta cell proliferation via inhibition of cell-cycle regulatory genes expression through the suppression of their promoter activities . Also required for LHB expression and ovarian maturation . Exacerbates CNS inflammation and demyelination upon cuprizone treatment . PTM: Phosphorylated. Phosphorylation promotes DNA-binding activity. Sequence Mass (Da): 8901 Sequence Length: 80 Subcellular Location: Nucleus
O54842
MATLPPTAHTSQQPVNIEDEDGILDEYDQYSLAQSYVVGGGRKGRTKREAAANTNRPSPGGHERKLLTKFQNSERKKAWR
Function: Transcription regulator that converts stress signals into a program of gene expression that empowers cells with resistance to the stress induced by a change in their microenvironment. Thereby participates in regulation of many process namely cell-cycle, apoptosis, autophagy and DNA repair responses . Controls cell cycle progression and protects cells from genotoxic stress induced by doxorubicin through the complex formation with TP53 and EP300 that binds CDKN1A promoter leading to transcriptional induction of CDKN1A (By similarity). Protects pancreatic cancer cells from stress-induced cell death by binding the RELB promoter and activating its transcription, leading to IER3 transactivation (By similarity). Negatively regulates apoptosis through interaction with PTMA (By similarity). Inhibits autophagy-induced apoptosis in cardiac cells through FOXO3 interaction, inducing cytoplasmic translocation of FOXO3 thereby preventing the FOXO3 association with the pro-autophagic BNIP3 promoter . Inhibits cell growth and facilitates programmed cell death by apoptosis after adriamycin-induced DNA damage through transactivation of TP53 (By similarity). Regulates methamphetamine-induced apoptosis and autophagy through DDIT3-mediated endoplasmic reticulum stress pathway . Participates in DNA repair following gamma-irradiation by facilitating DNA access of the transcription machinery through interaction with MSL1 leading to inhibition of histone H4' Lys-16' acetylation (H4K16ac) (By similarity). Coactivator of PAX2 transcription factor activity, both by recruiting the EP300 cofactor to increase PAX2 transcription factor activity and by binding PAXIP1 to suppress PAXIP1-induced inhibition on PAX2 (By similarity). Positively regulates cell cycle progression through interaction with COPS5 inducing cytoplasmic translocation of CDKN1B leading to the CDKN1B degradation (By similarity). Coordinates, through its interaction with EP300, the assiociation of MYOD1, EP300 and DDX5 to the MYOG promoter, leading to inhibition of cell-cycle progression and myogenic differentiation promotion (By similarity). Negatively regulates beta cell proliferation via inhibition of cell-cycle regulatory genes expression through the suppression of their promoter activities (By similarity). Also required for LHB expression and ovarian maturation (By similarity). Exacerbates CNS inflammation and demyelination upon cuprizone treatment (By similarity). PTM: Phosphorylated. Phosphorylation promotes DNA-binding activity. Sequence Mass (Da): 8955 Sequence Length: 80 Subcellular Location: Nucleus
Q759K4
MPKHHTFATKLEDLVLTSMSFRMSKHQAHPIEPEDVIREESEDFYSDEEEYKETWSRWALQLLSSSPYDLYLIVNENFESINWDLKAKTLARPLGGTMTFLFFTVRLLQDNVIKPNYHKINRTTDGFDFSRSATLREYDYFSKYQHGASWSSANWRVNSLSILDTLLKCLYILLLVSNSVLTYKFLFGYFLKYSLFHSAQPPASNNLTKKSLHDLAYRSATDVSRGSLWTLIRYTFFQRGRVQEEKPTDEFYYEIKKWCPSSFLTALFASFPPISVWFMAFSDITFVSLLPVILTQYLFWYVIFDCYEDRIKDELAIFKGMAAEYNNKVMKPKLSAQTQDAMVDATMYGQEFVQFYPSYSTARSGVFITHSLCGDVIKEKYNQRTKAFEDIPTGSHSQNIIRYSRNERLYHSVFPQNPLKKINGAAMSVNPMSFNRSPTYGGRYGTPPSRSHGSGQTYSSTSAPTSPMLKNRRAIPTDHSTGGNISGGNYVEYTSNDVHGEPPRRHSTSPLKRDITSSAGREDNHLAFGVNSPNIRSRTVDVKKNLHTHTTVVCPKSDLDTSQLSSKQSSISPFKLSRRGSIESRPPFR
Function: Member of a perinuclear network that controls recombination at multiple loci to maintain genome stability. Required for rDNA repeat stability (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 67521 Sequence Length: 589 Subcellular Location: Nucleus membrane
Q6FL09
MFSWLIPDIPELFLTISVWFRLQGWEDNTKLGFIIGNTLTTIFYILRLAQDTLLAGVSRKLIRDYELFDLSKSETLLSDPAFSSYHDVLFNKHHSTANASSYNKRVRKVTSTVYWSTYFLLLLSCYTCYRLFNTYKVYRIYYLKDLNLDKHPSLKKIEPDYEVDEKLLKTSLKSKLLSRFIRLLQLQDEVETELPKVTEHYTLNKWDPSKLIISLSTSFSPTIIICLMYTNVTFLTVIPIIIHQGIFYFMIWNRYEERFKDDALLMRENYLQYDTKYVKPLKQIMYQDVMTDTATISDGGFTKFFPVSKSTLFKHHEMSGDVIIERYNKKSREFENVTDIIKPHHHINNTVKILPPTIRKDHKTNRYDHRQQSILKDRKFNIDSNEPQIINALTTAIPSRSFFNNNPSGSNDDNCSGIKVRSSPTRETFFPATPLRKK
Function: Member of a perinuclear network that controls recombination at multiple loci to maintain genome stability. Required for rDNA repeat stability (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51561 Sequence Length: 438 Subcellular Location: Nucleus membrane