ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
A8ERZ9
MKINIYAILKPTADNFDQIIKEFIKMSSKYAKVEVHYIFNKNIAKAQTIGEKESQLAYSQTYEPLLKGYNIALDVLGKRVDTYAFSSLIDNKNEVNFFIGGAYGFQREFLNKCDSVISLSDLTMAHKVANVVLTEQIFRSLCIQNNHPYHK
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17296 Sequence Length: 151 Subcellular Location: Cytoplasm EC: 2.1.1.177
A7H6X6
MRLRVVAVGRDRSGLYAPAIEEYAKRLGRYVKFELVEVPEARKHAGTAQARDEEAEALLAKLGPRERVIALDERGAEWTSVAFAERVRRWTEGGRDVALVIGGSDGLSRAVLDRAEETLALSRMTLAHRLARLVLVEQLYRAMTILRGEPYHK
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17194 Sequence Length: 153 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q7NKY9
MRIKLVAVGRLREEAYERACAEYARRLAAYARLELVEVRDARIADSRAGLLKEGQALLDQLHPGEHAVLLDSGGKQFTSVELADWLENHTVQEPVFIVGSSHGVAPMVRERAQMVWSLSKLTFPHELARVIVLEQLYRAVTILAGHPYHHG
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 16944 Sequence Length: 151 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q5FRS9
MKLVAIGRLKAGPERELFERYAGRIRPALTVTELAPSKGSVQEQKRQDAAALLGACPDNALIVALDEGGKTPDSLRLAEMLSRWQESGRPIHFLIGGAEGLDSSVIQRADSVISLGKLTWPHMLVRVLIAEQVFRAQAINTGHPYHRESRPD
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 16658 Sequence Length: 152 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q0BRE3
MTAPWRIIAVGRMRGSEEEALFQRYAARLRPALTVTEIAEARGSTAEIRRRETSALLAALPPACIVVAMDLGGRAHDSEALATLARRWREQPLPVCFMIGGAEGLEQPVLDRADHVLSLGPMTWPHLLVRPLLAEQLYRAQAIATNHPYHRTGRPSG
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17307 Sequence Length: 157 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q2SA30
MRIKLIAVGGKMPGWVEQGYNEYVKRMPRDMPLQLIEIPMPRRQKNADPHKLKIQEGESILQSLGSGDHVVALEVEGKSWSTPQLSQQMERWRMSGQDVALLVGGPDGLSDACRARANQQWSLSPLTLPHPLVRVLLAEQLYRAWTILQGHPYHRE
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17724 Sequence Length: 156 Subcellular Location: Cytoplasm EC: 2.1.1.177
A1WYZ1
MRIHLVAVGHKPPRWVRDGHETYAQRLGKGWRLELHEVGAGGRGNDDPQAREREGERLLRALPSRAVCVALDEGGTPRDTRQWARSLERWSHEGGEVAFIIGGADGLSDAVRQRADACWSLSPLTLPHMLVRVLVAEQVYRAWTLLSGHPYHRS
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17282 Sequence Length: 154 Subcellular Location: Cytoplasm EC: 2.1.1.177
B8CZR7
MKINIMAVGKIKEDYINAGIKEFLKRLKPYTEVNVIEVDDERIPPNASGAQIEKVKEKEGERLLKNVPKNSYVIVLDVKGKPMTSEGLAKSIQNLQLQGYSNITFIIGGALGLSQKVLDTGDYILSFSHMTFTHQMIRLILLEQLYRAFKIIKGEPYHK
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 18008 Sequence Length: 159 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q7VGT3
MQINIYSIAKKDAKYQALLEELCMQCKQFGVEIKILNLLPQAVLKAQKISSAKAQQSYTQTFLPYIALPTALNLILHPTGHNYDSQSFAKLIESQHIVQFFIGGAFGFEESFVRLGKSVSLSAMTFNHKIAKLVLCEQIYRALSILHSHPYHK
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17286 Sequence Length: 153 Subcellular Location: Cytoplasm EC: 2.1.1.177
B0TA39
MLHIRIVAVGKLKEKYLKEGLREYIKRLGAYSRLEIIEVPDEKVPDKPSDTEAALIKRKEGDRLLAAAGDKDYIGVALDPRGEMWSTEDLADKMRRWELYGPNLVVFFIGGTLGLSKEVHAVCKAKWSLSRLTFPHQLVRLILLEQVYRGCKVNRGETYHR
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 18465 Sequence Length: 161 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q3IJ98
MKIQMIAVGTKMPAWVETGFTEYQRRFAKDMTLELIEIPAGKRGKNADIKRILHIEGEKTLAAIPKGNRIVTLEVTGKPLDTHELAKNMEKWQLDGRDVSLLIGGPEGLAPECIAASEQKWSLSNLTLPHPLVRIIVAESLYRGWSLNNNHPYHRE
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17562 Sequence Length: 156 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q1QDN7
MKVRILTVGNKMPKWVQTGFDEYHKRIQPMLTTEVVEIAAAKRAKNPSDANLAQYREQEGQAILAAHAVAGREQLWVLDVKGKMLSTENLADKLSDGMQQGDDIALVIGGADGVSPEVLAKADVKWSLSALTLPHPLVRVVLMEQLYRAMSINHNHPYHRGN
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17933 Sequence Length: 162 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q92LB0
MRIGLFAVGRLKAGPEKDLAGRYLDRFAKAGPAVGLELARVVETAESRAANAETRKREEAGQLEKALADGSLLVLLDERGKALDSEAFARLLGTLRDSGKRDLMIAIGGADGLDPALHARADAVLNLGKMTWPHQLVRILIAEQLYRAVTILSGHPYHRA
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 17274 Sequence Length: 160 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q5NLX2
MKIHIIARGRIGRSPEGELVERYMKRLSWPYRITELPDRASNAPLPPAPPHSITVAMDEKGKTWRSMEFAQKIGNWQDEGRSEIRFLIGAADGLREEERAAADMYFAFGAATWPHMLARAMLAEQLWRASAILSGHPYHREG
Function: Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA. Catalytic Activity: pseudouridine(1915) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(3)-methylpseudouridine(1915) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 16157 Sequence Length: 142 Subcellular Location: Cytoplasm EC: 2.1.1.177
Q8EFW4
MLNFFAAAPKGFEYSLAQELTEFGATEIKESVAGVYFTAPLTLAYRITLWTRLASRIVLVIYKGPCESAEQLYNAAYCIDWSAHFSNRNTFSIDFHGTGGFINNTQFGALKIKDAIVDRFRDDGDARPNVARIDADIKVDAHFRNGVITIAMNFSGPSLHQRGYRSTTGEAPLKENLAANMLVRSGWKAAPTTLLDPFCGSGTVLIEAALMAADIAPGLQRNRFGFEHWRRHDKATWHEIVEEAKARASLGVKRCEVKFYGSDIDSRLVALAKRNAQNAGVLELIEFNVANALNVEPPAAEGYLITNPPYGERLGSVSELLQLYYQLGDKFKKEFGGWKVAMLCSDIELISALKLKADKQMKMFNGALECAFNLYTLHAQSTRRDTPVLPEGVDIADIAPAFANRIKKNAKQFEKWAQKEGIDSYRLYDADIPEYNVAVDKYLDYVVVQEYMAPASIPEAVTKRRLSDVLLALPAAIGVDPHKIIMKTRERQKGTNQYQKLDERKLELITTEYGAKFKLNLTGYLDTGLFLDHRLTRRLVGQKSKGRRVLNLFSYTGSASVHAALGGAKSVTTVDMSNTYLAWAKENFALNNLSGKQYEFVQADCLQWIRDCNEQYDLIFIDPPTFSNSKRMEDSFDVQRDHVNLLGMLIKLLSPNGELVFSNNKRKFKMDTETLTKMKIKVQNIDDMTLPLDYKRNPHIHNTWLITHADK
Function: Specifically methylates the guanine in position 2445 (m2G2445) and the guanine in position 2069 (m7G2069) of 23S rRNA. Catalytic Activity: guanosine(2445) in 23S rRNA + S-adenosyl-L-methionine = H(+) + N(2)-methylguanosine(2445) in 23S rRNA + S-adenosyl-L-homocysteine Sequence Mass (Da): 80049 Sequence Length: 711 Subcellular Location: Cytoplasm
B1ZQZ5
MRPSLAELSVDDLASVLAQWGYKRSHAGRVLREYYARCGELTEAGRPWPAGLLERLRIEFAPGGTALAARQVAADGTTKLLLRLADGRTVEAVLMPDYRADRAAGCLSSQVGCAMGCDFCATAQSGFERNLTAGEMVEQFLALRREAASAGRKLQTVVFMGMGEPLLNLDAVLTAVRRIADNTYGGLGWRQVTVSTVGLVPGIDALTAADLGINLAVSLHAPDDATRAALLPAGRRFAIADILAAVDRFQASRGRPVIIQYCLLKGVNDSAAHARMLAAVIGSRRMHVNLLHYNPTGLSLRGVRYEPSGDEAAAQFLAELRARGVVTHLRRSRGPDIDAACGQLRAKRGELSVQS
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 37988 Sequence Length: 355 Subcellular Location: Cytoplasm EC: 2.1.1.192
Q6MED6
MKIPPISILSHTSESYANAISHELGKGFQHAKLVYQEWFRRGNISGLNPAFKNAQALLQNILSLTDFSFLPISQNLTDGQTGKFLIKTIDDLDIKSVLIPMQAGGTLCISSQIGCQMGCAFCETGRMGLLRNLTTQEILSQLFIAKFRLHFSVRNIVFMGMGEPFDNYDTVMHAFRILTDSHGFGLGNNRITISTSGCLEGIYRLLQETTPLPNLAVSLNAPNDELRNKLMPINKKYPLKELYQAIYDFCKQTSKQVLIAYVLIKEQNDSIEHAKQLTNFLSGLNVKINLIPYNPQSRDRFQSPEQSTLENFTSYLREKGFYTLLRQTKGQKIMAACGQLGNLELKRKKPFILPILKE
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 40409 Sequence Length: 358 Subcellular Location: Cytoplasm EC: 2.1.1.192
B1ZVM5
MRFLTGNVVVRARGADFFVAIDARSAGGADAWLALTNGAPLLRRFTLSPSAPTNLYDFTRAELRLWLSRRELNPVHAARIWSYLYLDLVEGFGAMTELPARVRARLEAEMCVGNLKIARETDSRDGFTRKYLLELADGAAIETVLMRFAGRATACVSSQVGCAMGCVFCATGQMGYTRHLTAGEIVAQAVHVARALRTAAFEKCHVMRDPSPGREAGEKSRDEADRHRAPPTPRLRNLVLMGMGEPLHNYEAVMRAVDILRDDGGLALGAERITLSTVGVVPGILRLAAEKRPVHLAVSLHAADQEERAALVPVAKKWPLDELMAACRTYSETTGRRVFYEWTLIEGRNDTAAHARAVGRLLRGLPAQVNLIPLNPTAGYDGTPGRTEAARRFQEILSREFALPSTVRQRRGIDIAAGCGQLAVAEQS
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 46782 Sequence Length: 428 Subcellular Location: Cytoplasm EC: 2.1.1.192
Q6MDD0
MDYADFDHQKLVEWLKAHGEKEFHAKQILSWIYQKGVLSWDKMSNLSQSLREKLAKHIRLPVLELVRYTESIDQETIKFLWRLRDGNLVESVLILSGIRRTVCVSSQVGCPAKCAFCASGQQGFFRNLRPTEIIEQILQINAWLSSKGEKVSHVVYMGMGEPLKNYESVVASIRVLSHPDFCNISQRRITVSTVGVVEGIKRLSKEGLKVNLVLSLHAPNQHIRKKIIPYARKYPLEEILESMDEYAQKTKRDITFEYTLLAGINDHPDHAHELAHLLKGKQCTVNLIPYNPIPGLRLKRPEKKAIKQFRSVLYGSHIVNTCRYTKGDDIGAACGQLALQEREGQTGLPMLKEVAFGS
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 40702 Sequence Length: 358 Subcellular Location: Cytoplasm EC: 2.1.1.192
A3DCX9
MDAKADLLSMTIEELENLMAEMGEQKFRAKQIFQWTNKGIKDIDAMTNLSKDLREKLKERAYINRLEVIKKFVSKIDGTIKYLFKLNDGNIIESVLMQYLHGYSACISSQVGCKMGCKFCASTGVGFVRNLTPGEMLDQILTIQNDTKNRIGNVVIMGIGEPLDNYENVVKFLRLVNHKDGINLGARHISVSTCGLVPEILRLAEEKIPVTLSISLHAPNDEIREKIMPINKRYSIDKIIEACKIYTETTNRRITFEYAMIDGLNDSKENALELAKRIRGMLCHVNLIPVNTVSDTGFKRSSREKITAFKEILERFGVETTVRRELGSDINAACGQLRRNLVENGQLVY
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 39515 Sequence Length: 349 Subcellular Location: Cytoplasm EC: 2.1.1.192
B1H070
MQLLKQNYKKYILDLNDAQFNRAVKPIIEQDYRINQIIEWIYAKKAVSFESFTNIPKELRNKLDEKFFLRTLKIVKKEKSLIDSTIRYTFRTADKKYFFAVFLPANGKNSVCISSQIGCPIMCAFCSSGKTKLARNLSRGEIIEQILQVENDTKEKISGILFMGMGEPMLNFNNLISVLNSLLSSKEFGIGKRHITVSSVGIVPAVKKLADDNFGVRLALSLHAVDERQRKKLVPDNLGFSIEDILKAGKYYLKKTNSHLTIEYVLVKGINISSADAHKLARLLKRCDLINSDVQVNLIPFNPVTDVQFQRPDKKSINKFKSILKLNGITVNVRQSKGANINAACGQLGY
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 39572 Sequence Length: 350 Subcellular Location: Cytoplasm EC: 2.1.1.192
B0S143
MQNKIILENMTVDELKEFFVNNGEKPFRALQYFQAIHKNRIFNPDEMTNFSNSLRGKLNQYNDIKNCSIIKRIDSKLDNTKKYLIEMSDGNIVETVFMQYKTHTSICLSTQIGCKMGCKFCASTKKSFVRNLQPYEMCAQIYLVENDLDIRINNIVLMGIGEPLDNYDNVSRFIDLITDKDGQDMSIRNITLSTCGLVDKIIRLANDDIGINITISLHNPFDNERNKLMPIGNKYSIEEILDACDYYFKKTKRRIGFEYTVIENVNDSKKYMDKLVSLLKNRNCLLNLITLNPIEEFNQKSPDRYKMTEFMEYMNKNNVNTTIRRKQGIDIDGACGQLRINNMTKRGVK
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 40597 Sequence Length: 349 Subcellular Location: Cytoplasm EC: 2.1.1.192
A6H1B8
MQIEKKDIRALSKDQLRDFFVINKDKAFRGNQVYEWLWSKGAHSFEDMTNVSKGTRQMLVENFVINHIKVDTMQRSSDGTVKNAVRLHDGLIVESVLIPTETRTTACVSSQVGCSLDCNFCATARLKRMRNLEPGEIYDQVLAIDRESKLYFNRPLSNIVFMGMGEPLMNYNNVIKAIDMITSSEGLGMSPKRITVSTSGVSKMIKKMADDEVKFKLAVSLHSAVEEIRNKIMPFTKSFPLPELREALQYWYHKTKSKITYEYVVWKGINDNKESVDALVKFCKHVPCKVNLIEYNPIDDGEFQQASPESINAYIKALEANGIIAKVRHSRGKDIDAACGQLANKEI
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 39359 Sequence Length: 347 Subcellular Location: Cytoplasm EC: 2.1.1.192
Q0RDQ8
MTAESDSPDGPVSAGTGRPVRLSLTRRAARPARHLADLSRDERRQVAVALGQPAFRADQVSRHYFARLVDADETDAMTDLPENARGPLLEALLPRLLVPARTLSCDDGLTRKTAWRTADGALLESVIMRYPDRATVCVSSQAGCGMGCPFCATGQGGLTRNLSTAEIVEQVVHAARVLRRQELAGGQGRLSNVVFMGMGEPLANYTAVTAALRRLIAPSPEGLGLSARGLTVSTVGLVPAMRRLAGEGLPVTLAVSLHAPDDELRDELVPINTRWPVAEVLAAAWEYAEVTGRRVSIEYALIDGVNDDVARADALATLLAGRLAHVNLIPLNPTEGSSWQASAPAGQRAFVRRLRERGIATTVRDTRGREIAAACGQLAAEPAGRARRVESARPVESARPVGVAGAASGSPAHGSRVLR
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 44374 Sequence Length: 419 Subcellular Location: Cytoplasm EC: 2.1.1.192
A8M6B6
MTSLPLTPVNLDAPARRAAMPPRHLADLDLAGRQALVAELGEPRFRARQVSTHYFGRLVRDSGQMTDLPAAAREKLTDRLLPTLLTPVRELTCDDGATHKALWRLHDGSLVESVLMGYPDRVTACLSSQAGCGMACPFCATGQAGLTRNLSTAEIVDQAVYLAGVAASGAVAGSPPRLSRVVFMGMGEPLANYNRVVAAIRRLVAPAPEGLGLSQRHVTVSTVGLVPAIRRLASEDLSVTLALSLHAPDDGLRDELVPVNQRWKVSEVLETAWEYAARTGRRVSIEYAMIKDVNDQPWRADLLGRLLAGKLAHVNLIPLNPTPGSRWDASPKPVEREFVRRLRDAGVSTTVRDTRGREIDGACGQLAAAEGDEIVGPGAP
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 40812 Sequence Length: 380 Subcellular Location: Cytoplasm EC: 2.1.1.192
Q2S0P9
MPDVKTASHTVGTAEDRVDLKTMGRAGLKDFVAEHGAPRYRGDQLFNWVYGKGVSDFDRMSNLPKRMRRGLQRDATVEDIEIVEQQQAADRTVKALFELPSGREAETVLIPAIDERGEARRLTVCVSSEVGCAMGCEFCATGRMGFRENLTPGAIFDQVWHMNEVAQEHFGRPVTNIVFMGMGEPLLNYDAVLDSISILTDEDSLNLSAQKITVSTVGLARRIKDLADDQLRTNLAVSLHAPDNETRSRIMPVNEAEKTSLPALKEALQYYFDKTGRQITYEYCLFKGVNDSETDARNLADVTRWAPSKVNLLMYNPVEGLNFERTSEAQLDRFVQVLVQEGVTVTVRRSRGQDIDAACGQLANEGEDA
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 41087 Sequence Length: 369 Subcellular Location: Cytoplasm EC: 2.1.1.192
A4X4J7
MTSLPLTPVNPDAPARRAAMPPRHLADFDLAGRQTLVTELGEPRFRARQVSTHYFGRLVRDPEQMTDLPAATREKLADQLLPTLLTPVRELACDDGATHKALWRLHDGSLVESVLMGYPDRVTVCLSSQAGCGMACPFCATGQAGLTRNLSTAEIVDQAVYLAGVAASGAVAGSPPRLSRVVFMGMGEPLANYNRVVAAIRRLVAPSPEGLGLSQRHITVSTVGLVPAIRRLASEDLSVTLALSLHAPDDELRDELVPVNQRWKVSEVLEAAWEYAARTGRRVSIEYAMIKDVNDQPWRADLLGRLLADRLAHVNLIPLNPTPGSRWDASPKPVEREFVRRLRAAGVSTTVRDTRGREIDGACGQLAAAEGP
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 40317 Sequence Length: 372 Subcellular Location: Cytoplasm EC: 2.1.1.192
A7ICB3
MMSTPETATEATAPEAAPAPSLGADAPAPLPSLIGLDRDKLGAALDAIGVRGSDRRMRVNQLWHWIYLRGATDFAEMTNVSKHLRADLAAAYSLARPEIVMEQVSQDGTRKWLLRFPADHPGERPHDIETVYIPESDRGTLCVSSQVGCTLNCSFCHTGTQRLVRNLTAAEIVAQVMVARDRLGDYPGRDRATGPGLPTEGDRLVTNIVFMGMGEPLYAYDSVKEAIETLSDGDGLGLGKRRITVSTSGVVPEIERLGAEVGPMLAISLHAVRDKLRDELVPINKKYPIAELMEACRTYPAASNAKRITFEYVMLKGVNDSPADARALVKLLEGVPAKINLIPFNPWPGTQYECSDWETIERFSDIVFRAGYASPVRTPRGRDILAACGQLKSESEKLSARERLALRAMMAQDE
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. m2A2503 modification seems to play a crucial role in the proofreading step occurring at the peptidyl transferase center and thus would serve to optimize ribosomal fidelity. Catalytic Activity: adenosine(2503) in 23S rRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2-methyladenosine(2503) in 23S rRNA + 5'-deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S-adenosyl-L-homocysteine Sequence Mass (Da): 45275 Sequence Length: 414 Subcellular Location: Cytoplasm EC: 2.1.1.192
P0CU92
MRASTILFVLGAAILAVIGVTTALDSGEIDKSTQENHRLLRSGSMEQEPDEERKFIKVPSFMNKAAREAKKAKKKAEIANLVWLKLQKYSDSYALNYVDDMVKSGRSADDEIKFLKKHMKVSNNLQRVIEGHFRSHAELGRVLAKPKYK
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 16864 Sequence Length: 149 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
P0CV09
MRLYTQVVAASLVATLAIVDSKVSNAIAGQGNNLRFLRQDNATVARVSEDGERGGLLADEKDIMAIADHLIRLNYSLSYARKVLGKFANYEYAIAKVEEKIKKRTVSYMFLDEKFLTQEEAEGKFIEWILEGKTQEQLEREFDIFTRPESKRAKKIQEVNKFAIRAYLDWLRNLRARSFRMTMMEYTNPSNAFATFDRHGHSRNKILSMFDAWVAKGTLLDVVKDRLGFNKPMKPADMFHSDNFVAYATYAQMLREKNNSLRPPRLDSVSTPSN
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 31528 Sequence Length: 274 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
P0CV10
MLGFVTGVLAISAHVIVSQPNEHSPVVVARETYGLRDVIFRRLRSYETDTASARAEEGTSDIEERSDHEIPPDFYKRLASTSTPYVANLSHKAQIAAQALRKDAERSKGALELLKKYAELEGKMDAPKEEKNHVDRLKAAAFKEWNEKGLNLDQVRVLFADNKRRTSKYENLIEKIVGEYEKS
Function: Secreted effector that dos not suppress the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 20718 Sequence Length: 183 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
P0CV11
MKVTMALAALCVALQAPCIGSESTPSNLNNRHLRHEHDSNTPLQRRDEALVPAHRVYDPVSGLACSLVGKCMVCPTSEKDESYCRETGYRQELDCPRVEDDVVHTKSVNQRTTRFRPCSFAEPARPGVAFVKFEVGNLRTLLQKL
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 16183 Sequence Length: 145 Domain: Has the canonical translocation RxLR motif, but lacks the canonical EER motif, which characterizes most oomycete effectors identified so far. Subcellular Location: Secreted
P0CV12
MSIFIFISLVLGLAHQHKRSSIIVRLYSKDGFQKCSLTIRAVSAYALACKLQLEHRPLRAQRLRQIRLAQKSRVFPFIFYQCPHKKKSARIHALTFTKEAELSKLSIETLRCIHLQLISCTRSPVVTNSSY
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 15100 Sequence Length: 131 Domain: Has the canonical translocation RxLR motif, but lacks the canonical EER motif, which characterizes most oomycete effectors identified so far. Subcellular Location: Secreted
P0CV13
MICLLPLIAVMLFVFATHTVLALEIATGIDAPETEFSASTQTTRVSFRRITSVDNKRFLRQETTFEEKPSVNDVHAEERSSFYRKFLYRLFGDRMDVEAKVLARDSNWLINIFRRKFLRWAGREEHPHKATTFDTTCCQVAPYDPVTSS
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 17270 Sequence Length: 149 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
P0CV14
MCCVSWNWVLACTFLLIFLSWWNCCNDRISVNSGVPGMAARVAGAHHVVLTEQDELLRLLRVNLAANAEVLTHEIEEEKGGIVARPLSWGIEHTKEYLARYGDEKIDVILSCDCIYEPLYGTSWKGLAQTMELLCLANPKSVVLLAVERRNEDGIDKFLAFVEKETMLLYRRDEVTVGSSKNRLEVYHLHLENILKN
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 22408 Sequence Length: 197 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
A0A182BSS2
MIRRSPLVAVILFVAITHVVLALDDATRIDSSEIVPSEPTRRTRVSPHYISSGGSKRSLRQQAFRPVAYLKNKLNWFLSRFFGTPTDAFTQMNSPRSSRIANIFRKIYMHTAKDDEYFSRLRSV
Function: Effector that acts as a broad suppressor of cell death to interrupt plant immunity. Inhibits cell death induced by cell death-inducing proteins, including the PAMP elicitor INF1 from P.infestans. Sequence Mass (Da): 14276 Sequence Length: 124 Domain: Has a conserved RxLR motif that acts to carry the protein into the host cell cytoplasm. Lacks the 'so-called' EER motif, which is found closely behind the RxLR motif in most of RxLR effector family members, but the presence of an EER motif is not always essential for the translocation of every RxLR effector into host cells, or for inducing a hypersensitive response. Subcellular Location: Secreted
P0CV15
MRSSTVLYVLGAAILAVNGVTTALISDGVDKGSQEQTRWLRSNAMEHETDDEERVLEFKLPSSISTWRAERFERLESLEKQKEMERQAVLELVDKYAPLLLTDRMFAGFTKLDQEGIPLPSMIALLREHGKDITSEMEAYLINSYKTTHKIPLELNTAR
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 18115 Sequence Length: 159 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
P0CV16
MRSSTILFVLGVAMVAVNGVTTALISDGTGKGTQGKHRLLRSNSGKHKTDEERLKLSARIYGTKAYKKRQVRNRESARKFQKALLNMADGNDIARLLKKRNTTLKGLFALLARNKAGLPKEAKNHITTVYNTRRGGVL
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 15248 Sequence Length: 138 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
P0CV17
MIFTLLGLALVATKSACIAHVFILQLGALDMEALATPLAKVIATSARALHTRSLRASERDKCTNLTARSTRALLAHGPRLRHAVQQQAVAALFTIAVARRRRTA
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 11197 Sequence Length: 104 Domain: Has the canonical translocation RxLR motif, but lacks the canonical EER motif, which characterizes most oomycete effectors identified so far. Subcellular Location: Secreted
A0A182BSS3
MAASRSSITTLLLLIVAVALGYGILPISAKTSVARQLREQVDFVDAAALSESATSSSSSSALDHKSSAPGEATNASETEHSAASTASEPKHEGPTMMSFVGPAAAGVLAILLIGAVIAFKKRMNK
Function: Effector that acts as a broad suppressor of cell death to interrupt plant immunity. Inhibits cell death induced by cell death-inducing proteins, including the PAMP elicitor INF1 from P.infestans. Location Topology: Single-pass membrane protein Sequence Mass (Da): 12700 Sequence Length: 125 Domain: Has a conserved RxLR motif that acts to carry the protein into the host cell cytoplasm. Lacks the 'so-called' EER motif, which is found closely behind the RxLR motif in most of RxLR effector family members, but the presence of an EER motif is not always essential for the translocation of every RxLR effector into host cells, or for inducing a hypersensitive response. Subcellular Location: Secreted
P0CV18
MHRKRLRVVLSATLLDLITCVQLMLDPLVRSHVIARLVRWRHHRLLLAELVLSETRVRILRLALEQGALESGAMSSRALARIVIPRSSSRPNWKLSRVVSELSDNSKTNVYKNQLFIHCARYLLHVLP
Function: Secreted effector that completely suppresses the host cell death induced by cell death-inducing proteins. Sequence Mass (Da): 14762 Sequence Length: 128 Domain: Has the canonical translocation RxLR motif, but lacks the canonical EER motif, which characterizes most oomycete effectors identified so far. Subcellular Location: Secreted
A0A182BSS4
MAFQLRIVQHLLHITFLRLPLAYPSQIHQRENERMFLLRIHRQDVQHLSHRRLRQLNEHRSLLPKGFPFKLLRPLPQLQRLLSQVCRGSVRIDACCCIPSCH
Function: Effector that partially suppresses the tobacco programmed cell death induced by cell death-inducing proteins. Sequence Mass (Da): 12219 Sequence Length: 102 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
A0A172M490
MQRFPYSLLLLLLSATNRSRRHHITRPGRSIHWCLVRPTRPNRMLRAIRTCGARYWRNWPLNWPRKAGLTRRSSARIGLSDALRPCPTLFGCFKRRYARQAMSCYCRTEWRVNWLKKKRRGSSRWRRESSVWRCWK
Function: Effector that partially suppresses the tobacco programmed cell death induced by cell death-inducing proteins. Sequence Mass (Da): 16589 Sequence Length: 136 Domain: Has a conserved RxLR motif that acts to carry the protein into the host cell cytoplasm. Lacks the 'so-called' EER motif, which is found closely behind the RxLR motif in most of RxLR effector family members, but the presence of an EER motif is not always essential for the translocation of every RxLR effector into host cells, or for inducing a hypersensitive response. Subcellular Location: Secreted
A0A182BSS5
MMSPPMTTTLMFILNYAIISFHGQPSGISWGNHIETAEAAAILAMANRELRSRELLLWTSGSTHLLLQPILPLPLCLPFPLVPASIFKKMMLPLSAFSFWM
Function: Effector that acts as a broad suppressor of cell death to interrupt plant immunity. Inhibits cell death induced by cell death-inducing proteins, including the PAMP elicitor INF1 from P.infestans. Location Topology: Single-pass membrane protein Sequence Mass (Da): 11272 Sequence Length: 101 Domain: Has a conserved RxLR motif that acts to carry the protein into the host cell cytoplasm. Lacks the 'so-called' EER motif, which is found closely behind the RxLR motif in most of RxLR effector family members, but the presence of an EER motif is not always essential for the translocation of every RxLR effector into host cells, or for inducing a hypersensitive response. Subcellular Location: Secreted
A0A172M476
MHLRLLMSTVITATLIVSNNALTSPSDKTKTRALRGASTVGIAADNLLAAHFSPTLKHKESRGDYNNIQTERHRKRRLYDAPHHPEFYDIAVHQVPSDKSYGGGPAIAIFAGVAATFILIDYLIRHFTEN
Function: Effector that acts as a broad suppressor of cell death to interrupt plant immunity. Inhibits cell death induced by cell death-inducing proteins, including the PAMP elicitor INF1 from P.infestans. Location Topology: Single-pass membrane protein Sequence Mass (Da): 14395 Sequence Length: 130 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
A0A172M477
MRLYILVLAAIAVTLVFASSGPAITYHEVGTRALRQASITDEKSDDSLNAQAPPLSKSEKRLSRSFRTTSRRLPYTNYYHPQYYHPQNYHPHYNYPQYHSSPHVYVHQESKKSWFVRMILEAGIFWAVFHCLSAAFC
Function: Effector that partially suppresses the tobacco programmed cell death induced by cell death-inducing proteins. Location Topology: Single-pass membrane protein Sequence Mass (Da): 15897 Sequence Length: 137 Domain: The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate. Subcellular Location: Secreted
A0A172M4N1
MRCVCASIRRTRIIEFLMFFALSSSTASCAPFSVSNVTHASPRPRWLRWHEKTSMAGNPVSLSIATPNGAKSSSICSANTVGFTPDTYTCPDIRDSSTDTLSRSKRISSLSLTKPISSSSESETKVLSAS
Function: Effector that acts as a broad suppressor of cell death to interrupt plant immunity. Inhibits cell death induced by cell death-inducing proteins, including the PAMP elicitor INF1 from P.infestans. Sequence Mass (Da): 14013 Sequence Length: 130 Domain: Has a conserved RxLR motif that acts to carry the protein into the host cell cytoplasm. Lacks the 'so-called' EER motif, which is found closely behind the RxLR motif in most of RxLR effector family members, but the presence of an EER motif is not always essential for the translocation of every RxLR effector into host cells, or for inducing a hypersensitive response. Subcellular Location: Secreted
A5PJU7
MAAPTDSLSVSGPTAVRLPRSPPIKVLAEQLRRDAEGGPGSWRLSRAAVGREPLELRAVWMQGTVVEAGGGVARLRDPSGSFSVRGLERVPRGRPCLVPGKYVMVMGVIQACSPEPCLQAVKMTDLSDNPLHESLWELEVEDLHRHIYSLDDVGTGD
Function: Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM. PTM: Phosphorylated during mitosis. Sequence Mass (Da): 16948 Sequence Length: 157 Subcellular Location: Nucleus
Q96E14
MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Function: Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM. PTM: Phosphorylated during mitosis. Sequence Mass (Da): 15865 Sequence Length: 147 Subcellular Location: Nucleus
Q8WU17
MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLFGVFASSIVLILSQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIGYVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLLFTSSLILTLNTVFVLAVKLKWFYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNLIISGCDSTLTVLGMSAVISSVAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLIRLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWLFAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYYVRSTGSIIEFIFGVVMFGNGAYTMMFESGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
Function: E3-ubiquitin ligase; acts as a negative regulator of cell proliferation through mechanisms involving G2/M arrest and cell death . Required for MHC class I ubiquitination in cells expressing the cytomegalovirus protein US2 before dislocation from the endoplasmic reticulum (ER) . Affects SREBP processing by hindering the SREBP-SCAP complex translocation from the ER to the Golgi, thereby reducing SREBF2 target gene expression . Involved in the sterol-accelerated degradation of HMGCR . This is achieved through binding of RNF139 to INSIG1 and/or INSIG2 at the ER membrane . In addition, interaction of RNF139 with AUP1 facilitates interaction of RNF139 with ubiquitin-conjugating enzyme UBE2G2 and ubiquitin ligase AMFR, leading to ubiquitination of HMGCR . The ubiquitinated HMGCR is then released from the ER into the cytosol for subsequent destruction . Required for INSIG1 ubiquitination . May be required for EIF3 complex ubiquitination . PTM: Autoubiquitinated. Ubiquitination is induced by sterol and leads to ist degradation via the ubiquitin-proteasome pathway. Location Topology: Multi-pass membrane protein Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 75994 Sequence Length: 664 Domain: The RING-type zinc finger domain mediates ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Endoplasmic reticulum membrane EC: 2.3.2.27
Q5RBT7
MAAVGPPQQQVRMAHRQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLLGIFVSSIVLILSQRSLFKFYMYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIGYVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLVFTSSLILTLNTVLVLAVKLKWFYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNLIISGCDSTLTVLGMSAVISSVAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLIRLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWLFAATAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDNYVYYVRSTGSIIVFIFGVVMFGNGAYTMMFESGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFTPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
Function: E3-ubiquitin ligase; acts as a negative regulator of cell proliferation through mechanisms involving G2/M arrest and cell death. Required for MHC class I ubiquitination in cells expressing the cytomegalovirus protein US2 before dislocation from the endoplasmic reticulum (ER). Affects SREBP processing by hindering the SREBP-SCAP complex translocation from the ER to the Golgi, thereby reducing SREBF2 target gene expression. Involved in the sterol-accelerated degradation of HMGCR. This is achieved through binding to INSIG1 and/or INSIG2 at the ER membrane. In addition, interaction of RNF139 with AUP1 facilitates interaction of RNF139 with ubiquitin-conjugating enzyme UBE2G2 and ubiquitin ligase AMFR, leading to ubiquitination of HMGCR. The ubiquitinated HMGCR is then released from the ER by the complex into the cytosol for subsequent destruction. Required for INSIG1 ubiquitination. May be required for EIF3 complex ubiquitination. PTM: Autoubiquitinated. Ubiquitination is induced by sterol and leads to ist degradation via the ubiquitin-proteasome pathway. Location Topology: Multi-pass membrane protein Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 75941 Sequence Length: 664 Domain: The RING-type zinc finger domain may be essential for ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Endoplasmic reticulum membrane EC: 2.3.2.27
Q8WVD5
MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHRP
Function: May be involved in spermatogenesis. Location Topology: Lipid-anchor Sequence Mass (Da): 25535 Sequence Length: 230 Subcellular Location: Membrane
Q95Y82
MEGVMENVGGLMQNIRRRHMSITEMTEESVRLGVAQMDTGFKKIKEMSIMVLETGLRLPGLLFIELLWRYQGFSFEDISDDMMKQTPLSYFDIPTMLDFVHRRNFDHHAAIILSYFVIFISLMFLTLPLSRLIRMYSHFLSVFLFGVAYKLSAIYVDLEMKTGEEELKLDGLIKLERHGFHFLAQMLLVVLQSMLLEVDGEPWRVALPVFALPIVARMCGCPMDKLKNAHNYACTGTMIFIATYMLYRAPSLIKSTKTALRQIKAVFMVHGLADGVAVLWRKLRILELLTFTWITMFLMVLYVELIDKGRTWSEVGRILLTGVAETTNTPITLAALAVSVSYVCKWIADLTKLITGGTRSHGHVLAHSGYTEAVSVVILCIQTGFLGMQVEQKTILLALVLYIVISALLQSLFEIIEVVLLNLPSSPTASRARHARCICIALLLVVIPFFTTKTMLALLPIDIYTAIIIANSATVTARAIGVILKYIVLIVETKSEEPWEGIDDLTYYIDCANKGIELLAAKVVMVFGCMQVVKVGFSFATFAILLFHVIVNIYKRLEHTVSFIKNRNAAVKNINRLSKADVVQLREREDVCAICFIEMKEEARITPCKHYFHGPCLRKWLAVKMVCPLCYTYMKEDDFDSKSSSSGTLNEVQQNEEGAAVEENPENPEEQPEAPNAERAPGDMFDWDDLFGFRAERETRNRNEQRIHGARDMWPLLVDNDAYESDSDAGSEELVIEEENNN
Function: E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate (By similarity). Acting downstream of probable Golgi transport protein eas-1, involved in inhibition of activation of transcription factor sbp-1, thereby playing a role in regulating AMsh glial cell size . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 83994 Sequence Length: 742 Subcellular Location: Membrane EC: 2.3.2.27
Q96MT1
MAAKEKLEAVLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLSNNPLFQYKYLALNMHYVGYILSVVLLTLPRQHLVQLYLYFLTALLLYAGHQISRDYVRSELEFAYEGPMYLEPLSMNRFTTALIGQLVVCTLCSCVMKTKQIWLFSAHMLPLLARLCLVPLETIVIINKFAMIFTGLEVLYFLGSNLLVPYNLAKSAYRELVQVVEVYGLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSYFSTRDQPASRERLLFLFLTSIAECCSTPYSLLGLVFTVSFVALGVLTLCKFYLQGYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVVASILQSMLEIADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQFFHMDFWLLIIISSSILTSLQVLGTLFIYVLFMVEEFRKEPVENMDDVIYYVNGTYRLLEFLVALCVVAYGVSETIFGEWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPIATKEQLEKHNDICAICYQDMKSAVITPCSHFFHAGCLKKWLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA
Function: E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'-linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species. Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations ubiquitinates HMGCR, a rate-limiting enzyme in cholesterol biosynthesis, and targets it for degradation. The interaction with INSIG1 is required for this function. In addition, triggers ubiquitination of SCAP, likely inhibiting its transport to the Golgi apparatus and the subsequent processing/maturation of SREBPF2, ultimately down-regulating cholesterol biosynthesis. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 75617 Sequence Length: 663 Subcellular Location: Endoplasmic reticulum membrane EC: 2.3.2.27
Q5SWK7
MAAKEKLEAVLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLNNNPLFQYKYLALNMHYVGYILSVVLLTLPRQHLVQLYLYFVTALLLYAGHQISRDYVRSELESAYEGPMYLEPLSMNRFTTALIGQLVVCTLCSCVMKTKQIWLFSAHMLPLLARLCLVPLETIVIINKFAMIFTGLEVLYFLGSNLLVPYNLAKSAYRELVQVVEVYGLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSYFSTRDQPASRERLLFLFLTSIAECCSTPYSLLGLVFTVSFVALGVLTLCKFYLQGYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVVASILQSMLEIADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQFFHMDFWLLIIISSSILTSLQVLGTLFIYVLFMVEEFRKEPVENMDDVIYYVNGTYRLLEFVVALCVVAYGVSETIFGEWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPVATQEQLEKHNDICAICYQDMKSAVITPCSHFFHAGCLKKWLYVQDTCPLCHCHLKNSSQLPGLGTEAAPQPPAGAEQNIVLQEGPEPPDHESPPGTGTQEGSGDSSEHINRGSASQEGAADAGEGPQIPEGEVCPVESA
Function: E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'-linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species . Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations ubiquitinates HMGCR, a rate-limiting enzyme in cholesterol biosynthesis, and targets it for degradation. The interaction with INSIG1 is required for this function . In addition, triggers ubiquitination of SCAP, likely inhibiting its transport to the Golgi apparatus and the subsequent processing/maturation of SREBPF2, ultimately down-regulating cholesterol biosynthesis . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 74648 Sequence Length: 663 Subcellular Location: Endoplasmic reticulum membrane EC: 2.3.2.27
Q7ZUK0
MASCGEVNLTVDSLTSGKKVSGEAVPEGSGSPSSPSLPVPECPICLQSCVHPVRLPCRHIFCFLCVKGASWHSKRCALCRREVPEDFLERPTLLSPEELKASATGGCGTGSSGHAWYYEGRNGWWQYDERTSRELEDAFSKGKKSAEMLIAGFLYVADLENMVQYRRNEHGRRRRMKRDVVDIPKKGVAGLRLDPDPNSSAGAVPAPAVVDVSVDGAAAERESSADGADTGVSGGRPQGTFVPAPIRPPTILGGHLTSPASSSDIQLVQTLAQLNISPNEQEPEEEDAEDEDDSAAPDASGYDSESGTSDDDEQVEDEDENEHTDGSQGKHRLQQLNRPPPGGGPANSGDRSGCPDGQCTVTKV
Function: E3 ubiquitin-protein ligase that specifically binds poly-ADP-ribosylated proteins and mediates their ubiquitination and subsequent degradation. May regulate many important biological processes, such as cell survival and DNA damage response. Acts as an activator of the Wnt signaling pathway by mediating the ubiquitination of poly-ADP-ribosylated proteins. Neuroprotective protein. Protects against cell death induced by DNA damaging agents and rescues cells from G1 arrest. Promotes cell survival after gamma-irradiation. Facilitates DNA repair. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 38786 Sequence Length: 364 Domain: The WWE domain mediates non-covalent poly(ADP-ribose)-binding. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.27
Q9NTX7
MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGASVQPLVSSVRPLTSVDGQLTSPATPSPDASTSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPAPDTSIEETESDASSDSEDVSAVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRPDGQCTVTEV
Function: E3 ubiquitin-protein ligase that specifically binds poly-ADP-ribosylated (PARsylated) proteins and mediates their ubiquitination and subsequent degradation . May regulate many important biological processes, such as cell survival and DNA damage response . Acts as an activator of the Wnt signaling pathway by mediating the ubiquitination of PARsylated AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex . Acts in cooperation with tankyrase proteins (TNKS and TNKS2), which mediate PARsylation of target proteins AXIN1, AXIN2, BLZF1, CASC3, TNKS and TNKS2 . Recognizes and binds tankyrase-dependent PARsylated proteins via its WWE domain and mediates their ubiquitination, leading to their degradation . Different ubiquitin linkage types have been observed: TNKS2 undergoes ubiquitination at 'Lys-48' and 'Lys-63', while AXIN1 is only ubiquitinated at 'Lys-48' . May regulate TNKS and TNKS2 subcellular location, preventing aggregation at a centrosomal location . Neuroprotective protein . Protects the brain against N-methyl-D-aspartate (NMDA) receptor-mediated glutamate excitotoxicity and ischemia, by interfering with PAR-induced cell death, called parthanatos (By similarity). Prevents nuclear translocation of AIFM1 in a PAR-binding dependent manner (By similarity). Does not affect PARP1 activation (By similarity). Protects against cell death induced by DNA damaging agents, such as N-methyl-N-nitro-N-nitrosoguanidine (MNNG) and rescues cells from G1 arrest (By similarity). Promotes cell survival after gamma-irradiation . Facilitates DNA repair . PTM: Ubiquitinated; autoubiquitinated. Polyubiquitinated in the presence of UBE2D1, UBE2D2 and UBE2D3. Multimonoubiquitinated in the presence of UBE2E1. Not ubiquitinated in the presence of UBE2H, CDC34, UBE2L3, UBE2L6, nor UBE2C. In the absence of PAR, autoubiquitination occurs on Lys-85, Lys-95 and Lys-176 via 'Lys-11' and 'Lys-48' ubiquitin linkages. In the presence of PAR, Lys-131 and Lys-176 are ubiquitinated via 'Lys-6', 'Lys-33' and 'Lys-48' ubiquitin linkages. Autoubiquitination is enhanced upon PAR-binding. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 38950 Sequence Length: 359 Domain: The WWE domain mediates non-covalent PAR-binding. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.27
Q97YD2
MEVHVCSVGTSLLKNSLDDDNVRKEIERLGLKDWDRLKFDDDRQNRIKENFDSLRKMLLKFIRSKGRRASAELDSLFSTFEKLKHNKSEIYVFLYSTNTSNSQLAGEVIRDYLIEEGIRSELVTVKTISSEENFYEGIVDLFDKVIYRILKFKEQDNEVYINATPGLKPESIFLTLAGLLAGADLIYYKYQEFNDVVILPSPPITIRPKYLDWLIRFAISGYTLSEKRAEELGIPVRLLEAKMLVERKGEDAYRLKDWVRKLLGIYLPIGAQNKYYRVIVEGEGERTFDNEVEAYNYMESKRKEGKNVRVEVPDRVYFLGL
Cofactor: Does not require a metal cofactor. Function: CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA) (Probable). A nuclease that degrades cyclic oligoadenylates (cOA), second messengers that induce an antiviral state important for defense against invading nucleic acids. Destruction of cOA deactivates the Csx1 ribonuclease, preventing uncontrolled degradation of cellular RNA. Slowly degrades cA4 (a tetraadenylate ring) into first a linear tetraadenylate product and secondly into a linear diadenylate product with 5'-OH and 2',3'-cyclic phosphate termini. Is 10-fold less active than SSO2081, suggesting it plays a minor role in cA4 degradation. There may be 2 active sites per homodimer . Catalytic Activity: cyclic tetraadenylate = 2 5'-hydroxy-diadenylate 2',3'-cylic phosphate Sequence Mass (Da): 37448 Sequence Length: 321 Subcellular Location: Cytoplasm EC: 4.6.1.-
Q05823
MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTDCGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC
Cofactor: Manganese or magnesium. Required for optimal RNA cleavage rates. Function: Endoribonuclease that functions in the interferon (IFN) antiviral response. In INF treated and virus infected cells, RNASEL probably mediates its antiviral effects through a combination of direct cleavage of single-stranded viral RNAs, inhibition of protein synthesis through the degradation of rRNA, induction of apoptosis, and induction of other antiviral genes. RNASEL mediated apoptosis is the result of a JNK-dependent stress-response pathway leading to cytochrome c release from mitochondria and caspase-dependent apoptosis. Therefore, activation of RNASEL could lead to elimination of virus infected cells under some circumstances. In the crosstalk between autophagy and apoptosis proposed to induce autophagy as an early stress response to small double-stranded RNA and at later stages of prolonged stress to activate caspase-dependent proteolytic cleavage of BECN1 to terminate autophagy and promote apoptosis . Might play a central role in the regulation of mRNA turnover . Cleaves 3' of UpNp dimers, with preference for UU and UA sequences, to sets of discrete products ranging from between 4 and 22 nucleotides in length. Sequence Mass (Da): 83533 Sequence Length: 741 Domain: The nine ankyrin repeats also called 2-5A sensor constitute the N-terminus 2-5A binding domain. Subcellular Location: Cytoplasm EC: 3.1.26.-
P59107
MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVEPFLTRFVGKVQGKNDRLTIVPDHPLLKDAIPCRAARGLNHEFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVPWWVTLARHNLEKEAPDGVATEMLDEGLVREDLTSLDFVTIDSASTEDMDDALFAKALPDDKLQLIVAIADPTAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKLVYDQVSDWLENTGDWKPESEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIVEEAMIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGLHVDAEEVLTLDGFCKLRRELDAQPTGFLDSRIRRFQSFAEISSEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATRPQDEITVQMAERRRLNRMAERDVGDWLYARFLKDKAGTGTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVYKVTDVIDVTIAEVRMETRSIIARPVA
Function: Involved in mRNA degradation. Hydrolyzes single-stranded polyribonucleotides processively in the 3' to 5' direction. Catalytic Activity: Exonucleolytic cleavage in the 3'- to 5'-direction to yield nucleoside 5'-phosphates. Sequence Mass (Da): 72465 Sequence Length: 644 Subcellular Location: Cytoplasm EC: 3.1.13.1
Q7MEL4
MFQDNPLLAQLKQQIQENLPKKEGTIKATEKGFGFLEVDSKTSFFIPPAYMKKCMHGDKVIAIIRTENEREVAEPQELVEQMLNRFIGRVKMFKGKLNVVPDHPQLKKMSLKAKTKKGLNPQEFAEGDWVVGHLIRHPLKDDNGFFVEISEKITDADDKIAPWWVTLAENDLPNSEPAGIDDWQIKDDADLERIDMTHIPFVTIDGESTKDMDDALYAKKNDAGDFELTIAIADPTAYITPDDEMDKVARERGFTIYLPGRNIPMLPRDLADELCSLIEGEIRPALCCTVTVSKDGVIGDDIQFFAANIKSHARLAYDNVSDWLETGSCEKWQPSEEIAAIVRDLYEFSQARAEWREKNAVVFPDRPDYRFELSEDNDVVAIHADMRRSANRLVEESMITANICAGKTLQAHFGTGVFNCHAGFKPEKIADVVELVNPEGTLEFTAESIATREGFAALRRWLSKQETTYLDNRIRKFQTYSEVSNQPLPHYAMGLDIYATWTSPIRKYGDMINHRMLKALILNKEPVQKPDDSVGEELALHRKHHKIAERNVADWLYARTLADAPENQTLFTGEIFDINRAGMRIRLLENGAAAFIPGSLIIDNKERIECNGDLGTVSIDKEVVYKLGDVLEVVLADVNQENRSLVAKPTQVFAELPVVEETQN
Function: Involved in mRNA degradation. Hydrolyzes single-stranded polyribonucleotides processively in the 3' to 5' direction. Catalytic Activity: Exonucleolytic cleavage in the 3'- to 5'-direction to yield nucleoside 5'-phosphates. Sequence Mass (Da): 75069 Sequence Length: 664 Subcellular Location: Cytoplasm EC: 3.1.13.1
Q6GZP5
MEGWLGNLLAKSVKDKYIPVIVGRRDLWNKVFTPKSVNPDDNYEALEIVGDGVASYFFPSYFLKRFPQLNSPKGVKTVARLKIYYGSKKSFSSIADSLGFWKFIRSGPVPVNPSTRESLLEDTFEAFLGAVCMAVDDEYSIDGLGAVVAYKIMADIFDDMDISLEYTALFDTVTRLKELMDVKKDVLGGDAVYNHRGDTTVITLKGRVIGKATGAIKRDRAKEAAGQALDLLRREGHFREHDDDAVVKVAKGPAGDGLVVAQSALGGFTVFGAESGVVEGSGGTVAQALSRVVGTKRPSAVEVAGGDYKSLLKEYLESVGETDSVNYIHEGVTVTMTRKGKPVATANHLVKKVREQLASRDYYRTVHAKGV
Function: Digests double-stranded RNA. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 40362 Sequence Length: 371 EC: 3.1.26.3
Q8RGX3
MKNLLDLEHKLNYYFNDRNLLKNALLHKSLGNERKEYKNQTNERLELLGDAVLDLIVAEYLYKSYKNASEGPIAKLKAMIVSEPILAKISRQIGVGKFLMLSRGEVMSGGRNRESILADSFEAILGAVYIDSNLDEARVFALSHIKQYIDHIEENEDILDFKSILQEYVQKEFKTVPTYELVAERGPDHMKEFEIQVIVGNYKEKAVARNKKKAEQLSAKALCIKLGVKYNEAL
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 26756 Sequence Length: 234 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q74AX1
MRETDEQPVAGGAASTEGLETSIGYRFTDRRFLDEALTHRSWLNEVRSPTVPDNERLEFFGDAILGFCIGKMLLRHYPESREGALARMKSALVGEETLADLAAAVELGSYLRLGRGEERSGGRHRRSLLANALEALLAAMYLDGGMAPVERLVDAWFGPRLAGVAAGIKGRDFKTDFQELAQAQYGGLPRYVLVDTSGPAHDLRFTVAAYVGERLLGQGTGRSKKEAEQAAARQCLERLETGRCSAAP
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 27017 Sequence Length: 248 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q7NH89
MAESALTPLRLAQLRRFAARFALSEPEALSWELLHRALIHPSWSAQEGGEDNDRLEFLGDEILRLLAAEFLYRADPELTVGEMTAVRSVLVSDVALAELAEGYDLGEFLVVGRSASGDERGRITRLADGFEAVIGALYLSTGDLGLIRPWLLPHLAHLAESVMADPTRGNHKSALQELTQKLAAGELPEYRLVDPGPPFRYEVWALGRLWGSGEGPSKKLAQQRAARGAYAALRSAFDTALQ
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 26473 Sequence Length: 242 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q9KA05
MPHSKNQRKHRHHSHSERRRQPKRLTLTAKQQQMFDELLRTLNLTFANKKLLVQAFTHSSYVNEHRIQSCKDNERLEFLGDAVLELAVSQYLYKAFEQMSEGDMTKLRASIVCEPSLAQLAEELHFGELVLLGKGEEMTGGRKRPALLADVFESFVGALYLDQGMDAVYLFLERTIYPKISEGAFSHMMDFKSQLQEFIQRDNLGHIHYEIVQERGPAHNREFVSEVVLNNETLGVGTGRSKKEAEQHAAQQALITLSQKKEQ
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 30224 Sequence Length: 263 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q7VIA9
MSKSILPKSPQLLEKKLGYVFQNQQLLLEALTHKSCKKQYNNERLEFLGDAVLDLLVGEYLFKKFPLAKEGELSKLRACIVNEKGFMKLAQSLDLGAYLYISQSEENNNGRQKASILSNAFEALIGAIYLESSLTYVQSIIYDLLEYNYIKIDLDSLFMDYKTALQEITQAFYGEIPTYTLISESGPDHKKSFEIALSVQGKEYARASGNSKKEAQQKSAQIAYKKLYSKMNKTHHKGEK
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 27283 Sequence Length: 240 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q8Y0I1
MSLEALQQRLGYRFSKPELLQQALTHRSHNAMHNERLEFLGDSILNCAVADMLYGMFGKLDEGDLSRVRANLVKQQALYEIAQMLLLPDELRLGEGELKSGGFRRPSILADALEAIFGAVFLDGGFDAARTLIRKLYIPILEQVDPRTLGKDAKTLLQEYLQGHKIALPQYAVVATHGAAHNQQFEVECTIPKLEIRVSGSGASRRAAEQSAAKLALEEAHRLVPQLVKRSRAERTGKTRKQATPPDPQLSLRLKE
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 28502 Sequence Length: 256 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q7UGZ7
MDASSSSNPDDGLQAIRLVDASDDEPYADAVAKIERCQEILGYDFRDLDLLRSALTHASGASHRLASNERLEFLGDSVLGLTVCEWLFNEYPEYSEGDLTKIKSAVVSRRSCGKVACKLGLDQCLIVGRGVTRNRSYPKSLVSDVFEAVIAALYIDGGPEIVRDRLKLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPDHRKMFLMGAMVDDRRFAPAWGNNKKDAEQRAAANALAELHNAKVPYDSEQPPA
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 29313 Sequence Length: 266 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q52698
MKVAADLSAFMDRLGHRFTTPEHLVRALTHSSLGSATRPDNQRLEFLGDRVLGLSMAEALFHADGRASEGQLAPRFNALVRKETCAAVARDIDLGAVLKLGRSEMMSGGRRKDALLGDAMEAVIAAVYLDAGFEVARALVLRLWAARIQSVDNDARDPKTALQEWAQARGLPPPRYETLGRDGPDHAPQFRIAVVLASGETEEAQAGSKRNAEQAAAKALLERLERGA
Function: Digests double-stranded RNA. Involved in the processing of ribosomal RNA precursors and of some mRNAs. Complements an E.coli disruption mutant, but the E.coli enzyme does not cleave R.capsulatus rRNA precursor, showing substrate recognition is different. Probably also processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Probably processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 24663 Sequence Length: 228 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q6N6C1
MTDDVTNVEQPSTASEQQPQDVPAAEPSAAKKRRANKAKSKATAAAIEQRLGHSFADPSLLTTAFTHVSALKSARRTDSYQRLEFLGDHVLGLIVSDMLYRAFPDADEGELSKRLADLVRKETCADVARSLDLVEGIKLGTVGAGAGAKLRKSVLGDICEAVIGAIYLDGGYEAASDFVRRNWTERMRKPARSLRDPKTVLQEWAQARGLPTPVYREVERTGPHHDPQFRVAVILPGLEPAEGLGGSKRAAEKVAASAMLAREGVGTGGNDG
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 29186 Sequence Length: 272 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q9ZE31
MESFEKLETLLGYSFKNKELLIEALSHPSLRQYHEYKYDKDYERLEFLGDAVLNLLITEILFKNFENYKEGNLAKIRSYLVCKETICIVGTKLALKDYIIMTHGEEVAGGRDNPNNIENATEALIAAIYLDSNIEITHNIIEKLWAEFMKVQNLTDYDPKTALQEWAQANSHHLPIYRLIKREGAAHSSIFTVLVKVKDYEQTCTGYSIKEAEKKAARSLLHRLK
Function: Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 26006 Sequence Length: 225 Subcellular Location: Cytoplasm EC: 3.1.26.3
Q9UBS8
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
Function: E3 ubiquitin-protein ligase that plays a key role in the RNF14-RNF25 translation quality control pathway, a pathway that takes place when a ribosome has stalled during translation, and which promotes ubiquitination and degradation of translation factors on stalled ribosomes . Recruited to stalled ribosomes by the ribosome collision sensor GCN1 and mediates ubiquitination of EEF1A1/eEF1A, leading to its degradation . In addition to EEF1A1/eEF1A, RNF14 catalyzes ubiquitination of other translation factors on stalled ribosomes: mediates ubiquitination and degradation of ETF1/eRF1 and ubiquitination of ribosomal proteins RPL0, RPL1, RPL12, RPS13 and RPS17 . Independently of its function in the response to stalled ribosomes, acts as a regulator of transcription in Wnt signaling via its interation with TCF transcription factors (TCF7/TCF1, TCF7L1/TCF3 and TCF7L2/TCF4) . May also play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription . PTM: RING-type zinc finger-dependent and UBE2E2-dependent autoubiquitination. Catalytic Activity: [E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine. Sequence Mass (Da): 53837 Sequence Length: 474 Domain: The N-terminal destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.31
Q9JI90
MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD
Function: E3 ubiquitin-protein ligase that plays a key role in the RNF14-RNF25 translation quality control pathway, a pathway that takes place when a ribosome has stalled during translation, and which promotes ubiquitination and degradation of translation factors on stalled ribosomes (By similarity). Recruited to stalled ribosomes by the ribosome collision sensor GCN1 and mediates ubiquitination of EEF1A1/eEF1A, leading to its degradation (By similarity). In addition to EEF1A1/eEF1A, RNF14 catalyzes ubiquitination of other translation factors on stalled ribosomes: mediates ubiquitination and degradation of ETF1/eRF1 and ubiquitination of ribosomal proteins RPL0, RPL1, RPL12, RPS13 and RPS17 (By similarity). Independently of its function in the response to stalled ribosomes, acts as a regulator of transcription in Wnt signaling via its interation with TCF transcription factors (TCF7/TCF1, TCF7L1/TCF3 and TCF7L2/TCF4) (By similarity). May also play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription (By similarity). May regulate the expression of both mitochondrial and immune related genes in skeletal muscle . PTM: RING-type zinc finger-dependent and UBE2E2-dependent autoubiquitination. Catalytic Activity: [E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine. Sequence Mass (Da): 54926 Sequence Length: 485 Domain: The N-terminal destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.31
Q9Y225
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV
Function: May play a role in TRPCs intracellular trafficking. Location Topology: Single-pass membrane protein Sequence Mass (Da): 17210 Sequence Length: 148 Subcellular Location: Golgi apparatus membrane
Q8BGI1
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAVFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLVKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQEPLPGAENIV
Function: May play a role in TRPCs intracellular trafficking. Location Topology: Single-pass membrane protein Sequence Mass (Da): 17254 Sequence Length: 148 Subcellular Location: Golgi apparatus membrane
Q7SXJ6
MAAESDVLSEIEVLQSIYLDELNVTQNDEGGWTVSLVLHPSTAEDCLSQFVRLTLTMDLDSQYPYSSPYISIHNPRGLSDDKLLSLQKSLQMEAEECVGTPVLYQLIERAKEILTDSNIPHGNCVICLYDFKEGEVFTKTSCYHYFHSHCLGRYITHSEMELKDRERELEEDKTRDRTEEEELAVVCPVCRESLTYDLDALLSSPAPVLCQQEDAVIGGEFKKKWEALQKILERQKEKGGVIDPEAESNRFLIHINEAPVNLSDTPGMTDSSGAESSQSLPSSSPDSTSTTQTSQNQHTAGQPQRKHTGDFKRGRRGRGAGRGGPARHMVPAPGEERLGKHIQSSDKINSANSGPTNTTSQVESTAQRQACELSENTAQLRQPLTNEENKPVSQDMLTSEPKDGQEVSQQKECISKEVTQTILQEGHPEREHVGRGDKRGSRGSARHHGHWQDRNYKGPGHWDNSGSAGHRGGAYRTREGGAGRGHRGGGAYRGGGRGMHQRVEKEFRKEGVL
Function: E3 ubiquitin-protein ligase that plays a key role in the RNF14-RNF25 translation quality control pathway, a pathway that takes place when a ribosome has stalled during translation, and which promotes ubiquitination and degradation of translation factors on stalled ribosomes (By similarity). May also acts as a positive regulator of the Wnt signaling . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 56887 Sequence Length: 513 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.27
Q96BH1
MAASASAAAGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGQEQEQERQHATTKQKAVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLEAERNRYFISLQQPPAPAEPESAVDVSKGSQPPSTLAAELSTSPAVQSTLPPPLPVATQHICEKIPGTRSNQQRLGETQKAMLDPPKPSRGPWRQPERRHPKGGECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPRLPRGQGAYRPGTRRESLGLESKDGS
Function: E3 ubiquitin-protein ligase that plays a key role in the RNF14-RNF25 translation quality control pathway, a pathway that takes place when a ribosome has stalled during translation, and which promotes ubiquitination and degradation of translation factors on stalled ribosomes . Catalyzes ubiquitination of RPS27A in response to ribosome collisions, promoting activation of RNF14 . RNF25 catalyzes ubiquitination of other ribosomal proteins on stalled ribosomes, such as RPL0, RPL1, RPL12, RPS13 and RPS17 . Also involved in ubiquitination and degradation of stalled ETF1/eRF1 . Independently of its function in the response to stalled ribosomes, mediates ubiquitination and subsequent proteasomal degradation of NKD2 (By similarity). May also stimulate transcription mediated by NF-kappa-B via its interaction with RELA/p65 . PTM: Ubiquitinated; autoubiquitinated. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 51219 Sequence Length: 459 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.27
Q9QZR0
MAASASTAAGEEDWVLPSEVEVLESIYLDELQVMKGNGRSPWEIFITLHPATAEVQDSQFVCFTLVLRIPVQYPHEVPQISIRNPRGLSDEQIHKISQALGHVAKEGLGTAMLYELIEKGKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELTTQEQEQERQHVVTKQKAVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEELKLLYQRQQEKGGIIDLEAERNRYFISLQQPPAALEPESAVDVSREPQPPNALSAEQSTSLADQSTLPTSLPMTTQYTYEKTSGAGPNQQRPGETQKSVLDPPRHGRGSWRQYDRRHPKGGECCTPKGTSEIHELPPPEKPLKETVDLKAEPRNKGLTGHPQEKGPGSWQGPSARRTRDCARWERSKNRTPGSCYPHLPRGQGAYRSGTRREPLGLESEEGS
Function: E3 ubiquitin-protein ligase that plays a key role in the RNF14-RNF25 translation quality control pathway, a pathway that takes place when a ribosome has stalled during translation, and which promotes ubiquitination and degradation of translation factors on stalled ribosomes (By similarity). Catalyzes ubiquitination of RPS27A in response to ribosome collisions, promoting activation of RNF14 (By similarity). RNF25 catalyzes ubiquitination of other ribosomal proteins on stalled ribosomes, such as RPL0, RPL1, RPL12, RPS13 and RPS17 (By similarity). Also involved in ubiquitination and degradation of stalled ETF1/eRF1 (By similarity). Independently of its function in the response to stalled ribosomes, mediates ubiquitination and subsequent proteasomal degradation of NKD2 . May also stimulate transcription mediated by NF-kappa-B via its interaction with RELA/p65 (By similarity). PTM: Ubiquitinated; autoubiquitinated. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 51227 Sequence Length: 456 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.27
Q9BY78
MEAVYLVVNGLGLVLDVLTLVLDLNFLLVSSLLASLAWLLAFVYNLPHTVLTSLLHLGRGVLLSLLALIEAVVRFTCGGLQALCTLLYSCCSGLESLKLLGHLASHGALRSREILHRGVLNVVSSGHALLRQACDICAIAMSLVAYVINSLVNICLIGTQNLFSLVLALWDAVTGPLWRMTDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASFVLVNLTGLVLLACVLAVTVTVLHPDFTLRLATQALSQLHARPSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLASWPNRGGAPGAPQGDPMRVFSVRTRRQDTLPEAGRRSEAEEEEARTIRVTPVRGRERLNEEEPPGGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL
Function: E3 ubiquitin-protein ligase that plays a key role in endosome organization by retaining vesicles in the perinuclear cloud . Acts as a platform for perinuclear positioning of the endosomal system by mediating ubiquitination of SQSTM1 through interaction with the ubiquitin conjugating enzyme UBE2J1 . Ubiquitinated SQSTM1 attracts specific vesicle-associated adapters, forming a molecular bridge that restrains cognate vesicles in the perinuclear region and organizes the endosomal pathway for efficient cargo transport . Also acts as a regulator of type I interferon production in response to viral infection by mediating the formation of 'Lys-11'-linked polyubiquitin chains on TMEM173/STING, leading to stabilize TMEM173/STING . Also required to limit type I interferon response by promoting autophagic degradation of IRF3 . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 47737 Sequence Length: 433 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Endoplasmic reticulum membrane EC: 2.3.2.27
Q8BUH7
MEAVYLVVNGVGLVLDLLTLMLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRGFLLSLLALVEAVVRFTFGGLQALGTLLYSCYSGLESLKLLGHLASHGALRSREFLNRGILNMVSNGHALLRQACDICAIAMSLVAYVINSLVNICLISTQNFFSLVLALWDAVTGPLWRMTDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASCVVFHLTGLVLLACVLAVILIVLHPEQTLRLATQALSQLHARPSYHRLWEDIVRLTRLPLGLEAWRRVWSRSLQLASWPNRGGAPGAPQGGPRRVFSARIQPQDTPPEAEEEVIRTAPARGREQLNEDEPAAGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRSILQTLNVYL
Function: E3 ubiquitin-protein ligase that plays a key role in endosome organization by retaining vesicles in the perinuclear cloud. Acts as a platform for perinuclear positioning of the endosomal system by mediating ubiquitination of SQSTM1 through interaction with the ubiquitin conjugating enzyme UBE2J1. Ubiquitinated SQSTM1 attracts specific vesicle-associated adapters, forming a molecular bridge that restrains cognate vesicles in the perinuclear region and organizes the endosomal pathway for efficient cargo transport. Also acts as a regulator of type I interferon production in response to viral infection by mediating the formation of 'Lys-11'-linked polyubiquitin chains on TMEM173/STING, leading to stabilize TMEM173/STING. Also required to limit type I interferon response by promoting autophagic degradation of IRF3. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 46914 Sequence Length: 424 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Endoplasmic reticulum membrane EC: 2.3.2.27
A1TZ60
MSTKTSSEIIKDGLWHNNPALVQVLGLCPLLAVTSTVVNAIGLGLATLLVLMGSNLSVSLIRNFVSESVRLPAFVMIIASFVTCAELLMQAFTYELYQILGIFIPLIVTNCAILGRADAFASKNPPLPAILDGAMMGIGFLAVLMTLGAMRELIGQGTLFADMHLLLGPMAADWVIRPLEQYPDMLFMVLPPGAFVGLGLLIALKNGIDNHLKERRKAAEPAPASTGSKRVRVTGTIS
Function: Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25388 Sequence Length: 238 Subcellular Location: Cell inner membrane EC: 7.-.-.-
Q8TSY1
MYPHRRADMNPISEFIRGITKDNPTFGLVLGLCPTLAVTTSVENGIGMAMGTLFVLVGSNMMVSAIRKGIPGTVRLPVEIIVIATFVTIVDMVMEAFTPDLYTSLGVFIPLIVVNCIVIGRAEAYALKNGVFYSIIDALGEGTGFLLVLILIGGIRELLGTGIIDPFGMTLINLSGVINPAMFMTMSPGAFLTIAVLMTIVNYRRQQKAAKGG
Function: Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane. Catalyzes Na(+) transport, most probably coupled to electron transfer from reduced ferredoxin to methanophenazine and heterodisulfide reductase. Involved in heterodisulfide reduction during methanogenesis from acetate. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 22745 Sequence Length: 213 Subcellular Location: Cell membrane EC: 7.2.1.-
P97055
MSESYAKIARDGLWDKNIVTGQMLALCPTLAITGTATNGLGMGLATTVVLILSNVVISALRKTIAPEIRIPAFILIIAAIVTVVDLALNAWLHDLHKVLGLFIALIVTNCAILGRAEAFASRFGVLASALDGLMMGIGFTLALVVVGAIREILGSGTLFAQASLLLGPHFAFMELQIFPDYPGFLIMILPPGGFLVVGGLFALKRIIDARKPTIEQEIKQMRTERVFTAAGVLKPKLETGEEA
Function: Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane (By similarity). Required for nitrogen fixation. Involved in electron transfer to nitrogenase . Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25867 Sequence Length: 243 Subcellular Location: Cellular chromatophore membrane EC: 7.-.-.-
O70338
MRWLLPLSRTVTLAVVRLRRGICGLGMFYAVRRGRRTGVFLSWSECKAQVDRFPAARFKKFATEDEAWAFVRSSSSPDGSKGQESAHEQKSQAKTSKRPREPLGEGEELPEPGPKHTRQDTEPAAVVSKDTFSYMGESVIVYTDGCCSSNGRKRARAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIMQAKAQNISKLVLYTDSMFTINGITNWVQGWKKNGWRTSTGKDVINKEDFMELDELTQGMDIQWMHIPGHSGFVGNEEADRLAREGAKQSED
Cofactor: Binds 1 Mg(2+) ion per subunit. May bind a second metal ion at a regulatory site, or after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Plays a role in RNA polymerase II (RNAp II) transcription termination by degrading R-loop RNA-DNA hybrid formation at G-rich pause sites located downstream of the poly(A) site and behind the elongating RNAp II. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 31805 Sequence Length: 285 Subcellular Location: Cytoplasm EC: 3.1.26.4
Q9UST8
MGGNKRAYYAVARGRNTGIYSTWDEASDQVKGYGGNRYKKFDSYEAAQEFCRTEGSRYSSSSGPYRRSTTSYGYSPYSSSSSNYSARHSDKYRKKISRSYSTEKDIEIFSNDTHEKSIACSDRQVVYADGSSLRNGKKGAVAGCGVFFGNDDPRNISVPLAGEEQTNNRAELQAIILALENTSGDLTIRSDSNYSIKSLTTWLPKWKKNDFKTSNSQPVKNLDLINRASDLMSDRNVSLEYVKGHSTDYGNQQADMLARRGASE
Cofactor: Binds 1 Mg(2+) ion per subunit. May bind a second metal ion at a regulatory site, or after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 29421 Sequence Length: 264 EC: 3.1.26.4
Q04740
MARQGNFYAVRKGRETGIYNTWNECKNQVDGYGGAIYKKFNSYEQAKSFLGQPNTTSNYGSSTHAGGQVSKPHTTQKRVHRRNRPLHYSSLTSSSACSSLSSANTNTFYSVKSNVPNIESKIFNNWKDCQAYVKHKRGITFKKFEDQLAAENFISGMSAHDYKLMNISKESFESKYKLSSNTMYNKSMNVYCDGSSFGNGTSSSRAGYGAYFEGAPEENISEPLLSGAQTNNRAEIEAVSEALKKIWEKLTNEKEKVNYQIKTDSEYVTKLLNDRYMTYDNKKLEGLPNSDLIVPLVQRFVKVKKYYELNKECFKNNGKFQIEWVKGHDGDPGNEMADFLAKKGASRR
Cofactor: Binds 1 Mg(2+) ion per subunit. May bind a second metal ion at a regulatory site, or after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 39431 Sequence Length: 348 EC: 3.1.26.4
Q67PD4
MKRLQALMAEQGPDIYPEVIAALKDDPREGAQRLVRQCQTYLKERERQRAVLQRMYNYERQLWSMGYRHIAGIDEVGRGPLAGPVVAAAVILPGEVELPGIEEAKRLSDRRRMELYRRIREVAVAVGVGLVQPEGIDEASVVVATYKAMMKAVADLPVTPDYLLIDGVHLPNVSQPQVPVVGGETLSCSIAAAAVVAKVVRDEYMVEMDAKYPAYGFAHHKGYGTPEHRLALERYGPCPIHRKPSDGTPAGAVLLFTEG
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 28540 Sequence Length: 259 Subcellular Location: Cytoplasm EC: 3.1.26.4
Q67MS9
MADLRLERVLWRHGCQVIGVDEAGRGPLAGPVVAAACILPPDAALPGVDDSKRMTEKRREAAFAAIQAVAVGWGIGIVDAARIDEINILQATFEAMAQAVEGARAMAAARPGRTAEAALLVDGNRPLPLWPGWQRTVVGGDHKSLSIAAASILAKVTRDRMMIEYDAHYPEYGFARNKGYGSREHWDALERYGPCPLHRRTFIGPRQIRFF
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 23038 Sequence Length: 211 Subcellular Location: Cytoplasm EC: 3.1.26.4
Q9SEZ6
MESECLTPEWASQPCLMGIDEAGRGPVLGPMVYGCMYCPISYQSSLASLHFADSKTLKEEKREELYESLKLDKSLGWAVDVIDPRELSAKMLAKNKTNLNEISHNSAMGLIKRVLDMGVLLTEAYLDTVGDPDKYRIKLSERFPSIKFVVSKKADSLFPIVSGASIVAKVTRDRALKEWLVEETGEDINRNFGSGYPGDPETKAWLVQHKHSVFGFPSLVRFSWGTCTTHLKGEVEVAWEADENEESGNGSSSKRQAKLSSFGFKTCEKRSEEIESSGKGRCKFLQARKIQQLTQF
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes (By similarity). Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 33078 Sequence Length: 296 EC: 3.1.26.4
Q9U6P6
MSLKCETERSKTWNNFGNGIPCVLGIDEAGRGPVLGPMVYAAAISPLDQNVELKNLGVDDSKALNEAKREEIFNKMNEDEDIQQIIAYALRCLSPELISCSMLKRQKYSLNEVSHEAAITLIRDALACNVNVVEIKVDTVGPKATYQAKLEKLFPGISICVTEKADSLFPIVSAASIAAKVTRDSRLRNWQFREKNIKVPDAGYGSGYPGDPNTKKFLQLSVEPVFGFCSLVRSSWKTASTIVEKRCVPGSWEDDEEEGKSQSKRMTSWMVPKNETEVVPKRNVYFKERHMSNILTF
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes (By similarity). Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 33191 Sequence Length: 297 EC: 3.1.26.4
Q54D13
MDNKIIYLTELDSSVDKSEPFVMGIDEAGRGPVMGPMVYGCCYAPISKSTTLKSMKFNDSKKLTEQQRDQLFDKMGESNKILAYETDVITAEILSEKMLYKKPISLNVISHESAIGLIRSVLKKGVNVQELYLDTVGPPDKYQLMLKKLFPEIGKIIVSKKADSLYPIVSAASIAAKVVRDFEITNKNFDYLNIYDQDEQLSTDFGSGYPSDPLSKKWLVKNRDKVFGYPNFIRFSWKTTETAMRGACFGVDWVLENDKLKQHFQENQNDKKRFMFFKENNIENCINDF
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Participates in DNA replication (By similarity). Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 33083 Sequence Length: 289 EC: 3.1.26.4
Q9VPP5
MSDQEDVVVKKEKKCIENIDENDEEPDDVDFKDSGKISSLKALGPFIAGKENSRNTVYLSDVPDICKDKPCMLGVDEAGRGPVLGPMVYGISYCPLESNKALEDLGCADSKQLTEGKRDIIFNDINTKEYATSCVGWAVEIISPNTISTSMYRRSKCSLNEVSMDSAMGLIQQAIDAGVNIAEVYVDTVGPPEKYQEKLLKRFPSFKITVAKKADSTYPIVSAASICAKVTRDHALKVWSFPEGLVIKDNEFGSGYPGDPVTRRFLTEYIDLVFGFPRLVRFSWSTAENALADKAYDMEFDEPDSEKPKYAGTKLTKFFKGTTKSGEIIREECRFFKQRHLESVMEF
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes (By similarity). Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 38750 Sequence Length: 347 EC: 3.1.26.4
O75792
MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLESATSL
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 33395 Sequence Length: 299 Subcellular Location: Nucleus EC: 3.1.26.4
Q9CWY8
MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAPHRYFQERGLEAASSL
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 33513 Sequence Length: 301 Subcellular Location: Nucleus EC: 3.1.26.4
Q9P5X8
MADIQDEAGPFLPPTISPPALLSGVSQTYFSPIPPQLLADNTPCCLGVDEAGRGPVLGPMVYSAFYLPLTLSDPLLKQKHSFDDSKVLTPAVRLSLMKELCTKDTELHDNCGYATSSLSPLSISSGMLKASKAQIYNLNQQAMDATIALIKGIYERGVNVTDIFIDTIGQPAAYQKKLERVFPTAKITVAKKADSLYPVVSAASVVAKVTRDIALEVLWADRTMAWGSGYPSDSKCVSWLKQNMHPVFGWGPECRFSWGTAKDMLETKGGVKVDWPEEEEEETQKLTDFFMAKRDQAEVDVDDLGTWFGAPAGVECF
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Participates in DNA replication. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 34627 Sequence Length: 317 EC: 3.1.26.4
Q10236
MKDDHDAWEPEELVSDNNSSENELQEDQNSSITFLPPSVNKSNPAKSNYYHSTVTDDISKSQPYRLGVDEAGRGPVLGPMVYAVAYCPVDFDLTNYGFADSKTLASLKREELLKLICNKSNELGKNVGWSTMSISARELAAGMLRYRNKYNLNLQAHDTTIDLIKKVYESGINVTEIYVDTVGPPISYQEKLQAHFPQAKVTVTKKADSLFPIVSLASICAKVTRDIQLECARESIRTENWGSGYSSDARTTEWLKVNVDKIFGWKGDIVRYSWKTAKDLLELPSKSQSSIEIDWHEDDDTPTLNFTQKKKPNPASRSWFGSEFYF
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Participates in DNA replication. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 36808 Sequence Length: 326 EC: 3.1.26.4
P53942
MVPPTVEASLESPYTKSYFSPVPSALLEQNDSPIIMGIDEAGRGPVLGPMVYAVAYSTQKYQDETIIPNYEFDDSKKLTDPIRRMLFSKIYQDNEELTQIGYATTCITPLDISRGMSKFPPTRNYNLNEQAHDVTMALIDGVIKQNVKLSHVYVDTVGPPASYQKKLEQRFPGVKFTVAKKADSLYCMVSVASVVAKVTRDILVESLKRDPDEILGSGYPSDPKTVAWLKRNQTSLMGWPANMVRFSWQTCQTLLDDASKNSIPIKWEEQYMDSRKNAAQKTKQLQLQMVAKPVRRKRLRTLDNWYR
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 34875 Sequence Length: 307 Subcellular Location: Cytoplasm EC: 3.1.26.4
Q8KAA5
MLSTDFEYPLWESLSQVCGIDEAGRGPLAGPVVAAAVVFPRHFRPTGIFAKLDDSKKLTAELRDELALAIRESAESWALGVVDAETIDRINILQATMLAMNLAVESLGSTPEFLLVDGNRFRPVLPIPYQTIVKGDSKVFSIAAASVLAKTHRDELMTTSAAEYPEYGFEVHFGYPTARHVEAIARHGRCAIHRQSFKLRKLGEK
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 22583 Sequence Length: 205 Subcellular Location: Cytoplasm EC: 3.1.26.4
O84032
MKSTVEQAMLFEEKSIFENQAIEQGYSQVAGVDEAGRGPLAGPVVAGACILPRGKVFLGIDDSKKLTPKQRRYLYELLLEDPEVDCGVGVISVERIDEINILEATKEAMVQAIASLRSTPDFLLVDGLFLPHKVPSLKIIKGDARSVSIAAASIIAKEYRDELMRKLHVEYPEYGFDKHKGYGTAAHLQALKHFGPCVYHRKSFSPVKESIQEGVCQ
Cofactor: Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. Function: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Catalytic Activity: Endonucleolytic cleavage to 5'-phosphomonoester. Sequence Mass (Da): 23961 Sequence Length: 217 Subcellular Location: Cytoplasm EC: 3.1.26.4