ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
Q04G23
MAFNENRVINNYAEALMEVSGKQTAKVLSELQVIELVFERNKELAQTLDDVSVSSQQQEAFIGILGKGCSTTTKNFLETLADNRHFSLLEEIVENLDQRVSASNNHSLVIAKTAIPITAEQSKRLSKIAQKKFGYQHVEVKNVVDPNVIAGVILTAGSKTIDGSIKNKLVQLNNHIKQAVGKE
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A5CD08
MHKLNNVAVLYAKILFKQAIKLNIVSKVKQDLKALKQFCKFLAKQNMSLQLIALMKNKINLMDYLSSTYGLNHLTYNFLKLLQKNNRLTYLSHIIIAFDAQVRNYQGVTLGYLITTKKWSKSAIKEIKDIFERKLNRKLIISNIVDKSIVGGIILRYEDYEYDLSMLGAINRFKSRIKLNY
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A6L8N6
MDIGTISSRYAKALFSLAKDKEQESRVYDDMKMLADSFSMEPELRGALSNPIVSVPEKVKLLTAAGGIEVCELYSRFINLVLAHKRETLLPFIAYIYIHLYRKEKKITRVRFDTAVAVDDAVKSHLQDKLRKETGCTIEFSGHVEPELIGGFRLRIGNYRIDASYATQLRDIRTGLLENR
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
P50008
MSGMHGASREALAAARERLDALTDSTSVDAGSLADELAAVTALLHREVSLRRVLTDPAQSARPRPSSPSVSSAPRSAAPVDLVAGTVRSRWSQSRDLVDALEQLANIADLTAAQKRGRLDNVEDELFRFGRIISSNTELRAALTSRSATTAAKSELLAGLLGSRAERTTERLVTRLVTAPRGRSLESGLESLSKLAADRRDRMVAVVTSAVPLSDTQKQRLGAALAKVYGRPMHLNLDVDPEVLGGIRVQVGDEVINGSIADRLEDAGRRLAS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
B2FHZ1
MSQALTLARPYARAAFATARDEGAFAPWSDALAFSAHVAVDPRVAALLANPELGRDDAVALLAPVSHGETYSRFLAILAESHRLPLLPEISGMFDALRAEAEHVVKATVTSAAELSAGELDAIKVALRKRFNREVDVTTAVDASLIGGAVIDAGDVVIDGSLKGKLARLQTALAN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
P95786
MDKKTQAVTEIYAKSLVEVALERDSVPIIYDEVRAILSVLDDQQVQDFLASKAIDLSAKSEVVRLFQESCSNYMKQFLEIILQNERQQLLYLIMKEVLKELSLKTHIFDIEVTTAVALSDDQKERLTALVEKKFALTKRNLIEKIDDEIIGGFIIKANNKVIDTSIRSQLQELKMNLK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q9A0J0
MTKKEQALIEQYAKSLVEVASEHHSLDALQADVLAILETFVTTNLDQSLSSQAVPHAEKIKLLTLLKGNNSVYMNNFLNLILQNEREAYLYQMLQAVLNEIAIVSNQYDVTVTSSLPLTEEQKSRVRAVVAKKFAVTAGRLIEKVDPSLIGGFIISVNNKVIDTSIRRQLQAFKMNLK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q04HT6
MDKKTVKVIEKYSMPFVQLVLEKGEEDRIFSDLTQIKQVVEKTGLPSFLKQVAVDESDKEKTIAFFQDSVSPLLQNFIQVLAYNHRANLFYDVLVDCLNRLEKETNRFEVTITSAHPLTDEQKTRLLPLIEKKMSLKVRSVKEQIDESLIGGFVIFANHKTIDVSIKQQLKVVKENLK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A7HIX6
MALTLDIVTPERRVLSVTVDEVRAPGAAGGFGIRVNHEPFMTALEPGRLTYVEGGREHHYAIGGGFLQVAENRVIVLADTAEAAGDIDVERAKRAFQDAQDRLLRMTEQDEHHPAESARVKRAAARISVAGR
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14369 Sequence Length: 132 Subcellular Location: Cell inner membrane
O66903
MIQVEIVSPQGMVYSGEVESVNVPTVEGEVGILENHMYLMTLLKPGLVYFNGDDKNGIAVTYGVLDVTPQKVLILAEEAYEVGKLPPASKLKEEFEEAVKKMATAQTMEELKEWEKEAEKARTLLELVEKYR
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14806 Sequence Length: 132 Subcellular Location: Cell inner membrane
P09468
MTLNLCVLTPNRIVWDSEVKEIILSTNSGQIGVLANHAPIATAVDIGILKIRLANQWLTMALMGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLEIAEANLRKAEGKRQTIEANLALRRARTRVEALNTI
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14499 Sequence Length: 132 Subcellular Location: Plastid
Q5P4E1
MAMTVHVDIVSAEEQIFSGLAEFVALPGEAGELGILPGHMPLMTRIKPGAVRVKRPDQAEEELVFVAGGILEVQPGLVTVLADTAIRGKDLDEAKALEAKRIAEEALKNQSTEIDYAKAQAELAEAIAQIAAIQKLRKRGH
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15104 Sequence Length: 141 Subcellular Location: Cell inner membrane
P31477
MTLDVSIIIPERVFWEKRVEEIILPTLSGQMGVLKDHIPILTGLDIGIILVRQKSSSDWTSLVVTGGFALINSNNVTILVNEAEFGSEINVEQAQISYNSSKHALEMNKDIKRKFELTLNLKKARARFQVTQLKK
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15222 Sequence Length: 135 Subcellular Location: Plastid
Q2J6N4
MPIRVAIVSPEQEVWSGDADMVVARTTDGDLGVLPGHVPLLGLLAPGGTVRVKTGGREISASVDGGFISVTHQGVSILAETAKLT
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 8676 Sequence Length: 85 Subcellular Location: Cell membrane
Q14K05
MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIMVDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15767 Sequence Length: 145 Subcellular Location: Cell inner membrane
Q8RGE3
MPSFDVSVVTQVKKILEQEAGYLRLRTSEGDIGILPNHAPFVAELSMGKMEIESPNKDRRDIYFLSGGFLEISDNQATVIADEVFPIEKIDVESEQALVENLKKELEKVSTEEEKRKLQKKIKISLAKIDAKNN
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15134 Sequence Length: 134 Subcellular Location: Cell inner membrane
A7HT53
MAEKLNFDLVSPERLLFSGQVDMVVIPGSEGDMGIMAGHAPVMSTLRPGIIEVENEGAPRQRIFVRGGFAEVTPAGLTVLAEFTVPLADLDATALDREIALADKDVADAKNDDKRQSALEKLDHLKELRHTV
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14292 Sequence Length: 132 Subcellular Location: Cell inner membrane
Q6MAK8
MLYPLSILTSEKNVFNEDVYSVNVPGADGYFEVLAHHATVIALLQPGKLTIINKDHQKLYFGITTGFIEVSHNSATIIADAIESVQEIDVERAKQSYERAKMRLESPDKHVDKERAKRSLNRAKNRIKLFLEIHPQVSFIPLKALLI
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 16669 Sequence Length: 147 Subcellular Location: Cell inner membrane
Q4FP39
MSEEFKIEIVNPEKSFLSKEDVTEVVVPAFEGEMGILKDHISIISFLKPGIIKIFSKSGEDNYYVEDGIVEFKNNNLSVLTSSIFNIKDIDKDKISELLTQAEENSKNSDITDQNKYLVDQKIDVLKTLN
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 14749 Sequence Length: 130 Subcellular Location: Cell inner membrane
Q85X21
MTLNLRVLSPNRVIWDSEVQEIIISTNSGQMGVLPNHVSLVTAVDIGVMKIRLNGKWSTMALMGGFAKIDKDRITILVNNAERDVDIDLQKAQETFRRAKACLVQAEGKRQVIEADVALKRARTLLEAINASPSDSN
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. Location Topology: Peripheral membrane protein Sequence Mass (Da): 15128 Sequence Length: 137 Subcellular Location: Plastid
B2IGK9
MAQERAEHESADQHTTSTGVPHEGQGEPFPPFDSSNFAPLLIWLAISFLLLYALMSKLVLPRIGGILHTRNEKLRSDMHEATALHAQAKEAAALQEKTIADAKAKAIALAQENQAKLRAESDAKQHAVEAELAAKLTAAEARITETKAAAMSNVTAIAQEAASAIVQQFTGKAPDAKKLTAALKAKA
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q89V70
MAESHGGAKGPAAGAHTGAEGGHGGGFPPFESSTYASQLVSLAIFFVVLYVIVSKLALPKVGGAIEARQNKIEGDLAEAQTLRDQSDAALKAYESELASARSRAQAIGNESRDKANAQAETERKALEEQLAAKLAGAEKTIASTRTAAMSNVRGIAADAAGQIVQQLTGVVPDAASVNAAVDASLKG
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A6WW80
MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYHRKRKEAEKEAGDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRASAVDLAVAAAGKIVADKVDTKVAGNLFKDALSQVKSNLN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A4WNY8
METEVHEAAGAAGHAGQAVGMPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLAERRGTITNDLAAAEELKQKAVLAEKAYNEALAKARAEAQAIIAETRAAIQAELAVATAKADAEIAAKSAESESRISEIRAGALQSVTEVAKDTAEALVAALGGKSDAASVDAAVAARMKG
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A8J785
MASLLARPQQAVVRAAKPAAARPLRLVVRASAQKPQQQLAQLAKPALSAIVANALMAMPAAAEAGKIFDFNLTLPVMAGEFLLLMVFLEKTWFTPVGKVLDERDNLIRSKLGSVKDNTGDVDKLVLEAETILKSARSDVSAMINTKKAAKQSELDKTYNEAKAKITAEVESSIAGLEQESASMLKSLDAQVDKISAEVLKRVLPEGVRV
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q65DX0
MSFLPQVMGAGVGFNAGTMLFQLVAMLILLALLKKYALGPLLNIMKEREDYITGEISSAEKKNEEAKKLIEEQQALLKEAREESQSLIENAKKLGEQQKDEIIKAARQEAERMKESARSEIVKERDQAVTALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
P09221
MLWKANVWVLGEAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIATKSTRRKNDRQEAEKLLEEQRELMKQSRQEAQALIENAASLAEEQKEQIVASARAEAERVKEAAKKEIEREKEQAMAALREQVASLSVLIASKVIEKELTEQDQAAS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q8A9U9
MSLLLPDSGLLFWMFVAFGVVFVILAKYGFPIIIKMVEGRKTYIDQSLEVAREANAQLAHLKEEGEALVAAANKEQGRILKEAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQVAVLSVDIAEKVLRKNLQDKESQMGMIDRMLDEVLTPNKN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q6MGM3
MHMKLILNLLVLLAPAAVFAAGGGHGDGHIPTSTIMFQAINLTILFAAIIYFTKDAIVSFFAGRKAAYLEAAQKSAFAREQAEKEFVDIKNKLANLDQTREENLRKAQTHAEDLKKQILEEANDVTKRIKNDAELTARLEVQRAQKELRTQLLQDSVEAARIVLTKDLGSSDQQKLQKDFINNVGV
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q8G7A9
MMTQAASGIDLFIPEVYDIVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIQGNIAKAEQARKDADEAKAKYEAQLSTARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRSIESQHQQAIVSLKGEVGALATALAGKILGAKLEDNDVQSSMIDSMIDDLGAKK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q06J69
MNDLFLFNNSFQDSFEINTDLFDTNIINLSIVLFVVIRFLGEALSDTLENRKQTIIDSLQNSNKKVYIVKNKLVEVKSKLELTQTEVENVYSSRFSYFKTRKQTLLEQVQSYLTQLQSLQKDSIEGQTKKVLSDVYDTTISKTFDTLYINLASAFKKSGNFSNKKKAITYSYLKRLN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A6W7G5
MLVAAFAAAGEEVEGNPTYPILPHLGELIVGIIFAIIIYAVIAKKVVPRLEAMYEERRAAIEGNVEKAEKAQAEAQVALEQYKAQLADARGEANRIREEARQQGAQILAEMREQAQAESERITTAARATIEAERVQATAQLRAEVGRLATDLAGRIVGESLQDSARQSGVVDRFLADLERSESGASSR
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q1IIG4
MYAQEAQQKPEAQQSAPAAEQPKPAEEQAKPEQHVTNPNAAVGKELSEASHAAEGEEEAGEHMELKHSTMVKTLAKWLGVSVETSYWIAMAFNFAIVFALLGWAMKKNLPGVFKARNESIQRGIAEARAASDDAKRRLADIEARLSKMDGEVAAIRAVTEKESAAEEVRIREAAEADVKRILESAENEIDAATKQARRDLKSLAAGLAIDLATRKLHVDQQTDESLVRSFVAQLGKDGK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q9RGY5
MTIQTLFAASHHIYLGNAIWYLLCFAILMLLIKHYAWGPVSDMMEKRRQKIISDLDSAASDRKKAETLANEREAALKNSRQEATQILSDAKTNAQNTSKEIVASANEDAAAIRKKANEEAAKAKSDALDAARDQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLDD
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
P0A2Z0
MSTLLLEAAPNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A9KK96
MYSTTVLATGTKDTSLVNRIFGLDMQLVVDVAIMGLAIFVLFLILSYLLFNPARELLQKRQDRIKEEMDSSAKDKKEATQLKTNYEAKIKEASKEVDEILSEGRKKALKRENDIVDEAKVEASRIVDRANKEIELNKSKMKDEVKQEMIAVASVMAGKIIAGNIDETKQKQLIDEALNEMGDETWQN
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q88UT9
MLSHLIIGASGLYLGDMLFIGISFIVLMALISVVAWKPITKMMADRADKIANDIDSAQKSRQEASDLADQRRDALSHSRAEASEIVADAKKSGEKQRSSIVADAQNEATQYKQNARKDIEQERQDALKNVQSDVADISVAIATKIIKKQLDPEGQQALINSYIEGLGKHES
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A8F3J8
MGFVELNLTGIIQLLNFLILLFVLYKFLYKPFLQIADKRREKIQSDLASAEKELKEAQEMKKQAHDALESARKSADGIISEARQKSEEIINQAKVKAREEAEKVLNSARNEIEREKKQALQEIEKRAGEIAVTLALKILQGVLDEKAKREYLINILNKEKEK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q88BX0
MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKAGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVKAQALAEIEQELNSAKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
B0U5A2
MDITFTIFAQSIAFAALIWIVATKIWPPLIKVIEERQQKIAEGLAAADLGQKELAQAQEEIKKTLKNAREKANEIIEQAHARAHQIIEAAKAEAITETNRQQNLAQVEIEAAAKRAREELRKHVSILAVNGAEKLLKREIDVNTHKMLLDELAAEI
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q6C105
MPFARVGALSARHYSNQVDPKVKATSILDSIPGNNVLSKTGVLATGVLGSIYAISNELYIVNDESIVLGVFAAFVVVVAKLGGPGYTSWADGYIENMRNILNTTRDKHTDAVKERIGDVSKLKDVVKTTQDLFAVSKDTVKLEAEVFETKQQVVLAAEAKSVLDSWVRYENSVRQREQKLLTETVISKIEKDLKDPKFQQKILQQSVEDIEKLFAKA
Function: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain . F-type ATP synthases consist of two structural domains, F(1) - containing the ex...
A1JTD1
MNLNATILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q9Z688
MAGAGLIIIKRRIKSITNTKKITNAMGLIATSNLRKSRQNLEANKAYYEAFNDVINKIVSSSSKSNLYVAGNKSDKKLYIALTSDSGLCGGFNGAVVTAADNVMRGDKDKSLLITVGQKGISYFKRLKYETLSEYVDIPNEPGLKEAKEIADRALSLYEKGEIGEVHVIYTQFLSTVNQKVEVKKVLPIEPKKMEKVSVAEFEPDAEIILEKAIRLHIEQQLFNLLLNSKASEQASRMSSMDSATKNANDLLDALNIKYNRIRQSAITQEITEIVGGAEALK
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 31137 Sequence Length: 282 Subcellular...
A0LDA1
MANLKALKVRIGSVKNTRQITKAMKMVAAAKLRKATEQAESARPYSKRMSRMMHSLAPAAAGRDNAPELLVGRGDVKKVNLVVYTADRGLCGSFNSVVIRATRARIAELEKQGFQVMLTFIGRKAYDVLKRSHGHLVRKVYTEMSRHMSFAYVEKNIVKELIKDFHEGQFDACYLVFNQFKSAMSQELTWAQSIPQPIDTEGASTQTGYQFEPVEEELLEELLPRNLAVQVFQALAESEASEHGSRMTAMDNAVRNAGDMVKKLQTKYNRSRQAAITTELIEIISGAESLKG
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 32634 Sequence Length: 292 Subcellular...
Q8EWY9
MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 32516 Sequence Length: 286 Subcellular...
Q6F203
MANLSNLKTQISNTQDIGKITNAMQLVASAKLRRIGKKVTETQEYVSEVYAIFNEIIKHSSESIYLKNSANDIKKTLWVVVNSNLGLCGGYNANVNKLVISNFKKEDQIYAIGSKAVSAYNSKKIKIKNECTDVDIDFSPAQAKQIGNELLSYYSSGEFDEIQIVYTKFINNVTFEPTKLRVFPIIKEETQETSSSYYSFEPSAEEVLNNAVTLYLSTIIFGTIVESQVSEQASRRLAMENATNNGKELEYNLSIQYNRERQASITQEISEIVSGANALMG
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 31416 Sequence Length: 281 Subcellular...
Q6KI81
MAELQKLSSRLKSVKVTRKITKAMELVAASKIRRAKESFFSNKEYFQIIQDIFDNLASKTEQIFLKKQMKFDKENNTNSILYIVINSDLGLCGAYNSSIAKEIKKEIKSKDKLFLIGKKGLLFLGKFKTQITNLDKVKEISTNYKNIKKISEKILSMFKSGDYKSIKIVYTKYVNAFTYLPTIKHALPILKSEKNINEATFSNLEFEPDPITIFQKAIPLYFSSLLYSCVLESHVSEVSSRRIAMENATKNADELGDQLKIELNTIRQSKITQEITEIVAGSETEI
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 32672 Sequence Length: 286 Subcellular...
Q1AVH8
MASLRDLKRQIQSVKNIAKVTDALQAVSAVKFRKAEARVKQARPYAENMEEVMRAIASKASTRNPMLAGREQVRRVAVATLTSDRGLCGSFNAQVLRRTVRFREQQGAEALQVASGRKGIAFFRFRRIGLAESYSGFTDDPSYEDAQRIGRGLTRLFEREEADEVYLVYNRFVNPAVQRPVVVRLLPAAPEGGEEGEGGTVSGAPFDFIPDADTILRRLIPQYVETLVWQALLESAAGEHGARMTAMKNATDNANELVDTLTLQMNKARQAQITREISEIAAGAEALAAG
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 31900 Sequence Length: 290 Subcellular...
O50141
MANMKDVKRRIKSVESTMQITKAMQLVASSKMRKAKERAEAVHPFFEGVFQVMADISRDHEFTSVFTKKKFKNSVLLIVIAGDRGLAGGFNTNVLKLAKAKADAITESGGEAVIMAIGKKAVEYFEKREYKLIDGFPQIAEGIELIDAMMIANKVIERFKIGDFDAVELVYTTFVSVMTQEPQHLRILPVENLEYLGQKHPMTIYDPSPEEVFDSLIPEYMGGMLYSAIVDSFASEQAARRTAMESASDNANEMIEKLSLLYNRARQAQITQEITEISSASLNDNS
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 31970 Sequence Length: 286 Subcellular...
B3EA02
MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAQKMGEVLQSLAGNLEGNLHPLLEKRDAKKLLLIVVTSDRGLCGGFNTNLCKAGERYIKEKQAEFDQISIMTVGRKGYEFLKSRHTVYKNFANMLSKPNYQAAAMLAQDVIEGYLAEEYDQVVMLFNSFRTVMSQDITFQQLLPIEPEEKIAADENGVEYIYEPSVSDLLTEILPKNIEVQIFKAMLESVAGEHGARMTAMDSASKNASEMIGKLTLQYNRARQAAITTELMEIISGAESIKG
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 32124 Sequence Length: 288 Subcellular...
A0A161CFW5
MSGKLRLYKEKLEGYNRFYSIVKTIKMVTLAKYRAAQGRIRTRDFSLRYTELAFSKPQASRDAVAAAKNALVYIPITTNRGSCGALNSNIVRCIDSVVSSKMVLMPVGKRGIDSFSKLYPDEFRYGIINDMKESMHFGYATFVIENAYEVSKDADRYQVIFNRFVSAGVQRNAVYNIPSYEKWKEDLADAASSDNQKNRYLFANALQNEEEQLIRDFFDFHAALAVLNAVGENELSEQAARLVAVEGQLTNISSLQQRTSSLYNKTRQFGITAALIEILSAMSSLEGNAMKGVRRNKFWEGAVTK
Function: Mitochondrial membrane ATP synthase (F(1)F(o) ATP synthase) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain . F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous cata...
B5ZAW2
MSLDAIKRKISSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVNDIEFLKIPNAKNRTLYITINSTMGLAGSYNYNVNKLVSKIINEDDITFTIGKKGHDFMRLSNRLHQVNTYLNLNDNDLTFDMSLQIAREALELYSNGEVNKICIIYTKFINAITFEVNNIDVLPFDKTVLTKDNLAETIELAKDNIIFQPNKVELVKKILPTYIATVLYGSLIESKISENASRRNAMDAATKNAKALAEDYKLIYNTLRQGKITREITEIVAGSDD
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 32343 Sequence Length: 286 Subcellular...
Q2LGZ2
DPLYTKFVSLVKSDPVIHTLLPLSPKGEICDINGVCVDAAEDEFFRLTTKEGKLTVERDVVRTKTTDYSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAMSNAAA
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 13024 Sequence Length: 118 Subcellular...
Q8D3J4
MYNIKDIRQKIIGIKKTQSITSAMEKISAIKMKKSQNLLNSTKPYYEKISLLLNKLLFQNIKYKHPYLKKRQIKCIGYIVVSTDRGLAGSLNINLFKKLLYEINKSKEKKINTKLVLIGSKAISFFRFFEDEIISTISGIGDTPKISELIKPVQIMLKEYDSNIIDKIYIISNKFINTMTYVPDIKKVLPISIKKSSIKFKNLNYLYEPDFSSLFESILPRYIESLIYQSIVENISSEQSARMVAMKSAMDNSKNLIEELSLIYNKARQSNITKELTEIIAGSNNIY
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 33088 Sequence Length: 287 Subcellular...
B3TN45
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVLIAVRNPQTIPTDGQNFFEYILEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH
Function: Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 27320 Sequence Length: 247 Subcellular Location: Plastid
O63075
MNPLLEIAEVSVGQHYYWELGGYELHGQVLITSWVVLGILAVLSFLGNTNLKSTPDGFQNFTELVTEFIRDLAKTQIGEEDYLKWVPFLGTIFLFIFVSNWSGALLPYRLIEIPNGELAAPTNDINTTVALALLTSISYFYAGISKKGLGYFSRYVEPAAFLLPINVLEDFTKPLSLSFRLFGNILADELVVGVLVALVPLIIPIPIMLLGVFTSAIQALVFATLAGAYINEALADHH
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
P22483
MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIAIVISLLILF
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
O66564
MMKRLMAILTAIMPAIAMAAEGEASVAKGLLYLGAGLAIGLAGLGAGVGMGHAVRGTQEGVARNPNAGGRLQTLMFIGLAFIETIALYGLLIAFILLFVV
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q5P4E7
MENVLGFVALAAGLIIGLGAIGACIGIGIMGSKYLEASARQPELMNALQTKMFLLAGLIDAAFLIGVGIAMMFAFANPFQLV
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
B6YR09
MLLSILLQVATGTGLAKLGEALGAGLAVIGAGLGIGKIGESAMEGIARQPEAAGDIRMNMIIAAALVEGVSLFAVVVCGFLL
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q98QU0
MENIISLLALKNDPTSATTGAGLVAVGAGLASIGNFGTGLGQGLSAGRAAEAVGRNPEAIKKIRSLMIIGMAISESASLYSFIIAILLVFVY
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q4A5Z9
MNQLQNLAEALSASSPVSGTVQTVVDGNTTTTTTTNTGLGVVAVGAGLAMIGAIGSGLGQGYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
B2A3G7
MIDGQSLVLAASAIGAGLAMIAGIGAGIGQGFAAGKGAESVGRQPDAQGDIIRTMLLGAAVAETTGIYALVIALLLLFANPLIGML
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q3J6M6
MDPELLVSIYASTAVSVGIILAAAGLGSALGWGLICSKYLEGIARQPEMRPQLMGQMLFTGGLMEAFPMIVLGMSMWFIFANPFTGAALAAIGS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q04G25
MNYIAAGIALCGSAIGAGIGNGMLMAKLIESIARQPELEGNLRTNMFISMALVEAMPIIVIAMSFVLINE
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q8DLP7
MNPLIASASVLAAALAIGLASLGPGLAQGNASGQALEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFANPFAS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
B5YGC8
MRKFFVILMVALVVVLTASAVFAADSDPAKLNYYGYATAGALIGLGAAAGGGGAGMGQGLRGILEGSARNPGVTGKLMTLFIVGLALIESLVIYVLVFVLITFYANPFVK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q83HY5
MGSVLAEVAGSLASIGYGLAAIGSAIGVGIVVGKTVESVARQPELAKRLTVLMYVGVAFTEALALIGIGTYFLFR
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
B5ZAW9
MSSFIDITNVISSHVEANLPAVSAENVQSLANGAGIAYLGKYIGTGITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
A1WF53
MEIILGFVALACGLIVGLGAIGASIGIGLMGGKFLESSARQPELINELQTKMFILAGLIDAAFLIGVAIALMFAFANPFVSTLLANMPK
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
P0A309
METLLSFSAIAVGIIVGLASLGTAIGFALLGGKFLEGAARQPEMAPMLQVKMFIIAGLLDAVPMIGIVIALLFTFANPFVGQLG
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
Q8D3J8
MNSINADLLYISAAIIMGFASIGAAIGIGILGGKFLEGAARQPDLIPTLRTQFFIVMGLVDAIPMISVGLGLYLIFAAS
Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During c...
P59384
MLLLGISILALAWRPAGSSEPEWEVVVPIRRDPDINGRHYYRRGTEDSGDQGLIFQITAFQQDFYLHLTPDAQFLAPAFATEYLGVPLQRLTGSSLDLRRCFYSGYVNAEPDSFAAVSLCGGLRGAFGYRGAEYVISPLPNTSAPEAQRHSQGAHLLQRRGAPVGPSGDPTSRCGVASGWNPAILRALDPYKPRRTGAGESHNRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEHYLLTLLATAARLYRHPSILNPINIVVVKVLLLGDRDTGPKVTGNAALTLRNFCAWQKKLNKVSDKHPEYWDTAILFTRQD...
Cofactor: Binds 1 zinc ion per subunit. Function: Metalloprotease which has proteolytic activity against the proteoglycan VCAN, cleaving it at the 'Glu-1401-|-1402-Ala' site . Cleaves VCAN in the pericellular matrix surrounding myoblasts, facilitating myoblast contact and fusion which is required for skeletal muscle de...
Q5W7F4
MPCCLWAALSLLLAVVGAGAWTPPRQPLLLTPRHRRHAQETHHLRLLGWDLKLKENKAIRSPYYKECQFFTGRVLHEEGSAVTVTECDGQLYGLLQVGGEEFVLQPTRTQEKHVLRRRDVTHSERSAEYNLTGDTVIDLDLDFDEDDDLLPTSHVHPRHSDHSDKEYFHDMHLFRRPASGVKGLWLELAIVADNTMLKFHGRERVKHYILALMNIVSAIFNDPSLGSNITLVINKLFLYEDKDIILKYGNIKKSLEAINKWNYRHLMKLPEGSTGWDATIWLTRSQLGGPSGFAPVGGVCTKTRSAAIDRDEGLTSAFVI...
Cofactor: Binds 1 zinc ion per subunit. Function: Involved in larval molting and metamorphosis. May degrade extracellular matrix (ECM) and basement membrane (BM) during the development of organs to allow degeneration and remodeling of tissues. Sequence Mass (Da): 113853 Sequence Length: 1007 Subcellular Location: Secre...
Q9UHI8
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEELVVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAPLQFHLLRRNRQGDVGGTCGVVDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVGQPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPE...
Cofactor: Binds 1 zinc ion per subunit. Function: Cleaves aggrecan, a cartilage proteoglycan, at the '1938-Glu-|-Leu-1939' site (within the chondroitin sulfate attachment domain), and may be involved in its turnover (By similarity). Has angiogenic inhibitor activity. Active metalloprotease, which may be associated with...
P97857
MQPKVPLGSRKQKPCSDMGDVQRAARSRGSLSAHMLLLLLASITMLLCARGAHGRPTEEDEELVLPSLERAPGHDSTTTRLRLDAFGQQLHLKLQPDSGFLAPGFTLQTVGRSPGSEAQHLDPTGDLAHCFYSGTVNGDPGSAAALSLCEGVRGAFYLQGEEFFIQPAPGVATERLAPAVPEEESSARPQFHILRRRRRGSGGAKCGVMDDETLPTSDSRPESQNTRNQWPVRDPTPQDAGKPSGPGSIRKKRFVSSPRYVETMLVADQSMADFHGSGLKHYLLTLFSVAARFYKHPSIRNSISLVVVKILVIYEEQKGP...
Cofactor: Binds 1 zinc ion per subunit. Function: Cleaves aggrecan, a cartilage proteoglycan, at the '1691-Glu-|-Leu-1692' site (within the chondroitin sulfate attachment domain), and may be involved in its turnover. Has angiogenic inhibitor activity (By similarity). Active metalloprotease, which may be associated with...
A0A0U5GGX2
MVDKSNKVALVLGATGISGWALAKNALSYPSRSTFQRVIGLMHRPRTVEETGLPNDPRLELYSGVDLQGDLNHVVVKLKEKIPRIEEVTHVYYLAYMTLQTCSGDMRQFRDANVAMTYTAVHACDRLCPNMEFFVLQTGTNAYGVACFDYLRQTQLQVPLRESNPRVPRPWSDTLFYYAQADLIKEANKGKAWKWCEVRPDQIVGHTPAQVSVPYVAPMALYLALYRYINGPGARVQFPGTVRNYHHTYTDVRPDTMARAELYLSLVKSDESHGEAFNIADTDTPGPWSAKWPSICRYFGLEASETIDDEWTDIDGWWYA...
Function: Short chain dehydrogenase; part of the gene cluster that mediates the biosynthesis of calidodehydroaustin, a fungal meroterpenoid . The first step of the pathway is the synthesis of 3,5-dimethylorsellinic acid by the polyketide synthase ausA . 3,5-dimethylorsellinic acid is then prenylated by the polyprenyl t...
A0A0U5GJ41
MTILDKRQIQRFASDTDIETLSKAIDDDGVAIVRSVVSRDVIQRLQKEVESSDQPVWLEDNPSLKDSKFPSQARHANNLVPASKTYRDDILNNSAVHTTCKAVFRDVGDYWLTTGILRTTKPGSPAQGFHRDALLYPVLQYQPPTSPPLTVALLVSMTDATVANGATRVILGSHKWETVGTPSEDQAVRAELDAGDMLVIHQRLVHAGGEHTHQAPDTRRMLLMFLTSCQLVALESPLALSRELVETMTPLAQKMVGWRTVRPVEPNTVGLNTHRSGCLEDGLKLRAAKPLEGQDGH
Function: Iron/alpha-ketoglutarate-dependent dioxygenase; part of the gene cluster that mediates the biosynthesis of calidodehydroaustin, a fungal meroterpenoid . The first step of the pathway is the synthesis of 3,5-dimethylorsellinic acid by the polyketide synthase ausA . 3,5-dimethylorsellinic acid is then prenylate...
A0A1U8QGE6
MTIIPKRSYNVLTTCKAVFRDVGDYWLTTGNLRTTKPQSPAQGFHRDTLLYPVLQYQPATSPSLIVTLLVSMTDATVANGATRVILSSQNGRLLNTIGGPGRASRAKRWGHAGNPSAAAARWWEAYESGTEYKTNATNFLHKMLASCS
Function: Iron/alpha-ketoglutarate-dependent dioxygenase; part of the gene cluster B that mediates the biosynthesis of austinol and dehydroaustinol, two fungal meroterpenoids . The first step of the pathway is the synthesis of 3,5-dimethylorsellinic acid by the polyketide synthase ausA . 3,5-dimethylorsellinic acid is ...
A0A0U5GHD4
MYNLKNQVIVITGSSSGIGLAASTIALSSGAKVFGVDIRPPPSTLTSQSNYACLQYDLSSSSTVSDIVAACEGAFGPRIDGLLNIAGVMDLNQSADTLADEIWERCIAVNLTAPVKLMREVLPVMQRQGGGSIVNVASKAALSGAVSGVAYTASKHGLVGATKNVAWRFKHERIRCNVVCPGGVGATSIRDGVDVTQFDAAALETMALIHQAHGCDREKGVELQPQDIAHMLLFLLDERSRGVSGAVIPVDNAWSTI
Function: Short chain dehydrogenase; part of the gene cluster that mediates the biosynthesis of calidodehydroaustin, a fungal meroterpenoid . The first step of the pathway is the synthesis of 3,5-dimethylorsellinic acid by the polyketide synthase ausA . 3,5-dimethylorsellinic acid is then prenylated by the polyprenyl t...
P9WEP2
MFIISQYREHRSLSILTQTCTIFRSMQVSSKHENLSVSFHLTPLQVLIITGTSSGIGLAAATMALEEGAKVLGVDISKPPDSLARHANYQFFQADLSHPEAPARVVEACSRTYGDRIDGLLNIAGVMDLNQSADSLSDNVWERCISINLTAPVKLMREVIPIMKLRGKGSIVNVASKAALSGAVSGVAYTASEHPWP
Function: Short chain dehydrogenase; part of the gene cluster A that mediates the biosynthesis of austinol and dehydroaustinol, two fungal meroterpenoids . The first step of the pathway is the synthesis of 3,5-dimethylorsellinic acid by the polyketide synthase ausA . 3,5-dimethylorsellinic acid is then prenylated by th...
A0A0U5GJZ5
MQPSLLDRISSVTGNRSKRHAKFRLGRLQQPPTESTTRLAISDGAQAIDETKSPRQSEPGATQCKSEGSGDDIADGPQPMPAPNEGDTPTLDELQQGPNPRGSGIVSGWKLAAVLTALSLAVFCMALDSTVLSTAIPKITAEFNSLHDMGWYVSAYNLTISSFSLIYGKLYSLYRVKWVYLSTLFLFEAGSLVCGAAPSSLALIIGRAIAGVGGAGVFLGSMIIVHEIMPLHHVPLFLSLISGLYGIASVVGPLLGGVFTDYVSWRWCFYINLPIGGVTALIIVLFVRPRARDQATVKKTVWAQFLELDPLGMVLILPAV...
Function: MFS-type transporter; part of the gene cluster that mediates the biosynthesis of calidodehydroaustin, a fungal meroterpenoid. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 65630 Sequence Length: 614 Subcellular Location: Membrane
Q96247
MSEGVEAIVANDNGTDQVNGNRTGKDNEEHDGSTGSNLSNFLWHGGSVWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGIVLQIFYGLLGSWTAYLISVLYVEYRARKEKEGKSFKNHVIQWFEVLDGLLGSYWKALGLAFNCTFLLFGSVIQLIACASNIYYINDHLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIASIIHGQAEGVKHSGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLMATLYVFTLTIPSAAAVYWAFGDALLDHSNAFSLMPKNAWRDAAVILMLI...
Function: Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root ape...
P57094
MSMSVNEKGICYLPDLGSSFTEDAPRPPVPGEEGDLVSSDGRQYNHSFYSSKSDSLKNEASIATPRRPDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEECADMLDFWFACSGFRKQEANDGNEKMLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVTKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLEYTRTGGESPKLFSDQSSVSGNGKVLPGYLPTVIEDVEWRCDQEEEQIAESDPTPSNRLTQKLPLETVPQRVANSKRYQDNREYRHASWREPVNPYYVNSGYALAPATS...
Function: Component of the beta-catenin destruction complex required for regulating ctnnb1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling . Controls dorsoventral patterning via two opposing effects: down-regulates ctnnb1 to inhibit the Wnt signaling pathway and ventralize embryos, but a...
O15169
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSAND...
Function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling . Controls dorsoventral patterning via two opposing effects; down-regulates CTNNB1 to inhibit the Wnt signaling pathway and ventralize embryos, but a...
P57095
MNRTLTDPMVSSFREDDPRPPVPGEEGETTCHHPSKLAMMRPKDPVKTIMADLRCSTARRDEDGLGEPEGSASPDSPLARWTKSLHFLLGDQDGAQLFRAYLEREKCVDTLDFWFACNGFRQMDLKDTKTHRVAKAIYKRYIENNSIVAKQLKPATKTFIRDNIKRQQIDSAMFDQAQMEIQTAMEENAYQMFLTSDIYLEYVRTGCENPSHVNPNGLGGLKLVCGYLPTLNEEEEWSCNDFKAKALATVVGLSAKTLRSPPLRAVEALEKGYRSYRRSDPGNPNRFTSGYSFAPATSANDSEVSSDALTDDSMSMTDSS...
Function: Component of the beta-catenin destruction complex required for regulating ctnnb1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (By similarity). Controls dorsoventral patterning by down-regulating ctnnb1 to inhibit the Wnt signaling pathway and ventralize embryos . PTM: ADP-ri...
Q9Y2T1
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDSEISSDALTDDSMSMTDSSVD...
Function: Inhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B. PTM: Probably phosphorylated by GSK3B and dephosphorylated by PP2A. Sequence Mass (Da): 93568 Sequence Length: 843 Domain: The tankyrase-binding motif (also named TBD)...
O70240
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQAVMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLKCKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSEPVNPYHVGSGYVFAPATSANDSELSSDALTDDSMSMTDSSVD...
Function: Inhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B. PTM: ADP-ribosylated by tankyrase TNKS and TNKS2. Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination and subsequent activation of the Wnt...
Q9ZV69
MAEPKTKYDRQLRIWGELGQSALETASICLLNCGPTGSEALKNLVIGGIGSITIVDGSKVEIGDLGNNFMVDAKSVGQSRAKTVCGFLQELNDSVKANFVEENPDTLISTDPSFFSQFTLVIATQLVEDSMVKLDRICREANVMLVLARSYGLTGFVRISVKEHTAIETKPDHSLDDLRLNSPWPELKSYVESIDLNVEEPAAHKHIPYVVILVKVAEEWAQHHSGNLPSTREEKNEFKDLVKSKMVSADEENYKEALLAAFKVFAPTGISQEIQDINHDSCAEVGSNSSDFWVMVAALKEFISNEGGGEVPLEGSMPDM...
Function: Regulatory subunit of the dimeric ECR1-AXL1 E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cyst...
P38928
MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESFTFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFNVILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNEVFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPETSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYVYLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNS...
Function: Required for haploid cells axial budding pattern. Acts as an anchor to help direct new growth components and/or polarity establishment components like the BUD5 GTP/GDP exchange factor to localize at the cortical axial budding site. Regulates septin organization in late G1 independently of its role in polarity...
P50080
MKGEPKTYSMSDLSYYGEKAQQQNEKQQKQYVVRRNSTQSTSKQNVSVVLEDNASESNELPKGFILYASLIALALSLFLAALDIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSVTWRWCFYVNLPIGGLAFFLFLFFYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKIKGFSKLNGWRKPFMELIFMYDIIEFVFCSAGFTCILLAFTFGG...
Function: Transporter protein required for adaptation to high stress imposed by low-chain organic acids, in particular by acetic acid, and for resistance to azoles, especially to ketoconazole and fluconazole. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 67169 Sequence Length: 613 Subcellular Locat...
A1B2F3
MKDWLFRIATCSIMTFSSLAAAQAEPLDVVATFSIIGDFAAKVGGDRIRLNVLVGPDSDTHVYEPRPADAIALAGADVVLTNGLEFEGFLTRLIAASGTDAAVATLTDGVETMEEPGGGHYHYIDGKAVFHAGAHDPHAWQAVPNAKVYVQNIAAAFCAADAEGCAAYQANAARYIGELDALDTEIRAAIAALPQDRRTVVVAHNAFRYFEAAYGVHFLSPQGVSTESEAAAADVAGLIREIRARNASAIFAENISDTRLLEQIAREAGLPLAGTLYSDALSGPDGPASNYIAMMRHNAGAIAAALAAR
Function: Part of the ATP-binding cassette (ABC) transport system AztABCD involved in zinc import . Binds zinc with high affinity and specificity and delivers it to the membrane permease for translocation into the cytoplasm . Sequence Mass (Da): 32387 Sequence Length: 309 Domain: The D-loop is required for the efficien...
P04377
MRNIAIKFAAAGILAMLAAPALAENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Cofactor: Binds 1 copper ion per subunit. Function: This soluble electron transfer copper protein is required for the inactivation of copper-containing nitrite reductase in the presence of oxygen. Serves as a direct electron donor to the nitrite reductase. Sequence Mass (Da): 15647 Sequence Length: 146 Subcellular Loca...
P80401
MFHHSLAAAAAALLALAAPGFAATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPKKARERMDAELAQVN
Cofactor: Binds 1 copper ion per subunit. Function: This soluble electron transfer copper protein is required for the inactivation of copper-containing nitrite reductase in the presence of oxygen. Sequence Mass (Da): 15446 Sequence Length: 145 Subcellular Location: Periplasm
Q52825
MPLKFGLIVATAALIASAASLMAADHQVQMLNKGTDGAMVFEPGFLKIAPGDTVTFIPTDKSHNVETFKGLIPDGVPDFKSKPNEQYQVKFDIPGAYVLKCTPHVGMGMVALIQVGDNPANLEPIKIAKVPNMVRKRLDADLAQITPAQITQ
Cofactor: Binds 1 copper ion per subunit. Function: This soluble electron transfer copper protein is required for the inactivation of copper-containing nitrite reductase in the presence of oxygen. Sequence Mass (Da): 16283 Sequence Length: 152 Subcellular Location: Periplasm
Q6P3P5
MLISARRLRRCQFFQLLTSCFVLSLMALLVQEDNSLINHVKSYSYRYLINSYDFVNDSLSVPRDRPDGAPSYRYLINNRDKCQNEDVLLLLFVKTSPENRRRRNAIRKTWGNEDYIRSQYAANIKVVFALGIEADPVKSHQTQKDLVIENKRFNDLIQQDFKDTFHNLTLKLLLQFGWVNSYCPSAKFIMSADDDIFVHTPNLVSYLKSLPIETQDFWIGRVHRGSPPIRSKTSKYYVPYEMYPWSSYPDYTAGAAYVVSKDVAAKVYEASQTLNTSLYIDDVFMGICANKMGVVPQYHVYFAGEGKAPYHPCIYNKMIT...
Function: Beta-1,3-N-acetylglucosaminyltransferase that plays a key role in the synthesis of lacto- or neolacto-series carbohydrate chains on glycolipids. Catalytic Activity: a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1...
Q6ZMB0
MAFPCRRSLTAKTLACLLVGVSFLALQQWFLQAPRSPREERSPQEETPEGPTDAPAADEPPSELVPGPPCVANASANATADFEQLPARIQDFLRYRHCRHFPLLWDAPAKCAGGRGVFLLLAVKSAPEHYERRELIRRTWGQERSYGGRPVRRLFLLGTPGPEDEARAERLAELVALEAREHGDVLQWAFADTFLNLTLKHLHLLDWLAARCPHARFLLSGDDDVFVHTANVVRFLQAQPPGRHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYCSGGGFLLSGPTARALRAAARHTPLFPIDDAYMGMCLERAG...
Function: Beta-1,3-N-acetylglucosaminyltransferase that synthesizes the core 3 structure of the O-glycan, an important precursor in the biosynthesis of mucin-type glycoproteins. Plays an important role in the synthesis of mucin-type O-glycans in digestive organs. Catalytic Activity: 3-O-[N-acetyl-alpha-D-galactosaminyl...
Q8NFL0
MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYGDILQWGFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTL...
Function: N-acetyl glucosamine (GlcNAc) transferase that catalyzes the transfer of GlcNAc via a beta1->3 linkage from UDP-GlcNAc to the non-reducing terminal galactose (Gal) in the linearly growing chain of N- and O-linked keratan sulfate proteoglycans. Cooperates with B4GALT4 galactosyltransferase and CHST6 and CHST1 ...
Q8K0J2
MSLWKKTLYKSVCLALALLVAVTVFQRSVTPGQFLQDPLPPTPGPAKTGNLVNPNSFWKSSKDVAAPTPTVPRGPQVWDVITTNCSININLTHQPWFQSLEPHFRQFLAYRHCRYFPMLLNHPEKCAGDVYMLVVVKSVITQHDRREVIRQTWGHEWESAGLGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFVFKGDDDVFVNPTNLLEFLSDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFLMSGSLARQLHHACDTLELFP...
Function: N-acetyl glucosamine (GlcNAc) transferase that catalyzes the transfer of GlcNAc via a beta1->3 linkage from UDP-GlcNAc to the non-reducing terminal galactose (Gal) in the linearly growing chain of N- and O-linked keratan sulfate proteoglycans. Cooperates with B4GALT4 galactosyltransferase and CHST6 and CHST1 ...
Q7Z7M8
MRCPKCLLCLSALLTLLGLKVYIEWTSESRLSKAYPSPRGTPPSPTPANPEPTLPANLSTRLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLPGGGGSQVSSCSDTDVPYLLLAVKSEPGRFAERQAVRETWGSPAPGIRLLFLLGSPVGEAGPDLDSLVAWESRRYSDLLLWDFLDVPFNQTLKDLLLLAWLGRHCPTVSFVLRAQDDAFVHTPALLAHLRALPPASARSLYLGEVFTQAMPLRKPGGPFYVPESFFEGGYPAYASGGGYVIAGRLAPWL...
Function: Beta-1,3-N-acetylglucosaminyltransferase that plays a role in the elongation of specific branch structures of multiantennary N-glycans. Has strong activity towards tetraantennary N-glycans and 2,6 triantennary glycans. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 43396 Sequence ...