ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
E0Y3X0
MAIEEKSTSAEPGPYDALSRFSSLTGEDDRKWWEHTGPVLEKVMRDSGYELQSQYIYLYFVQQHLIPYLGKFPTRGQDDHRWQSNLTPYKVPYELSWNVSHKVVRISWDPVCDASGTENDAFNKKAIHDCTRQLAELDSTVILDRYRLLHKDLVITDEEEQQLLRRDVLPKSGRGQHNLAVDFQEGGITLKVYFYPYMKFLATGTPIEELFFSAIEKLRIADIDEAVGMLKCFLSPKSDDGKPSVDEKVFPSLLACDLCDPSKSRIKYYVIDKWVKWERIANLWTIGGRRLEDPYCAKGLALLKELWDLLAIPEGDRGDIWPNLVLGQPPTHLMTTIANYTLSPASRFPEPQVYLTTFGLNDMAIIDALTAFYERVGFTDMAKSYKKNVQSYYPNLDLNQTNWVHEAVSFSYRNSKPYLSVYYSPF
Function: Prenyltransferase; part of the gene cluster that mediates the biosynthesis of notoamide, a fungal indole alkaloid that belongs to a family of natural products containing a characteristic bicyclo[2.2.2]diazaoctane core . The first step of notoamide biosynthesis involves coupling of L-proline and L-tryptophan by the bimodular NRPS notE, to produce cyclo-L-tryptophan-L-proline called brevianamide F . The reverse prenyltransferase notF then acts as a deoxybrevianamide E synthase and converts brevianamide F to deoxybrevianamide E via reverse prenylation at C-2 of the indole ring leading to the bicyclo[2.2.2]diazaoctane core . Deoxybrevianamide E is further hydroxylated at C-6 of the indole ring, likely catalyzed by the cytochrome P450 monooxygenase notG, to yield 6-hydroxy-deoxybrevianamide E (Probable). 6-hydroxy-deoxybrevianamide E is a specific substrate of the prenyltransferase notC for normal prenylation at C-7 to produce 6-hydroxy-7-prenyl-deoxybrevianamide, also called notoamide S . As the proposed pivotal branching point in notoamide biosynthesis, notoamide S can be diverted to notoamide E through an oxidative pyran ring closure putatively catalyzed by either notH cytochrome P450 monooxygenase or the notD FAD-linked oxidoreductase (Probable). This step would be followed by an indole 2,3-epoxidation-initiated pinacol-like rearrangement catalyzed by the notB FAD-dependent monooxygenase leading to the formation of notoamide C and notoamide D . On the other hand notoamide S is converted to notoamide T by notH (or notD), a bifunctional oxidase that also functions as the intramolecular Diels-Alderase responsible for generation of (+)-notoamide T (Probable). To generate antipodal (-)-notoaminide T, notH' (or notD') in Aspergillus versicolor is expected to catalyze a Diels-Alder reaction leading to the opposite stereochemistry (Probable). The remaining oxidoreductase notD (or notH) likely catalyzes the oxidative pyran ring formation to yield (+)-stephacidin A (Probable). The FAD-dependent monooxygenase notI is highly similar to notB and is predicted to catalyze a similar conversion from (+)-stephacidin A to (-)-notoamide B via the 2,3-epoxidation of (+)-stephacidin A followed by a pinacol-type rearrangement (Probable). Finally, it remains unclear which enzyme could be responsible for the final hydroxylation steps leading to notoamide A and sclerotiamide (Probable). Catalytic Activity: 6-hydroxydeoxybrevianamide E + dimethylallyl diphosphate = diphosphate + notoamide S Sequence Mass (Da): 49102 Sequence Length: 426 Pathway: Alkaloid biosynthesis. EC: 2.5.1.-
L7WR40
MRDIRELLLVLFTSCLALGSVPSSFDGDRYCRCQPGEACWPSLADWQALNMSIQGTLVEVRPIGHVCHEPTYNKADCERVSKLSSNGTWRASQPGAQQEHAWEVSLSRNESCYVGPANPAEPCGQGRIPRYSAMVETTEQAQKAIRFARERRLRLVIKNTGHDSGGRSSAVDSFQILTQRLKDISFIEEFTPTLAETRGPSVRIGAGVLTKELYAVADEHGYTAMGGECATVGVAGGYIQGGGVSTALTPMMGLAADLVQEFEVISAEGSLVIANEFQNQDLFWALRGGGGGTVGLVTSITMPVFGAIPANISELSFESQQPDEAFWTAVKEMIYVTRDITTGGNSGQYWVGRGPTGSYFVRQTLFFLGETDIEPADKMGSLLRVLQDQEIAFRFNVTAYPRLSSFLAIPQGEFVGGIAFHQENILIPQGFYDSPEGPAQLVDRLAEVKLNPGDMWVANTLGGQVMANKDVDNAMHSGWRTASVLLVGNRIFEPALKSQLDVQERLTAVEGPLLHSIGQPAPEAIYLNEADADLENWQDWFWGEKYARLRDIKSKWDPDDLFLVRHGVGSEDWDEDGMCRMQLSPQECPVREHSRCTCKFFECAMLHVPGLL
Function: FAD-linked oxidoreductase; part of the gene cluster that mediates the biosynthesis of notoamide, a fungal indole alkaloid that belongs to a family of natural products containing a characteristic bicyclo[2.2.2]diazaoctane core . The first step of notoamide biosynthesis involves coupling of L-proline and L-tryptophan by the bimodular NRPS notE', to produce cyclo-L-tryptophan-L-proline called brevianamide F (Probable). The reverse prenyltransferase notF' then acts as a deoxybrevianamide E synthase and converts brevianamide F to deoxybrevianamide E via reverse prenylation at C-2 of the indole ring leading to the bicyclo[2.2.2]diazaoctane core (Probable). Deoxybrevianamide E is further hydroxylated at C-6 of the indole ring, likely catalyzed by the cytochrome P450 monooxygenase notG', to yield 6-hydroxy-deoxybrevianamide E (Probable). 6-hydroxy-deoxybrevianamide E is a specific substrate of the prenyltransferase notC' for normal prenylation at C-7 to produce 6-hydroxy-7-prenyl-deoxybrevianamide, also called notoamide S (Probable). As the proposed pivotal branching point in notoamide biosynthesis, notoamide S can be diverted to notoamide E through an oxidative pyran ring closure putatively catalyzed by either notH' cytochrome P450 monooxygenase or the notD' FAD-linked oxidoreductase (Probable). This step would be followed by an indole 2,3-epoxidation-initiated pinacol-like rearrangement catalyzed by the notB' FAD-dependent monooxygenase leading to the formation of notoamide C and notoamide D (Probable). On the other hand notoamide S is converted to notoamide T by notH' (or notD'), a bifunctional oxidase that also functions as the intramolecular Diels-Alderase responsible for generation of (-)-notoamide T (Probable). To generate antipodal (+)-notoaminide T, notH (or notD) in Aspergillus strain MF297-2 is expected to catalyze a Diels-Alder reaction leading to the opposite stereochemistry (Probable). The remaining oxidoreductase notD' (or notH') likely catalyzes the oxidative pyran ring formation to yield (-)-stephacidin A (Probable). The FAD-dependent monooxygenase notI' is highly similar to notB' and is predicted to catalyze a similar conversion from (-)-stephacidin A to (+)-notoamide B via the 2,3-epoxidation of (-)-stephacidin A followed by a pinacol-type rearrangement (Probable). Finally, it remains unclear which enzyme could be responsible for the final hydroxylation steps leading to notoamide A and sclerotiamide (Probable). Sequence Mass (Da): 67308 Sequence Length: 612 Pathway: Alkaloid biosynthesis. EC: 1.-.-.-
I4AY86
MTAPELRAPAGHPQEPPARSSPAQALSSYHHFPTSDQERWYQETGSLCSRFLEAGQYGLHQQYQFMFFFMHHLIPALGPYPQKWRSTISRSGLPIEFSLNFQKGSHRLLRIGFEPVNFLSGSSQDPFNRIPIADLLAQLARLQLRGFDTQCFQQLLTRFQLSLDEVRQLPPDDQPLKSQGAFGFDFNPDGAILVKGYVFPYLKAKAAGVPVATLIAESVRAIDADRNQFMHAFSLINDYMQESTGYNEYTFLSCDLVEMSRQRVKIYGAHTEVTWAKIAEMWTLGGRLIEEPEIMEGLARLKQIWSLLQIGEGSRAFKGGFDYGKASATDQIPSPIIWNYEISPGSSFPVPKFYLPVHGENDLRVARSLAQFWDSLGWSEHACAYPDMLQQLYPDLDVSRTSRLQSWISYSYTAKKGVYMSVYFHSQSTYLWEED
Function: Deoxybrevianamide E synthase; part of the gene cluster that mediates the biosynthesis of notoamide, a fungal indole alkaloid that belongs to a family of natural products containing a characteristic bicyclo[2.2.2]diazaoctane core . The first step of notoamide biosynthesis involves coupling of L-proline and L-tryptophan by the bimodular NRPS notE', to produce cyclo-L-tryptophan-L-proline called brevianamide F (Probable). The reverse prenyltransferase notF' then acts as a deoxybrevianamide E synthase and converts brevianamide F to deoxybrevianamide E via reverse prenylation at C-2 of the indole ring leading to the bicyclo[2.2.2]diazaoctane core . Deoxybrevianamide E is further hydroxylated at C-6 of the indole ring, likely catalyzed by the cytochrome P450 monooxygenase notG', to yield 6-hydroxy-deoxybrevianamide E (Probable). 6-hydroxy-deoxybrevianamide E is a specific substrate of the prenyltransferase notC' for normal prenylation at C-7 to produce 6-hydroxy-7-prenyl-deoxybrevianamide, also called notoamide S (Probable). As the proposed pivotal branching point in notoamide biosynthesis, notoamide S can be diverted to notoamide E through an oxidative pyran ring closure putatively catalyzed by either notH' cytochrome P450 monooxygenase or the notD' FAD-linked oxidoreductase (Probable). This step would be followed by an indole 2,3-epoxidation-initiated pinacol-like rearrangement catalyzed by the notB' FAD-dependent monooxygenase leading to the formation of notoamide C and notoamide D (Probable). On the other hand notoamide S is converted to notoamide T by notH' (or notD'), a bifunctional oxidase that also functions as the intramolecular Diels-Alderase responsible for generation of (-)-notoamide T (Probable). To generate antipodal (+)-notoaminide T, notH (or notD) in Aspergillus strain MF297-2 is expected to catalyze a Diels-Alder reaction leading to the opposite stereochemistry (Probable). The remaining oxidoreductase notD' (or notH') likely catalyzes the oxidative pyran ring formation to yield (-)-stephacidin A (Probable). The FAD-dependent monooxygenase notI' is highly similar to notB' and is predicted to catalyze a similar conversion from (-)-stephacidin A to (+)-notoamide B via the 2,3-epoxidation of (-)-stephacidin A followed by a pinacol-type rearrangement (Probable). Finally, it remains unclear which enzyme could be responsible for the final hydroxylation steps leading to notoamide A and sclerotiamide (Probable). Catalytic Activity: brevianamide F + dimethylallyl diphosphate = deoxybrevianamide E + diphosphate Sequence Mass (Da): 49567 Sequence Length: 435 Pathway: Alkaloid biosynthesis. EC: 2.5.1.109
A6R538
MAPARPILLRFESRNGQFRLTVNPTDEFPSLLPKVLDNLPKNTAPPSIVLSNKPIGTGGQERNISTLKGVTIQRVGLSHGDKLFIGYEEETAVVNGSSSEHPSSISKSQNAPRRLDGVAVRQQEQAPPVPTPTSETLIKNPWEAVKQSPLDDRLDRKDGKISRGLDHKMCRHGPKGMCDYCMPLEPYAPEYLAEKKIKHLSFHSYLRKINSSTNKPELKSSYIPPLSEPDYRVKRDCPSGHPAWPEGICTKCQPSAITLQPQPFRMVDHVEFSSPDLINSLLDFWRKSGTQRLGFLYGTYEEYTEVPLGIKAVVQAIYEPPQVGEVDGVTLHEWGNEKDVDEVAKFCGLEKIGVIFTDLLDAGAGDEIVFAAQLQARYPKATKWSETGRFGSNFVTCVLSGDEDGAISISAYQASNSAVEMVKADIIEPSADPGVMLVQQENHSDDDASKARYIPEVFYRKVNEYGANVQENAKPSFPVEYLLVTLTHGFPTDPDVMFNNSTFPIENREVIGESQDLRMLADKLVSHGDPNKTICGVSDFHLLCFLNSLGILNKDEEFLLCTVARSHDTADGMQLINTSGWATLVTILQESGERPPKRSWPFQSQTFISSHQRSKHPQAPKSEHPQSDSEQLAKRFKGASLG
Function: Involved in the import of nuclear-targeted proteins into the nucleus and the export of poly(A) RNA out of the nucleus. Has a role in the endoplasmic reticulum-associated degradation (ERAD) pathway (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 71205 Sequence Length: 642 Subcellular Location: Cytoplasm
Q74ZJ1
MILRFRSKHGMQRVNCEGSEQFGTVLDRWVKLVHERAPREAMEVGVAERQIETRIAAEMAQKTVEQLGLKHGDMLSVSFKETGGSLAVAAAPERSSELAVDRELAREEGLIRRSHSRLCRHGDRGMCEYCSPLPPWDRGYQQEQNLKHISFHAHVKELNEHTNKKASGSTYIPPLSPPDFHVNKHCPAPHEPWPRGICSKCQPSAISLQQQEFRMVDHVEFQHSELVNEFINTWRSTGMQRFGYLYGRYARYDNTPLGIKAVVEAIWEPEQHDEQDGLTMDTVAVRVSVAAVDAIAADMGLMRLGMIFTDLTDSGSGDGSVFCKRHKDSFFLSSLEVITAARHQLHHRNACRFSDQGFYSSKFVTCVVSGNLQGEIDVAAYQVSTDAEALVDADIISGSTHPSMAYINEPSAERYVPEIFYMRRNEYGITIKENAKPAFPVDYLIVSLTHGFPVAADTPPTFQAHTGFPWANRQAMGQSQDYLELRRVLLPSIAAGDYTELHRRLSSFHLLLYLHSLQILDASEWRRLVTVATTPAPRGVEAVYDLISGPGWQTLVMILQEAA
Function: Involved in the import of nuclear-targeted proteins into the nucleus and the export of poly(A) RNA out of the nucleus. Has a role in the endoplasmic reticulum-associated degradation (ERAD) pathway (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 63253 Sequence Length: 563 Subcellular Location: Cytoplasm
A1CS06
MAATRPIILRFESRNGQFRLSVSPQELFPTLKQKILENLPKDVEPSSITLSNKPIGTGGEERSLDGLEGVSIEQVGLKHGDKLFVGYQERKGGETTPAKAHAAADSLRRLNGALVPQTETVTFRPPTSSSATVKNPWEVVQQSPLDDKLDKKDGKIQRPRDMKMCKHGPKGMCDYCMPLEPYDPKYLAEKKIKHLSFHSYMRKINAATNKAELKSSFMPPLSEPYYRVRHDCPSGHPPWPEGICTKCQPSAISLQPQEFRMVDHVEFSSPDLINSLLDFWRKSGSQRLGFLYGTYEEYTEVPLGVKAVVQAIYEPPQVDEVDGVTLHEWPNEKEVDEVARLCGLEKVGVIFTDLLDAGRGDGSVVCKRHIDSYYLSSLEIAFASRLQAQYPKTTKWSRTGRFGSNFVTCVLSGDEEGAITISSYQASVSAVEMVRADIVEPSAEPSVMLVQSEDDDSDNKSRYIPEVFYRKINEYGVSAQQNAKPSFPVEFLLVTLTHGFPTESNPLFTKSTFPIENREVIGESQDLRSVAKKLVSHRDSNEVIPEVSDFHLLCYLHSLSTFSKTNANRLHSKITRTVTTNLMTPQDEEKLLCRVATSHDPTEGLKLINTPGWATLVTILQESGERPPKRPWLNPADPPRPLSQQGKRHLSSRPESPKSESEQLAKRFKGASLE
Function: Involved in the import of nuclear-targeted proteins into the nucleus and the export of poly(A) RNA out of the nucleus. Has a role in the endoplasmic reticulum-associated degradation (ERAD) pathway (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 75417 Sequence Length: 674 Subcellular Location: Cytoplasm
Q5AA50
MSSIILRFRSKDGMFRITTDSSSNFTLVLEQLIEKLSQSGNNGNGNGNNNKIDLQSLTIANKPQDKGKSSYEFQNQTVNELGLKNGDMLYVNYESVTNDSGPTTTATNTTTNTASGNTIPITGPVPSIPINSVVTSHGPLKVEELPIDQELDKEDGLITRPLSSMCRHGPKGMCEYCSPLPPWDENYRKDHAIKHISFHAYLKQQLEKLKSSGGSYFPPLDPVDYSIDLTCNQGHKPYPNGICSKCQPSPITLQLQKFRMVDHLEFADSFILNDFINVWRVSGVQRFGYLYGRYAKSEKTPLGIKAIVETIIEPPQHDELDGITLLDWDQQEEKMVDQVANKFGLYKVGIIFTDLTDAGTKNGKVLCKRHKDSYFLTNLEIIMAAKFQLKYPNISKYSTAKNNGQFSSKFVTCVISGGLNGEIEPRSYQVSTSAEALVKADIITGCTQPSQIYVNESNNHRYVPDIQYSKINKYGLEVKSNAKPTFPGEFLLVSLTDSFPLQPTPIFTNSYVIENREFLGDENHDIQSLKTLHNYLKSNNDQIFNFHFILHLIKTHILNDQEIDLLIEYIKSKNLEDYLKLVESNGWMTLMTILEQSV
Function: Involved in the import of nuclear-targeted proteins into the nucleus and the export of poly(A) RNA out of the nucleus. Has a role in the endoplasmic reticulum-associated degradation (ERAD) pathway (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 67354 Sequence Length: 598 Subcellular Location: Cytoplasm
P0CP30
MLLRIRSPAGTARLTVQPETTGEDFAEAILNTIPAADPQPDPATLALSNQPGAAGESVPFHALSGRTVGDMGFSHGDLLFLSYKPRAADPDSHPAMQATAPHPQPAQPDPSHPKTHTDPPMPNTIPLRDLSSVQEPEIDQYWEKQTGKIERKRDPAFCRHGDKAMCDYCMPLEPYDPKFQSEHQIKHLSYHAYLRKLLSSRPPTASSATDLPPLSPTSLSVITPCPTGAHPSFPDGICSTCQPSAVTLQSQPFRMVDHIEFASPSIIEGLLSAWRRTGTQRIAFLIGREDKYEKVPMGIKVIVEAVWEPKQEGELDGLTVETPWSDESRVQEIAKWCDKGLSVVGMIYTDLTPSPDDITKTLYKRHAQSYTASSLEMLLSAAYQLSHPLSTRMSPTGHYSSRFVTCCLTGDKDGGVDILAWQASEHAEAMVKAGIVEASVDPAVVRVRKPGEGEYVPEVFYSYKNEYGLQVKMPAKPTFPVEYLYVNITHGFPLAPSPLFLSNAFPTENRPGLHDQSMQVVITQLAAILKTSDAEIGDAGTWPGRIKKDVEKWLSDWHLVTFLCMQGLFSLKEQQILCRAATAHAHPNDTHALEELFASGGWQTLLTIVDSEASANARSNPPPTSSFNNLGIDSPAFAGPSTESSAPPSGPDSVGAGAGAGAGGGRERVCPHCTFVNEHGGSDCEICGLPLDG
Function: Involved in the import of nuclear-targeted proteins into the nucleus and the export of poly(A) RNA out of the nucleus. Has a role in the endoplasmic reticulum-associated degradation (ERAD) pathway (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 75103 Sequence Length: 693 Subcellular Location: Cytoplasm
Q8TAT6
MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKRSEQWATIEQLCSTVGGQLPGLHEYGAVGGSTHTATAAMWACQHCTFMNQPGTGHCEMCSLPRT
Function: The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). Acts as a negative regulator of type I interferon production via the complex formed with VCP and UFD1, which binds to RIGI and recruits RNF125 to promote ubiquitination and degradation of RIGI . Sequence Mass (Da): 68120 Sequence Length: 608 Domain: Binds ubiquitinated proteins via its RanBP2-type zinc finger. Pathway: Protein degradation; proteasomal ubiquitin-dependent pathway. Subcellular Location: Cytoplasm
A4RN19
MLLRLRGPDGMLRIELDPKDTFNKLGQELMGKLPPTVDPATITVSNAPGSQGDKKLLKDIAKYKVEAIGLKHGDLIFVDYKHQGAEADGTANSDGASQPLTSTTNRLNGQPVLPTEDLPIDPLPTPAPGATIKNPWEVVRQSPLDDRLDKKDGKIPRKRDAMCRHGPKGMCDYCQPLDPFDAKFLAEKKIKYLSMHAHLRKINSATNKPELGSSFIPPLSEPYFRVKHDCPSGHPQWPEGICSKCQPSAITLQPQPFRMVDHVEFASPSIVDSFINTWRRTGGQRYGIMYGKYSEYEEVPLGIKAVVQAIYEPPQVDEVDGVSLNSWDNEKDVNQVARLCGLEPVGAIWTDLLDAGAGDGSVVCKRHADSYFLSSLEVCFAARLQAQHPKPSKWSDTGRFGSNFVTCIISGNEQGEIAISSYQVSNEAVEMVRADIMEPSADPTVMLVREEEEDDGSTSRTRYIPDVFYRRINEYGANVQENAKPSFPVEYLFVTLTHGFPDVAKPMFSDEGAFPIENREYMGESQEHSAAAKALKVHEKASSGSSKDGMKVSNFHLLCFLHQMSVLSKDEESLLCRVATQHDLADAFQLRSTTGWQTLMAILQSTGERIPKRSRQTDVLAADPAASSYPGRRGIDDSDERLAKRFASVRLNARGDGRNGRDRPSAHET
Function: Involved in the import of nuclear-targeted proteins into the nucleus and the export of poly(A) RNA out of the nucleus. Has a role in the endoplasmic reticulum-associated degradation (ERAD) pathway (By similarity). Location Topology: Peripheral membrane protein Sequence Mass (Da): 74006 Sequence Length: 669 Subcellular Location: Cytoplasm
Q9UTK3
MSEPAVVSILDTDLYKLTMLQAVLEHYPDAQVSYKYTNRSPKMALNQEAYNWLREQIRGLRNLHLLPEEEQWLRKNCPYLKESFYEFMHEFEFDPENSISLNYDSETKDLSIFIHGLWKNTIFYEIPLLALVSESYFKFVDKDWSPEGQFEKAYEKGKRLIRAGCAFTDFGTRRRRDPHTQEIVLQGLMKAQEDFKGPGSFLGTSNVYFAAKYNLNVSGTVAHEWYMGIAAITQNYKQANRIASLKWVQTFGTSLLIALTDTFSTDVFLKSFTANSADDLANVFHGVRQDSGCAEEYIEKVVKHYKSIGVDPSTKVIVHSDALNVDRCIELYKYCEKCGIKSAFGIGTNLTSDFQKVSNPSEVSKPMNIVIKLFSAEGTKAVKISDDIMKNTGDRDAVIQAKHQLCLPIA
Cofactor: Activity is highest with Mn(2+). Function: Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate. Helps prevent cellular oxidative stress via its role in NAD biosynthesis. PTM: Transiently phosphorylated on a His residue during the reaction cycle. Phosphorylation strongly increases the affinity for substrates and increases the rate of nicotinate D-ribonucleotide production. Dephosphorylation regenerates the low-affinity form of the enzyme, leading to product release. Catalytic Activity: 5-phospho-alpha-D-ribose 1-diphosphate + ATP + H2O + nicotinate = ADP + diphosphate + nicotinate beta-D-ribonucleotide + phosphate Sequence Mass (Da): 46694 Sequence Length: 410 Pathway: Cofactor biosynthesis; NAD(+) biosynthesis; nicotinate D-ribonucleotide from nicotinate: step 1/1. EC: 6.3.4.21
P39683
MSEPVIKSLLDTDMYKITMHAAVFTNFPDVTVTYKYTNRSSQLTFNKEAINWLKEQFSYLGNLRFTEEEIEYLKQEIPYLPSAYIKYISSSNYKLHPEEQISFTSEEIEGKPTHYKLKILVSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQAEKKAETLFDNGIRFSEFGTRRRRSLKAQDLIMQGIMKAVNGNPDRNKSLLLGTSNILFAKKYGVKPIGTVAHEWVMGVASISEDYLHANKNAMDCWINTFGAKNAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDPVEYTKKISHHYHDVLKLPKFSKIICYSDSLNVEKAITYSHAAKENGMLATFGIGTNFTNDFRKKSEPQVKSEPLNIVIKLLEVNGNHAIKISDNLGKNMGDPATVKRVKEELGYTERSWSGDNEAHRWT
Function: Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate . Essential for growth under anaerobic conditions . PTM: Transiently phosphorylated on a His residue during the reaction cycle (By similarity). Phosphorylation strongly increases the affinity for substrates and increases the rate of nicotinate D-ribonucleotide production . Dephosphorylation regenerates the low-affinity form of the enzyme, leading to product release (By similarity). Catalytic Activity: 5-phospho-alpha-D-ribose 1-diphosphate + ATP + H2O + nicotinate = ADP + diphosphate + nicotinate beta-D-ribonucleotide + phosphate Sequence Mass (Da): 49019 Sequence Length: 429 Pathway: Cofactor biosynthesis; NAD(+) biosynthesis; nicotinate D-ribonucleotide from nicotinate: step 1/1. Subcellular Location: Cytoplasm EC: 6.3.4.21
Q06495
MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLKVPLMLTFLYLFVCSLDMLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPDLAVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQVMVGVGTPFGALLAFVVLINVLQSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCCARPEPRSPPLPPRVFLEELPPATPSPRLALPAHHNATRL
Function: Involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane . The cotransport has a Na(+):Pi stoichiometry of 3:1 and is electrogenic (By similarity). Catalytic Activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 68937 Sequence Length: 639 Subcellular Location: Apical cell membrane
Q06496
MMSYSERLGGPAVSPLPVRGRHMVHGAAFAYVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQEEEQKPEPRLSQKLAQVGTKLLKVPLMLGFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIRGGRDAPDLLKVITEPFTKLIIQLDKSVITSIAVGDESLRNHSLIRIWCQPETKEASTSMSRVEAIGSLANTTMEKCNHIFVDTGLPDLAVGLILLAGSLVVLCTCLILLVKMLNSLLKGQVANVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNISGILLWYPLPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQAMVGVGTPFGALLAFVVLVNVLQSRSPGHLPKWLQTWDFLPRWMHSLQPLDGLITRATLCYARPEPRSPQLPPRVFLEELPPATPSPRLALPAHHNATRL
Function: Involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane . The cotransport has a Na(+):Pi stoichiometry of 3:1 and is electrogenic . Catalytic Activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 68707 Sequence Length: 637 Subcellular Location: Apical cell membrane
O97704
MISYGENLGGRAVSPLPVRGGHMMHGAAFAYVPSPQVLHRIPGTSAYGFPSVGPMALPEHGCPYGEVVEHHDPLPAKLALEDERKPEPGLIQKLRRAGVTLLKVPLMLSFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIVVSMVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLVVASFNIRGGRDAPDLLKIITEPFTKLIIQLDKSVITSLASGDESLRNHSLIRVWCYPNPTEVPTPMPRAEANTSRMLRNATLEKCNHIFVDTGLPDLAVGLILLAGSLALLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPTPFTWATGYFAMVVGASMTFVVQSSSVFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQIALCHFFFNISGILLWYPVPCTRLPIRMAKALGKRTAKYRWFAVLYLLLCFLLLPSMVFGLSMAGWRAMVGVGAPFGALLAFVVLVSALQHRSPGCLPKWLQTWDFLPLWVHSLKPLDHLITRATLCCARPEPRSPPLPTRVFLEELPPATPSPRLAMPHHHDATRL
Function: Involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. The cotransport has a Na(+):Pi stoichiometry of 3:1 and is electrogenic. Catalytic Activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 69023 Sequence Length: 639 Subcellular Location: Apical cell membrane
O95436
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRAAIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNALRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLIPLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL
Function: Involved in actively transporting phosphate into cells via Na(+) cotransport. Catalytic Activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 75759 Sequence Length: 690 Subcellular Location: Apical cell membrane
Q9JJ09
MAPWPELENAHPNPNKFIEGASGPQSSIPDKDKGTSKTNDSGTPVAKIELLPSYSALVLIEEPPEGNDPWDLPELQDNGIKWSERDSKGKILCIFQGIGKFILLLGFLYLFVCSLDVLSSAFQLVGGKMAGQFFSNNSIMSNPVAGLVIGVLVTVMVQSSSTSSSIIVSMVASSLLSVRAAIPIIMGANIGTSITNTIVALMQAGDRNEFRRAFAGATVHDFFNWLSVLVLLPLEAATHYLEKLTNLVLETFSFQNGEDAPDILKVITDPFTKLIIQLDKKVIQQIAMGDSEAQNKSLIKIWCKTISNVIEENVTVPSPDNCTSPSYCWTDGIQTWTIQNVTEKENIAKCQHIFVNFSLPDLAVGIILLTVSLLILCGCLIMIVKLLGSVLRGQVATVIKKTLNTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSAMTPLIGIGVISIERAYPLTLGSNIGTTTTAILAALASPGNTLRSSLQIALCHFFFNISGILLWYPIPFTRLPIRLAKGLGNISAKYRWFAVFYLIFFFLLTPLTVFGLSLAGWPVLVGVGVPIILLILLVLCLRMLQARCPRILPLKLRDWNFLPLWMHSLKPWDNIISLATSCFQRRCCCCCRVCCRVCCMVCGCKCCRCSKCCKNLEEEEKEQDVPVKASGGFDNTAMSKECQDEGKGQVEVLGMKALSNTTVF
Function: Involved in actively transporting phosphate into cells via Na(+) cotransport. Catalytic Activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 75992 Sequence Length: 695 Subcellular Location: Apical cell membrane
Q8N130
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVAGLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNSTAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRTVINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGSNIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVVTARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMELAAVGGPLVGLVLLVILVTVLQRRRPAWLPVRLRSWAWLPVWLHSLEPWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL
Function: Involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane . The cotransport has a Na(+):Pi stoichiometry of 2:1 and is electroneutral (By similarity). Catalytic Activity: 2 Na(+)(out) + phosphate(out) = 2 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 63550 Sequence Length: 599 Subcellular Location: Apical cell membrane
Q80SU6
MPNSLAGGQVPNPTLDAFDLVDRSLRNAGISGSIPGLEEGGTDPWTFSPLKNADQLKEVGMASRLRRVVSSFLKACGLLGSLYFFICSLDILSSAFQLLGSKMAGDIFKDNVVLSNPVAGLVIGVLVTVLVQSSSTSSSIVVSMVASKLLTVQVSVPIIMGVNVGTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATAALERLSELALGAASLQPGQQAPDILKALTRPFTHLIIQLDSSVITSGITSNTTNSSLIKHWCGFRGETPQGSSEGCGLFSSCTERNSSASPEEDRLLCHHLFAGSKLTDLAVGFILLAGSLLVLCVCLVLIVKLLNSVLKGRIAQAVKTVINADFPFPFGWLSGYLAILVGAGLTFLLQSSSVFTAAIVPLMGVGVIDLERAYPLFLGSNIGTTTTALLAALASPADMLIFAVQVALIHFFFNLAGILLWYLVPVLRLPIPLAKRFGNLTAQYRWVAIVYLLLTFLLLPLAAFGLSLAGGTVLAAVGGPLVGLVLLIILVNVLQQHRPSWLPRCLQSWAWLPLWLHSLEPWDRLVTACCPCRACSNSPMTSKVAHCYENPQVIASQQL
Function: Involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane . The cotransport has a Na(+):Pi stoichiometry of 2:1 and is electroneutral . Catalytic Activity: 2 Na(+)(out) + phosphate(out) = 2 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 63939 Sequence Length: 601 Subcellular Location: Apical cell membrane
Q5SZA1
MDEKPTTRKGSGFCSLRYALALIMHFSNFTMITQRVSLSIAIIAMVNSTQHQDPANASTEGPVMDLLSNQSRGIKDFSTRAAVYQWSTETQGIIFSSISYGIILTLIPSGYLAGIFGAKQILGAGLLISSLLTLFTPLAADFGVILVIVIRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTSIAGSGAAFGSFIILCVGGLISQALGWPFIFYIFGSIGCVCCVLWFTVIYDDPMHHPCISVREKEHITSSVAQQSSSPRRSVPIKAMVRCLPLWAIFMGFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGGQMADFLLSRNLLSLITVRKLFSSLGLLLPSLCAVALPFVTSSYIATIVLLILIPGTSNLCDSGFIINTLDVAPRYASFLMGISRGFGLTAGIISSTTTGFLISQDSESGWRNVFFLSAAVNMFGLIFYLIFGQAEIQSWAKERTLTRL
Function: Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions . Mediates chloride-dependent transport of urate . Can actively transport inorganic phosphate into cells via Na(+) cotransport . Catalytic Activity: 3 Na(+)(out) + phosphate(out) = 3 Na(+)(in) + phosphate(in) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51965 Sequence Length: 478 Subcellular Location: Apical cell membrane
P58796
MVKVNIIFYSMYGHVYRMAEAVAAGAREVEGAEVGIYQVPETLPEEVLEKMGAIETKKLFAHIPVLTREMNEEVLAGADALIFGTPTRYGNMTAQMRAVLDGLGGLWNRDAFVGKVGSVFTSSGTQHGGQESTILTFHVTLLHLGMILVGLPYSEKRQTRMDEITGGSPYGVSTIAGGDGSRQPSENELAMARYQGRHVTLIAKKIAGK
Cofactor: Binds 1 FMN per monomer. Catalytic Activity: a quinone + H(+) + NADH = a quinol + NAD(+) Sequence Mass (Da): 22604 Sequence Length: 209 EC: 1.6.5.2
Q1QX85
MGIRNTLDKLEPHFHQGGKYEKFYALYEAVDTIFYSPPSVTKSTAHVRDGIDLKRIMITVWLCTFPAMFFGMYNAGLQANMAIGDGFGALGGWREAVTMALAGSHDPGSIWANFVLGATYFLPIYLVTFAVGGFWEVLFAVKRGHEVNEGFFVTSVLYALILPATIPLWQVALGITFGVVIGKEIFGGTGKNFLNPALTGRAFLYFAYPAQISGDSVWVAADGYTGATALSTAAQNGMSAVQQAYSWWDAFLGFIPGSVGETSTLAILIGAAVLLITRIASWRIMLGVFVGMALTAMLFTAIGSESNPMFGMPWYWHLVLGGFAFGMVFMATDPVSASMTDPGKLLFGFLIGVMTVLIRVVNPAFPEGIMLAILFANLFAPMIDHFFVQANIKRRMKRDAAYSPATNEETA
Function: NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol. Catalytic Activity: a ubiquinone + H(+) + n Na(+)(in) + NADH = a ubiquinol + n Na(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 44600 Sequence Length: 411 Subcellular Location: Cell inner membrane EC: 7.2.1.1
Q7UWS1
MVEQYLSVFLKAVFVENLALAFFLGMCTFLAVSKNVKTAIGLGIAVIAIETITVPANQLIYSLLLKKGALTWVNDYLISTDTYNFAEVDLTFLGFISYIGVIAAMVQILEMFLDRFMPSLYNALGIFLPLITVNCAILGASLFMEQREYPFGESVVFGFGCGVGWALAIMALAGIREKLKYSDVPPPLRGLGITFITVGLMSLAFMSFSGIQL
Function: NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol. Catalytic Activity: a ubiquinone + H(+) + n Na(+)(in) + NADH = a ubiquinol + n Na(+)(out) + NAD(+) Location Topology: Multi-pass membrane protein Sequence Mass (Da): 23262 Sequence Length: 213 Subcellular Location: Cell inner membrane EC: 7.2.1.1
Q56589
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYNLVLRENALVEGVDLSFLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESIVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL
Function: NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol. PTM: The N-terminus is blocked. Location Topology: Multi-pass membrane protein Catalytic Activity: a ubiquinone + H(+) + n Na(+)(in) + NADH = a ubiquinol + n Na(+)(out) + NAD(+) Sequence Mass (Da): 21540 Sequence Length: 198 Subcellular Location: Cell inner membrane EC: 7.2.1.1
Q68D85
MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDAPILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ
Function: Triggers NCR3-dependent natural killer cell activation. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 50827 Sequence Length: 454 Domain: The C-terminal part is similar to retroviral Gag protein. This putative protein seems to be the result of a fusion between an Ig-like domain-containing protein and a ERV. Subcellular Location: Cell membrane
P22736
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
Cofactor: Binds 2 zinc ions. Function: Orphan nuclear receptor. Binds the NGFI-B response element (NBRE) 5'-AAAGGTCA-3' . Binds 9-cis-retinoic acid outside of its ligand-binding (NR LBD) domain . Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation . Regulates the inflammatory response in macrophages by regulating metabolic adaptations during inflammation, including repressing the transcription of genes involved in the citric acid cycle (TCA) (By similarity). Inhibits NF-kappa-B signaling by binding to low-affinity NF-kappa-B binding sites, such as at the IL2 promoter . May act concomitantly with NR4A2 in regulating the expression of delayed-early genes during liver regeneration (By similarity). Plays a role in the vascular response to injury (By similarity). PTM: Phosphorylated at Ser-351 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli. Sequence Mass (Da): 64463 Sequence Length: 598 Domain: The NR LBD domain binds the lipid A moiety of lipopolysaccharide (LPS) in the cytosol. Subcellular Location: Nucleus
P12813
MPCIQAQYGTPATSPGPRDHLTGDPLALEFGKPTMDLASPETAPAAPATLPSFSTFMDGYTGEFDTFLYQLPGTTQPCSSACSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLDETLSSSGSEYYGSPCSAPSPSTPNFQPSQLSPWDGSFGHFSPSQTYEGLWAWTEQLPKASSGPPPPPTFFSFSPPTGPSPSLAQSSLKLFPPPATHQLGEGESYSMPAAFPGLAPTSPNRDTSGILDAPVTSTKSRSGASGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPTNLLTSLIRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWAEKIPGFIELCPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHQLQCARGFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMATVAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF
Cofactor: Binds 2 zinc ions. Function: Orphan nuclear receptor. Binds the NGFI-B response element (NBRE) 5'-AAAGGTCA-3' . Binds 9-cis-retinoic acid outside of its ligand-binding (NR LBD) domain (By similarity). Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation (By similarity). Regulates the inflammatory response in macrophages by regulating metabolic adaptations during inflammation, including repressing the transcription of genes involved in the citric acid cycle (TCA) . Inhibits NF-kappa-B signaling by binding to low-affinity NF-kappa-B binding sites, such as at the IL2 promoter . May act concomitantly with NR4A2 in regulating the expression of delayed-early genes during liver regeneration (By similarity). Plays a role in the vascular response to injury . PTM: Phosphorylated at Ser-354 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli. Sequence Mass (Da): 64738 Sequence Length: 601 Domain: The NR LBD domain binds the lipid A moiety of lipopolysaccharide (LPS) in the cytosol. Subcellular Location: Nucleus
Q04913
MPCIQAQHGSLSQCAGPCDNYVPDILNSEFGKFTMDLVNSEIAASTSLPSFSTFMDGYTGEFDAFLYQIPSSNQQSSLKVEEFQVFGCYPGSFTNQLDETMSSSGSDYYGSPCSIPSPSTPGFQNPQLPTWECSYGAYSPTQNYDNMRHWTEQQKNSISQQTFFSFGTPAHSPNMAANPLKIAPATHRLDQQLVDTDVFALAQNSSAGFPAVPLGQAPGVLDSSVLLDSPLSPSKTRSPSSNEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLVVGMVKEVVRTDSLKGRRGRLPSKPKQIAESSPVDLINSLVRAHIDSIPSSSKLDYSKFQETVPLQLEKESSVDVQQFYDLLSGSLEVIRKWAEKIQGFVDLPKEDQDLLLESAFLELFILRLAYRSRPEEGKLIFCNGVVLHRTQCVRGFGEWIDSIIEFSHSLQRMNIDVPSFSCLSALVIVTDRHGLKEPKKVEELQSQIINCLKEHIPSSMNEQNRPNCLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF
Cofactor: Binds 2 zinc ions. Function: Orphan nuclear receptor. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. Sequence Mass (Da): 64383 Sequence Length: 577 Domain: The NR LBD domain may bind the lipid A moiety of lipopolysaccharide (LPS) in the cytosol. Subcellular Location: Nucleus
P43354
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Function: Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development . It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons (By similarity). Sequence Mass (Da): 66591 Sequence Length: 598 Domain: the ligand-binding domain (LBD) contains no cavity as a result of the tight packing of side chains from several bulky hydrophobic residues in the region normally occupied by ligands. NR4A2 lacks a 'classical' binding site for coactivators . Subcellular Location: Cytoplasm
Q06219
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPSTPSFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQDPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Function: Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development . It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons . Sequence Mass (Da): 66593 Sequence Length: 598 Domain: the ligand-binding domain (LBD) contains no cavity as a result of the tight packing of side chains from several bulky hydrophobic residues in the region normally occupied by ligands. NR4A2 lacks a 'classical' binding site for coactivators (By similarity). Subcellular Location: Cytoplasm
Q92570
MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSISTFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Function: Transcriptional activator that binds to regulatory elements in promoter regions in a cell- and response element (target)-specific manner. Induces gene expression by binding as monomers to the NR4A1 response element (NBRE) 5'-AAAAGGTCA-3' site and as homodimers to the Nur response element (NurRE) site in the promoter of their regulated target genes (By similarity). Plays a role in the regulation of proliferation, survival and differentiation of many different cell types and also in metabolism and inflammation. Mediates proliferation of vascular smooth muscle, myeloid progenitor cell and type B pancreatic cells; promotes mitogen-induced vascular smooth muscle cell proliferation through transactivation of SKP2 promoter by binding a NBRE site (By similarity). Upon PDGF stimulation, stimulates vascular smooth muscle cell proliferation by regulating CCND1 and CCND2 expression. In islets, induces type B pancreatic cell proliferation through up-regulation of genes that activate cell cycle, as well as genes that cause degradation of the CDKN1A (By similarity). Negatively regulates myeloid progenitor cell proliferation by repressing RUNX1 in a NBRE site-independent manner. During inner ear, plays a role as a key mediator of the proliferative growth phase of semicircular canal development (By similarity). Mediates also survival of neuron and smooth muscle cells; mediates CREB-induced neuronal survival, and during hippocampus development, plays a critical role in pyramidal cell survival and axonal guidance. Is required for S phase entry of the cell cycle and survival of smooth muscle cells by inducing CCND1, resulting in RB1 phosphorylation. Binds to NBRE motif in CCND1 promoter, resulting in the activation of the promoter and CCND1 transcription (By similarity). Also plays a role in inflammation; upon TNF stimulation, mediates monocyte adhesion by inducing the expression of VCAM1 and ICAM1 by binding to the NBRE consensus site (By similarity) . In mast cells activated by Fc-epsilon receptor cross-linking, promotes the synthesis and release of cytokines but impairs events leading to degranulation (By similarity). Also plays a role in metabolism; by modulating feeding behavior; and by playing a role in energy balance by inhibiting the glucocorticoid-induced orexigenic neuropeptides AGRP expression, at least in part by forming a complex with activated NR3C1 on the AGRP- glucocorticoid response element (GRE), and thus weakening the DNA binding activity of NR3C1. Upon catecholamines stimulation, regulates gene expression that controls oxidative metabolism in skeletal muscle (By similarity). Plays a role in glucose transport by regulating translocation of the SLC2A4 glucose transporter to the cell surface . Finally, during gastrulation plays a crucial role in the formation of anterior mesoderm by controlling cell migration. Inhibits adipogenesis (By similarity). Also participates in cardiac hypertrophy by activating PARP1 (By similarity). PTM: Phosphorylated by PRKDC. Sequence Mass (Da): 68230 Sequence Length: 626 Domain: The AF-1 domain mediates transcription activation. The N-terminal region (1-292) directly interacts with the C-terminal LBD (380-627): the interaction is potentiated by AF-1-mediated recruitment of NCOA2. Subcellular Location: Nucleus
P51179
MPCVQAQYSPSPPGSTYATQTYGSEYTTEIMNPDYAKLTMDLGSTGIMATATTSLPSFSTFMEGYPSSCELKPSCLYQMPPSGPRPLIKMEEGREHGYHHHHHHHHHHHHHHQQQQPSIPPPSGPEDEVLPSTSMYFKQSPPSTPTTPGFPPQAGALWDDELPSAPGCIAPGPLLDPQMKAVPPMAAAARFPIFFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALEGHPYGLPLAKRTATLTFPPLGLTASPTASSLLGESPSLPSPPNRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDATPRDLDYSRYCPTDQATAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQRKGQALEPSEPKVLRALVELRKICTQGLQRIFYLKLEDLVSPPSVIDKLFLDTLPF
Function: Transcriptional activator that binds to regulatory elements in promoter regions in a cell- and response element (target)-specific manner . Induces gene expression by binding as monomers to the NR4A1 response element (NBRE) 5'-AAAAGGTCA-3' site and as homodimers to the Nur response element (NurRE) site in the promoter of their regulated target genes . Plays a role in the regulation of proliferation, survival and differentiation of many different cell types and also in metabolism and inflammation. Mediates proliferation of vascular smooth muscle, myeloid progenitor cell and type B pancreatic cells; promotes mitogen-induced vascular smooth muscle cell proliferation through transactivation of SKP2 promoter by binding a NBRE site (By similarity). Upon PDGF stimulation, stimulates vascular smooth muscle cell proliferation by regulating CCND1 and CCND2 expression . In islets, induces type B pancreatic cell proliferation through up-regulation of genes that activate cell cycle, as well as genes that cause degradation of the CDKN1A . Negatively regulates myeloid progenitor cell proliferation by repressing RUNX1 in a NBRE site-independent manner. During inner ear, plays a role as a key mediator of the proliferative growth phase of semicircular canal development (By similarity). Mediates also survival of neuron and smooth muscle cells; mediates CREB-induced neuronal survival, and during hippocampus development, plays a critical role in pyramidal cell survival and axonal guidance. Is required for S phase entry of the cell cycle and survival of smooth muscle cells by inducing CCND1, resulting in RB1 phosphorylation. Binds to NBRE motif in CCND1 promoter, resulting in the activation of the promoter and CCND1 transcription (By similarity). Also plays a role in inflammation; Upon TNF stimulation, mediates monocyte adhesion by inducing the expression of VCAM1 and ICAM1 by binding to the NBRE consensus site (By similarity). In mast cells activated by Fc-epsilon receptor cross-linking, promotes the synthesis and release of cytokines but impairs events leading to degranulation. Also plays a role in metabolism; by modulating feeding behavior; and by playing a role in energy balance by inhibiting the glucocorticoid-induced orexigenic neuropeptides AGRP expression, at least in part by forming a complex with activated NR3C1 on the AGRP-glucocorticoid response element (GRE), and thus weakening the DNA binding activity of NR3C1. Upon catecholamines stimulation, regulates gene expression that controls oxidative metabolism in skeletal muscle (By similarity). Plays a role in glucose transport by regulating translocation of the SLC2A4 glucose transporter to the cell surface (By similarity). Finally, during gastrulation plays a crucial role in the formation of anterior mesoderm by controlling cell migration (By similarity). Also participates in cardiac hypertrophy by activating PARP1 . PTM: Phosphorylated by PRKDC. Sequence Mass (Da): 68564 Sequence Length: 628 Domain: The AF-1 domain mediates transcription activation. The N-terminal region (1-292) directly interacts with the C-terminal LBD (380-627): the interaction is potentiated by AF-1-mediated recruitment of NCOA2. Subcellular Location: Nucleus
P07071
MTIEKEIEGLIHKTNKDLLNENANKDSRVFPTQRDLMAGIVSKHIAKNMVPSFIMKAHESGIIHVHDIDYSPALPFTNCCLVDLKGMLENGFKLGNAQIETPKSIGVATAIMAQITAQVASHQYGGTTFANVDKVLSPYVKRTYAKHIEDAEKWQIADALNYAQSKTEKDVYDAFQAYEYEVNTLFSSNGQTPFVTITFGTGTDWTERMIQKAILKNRIKGLGRDGITPIFPKLVMFVEEGVNLYKDDPNYDIKQLALECASKRMYPDIISAKNNKAITGSSVPVSPMGCRSFLSVWKDSTGNEILDGRNNLGVVTLNLPRIALDSYIGTQFNEQKFVELFNERMDLCFEALMCRISSLKGVKATVAPILYQEGAFGVRLKPDDDIIELFKNGRSSVSLGYIGIHELNILVGRDIGREILTKMNAHLKQWTERTGFAFSLYSTPAENLCYRFCKLDTEKYGSVKDVTDKGWYTNSFHVSVEENITPFEKISREAPYHFIATGGHISYVELPDMKNNLKGLEAVWDYAAQHLDYFGVNMPVDKCFTCGSTHEMTPTENGFVCSICGETDPKKMNTIRRTCGYLGNPNERGFNLGKNKEIMHRVKHQ
Function: Catalyzes the conversion of ribonucleotides into deoxyribonucleotides, which are required for DNA synthesis and repair. Catalytic Activity: a ribonucleoside 5'-triphosphate + formate + H(+) = a 2'-deoxyribonucleoside 5'-triphosphate + CO2 + H2O Sequence Mass (Da): 67957 Sequence Length: 605 EC: 1.1.98.6
P28903
MTPHVMKRDGCKVPFKSERIKEAILRAAKAAEVDDADYCATVAAVVSEQMQGRNQVDINEIQTAVENQLMSGPYKQLARAYIEYRHDRDIEREKRGRLNQEIRGLVEQTNASLLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPRDVVQAHERGDIHYHDLDYSPFFPMFNCMLIDLKGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGGTTINRIDEVLAPFVTASYNKHRKTAEEWNIPDAEGYANSRTIKECYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGTSWESRLIQESILRNRIAGLGKNRKTAVFPKLVFAIRDGLNHKKGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVWENENGEQIHDGRNNLGVISLNLPRIALEAKGDEATFWKLLDERLVLARKALMTRIARLEGVKARVAPILYMEGACGVRLNADDDVSEIFKNGRASISLGYIGIHETINALFGGEHVYDNEQLRAKGIAIVERLRQAVDQWKEETGYGFSLYSTPSENLCDRFCRLDTAEFGVVPGVTDKGYYTNSFHLDVEKKVNPYDKIDFEAPYPPLANGGFICYGEYPNIQHNLKALEDVWDYSYQHVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDASRVSVTRRVCGYLGSPDARPFNAGKQEEVKRRVKHLGNGQIG
Function: Catalyzes the conversion of ribonucleotides into deoxyribonucleotides, which are required for DNA synthesis and repair . Can reduce each of the four common ribonucleoside triphosphates . Catalytic Activity: a ribonucleoside 5'-triphosphate + formate + H(+) = a 2'-deoxyribonucleoside 5'-triphosphate + CO2 + H2O Sequence Mass (Da): 80023 Sequence Length: 712 Domain: Modulators bind to two classes of sites, one that binds ATP and dATP and regulates pyrimidine ribonucleotide reduction ('pyrimidine site'), the other that binds dATP, dGTP, and dTTP and regulates purine ribonucleotide reduction ('purine site'). EC: 1.1.98.6
Q9L646
MTPHVMKRDGCKVPFKSERIKEAILRAAKAAGVDDADYCATVAEVVSSQMNARSQVDINEIQTAVENQLMSGPYKQLARAYIEYRHDRDIQREKRGRLNQEIRGLVEQTNSALLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPRDVVQAHERGDIHYHDLDYSPFFPMFNCMLIDLKGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGGTTINRIDEVLAPFVTESYNKHRKTADEWQIPDAEGYARSRTEKECYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGTSWESRLIQASILRNRIAGLGKNRKTAVFPKLVFAIRDGLNHKFGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVWENENGEQIHDGRNNLGVISLNLPRIALEAKGDETAFWKLLDERLALARKALMTRIARLEGVKARVAPILYMEGACGVRLKADDDVSEIFKNGRASISLGYIGIHETINALFGGEHLYDSEQLRAKGIAIVERLRQAVDQWKDETGYGFSLYSTPSENLCDRFCRLDTAEFGVVPGVTDKGYYTNSFHLDVEKKVNPYDKIDFEAPYPPLANGGFICYGEYPNIQHNLKALEDVWDYSYQHVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDAARVSVTRRVCGYLGSPDARPFNAGKQEEVKRRVKHLGNGQIG
Function: Catalyzes the conversion of ribonucleotides into deoxyribonucleotides, which are required for DNA synthesis and repair. Catalytic Activity: a ribonucleoside 5'-triphosphate + formate + H(+) = a 2'-deoxyribonucleoside 5'-triphosphate + CO2 + H2O Sequence Mass (Da): 79959 Sequence Length: 712 EC: 1.1.98.6
P07075
MNYDRIYPCDFVNGPGCRVVLFVTGCLHKCEGCYNRSTWNARNGQLFTMNTVKELASHLSKSYIQGLTLTGGDPLYPQNREEISNLVSWVKARFPEKDIWLWTGYKFEDIKQLEMLKYVDVIIDGKYEKNLPTKKLWRGSDNQRLWSNTDGVWKHD
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine. Catalytic Activity: glycyl-[protein] + reduced [flavodoxin] + S-adenosyl-L-methionine = 5'-deoxyadenosine + glycin-2-yl radical-[protein] + H(+) + L-methionine + semiquinone [flavodoxin] Sequence Mass (Da): 18247 Sequence Length: 156 EC: 1.97.1.-
P45080
MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDDVMEQQIINDLKDTRIKRQGLTLSGGDPLHPLNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDKQQRAMLPYIDVLIDGKFIQEQADPSLVWRGSANQIIHRFKL
Cofactor: Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Function: Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine. Catalytic Activity: glycyl-[protein] + reduced [flavodoxin] + S-adenosyl-L-methionine = 5'-deoxyadenosine + glycin-2-yl radical-[protein] + H(+) + L-methionine + semiquinone [flavodoxin] Sequence Mass (Da): 17856 Sequence Length: 155 Subcellular Location: Cytoplasm EC: 1.97.1.-
Q7WZY5
MKSISNRDKLQDLLTQYYLNTNEKMVFLNSTGEVIALNEAAEEVFADDNDYSQMTNAVCRRCEGYSNEYDIMSCENCFLEALEIGKGSFQVFIRTKDNKIQPYTASYELIDHEKGIYAFTLHNVSPQIQRQERMYQRKMMQKTISAQENERKRISRELHDGIVQELINVDVELRLLKYQQDKDELIDNSKRIEGIMSRLIDDVRNLSVELRPSSLDDLGLDAAFRSYFKQFEKNYGIHVNYHTNFSAQRFDNEIETVVYRVVQEALFNALKYAQVDIVEVSLQLNENNIIAEVSDRGVGFKRGDDPKGTGLGLFGMNERAELVNGTVNIDSQINRGTIVTLEVPITD
Cofactor: Binds 1 [4Fe-4S] cluster. Function: Member of the two-component regulatory system NreB/NreC involved in the control of dissimilatory nitrate/nitrite reduction in response to oxygen. NreB functions as a direct oxygen sensor histidine kinase which is autophosphorylated, in the absence of oxygen, probably at the conserved histidine residue, and transfers its phosphate group probably to a conserved aspartate residue of NreC. NreB/NreC activates the expression of the nitrate (narGHJI) and nitrite (nir) reductase operons, as well as the putative nitrate transporter gene narT. PTM: Autophosphorylated. Catalytic Activity: ATP + protein L-histidine = ADP + protein N-phospho-L-histidine. Sequence Mass (Da): 39953 Sequence Length: 347 Subcellular Location: Cytoplasm EC: 2.7.13.3
P46011
MSMQQETSHMTAAPQTNGHQIFPEIDMSAGDSSSIVRATVVQASTVFYDTPATLDKAERLLSEAAENGSQLVVFPEAFIGGYPRGSTFELAIGSRTAKGRDDFRKYHASAIDVPGPEVERLALMAKKYKVYLVMGVIEREGYTLYCTVLFFDSQGLFLGKHRKLMPTALERCIWGFGDGSTIPVFDTPIGKIGAAICWENRMPSLRTAMYAKGIEIYCAPTADSRETWLASMTHIALEGGCFVLSANQFCRRKDYPSPPEYMFSGSEESLTPDSVVCAGGSSIISPLGIVLAGPNYRGEALITADLDLGDIARAKFDFDVVGHYSRPEVFSLNIREHPRKAVSFKTSKVMEDESV
Function: Highly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN) or allylcyanide and no activity with indole-3-acetonitrile. Not associated with auxin production but may be involved in cyanide detoxification. Catalytic Activity: a nitrile + 2 H2O = a carboxylate + NH4(+) Location Topology: Peripheral membrane protein Sequence Mass (Da): 38895 Sequence Length: 355 Subcellular Location: Cell membrane EC: 3.5.5.1
Q6H849
MAMVPSGSGGGPPVIAEVEMNGGADSGAATVRATVVQASTVFYDTPATLDKAERLIEEAAGYGSQLVVFPEAFVGGYPRGSTFGFGANISIGNPKDKGKEEFRKYHAAAIEVPGPEVTRLAAMAGKYKVFLVMGVIEREGYTLYCSVLFFDPLGRYLGKHRKLMPTALERIIWGFGDGSTIPVYDTPLGKIGALICWENKMPLLRTALYGKGIEIYCAPTADSRQVWQASMTHIALEGGCFVLSANQFCRRKDYPPPPEYVFSGLGEEPSPDTVVCPGGSVIISPSGEVLAGPNYEGEALITADLDLGEIVRAKFDFDVVGHYARPEVLSLVVNDQPHLPVSFTSAAEKTTAAKSDSTAKPY
Function: Highly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification (By similarity). Catalytic Activity: a nitrile + 2 H2O = a carboxylate + NH4(+) Sequence Mass (Da): 38676 Sequence Length: 362 EC: 3.5.5.1
P33036
VSYNSKFLAATVQAEPVVLDA
Function: Acts on many kinds of nitrile compounds such as aliphatic, aromatic, and heterocyclic mononitriles or dinitriles. Prefers S-(-)-2-(4'-isobutylphenyl)-propionitrile to R-(+)-2-(4'-isobutylphenyl)-propionitrile as the substrate. Catalytic Activity: a nitrile + 2 H2O = a carboxylate + NH4(+) Sequence Mass (Da): 2223 Sequence Length: 21 EC: 3.5.5.1
P20960
MQTRKIVRAAAVQAASPNYDLATGVDKTIELARQARDEGCDLIVFGETWLPGYPFHVWLGAPAWSLKYSARYYANSLSLDSAEFQRIAQAARTLGIFIALGYSERSGGSLYLGQCLIDDKGQMLWSRRKLKPTHVERTVFGEGYARDLIVSDTELGRVGALCCWEHLSPLSKYALYSQHEAIHIAAWPSFSLYSEQAHALSAKVNMAASQIYSVEGQCFTIAASSVVTQETLDMLEVGEHNASLLKVGGGSSMIFAPDGRTLAPYLPHDAEGLIIADLNMEEIAFAKAINDPVGHYSKPEATRLVLDLGHREPMTRVHSKSVIQEEAPEPHVQSTAAPVAVSQTQDSDTLLVQEPS
Function: Nitrilase that acts mostly on arylacetonitriles. Catalytic Activity: a nitrile + 2 H2O = a carboxylate + NH4(+) Sequence Mass (Da): 38908 Sequence Length: 356 EC: 3.5.5.1
P10045
MDTTFKAAAVQAEPVWMDAAATADKTVTLVAKAAAAGAQLVAFPELWIPGYPGFMLTHNQTETLPFIIKYRKQAIAADGPEIEKIRCAAQEHNIALSFGYSERAGRTLYMSQMLIDADGITKIRRRKLKPTRFERELFGEGDGSDLQVAQTSVGRVGALNCAENLQSLNKFALAAEGEQIHISAWPFTLGSPVLVGDSIGAINQVYAAETGTFVLMSTQVVGPTGIAAFEIEDRYNPNQYLGGGYARIYGPDMQLKSKSLSPTEEGIVYAEIDLSMLEAAKYSLDPTGHYSRPDVFSVSINRQRQPAVSEVIDSNGDEDPRAACEPDEGDREVVISTAIGVLPRYCGHS
Function: Specific for the herbicide bromoxynil (3,5-dibromo-4-hydroxybenzonitrile); converts it to its metabolite 3,5-dibromo-4-hydroxybenzoic acid. Catalytic Activity: a nitrile + 2 H2O = a carboxylate + NH4(+) Sequence Mass (Da): 37802 Sequence Length: 349 EC: 3.5.5.1
P54845
MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL
Function: Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B . Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3 . Binds in a sequence-specific manner to the rhodopsin promoter . PTM: Phosphorylated . Sequence Mass (Da): 25940 Sequence Length: 237 Domain: The minimal transactivation domain (MTD) is conserved across the MAF family, it may activate transcription by recruiting TBP and associated factors at the promoters of target genes. Subcellular Location: Cytoplasm
P54846
MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL
Function: Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter. PTM: Disumoylated at Lys-20. Sumoylation modulates the transcriptional activity of NRL on RHO and NR2E3 promoters, and is required for normal rod differentiation. Sequence Mass (Da): 26083 Sequence Length: 237 Domain: The minimal transactivation domain (MTD) is conserved across the MAF family, it may activate transcription by recruiting TBP and associated factors at the promoters of target genes. Subcellular Location: Cytoplasm
Q9VMA0
MELVKRGFLRACKNHSYLSFELIDDILAPLCANHKTTKPGSKEAIRALVAEINDTISDLGQLLVFIKYPVKAEEYLVYAKTDATPDSVANTGLTAEECQYFSKLLDKIASEEDCHIAWNDAYNDIVLQASSKPLKKSRMQELLQKWIQMGYFMEVTDRIYLGPRSLVELSFYLSSNHADNIKNCTLCKCLVLWDIRCGSCNIQYHRGCIQTYLQRRDICPSCGNLWTTPIRRSIG
Function: Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination . The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks (By similarity). Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 26774 Sequence Length: 235 Subcellular Location: Nucleus EC: 2.3.2.27
Q8WV22
MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH
Function: RING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair . NSMCE3/MAGEG1 and NSMCE1 ubiquitin ligase are components of SMC5-SMC6 complex and may positively regulate homologous recombination-mediated DNA repair . MAGEF1-NSMCE1 ubiquitin ligase promotes proteasomal degradation of MMS19, a key component of the cytosolic iron-sulfur protein assembly (CIA) machinery. Down-regulation of MMS19 impairs the activity of several DNA repair and metabolism enzymes such as ERCC2/XPD, FANCJ, RTEL1 and POLD1 that require iron-sulfur clusters as cofactors . PTM: Ubiquitinated. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 30855 Sequence Length: 266 Subcellular Location: Nucleus EC: 2.3.2.27
Q9D720
MQGSTRRAGAMTDVHRRFLQLLMTHGVLEEWEVRRLQNHCYQVHDRNATVDKLEDFINNINSVLESLYIEIKKGVTEDDGRPIYALVNLATTSVSKMATDFAENELDLFRKALELIVDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQSKWLIEKEGEFTLHGRAILEMEQFIRESYPDSVKMCNICHGLLIQGQSCETCGIRMHLPCVAKYFQSIPEPHCPHCNDYWPHDIPEVYNPEKEREAGISKSSRKSLRTRQH
Function: RING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair. NSMCE3/MAGEG1 and NSMCE1 ubiquitin ligase are components of SMC5-SMC6 complex and may positively regulate homologous recombination-mediated DNA repair. PTM: Ubiquitinated. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 30708 Sequence Length: 266 Subcellular Location: Nucleus EC: 2.3.2.27
Q5RAZ5
MQGSTRRMSVMTDVHRRFLQLLMTHGVLEEWDVKRLQRHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFGSSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVSKSNKKSLRSRQH
Function: RING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair. NSMCE3/MAGEG1 and NSMCE1 ubiquitin ligase are components of SMC5-SMC6 complex and may positively regulate homologous recombination-mediated DNA repair. PTM: Ubiquitinated. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 30900 Sequence Length: 266 Subcellular Location: Nucleus EC: 2.3.2.27
Q53EK2
MEKERQDGLSDKHKFILQYIMCRTAGVDNEQVRELVQEQYGETATVEDVINELNNSLHNFDFKIKRVQDQLDGRLTLHFQNLSGDPVSQMATPYPPVQIELMRKIIEWIMKCDDYQYSLTTLQIQKLSRKEMGLAPSVIESHLHTFERDGWLRQREGIWTFTNHALAELDAYLHNEYESNLYECNACREIVIAGYVCDCGYCLHVYCCKHLAHVNCINCNTPWANATVIGRW
Function: Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks. Plays a critical role in meiosis. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 27052 Sequence Length: 232 Subcellular Location: Nucleus EC: 2.3.2.27
Q6PAF4
MADRINESHQRFLQALMSHGIMEGSAVRALHRHCCELHKVHYMHDKLDDFVGVLNRHLQPLFMTIEKGVGEEDGLTYYALVNRVENDITKMASDYAENELELFRKTMELIILSDNGFATSISILNLADELQSKKMKKKEVEQLLQSFVQEKWLIGRNGEYTLHTRCIMELEHYIRNTYQDVAKICNVCRKVAIQSQLCENCGIPLHLQCAGKYFHGKANPTCPNCNESWPHEIPDLNQVSSQGPSHSQTETVRGRNQRSKNTSTASRTSR
Function: RING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 30947 Sequence Length: 270 Subcellular Location: Nucleus EC: 2.3.2.27
Q07913
MEVHEEQVSAPVTGDATAKYLLQYILSARGICHENALILALMRLETDASTLNTEWSIQQWVDKLNDYINAINVKLNLLGYKIIRINHGIGRNAVTLKAKQNFESFEDNTAIRAHNNDYAVLQSIVLPESNRFFVYVNLASTEETKLATRFNQNEIEFMKWAIEQFMISGETIVEGPALETSIIVKEVNRILVAATGDSNLAKWRKFSTFTVGSTNLFQFQELTATDIEDLLLRLCELKWFYRTQEGKFGIDLRCIAELEEYLTSMYNLNTCQNCHKLAIQGVRCGNESCREENEETGENSLSQIWHVDCFKHYITHVSKNCDRCGSSLITEGVYVI
Function: Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 38335 Sequence Length: 336 Subcellular Location: Nucleus EC: 2.3.2.27
Q8GYH7
MASASSSDGVAGRIQNASLVLVSDNSSTLADIRKAVAMMKNIAVQLEKENQTDKVKDLENSVAELLDLHSDCNHRSTAIQSVANRYQPVEQLTDFKKLLDDEFTKLKATPSSVPQNDHLMRQFREAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDCRHVYEKSVILHYIVNNPNANCPVAGCRGKLQNSKVICDAMLKFEIEEMRSLNKQSNRAEVIEDFTEDVDED
Function: E3 SUMO-protein ligase that modulates cell cycle progression and functions as a repressor of endocycle onset in meristems. May function downstream of the meristem patterning transcription factors PLETHORA 1 and 2 (PLT1 and PLT2) in root meristem development. Modulates the expression of the mitotic cyclins CYCB1-1 and CYCB1-2 and cyclin-dependent kinases CDKB1-1 and CDKB2-1 in root meristem. Involved in cytokinin signaling in root development. PTM: Sumoylated, possibly via autosumoylation. Sequence Mass (Da): 27717 Sequence Length: 249 Pathway: Protein modification; protein sumoylation. Subcellular Location: Nucleus EC: 2.3.2.-
Q32KY9
MPGRSTSSSSSGSTGFISFSGVESALSSLKTFQSCISSGMDTASSVALDLVETQTEVSSEYSMDKAMVEFAMMDRELNHYLKAVQSTINHVKEERSEKIPDLKLLVEKKFLALQNKNSDADFQNNEKFVQFKQQLKELKKQYGLQSDREADITEGVDEDMIVTQSQTNFICPITQLEMKKPVKNKVCGHTYEEEAIVRMIESKHERKKKACCPKIGCSHVDMRMSDLIQDEALRRAIESHKKRRRQSN
Function: E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand break repair by homologous recombination. Is not be required for the stability of the complex. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. Acts as an E3 ligase mediating SUMO attachment to various proteins such as SMC6L1 and TSNAX, the shelterin complex subunits TERF1, TERF2, TINF2 and TERF2IP, RAD51AP1, and maybe the cohesin components RAD21 and STAG2. Required for recruitment of telomeres to PML nuclear bodies. Required for sister chromatid cohesion during prometaphase and mitotic progression. PTM: Sumoylated, possibly via autosumoylation. Sequence Mass (Da): 28119 Sequence Length: 248 Pathway: Protein modification; protein sumoylation. Subcellular Location: Nucleus EC: 2.3.2.-
Q96MF7
MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
Function: E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand break repair by homologous recombination . Is not be required for the stability of the complex . The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks . The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs) . Acts as an E3 ligase mediating SUMO attachment to various proteins such as SMC6L1 and TSNAX, the shelterin complex subunits TERF1, TERF2, TINF2 and TERF2IP, RAD51AP1, and maybe the cohesin components RAD21 and STAG2 . Required for recruitment of telomeres to PML nuclear bodies . SUMO protein-ligase activity is required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair, and for formation of APBs in ALT cell lines . Required for sister chromatid cohesion during prometaphase and mitotic progression . PTM: Sumoylated, possibly via autosumoylation. Sequence Mass (Da): 27932 Sequence Length: 247 Pathway: Protein modification; protein sumoylation. Subcellular Location: Nucleus EC: 2.3.2.-
Q91VT1
MPGRSSTSSGSTRYISFSGIESALSSLKNFQSCISSGMDTVSSVALDLVETQTEVSSEYSMDKAMVEFAKMDRELSHYVKAVQSTINHVKEERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQLRELKKQYGIHADRENDLTEGVDEDMIVTQSQTNFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGCSHTDMRMSDLIPDEALRRAIESHNKKKKRHSE
Function: E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand break repair by homologous recombination. Is not be required for the stability of the complex. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. Acts as an E3 ligase mediating SUMO attachment to various proteins such as SMC6L1 and TSNAX, the shelterin complex subunits TERF1, TERF2, TINF2 and TERF2IP, RAD51AP1, and maybe the cohesin components RAD21 and STAG2. Required for recruitment of telomeres to PML nuclear bodies. Required for sister chromatid cohesion during prometaphase and mitotic progression. PTM: Sumoylated, possibly via autosumoylation. Sequence Mass (Da): 28231 Sequence Length: 247 Pathway: Protein modification; protein sumoylation. Subcellular Location: Nucleus EC: 2.3.2.-
Q4PIR3
MSEAQLKTSLEALSQNLLPGNQNHCSFDFQLKEIDDSIKQVIKCALVAAEIKNNECLDMLDSGIRELLDAKQRLLLMQQSVDTLANKTSENISDFENKSLLDIYTQIFKELIQEYEEKSDYGKYGTQGEYIEFKKTIWHEQNTDGSDFPSMKTFFNVMNTEEQEADEVMVYSATFDNRCPLTLQPIVHPILSTACNHFYEKDAILSLLNPTCVCPVVGCEARLQRSLLKEDEILERRLRRAQEISNLKEA
Function: Acts as an E3 ligase mediating SUMO/Smt3 attachment to other proteins. Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks. Plays a critical role in meiosis. PTM: Autosumoylated. Sequence Mass (Da): 28676 Sequence Length: 250 Pathway: Protein modification; protein sumoylation. Subcellular Location: Nucleus EC: 2.3.2.-
Q7ZXH2
MSGRSAPVVSFSSVDNSLSSLKNCQGYLHTGMDITVSVALDLLETGCESTEVDAMESVMLEYSAMERDLKQYIHAVEETVQKLRREQMEQVPDLQSLVQEKYATIQKKNDDEDLKKNDRFVQFKDQLREMRKQMGEKEEGDAAFENVDEDIAVLPSQQNLTCPITQMEMTNPVKNKVCGHTYEKEAIERMIQDRHQKKKRVKCPKVGCVHSDMQISDLVPDTALKRTIDILNKQKGRH
Function: E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. Is not be required for the stability of the complex. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components. Required for recruitment of telomeres to PML nuclear bodies. SUMO protein-ligase activity is required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair. Required for sister chromatid cohesion during prometaphase and mitotic progression (By similarity). Sequence Mass (Da): 27226 Sequence Length: 238 Pathway: Protein modification; protein sumoylation. Subcellular Location: Nucleus EC: 2.3.2.-
P38632
MALNDNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDKRSSQAIDVL
Function: Acts as an E3 ligase mediating SUMO/Smt3 attachment to SMC5 and YKU70. Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks. Sequence Mass (Da): 30354 Sequence Length: 267 Pathway: Protein modification; protein sumoylation. Subcellular Location: Nucleus EC: 2.3.2.-
Q9Y7U4
MSQLSFTGKSSSKGRSRLTQEVRPTASQIIADEEASDLDEYEEDLEGSGNEDDFGPSMSRSSRGRKRRKGDPLELQSQFEERNETDAINFQLLVRNVVRYAICSQTSHNTITRKDIVQKAFPEGTSRNLFQSVFEEADRQLQLSFGFRLVAVTQSNRKKDMAVSQLRRPATSNANSSNLHRYWVLRSTLPMELQKDSRLIVDSVLDTAYYGFLMTVIAFIAVSHCSVGHSELQSFLQELLTEEETTPLHLDITRSLSLLVRQGYLDRVKDDTHNQFVYYIGSRAVTEISIEGLKSFVTEFFPDSDIDMDALLTEYRQEYQNQSSSSAA
Function: Acts in a DNA repair pathway for removal of UV-induced DNA damage that is distinct from classical nucleotide excision repair and in repair of ionizing radiation damage. Functions in homologous recombination repair of DNA double strand breaks and in recovery of stalled replication forks. Plays a critical role in meiosis. PTM: Sumoylated by nse2. Sequence Mass (Da): 37276 Sequence Length: 328 Subcellular Location: Nucleus
P03535
MDKLADLNYTLSVITSMNDTLHSIIQDPGMAYFLYIASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEWESGKNPYEPSEVTASM
Function: Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca(2+) in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly. PTM: The N-glycosyl content is primarily Man(9)GlcNAc, with a small amount of Man(8)GlcNAc. Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 20237 Sequence Length: 175 Domain: Binds 1 calcium ion per tetramer. Subcellular Location: Host rough endoplasmic reticulum membrane
Q45UF1
MEGTSESPVLDEFEVNNNDYDNDFISRFSQNPLNAFSLFTDGNLQEYFMNNSLEKIVIHVVLIVISLCGIKAQTSKIIYVVRLLFWKIYNVINNLVNKVINREKIINHQVVDNRFREFEERFRLLLLQHDKNIAKQDDIVQYNKLDNFAESIKSEFNLKVAEMERRFQELKWRCDMIANKAMNTIVLANTVDSNNKDEKIVFDEGSVVQYNRE
Function: Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca(2+) in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly. PTM: The N-glycosyl content is primarily Man(9)GlcNAc, with a small amount of Man(8)GlcNAc. Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 25111 Sequence Length: 213 Subcellular Location: Host rough endoplasmic reticulum membrane
Q9YS17
MEFINQTFFSDYSEGKIDTIPYALGIVLALTNGSRILKFINLLISLLRKFIITSKTVIGKFKIENNTSHQNDDIHKEYEEVMKQMREMRVHVTALFDSIHKDNMEWRMSESIRREKKREMKASTAENEVKIHTNDVNICDTSGLETEVCL
Function: Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca(2+) in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly. PTM: The N-glycosyl content is primarily Man(9)GlcNAc, with a small amount of Man(8)GlcNAc. Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 17489 Sequence Length: 150 Subcellular Location: Host rough endoplasmic reticulum membrane
Q9NPB1
MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC
Function: Dephosphorylates specifically the 5' and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides, and so protects mitochondrial DNA replication from excess dTTP. Has only marginal activity towards dIMP and dGMP. Sequence Mass (Da): 25862 Sequence Length: 228 Subcellular Location: Mitochondrion EC: 3.1.3.-
Q8CHQ9
MAAYHIRQYQEKDHKRVLELFSSGMKELIPAAIRQMLTLPHSLLLLPGVPVTIVLMSASWLLATLYSFLFLLCLWLIFWISCRNYVAKSLQADLADITKSYLNAHGSFWVAESGDQVVGMVGAQPVKDPPLGKKQMQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYSDVVLETGSVQHSAQALYQAMGFQKTGQYFVSISKKLMGLSILQFSYSLPFASGPGYSGKYLKKGPIPC
Function: Probable acetyltransferase (Probable). Has no detectable histone acetyltransferase activity towards histone H3 or H4. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 26424 Sequence Length: 238 Subcellular Location: Membrane EC: 2.3.1.-
Q9JIY8
MAPYHIRKYQDSDHRSVVDLFRRGMEEHIPATFRHMLLLPRTLLLLLGVPLTLFLASGSWLLVLLSILTLFLSLWFLAKYTWEKHVMNCLHTDMADITRTYLSSHSSCFWVAESRGQTVGMVAARPVKDPLLQKKQLQLLHLSVSLQHRREGLGKAMVRTVLQFAQMQGFSEVVLSTSMLQYAALALYQGMGFQKTGETFYTYLSRLRKSPMINLKYSLTSREGDL
Function: Has histone acetyltransferase activity in vitro, with specificity for histone H4. Catalytic Activity: acetyl-CoA + L-lysyl-[protein] = CoA + H(+) + N(6)-acetyl-L-lysyl-[protein] Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25956 Sequence Length: 226 Subcellular Location: Nucleus membrane EC: 2.3.1.48
Q9QXS4
MAPYHIRKYQDSDHRSVVNLFCRGTEEHISASFRYMLLLPGTLLILLGVPLTLFLASGSWLLVLLSTLTLLVSLWLLAKYPWEKYTAMCLHSDMADIPRTYLSSHYSCFWVAESRGQMVGIIAVLPVKDPLLQRKQLQLRHLSVSLEHRREGIGRAMVRTALQFAEMQGFSEVVLVTSMLQYAALALYQSMGFQKTGEFFYTFVSRLRNSPMICLKYCLTSALNDLKT
Function: Has histone acetyltransferase activity in vitro, with specificity for histone H4. Catalytic Activity: acetyl-CoA + L-lysyl-[protein] = CoA + H(+) + N(6)-acetyl-L-lysyl-[protein] Location Topology: Multi-pass membrane protein Sequence Mass (Da): 26038 Sequence Length: 228 Subcellular Location: Nucleus membrane EC: 2.3.1.48
O60178
MKFGCVQFFPKLGKVNENIVHLRQLLDQHSEALQSVKLLVFPEMCLTGYNFKNSESIQPFLENVTSNHCPSIQFAQEVSEQYRCYTIIGFPEFQNSNGISTLYNSTALISPKKELLNVYHKHFLFETDKSWATEGKGFSFEPCIPELGPISMAICMDINPYDFKAPFEKFEYANFILRELEHQQMVSSNVSRPIICLSMAWLVSDDKVIDASLPDIKNLHYWTTRLSPLINSNTDAIVLVANRWGKENDLNFSGTSCIMELSQGRAILHGVLKAAENGIVVGELEK
Function: Deamidates N-terminal Asn and Gln. Component of a targeting complex in the N-end rule pathway (By similarity). Sequence Mass (Da): 32427 Sequence Length: 286 Subcellular Location: Cytoplasm EC: 3.5.1.-
P54989
MGANKQMNLGFLFQISGVHYGGWRYPSAQPHRATDIQYYAEIVRTAERGKLDFCFLADSIAAYEGSADQQDRSKDALMAAEPKRLLEPFTLLAALAMVTEHIGLVTTATTTYNEPYTMARLFASLDHITNGRAGWNVVTSANLAEAHNFGRDGHVEHGDRYARAEEFINVVFKLWDSIEDGAYLRDKLAGRYGLSEKIHFINHIGEHFKVRGPLNVPRPPQGHPVIVQAGSSHPGKELAARTAEVVFTAQQTLADGKAFYSDVKGRMAKYGRSSENLKVLPGVVVYVAETESEAKAKYETVSNLVPPDFGLFMLSDLLGEIDLKQFDIDGPLPEDLPEAKGSQSRREVIINLARRENLTIRQLYQRVSGASGHRSIWGTPKQIADQFEQWVYEEAADGFNILPPYLPESMNDFVNFVVPELQRRGIFRTEYEGSTLRDHLGLARPKNSVAKPS
Function: Hydroxylation of nitrilotriacetate. Catalytic Activity: FMNH2 + nitrilotriacetate + O2 = ammoniodiacetate + FMN + glyoxylate + H2O Sequence Mass (Da): 50529 Sequence Length: 453 EC: 1.14.14.10
P54990
MADQIRSATEGGDPTSDPKGFRRALGTFPTGVTIVTAPGVDGPAGVTANSFASVSLDPPLVLWSIGHTSRSHSKFQQSATFAINILADDQVGVSQVFAGGSADKFSLVDWHTGRTGAPLIDNALAYFDCVCEARHEGGDHTIMIGRVVDFGRAEGSPLAFSQGRYGVTLDHPEAAKARDHKSEEYGLDDLPFLSLIAKAHYKEDADLEEQRSAAGCTPVGSKILAGLYGSAPLTADELARRMYLDRREVVDSLNEFVADGHVESCDSGRFALTESGKQRRRRMIEYVSRYQDEQLASISRSDLGVATRVLQAFLAGPGRGSS
Function: Catalyzes the NADH-dependent reduction of the FMN cofactor of the nitrilotriacetate monooxygenase subunit A. Catalytic Activity: FMNH2 + NAD(+) = FMN + 2 H(+) + NADH Sequence Mass (Da): 34496 Sequence Length: 322 EC: 1.5.1.42
Q5S7W5
MAQPELLWAAAGLMLLGVAVSACVRCQLYATKRGKDGSQGSRLERPQRFEVIRSCSAVTRRPERIKEPEHLARKAPEELSTSCHVGFESSAEPRYQNFLTEDCLHEDAAYVEPVPLDYYSHNRFFSPPNDEDSHSYQNVIIGDPCSSELDDAEDYENSTAIEVWKVQQAKAMLYAESQDEEPDYVNTDPTIDAVVLSK
Function: Involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells. May also be involved in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells and FCGR1 (high affinity immunoglobulin gamma Fc receptor I)-mediated signaling in myeloid cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as calcium mobilization through the recruitment of GRB2. PTM: Phosphorylated on tyrosines following cross-linking of BCR; which induces the recruitment of GRB2. Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 22277 Sequence Length: 198 Subcellular Location: Cell membrane
Q9GZY6
MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMGQLQREASPGPVGSPDEEDGEPDYVNGEVAATEA
Function: Involved in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. May also be involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells and FCGR1 (high affinity immunoglobulin gamma Fc receptor I)-mediated signaling in myeloid cells. Couples activation of these receptors and their associated kinases with distal intracellular events through the recruitment of GRB2. PTM: Phosphorylated on tyrosines following cross-linking of BCR in B-cells, FCGR1 in myeloid cells, or FCER1 in mast cells; which induces the recruitment of GRB2. Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 26550 Sequence Length: 243 Subcellular Location: Cell membrane
Q9JHL0
MSAELELLWPVSGLLLLLLGATAWLCVHCSRPGVKRNEKIYEQRNRQENAQSSAAAQTYSLARQVWPGPQMDTAPNKSFERKNKMLFSHLEGPESPRYQNFYKGSNQEPDAAYVDPIPTNYYNWGCFQKPSEDDDSNSYENVLVCKPSTPESGVEDFEDYQNSVSIHQWRESKRTMGAPMSLSGSPDEEPDYVNGDVAAAENI
Function: Involved in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. May also be involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells and FCGR1 (high affinity immunoglobulin gamma Fc receptor I)-mediated signaling in myeloid cells. Couples activation of these receptors and their associated kinases with distal intracellular events through the recruitment of GRB2. PTM: Phosphorylated on tyrosines following cross-linking of BCR in B-cells, high affinity IgG receptor (FCGR1) in myeloid cells, or high affinity IgE receptor (FCER1) in mast cells; which induces the recruitment of GRB2. Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 22876 Sequence Length: 203 Subcellular Location: Cell membrane
O64876
MIYVGGVQFLDESSSFSLSSSSQGSSLLVDVMSHPVITLASDSFKNLEEKNVSFDESDSESSTKDRYVYIFQREFAVVNPALVDFVGTDEATTCVGLVIRNRKSGMTSVAHMDSPEIVDLGISQMLLLVLQDDVDAELDVHMVGGYEDVDIKNADGVGDYAKPEGYSFPLCCKLVETLQKRRENFHIQTLFILGHNTKLDSQANTCPIFNGCLVNTSTGAILPASFNRTSRCPDEIVRRIRVSSSFEDSSWKGKLLDTYDTKTDRFIIAPCRWTMRLIEYVWELNQLTDEEILTNCSTSPSAEGPDFVNSLRRNWGYLLKYPEWSKTFPRRQPRVFERTVDGHWKKC
Function: N-terminal asparagine deamidase that mediates deamidation of N-terminal asparagine residues to aspartate. Required for the ubiquitin-dependent turnover of intracellular proteins that initiate with Met-Asn. These proteins are acetylated on the retained initiator methionine and can subsequently be modified by the removal of N-acetyl methionine by acylaminoacid hydrolase (AAH). Conversion of the resulting N-terminal asparagine to aspartate by NTAN1 renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. This enzyme does not act on substrates with internal or C-terminal asparagines and does not act on glutamine residues in any position (By similarity). Does not seem to be involved in immune response, unlike the N-terminal glutamine amidohydrolase NTAQ1 . Catalytic Activity: H(+) + H2O + N-terminal L-asparaginyl-[protein] = N-terminal L-aspartyl-[protein] + NH4(+) Sequence Mass (Da): 39174 Sequence Length: 347 EC: 3.5.1.121
Q96AB6
MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKISSPGS
Function: N-terminal asparagine deamidase that mediates deamidation of N-terminal asparagine residues to aspartate. Required for the ubiquitin-dependent turnover of intracellular proteins that initiate with Met-Asn. These proteins are acetylated on the retained initiator methionine and can subsequently be modified by the removal of N-acetyl methionine by acylaminoacid hydrolase (AAH). Conversion of the resulting N-terminal asparagine to aspartate by NTAN1/PNAD renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. This enzyme does not act on substrates with internal or C-terminal asparagines and does not act on glutamine residues in any position, nor on acetylated N-terminal peptidyl Asn. Catalytic Activity: H(+) + H2O + N-terminal L-asparaginyl-[protein] = N-terminal L-aspartyl-[protein] + NH4(+) Sequence Mass (Da): 34677 Sequence Length: 310 Subcellular Location: Cytoplasm EC: 3.5.1.121
Q64311
MPLLVDGQRVRLPRSAVELVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGSDTKAEVPLIMSSIKSFSEHAECGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDKQDDDIHLVTLCVTELNDREENENHFPIIYGIAVNIKTAEIYRASFQDRGPEEQLRAARALAGGPMISIYDAKTEQLRIGPCSWTPFPQVDFWLQQDDKQILESLSTSPLAEPPHFVEHIRSTLMFLKKFPSPENILFPGNKALLYKKNKDGLWEKISSPGS
Function: N-terminal asparagine deamidase that mediates deamidation of N-terminal asparagine residues to aspartate. Required for the ubiquitin-dependent turnover of intracellular proteins that initiate with Met-Asn. These proteins are acetylated on the retained initiator methionine and can subsequently be modified by the removal of N-acetyl methionine by acylaminoacid hydrolase (AAH). Conversion of the resulting N-terminal asparagine to aspartate by NTAN1/PNAD renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. This enzyme does not act on substrates with internal or C-terminal asparagines and does not act on glutamine residues in any position. Catalytic Activity: H(+) + H2O + N-terminal L-asparaginyl-[protein] = N-terminal L-aspartyl-[protein] + NH4(+) Sequence Mass (Da): 34595 Sequence Length: 310 Subcellular Location: Cytoplasm EC: 3.5.1.121
Q9BV86
MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR
Function: Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Gly/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of the exposed alpha-amino group of the Ala, Gly or Ser residue in the [Ala/Gly/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Some of the substrates may be primed by NTMT2-mediated monomethylation . Catalyzes the trimethylation of the N-terminal Gly in CENPA (after removal of Met-1). Responsible for the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on RCC1. Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 25387 Sequence Length: 223 Subcellular Location: Nucleus EC: 2.1.1.244
Q8R2U4
MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCCGLQDFSPEPGSYDVIWIQWVIGHLTDQHLAEFLRRCKRGLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLEVVRRIIRTAGLSLLAEERQENLPDEIYHVYSFALR
Function: Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Gly/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of the exposed alpha-amino group of the Ala, Gly or Ser residue in the [Ala/Gly/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif . Some of the substrates may be primed by NTMT2-mediated monomethylation. Catalyzes the trimethylation of the N-terminal Gly in CENPA (after removal of Met-1) (By similarity). Responsible for the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on RCC1 . Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 25420 Sequence Length: 223 Subcellular Location: Nucleus EC: 2.1.1.244
B8JM82
MEFSGTHQAFRNRWAKTDDEMCKHSMSFHLHKTLRKEFFASYLYLLEQIPLVKLYALTCEYIKGEKQFYYRAQNFYKDVPPSEEGMMGDFVEISDIDLEGSRQFLKKFVGPGKAGTKCALDCGCGIGRVSKGVLFPVFESMEMLDMMEEFILHAHECYLGDYADRVESYYLYNLQEFIPPRKKYDVIWMQWVACHLTDKDLMEFLMRAKESLRPNGVIIIKDNMARQGCKLDPIDSSIIRHLDIMNGIIQRAGLNILDVEKQEGFPEAIVPVWMIAMR
Function: Alpha N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes monomethylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and Pro in the Pro-Pro-Lys motif. Predominantly functions as a mono-methyltransferase but is also able to di-/tri-methylate the GPKRIA peptide and di-methylate the PPKRIA peptide (in vitro). May activate NTMT1 by priming its substrates for trimethylation. Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N-terminal N-methyl-L-alanyl-L-prolyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine Sequence Mass (Da): 32383 Sequence Length: 278 Subcellular Location: Nucleus EC: 2.1.1.299
Q5VVY1
MAHRGAHFAFRSRWQKTDDELCRHSMSFILHKAIRNDFFQSYLYLLEKIPLVKLYALTSQVINGEMQFYARAKLFYQEVPATEEGMMGNFIELSSPDIQASQKFLRKFVGGPGRAGTDCALDCGSGIGRVSKHVLLPVFNSVELVDMMESFLLEAQNYLQVKGDKVESYHCYSLQEFTPPFRRYDVIWIQWVSGHLTDKDLLAFLSRCRDGLKENGIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFALHSDRHS
Function: Alpha N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes monomethylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and Pro in the Pro-Pro-Lys motif . Predominantly functions as a mono-methyltransferase but is also able to di-/tri-methylate the GPKRIA peptide and di-methylate the PPKRIA peptide (in vitro) . May activate NTMT1 by priming its substrates for trimethylation . Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N-terminal N-methyl-L-alanyl-L-prolyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine Sequence Mass (Da): 32400 Sequence Length: 283 Subcellular Location: Nucleus EC: 2.1.1.299
B2RXM4
MAHLGAHFAFRSRWQKTDDELCRHSMSFILHKAIRNDFFQSYLYLLEKIPLVKLYALTSQVIDGEMQFYARAKLFYQEVPATEEGMMGNFIELSNPDIQASREFLRKFVGGPGRAGTGCALDCGSGIGRVSKHVLLPVFSSVELVDMMESFLLEAQSYLQVNEDKVESYHCYSLQEFTPHLGRYDVIWIQWVSGYLTDKDLLAFLSRCRDGLKENGVIILKDNVAREGCIFDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQEGFPEQCVPVWMFALHSDRHS
Function: Alpha N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes monomethylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and Pro in the Pro-Pro-Lys motif. Predominantly functions as a mono-methyltransferase but is also able to di-/tri-methylate the GPKRIA peptide and di-methylate the PPKRIA peptide (in vitro). May activate NTMT1 by priming its substrates for trimethylation. Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N-terminal N-methyl-L-alanyl-L-prolyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine Sequence Mass (Da): 32313 Sequence Length: 283 Subcellular Location: Nucleus EC: 2.1.1.299
Q5PP70
MDICGVDSEGKEFNSVQEMWREEIGEGDETKKTQWYRDGVSYWEGVEASVDGVLGGYGHVNDADIIGSEVFLKTLLQERLVNNVGANQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVAQFLDAARENLASAGSETHKATNFFCVPLQEFTPAAGRYDVIWVQWCIGHLTDNDFVSFFNRAKGYLKPGGFFVVKENLAKNGFVLDKEDHSITRSDPYFKQLFRQCGLHLYRTKDQKGLPQELFAVKMYALTVDTPPKIHRTRSKTRSNRPQIIK
Function: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity). Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 31247 Sequence Length: 276 EC: 2.1.1.244
Q9N4D9
MSSSSSSRIHNGEDVYEKAEEYWSRASQDVNGMLGGFEALHAPDISASKRFIEGLKKKNLFGYFDYALDCGAGIGRVTKHLLMPFFSKVDMEDVVEELITKSDQYIGKHPRIGDKFVEGLQTFAPPERRYDLIWIQWVSGHLVDEDLVDFFKRCAKGLKPGGCIVLKDNVTNHEKRLFDDDDHSWTRTEPELLKAFADSQLDMVSKALQTGFPKEIYPVKMYALKPQHTGFTNN
Function: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 26632 Sequence Length: 234 EC: 2.1.1.244
Q55DH6
MTIKNEEQQQQTNKLKYPKNLLSSGLDGEGNTYINIEDLWKKELEGKDNKMEDKWYKSADEYWKGVEATVDGMLGGLAQVSPIDVVASKVFIQDFIKGTDSRPPINLNLALDCGAGIGRVAKEFLLPIGFKNVDLVEQNKLFLDKAKSDNFKDDNRVENYYAVGLQDFTFEKKYDCIWIQWVIGHLHDLDFIEFLKKCMDSLTPNGIICIKDNCAKKRFIMDKEDNSVSRTEDHLKYLFDQAGCKLLKSMVQPNFPKELFPVLMFALERK
Function: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity). Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 31043 Sequence Length: 270 EC: 2.1.1.244
Q6NN40
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSDSSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLREIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCTSEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRIKQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIVRKVKQQNFPKGLFPVYMIACKPVSKE
Function: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity). Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 30602 Sequence Length: 276 EC: 2.1.1.244
Q10CT5
MDSRGFDSEGREFSSATEMWAHEIGAAADAPVSAAVAEPAPAPAAGSNGVAGEEEAGGGGKREEWYSKAIAYWQGVEASTEGVLGGYGCVNDVDVKGSDAFLRPLLAERFGAARRHLVALDCGSGIGRVTKNFLLRHFNEVDLVEPVSHFLEAAQENLTECMEVGEDTHKAANFYCVPLQDFTPDEGRYDVIWIQWCIGQLPDDDFISFFNRAKIGLKPNGFFVLKENIARNGFVLDKEDNSITRSDAYFKELFKKCGLYIHSIKDQSDLPKELFAVKMYALVTEKPKIQKNGKRRRPKNSPRMIRS
Function: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity). Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 33966 Sequence Length: 307 EC: 2.1.1.244
O13748
MDPEKFYSDAIDYWNGVQPTVDGMLGGLGTGRIPQTDVVGSRTFLNRLNYRIGKIENLVAADCGAGIGRVTENVLLKIASHVDLVEPVENFISTAKKQLATKPCSFINVGLQNWTPEKNRYGLIWNQWCLSHLTDEDLIAYLSRCCEAIQEKGVICVKENVSSFEDTFDPIDSSVTRCEQSLKSLFKKANLVVVAETLQHGFPEELFPVKMYALVPHSS
Function: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity). Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 24388 Sequence Length: 219 Subcellular Location: Cytoplasm EC: 2.1.1.244
P38340
MDVPADSHIKYEDAIDYWTDVDATVDGVLGGYGEGTVVPTMDVLGSNNFLRKLKSRMLPQENNVKYAVDIGAGIGRVSKTMLHKHAAKIDLVEPVKPFIEQMHVELAELKDKGQIGQIYEVGMQDWTPDAGKYWLIWCQWCVGHLPDAELVAFLKRCIVGLQPNGTIVVKENNTPTDTDDFDETDSSVTRSDAKFRQIFEEAGLKLIASERQRGLPRELYPVRMYALKPMPN
Function: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Responsible for the N-terminal methylation of the ribosomal proteins RPL12A, RPL12B, RPS25A and RPS25B. Catalytic Activity: N-terminal L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-methionine = 3 H(+) + N-terminal N,N,N-trimethyl-L-alanyl-L-prolyl-L-lysyl-[protein] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 26068 Sequence Length: 232 Subcellular Location: Cytoplasm EC: 2.1.1.244
Q7NH22
MTVRLLLASASPRRRELLSQIGVAFEVKPSAFEERMDPALPPEQLVVQNALGKALNVQKRAPAELILGADTVVVFNRRIYGKPTGPADAGRMLGELQGQWHTVYTGIALVEERRWRVAERATRVKLRAMTPAQIAAYVAGGEPLDKAGSYAIQGLGAALVEQIDGCYSNVVGLSLPLLVDLLAEFDRRVF
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 20692 Sequence Length: 190 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q5FS71
MTASPSSAEGSSGLPDRPKLVLASASPRRLSLLEQIGIVPDAVVSADIDEEPRPGELPRPLAQRLARQKAEHVAAQRTDAALVLGADTVVSVGRRVLPKAEDEKTARACLKLLSGRRHKVLTAVVLRPSAGWPQGTPCERLVETSVIFHRLTDAQIDALIAQGDWQGKAGGYAIQGAAAAHIRQIGGSYSAVVGLPLFETAQLLRGQPVGKPSGGWIA
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 22919 Sequence Length: 218 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q0BTC5
MMPDQPATACPLVLASASPRRAALLAQIGVIPALTLATDIDETPLKGEVPLKGEVPRLLSRRLAQGKADTAIRVLREQSDAPLAAPFILAADTVVAVGRRALPKAETEAEARQCLTLLSGRRHHVWTTVVVIAPDGKRAERIVESAVTFNRMTDLQQEAYIASGEWRGKAGGYAIQGLAAAYIRFLSGSYSNVVGLPLFETAQLLRGLGFRSL
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 22807 Sequence Length: 213 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q2SBH1
MFDGNPGRRRLVLASGSPRRREMIAGLGCEFSIASADIDESVRPSEAAADYVERLAKEKATAVFEARGDQQDIVVLGADTTVVAGGDILGKPVDFDDAKAMLRRLSGTWHEVLTSVALVAAEGCKVTTTLSRVRFRELSEQEIQRYWDSGEPADKAGAYGIQGLAGSFVERVEGSYSSIVGLPLCETVVLLKEFGIKIWSD
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 21715 Sequence Length: 201 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q9K8H3
MKPLILASGSPRRKQLLEQMNVPFTVCKSTIDETFDPTFPPDEVVQQLARQKAQDVAKKHEDSFILAADTIVVFQGRILGKPATEQEARQMLSQLSDQSHEVLTGVALLHQGQVETFVETTEVRFWPLTDTEIETYLQTGEPFDKAGAYGIQGLGAYLVKELKGDYYNVVGLPLSRTVRALKVHGFSTRF
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 21240 Sequence Length: 190 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q31FH4
MKRRLYLSSSSPRRKELLDQAGIPFDLVNAPVEETGLPNESPESFVLRMAVEKALSGFNKVPGKNVWVLGSDTIILKDGKVFGKPKHKMDAYRMLMSFSGEEHTVMTSIAIVNDGAVYSDVCQTNVFFRPISDSEFEQYWATGEAEDKAGAYGIQGQAAKFIEKIEGSYSAVMGLPLYELDKLLRESNFYSE
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 21408 Sequence Length: 192 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q0C2H1
MPGSAPLILASASPRRLELLAQIGIVPDRVAPTDIDETRRKAESPRELALRLAREKAAACDAEGAFVLAADTVVALGQRNLEKAADETEAADFLRLLSGRAHQCITGVAVRAPSGQIVSRAVLARVKMKRLTEAEIAAYVASGDWKGKAGGYGIQGAAGGFVTAINGSYTAIVGLPLYETKSLLEGLGYRR
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 20071 Sequence Length: 191 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q5QWE2
MRLLLASSSPRRRELLTLLHRPFDCEVPEVEELRGANENAGDYVTRLAEEKAQTVAQRQQTPCLVIGSDTLISFKGQVLEKPESYEHFSQMMKQLSGQTHQVLTSVSVCQWNGHKVVARETALVTTQVEFAALSQGEIDAYWATGEPHDKAAGYGIQGYGGKFVKRIEGSYFAVVGLPLYETEQLLRMFEMTGEVDER
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 22184 Sequence Length: 198 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q1IV55
MLRYNLGMGLILASASPRRSELLRKARMVFRVEPAHVPEVHTAGEDPKQYAQRLARDKARAVAAKYPNDFVIGADTIVVADAHVLEKPADEADAARMIRMLSGHTHEVTTGVCLCGPNVEIVETETTRVTVAEISDEEIADYIHTGEPMDKAGAYGIQGMFSRWVTGIEGDYFNVVGLPIARVYRMMRRAGVL
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 21268 Sequence Length: 193 Subcellular Location: Cytoplasm EC: 3.6.1.9
A9KHL6
MYQIVLASGSPRRKEILSQVGINFTVCVSNMEEITSETLPENIVMELSKMKAHDIAKQYETNTIIIGSDTIVAYKNQILGKPKNEDHAKEMLQLLSGVTHEVYTGVTVIIKNDSGEVEERTFFEISKVTVSDLTEEEIMDYIKSKEPMDKAGAYAVQGRFAAHVTRIEGDYYTIVGLPIARLYQEVKKFGIDLVKQM
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 22171 Sequence Length: 197 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q38YR2
MFILASQSPRRQALLKRVVNDFEVQPAQIDEHETPLTAPGDYVQTLAQRKGEAVAVQYPTATILAADTAISFQGTLYGKPKDRQDAYEMLRQLSGQTHQVYTGLWLMKDGLVQQKVVQTDVTFWHLSTAEIEQYLDQNEYADKAGAYGIQGAGALLINKVNGDFYNVVGLPVSTVARMLQN
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 20092 Sequence Length: 181 Subcellular Location: Cytoplasm EC: 3.6.1.9
Q1MQH1
MTQQRVSSVFIETVPIVLASASPRRRSLLEQLGLLFKIVSVDSEPLPLSSEHPLEYVIRAAKVKAFAAAALEPRSVIIAADTVVIYTKDDVFEIIGKPQSGNDSFSMLSRFQGGKHQVITGCCIVWPLEENITSVQYEIFYDTASIQFGQWDKDILSSYVSTGESNDKAGAFSIQGIGAFLIDIIEGNYTTILGLPLPQLVKRLLKRKAIKVVLNKNSEETISSDFLTYSR
Function: Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. Catalytic Activity: dTTP + H2O = diphosphate + dTMP + H(+) Sequence Mass (Da): 25506 Sequence Length: 231 Subcellular Location: Cytoplasm EC: 3.6.1.9