protenix / docs /msa_pipeline.md
Yimingbear's picture
Upload folder using huggingface_hub
2872543 verified

MSA data pipeline

If you download our released wwPDB dataset as in training.md, the mmcif_msa [450G] dir has the following directory structure.

β”œβ”€β”€ seq_to_pdb_index.json [45M] # sequence to integers mapping file
β”œβ”€β”€ mmcif_msa [450G] # msa files
  β”œβ”€β”€ 0
    β”œβ”€β”€ uniref100_hits.a3m
    β”œβ”€β”€ mmseqs_other_hits.a3m
  β”œβ”€β”€ 1
    β”œβ”€β”€ uniref100_hits.a3m
    β”œβ”€β”€ mmseqs_other_hits.a3m
  β”œβ”€β”€ 2
    β”œβ”€β”€ uniref100_hits.a3m
    β”œβ”€β”€ mmseqs_other_hits.a3m
  ...
  β”œβ”€β”€ 157201
    β”œβ”€β”€ uniref100_hits.a3m
    β”œβ”€β”€ mmseqs_other_hits.a3m

Each integer in the first-level directory under mmcif_msa (for example, 0, 1, 2, and 157201) represents a unique protein sequence. The key of seq_to_pdb_index.json is the unique protein sequence, and the value is the integer corresponding to the first-level subdirectory of mmcif_msa mentioned above.

This document is used to provide the steps to convert the MSA obtained from colabfold into the Protenix training format.

Steps to get your own MSA data for training

Step1: get input protein sequence

Run the following command:

python3 scripts/msa/step1-get_prot_seq.py

you will get outputs in scripts/msa/data/pdb_seqs dir. The result dir is as follows,

  β”œβ”€β”€ pdb_index_to_seq.json # mapping integers to sequences
  β”œβ”€β”€ seq_to_pdb_index.json # mapping sequences to integers identifiers when saving MSA, This file is required in training for finding local MSA path from sequence
  β”œβ”€β”€ pdb_seq.fasta # Input of MSA
  β”œβ”€β”€ pdb_seq.csv # Intermediate Files
  β”œβ”€β”€ seq_to_pdb_id_entity_id.json # Intermediate Files

Step2: run msa search

We give detailed environment configuration and search commands in

scripts/msa/step2-get_msa.ipynb

The searched MSA is in scripts/msa/data/mmcif_msa_initial, The result dir is as follows,

  β”œβ”€β”€ 0.a3m
  β”œβ”€β”€ 1.a3m
  β”œβ”€β”€ 2.a3m
  β”œβ”€β”€ 3.a3m
  β”œβ”€β”€ pdb70_220313_db.m8
  β”œβ”€β”€ uniref_tax.m8 # record Taxonomy ID which is used by MSA Pairing

Steps3: MSA Post-Processing

The overall solution is to search the MSA containing taxonomy information only once for the unique sequence, and pair it according to the species information of each MSA.

For MSA Post-Processing, Taxonomy ID from UniRef30 DB is added to MSAs and MSAs is split into uniref100_hits.a3m and mmseqs_other_hits.a3m, which correspond to pairing.a3m and non_pairing.a3m in inference stage respectively.

You can run:

python3 scripts/msa/step3-uniref_add_taxid.py

python3 scripts/msa/step4-split_msa_to_uniref_and_others.py

The final pairing and non_pairing MSAs in scripts/msa/data/mmcif_msa is as follows:

>query
GPTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
>UniRef100_A0A0S7JZT1_188132/	246	0.897	6.614E-70	2	236	237	97	331	332
--THRFADKVEEMVQNHMTYSLQDVGGDANWQLVIEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCHYFWDTDVRNDWETTIDNFNVVETLSDNAIIVYQTHKRVWPASQRDILFLSAIRKILAKNENDPDTWLVCNFSVDHDKAPPTNRCVRAKINVAMICQTLVSPPEGDKEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGNPILF
>UniRef100_A0A4W6GBN4_8187/	246	0.893	9.059E-70	2	236	237	373	607	608
--THRFANKVEEMVQNHMTYSLQDVGGDANWQLVIEEGEMKVYRREVEENGIVLDPLKATHSVKGVTGHEVCHYFWDTDVRMDWETTIENFNVVEKLSENAIIVYQTHKRVWPASQRDVLYLSAIRKIMATNENDPDTWLVCNFSVDHNNAPPTNRCVRAKINVAMICQTLVSPPEGDKEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
>query
MAEVIRSSAFWRSFPIFEEFDSETLCELSGIASYRKWSAGTVIFQRGDQGDYMIVVVSGRIKLSLFTPQGRELMLRQHEAGALFGEMALLDGQPRSADATAVTAAEGYVIGKKDFLALITQRPKTAEAVIRFLCAQLRDTTDRLETIALYDLNARVARFFLATLRQIHGSEMPQSANLRLTLSQTDIASILGASRPKVNRAILSLEESGAIKRADGIICCNVGRLLSIADPEEDLEHHHHHHHH
>MGYP001165762451	218	0.325	1.019E-59	5	230	244	3	228	230
-----DKVEFLKGVPLFSELPEAHLQSLGELLIERSYRRGATIFFEGDPGDALYIVRSGIVKISRVAEDGREKTLAFLGKGEPFGEMALIDGGPRSAIAQALEATSLYALHRADFLAALTENPALSLGVIKVLSARLQQANAQLMDLVFRDVRGRVAQALLDLARR-HGVPLTNGRMISVKLTHQEIANLVGTARETVSRTFAELQDSGIIRIeGRNIVLLDAAQLEGYAAG-------------
>A0A160T8V6	218	0.285	1.019E-59	0	227	244	0	229	237
MPTTRDsnAVQALQVVPFFANLPEDHVAALAKALVPRRFSPGQVIFHLGDPGGLLYLISRGKIKISHTTSDGQEVVLAILGPGDFFGEMALIDDAPRSATAITLEPSETWTLHREEFIQYLTDNPEFALHVLKTLARHIRRLNTQLADIFFLDLPGRLARTLLNLADQ-YGRRAADGTIIDLSLTQTDLAEMTGATRVSINKALGRFRRAGWIQvTGRQVTVLDRAALEAL----------------
>AP58_3_1055460.scaffolds.fasta_scaffold1119545_2	216	0.304	3.581E-59	10	225	244	5	221	226
----------LSRVPLFAELPPERIHELAQSVRRRTYHRGETIFHKGDPGNGLYIIAAGQVKIVLPSEMGEEAMLAVLEGGEFFGELALFDGLPRSATVVAVQNAEVLVLHRDDFMSFVGRNPEVVSALFAALSRRLRDADEMIEDAIFLDVPGRLAKRLLDLAEKHGRAEEKGGVAIDLKLTQQDLAAMVGATRESVNKHLGWMRDHGLIQLDRqRIVILKPDDLR------------------

Format of MSA

In uniref100_hits.a3m(training stage) or pairing.a3m(inference stage), the header must starts with the following format, which we use for pairing:

>UniRef100_{hitname}_{taxonomyid}/

we also provide a pipeline of local Colabfold_search to Generate Protenix-Compatible MSAs in colabfold_compatible_msa.md.