text
stringlengths
6
2.91M
{ "date_blocked": null, "citation": { "state_cite_three": null, "federal_cite_one": "58 U.S. 157", "federal_cite_two": null, "specialty_cite_one": null, "federal_cite_three": null, "lexis_cite": null, "document_uris": [ "/api/rest/v2/document/86917/" ], "scotus_early_cite": "17 How. 157", "case_name": "Bank of Tennessee v. Horn", "westlaw_cite": null, "state_cite_one": null, "neutral_cite": null, "state_cite_regional": null, "state_cite_two": null, "docket_number": null, "id": 55057, "resource_uri": "/api/rest/v2/citation/55057/" }, "id": 86917, "blocked": false, "judges": "Taney", "court": "/api/rest/v2/jurisdiction/scotus/", "date_filed": "1855-01-16", "download_url": null, "source": "LR", "local_path": null, "html_lawbox": "<div>\n<center><b>58 U.S. 157 (1854)</b></center>\n<center><b>17 How. 157</b></center>\n<center><h1>THE PRESIDENT, DIRECTORS, AND COMPANY OF THE BANK OF TENNESSEE, PLAINTIFFS IN ERROR,<br>\nv.<br>\nLEWIS B. HORN.</h1></center>\n<center><p><b>Supreme Court of United States.</b></p></center>\n<center></center>\n<p><span class=\"star-pagination\">*159</span> Upon this bill of exceptions, the case came up to this court, and was submitted by Mr. Dunbar, upon a printed argument of Messrs. Stockton and Steele, for the plaintiffs in error, and argued by Mr. Janin, for the defendant.</p>\n<p>Mr. Chief Justice TANEY delivered the opinion of the court.</p>\n<p>The facts in this case, as they appear on the record, are as follows: \u0097</p>\n<p>Peter Corney, jr., who resided in New Orleans, on the 7th of November, 1851, filed a petition under the insolvent law of Louisiana, in the second district court, declaring his inability to meet his engagements, and praying that a cession of his property might be accepted by the court, for the benefit of his creditors, and that in the mean time all proceedings against him should be stayed. To this petition, a schedule of his property <span class=\"star-pagination\">*160</span> was annexed, in which it is apparent that the lot in question was intended to be included, but which is so erroneously described that it can hardly be identified, by the schedule alone, as a part of his estate.</p>\n<p>The district court, on the day the petition was presented, accepted the cession, and ordered a meeting of the creditors on the 13th of December following. The meeting was held accordingly, and a syndic appointed, and a report of the proceedings made to the court. On the 8th of March following the court authorized a sale of the property now in dispute, by the syndic; and at that sale, in May, 1852, the defendant in error became the purchaser.</p>\n<p>The insolvent, at the time of his petition, was indebted to the Bank, the plaintiff in error, in a large sum of money, for which a suit was then pending in the circuit court of the United States for the eastern district of Louisiana. The Bank proceeded in its suit and obtained judgment; but the judgment was rendered after the cession had been accepted and the syndic appointed by the creditors. The Bank, however, issued an execution, under which this property was seized by the marshal, in February, 1852, and sold in the April following. The Bank was the purchaser at this sale, and obtained possession of the lot under it.</p>\n<p>The defendant in error, after his purchase from the syndic, brought suit for the premises, and upon a trial in the circuit court of the United States for the eastern district of Louisiana, recovered a judgment; the court being of opinion that the property in question vested in the creditors, upon the cession and acceptance above mentioned, and was not liable to seizure under the execution which issued upon the judgment afterwards obtained by the plaintiff in error.</p>\n<p>By an act of the legislature of Louisiana, passed on the 29th of March, 1826, all the property of an insolvent petitioner mentioned in his schedule is fully vested in the creditors, from and after the cession and acceptance; and the syndic is directed to take possession of it, and to administer and sell it, for the benefit of the creditors. At the time, therefore, when the Bank obtained judgment against Corney, the insolvent, he had no interest in the lot in question upon which the judgment could be a lien, or which could be seized upon, on execution issuing on that judgment. The right and title to it had, by operation of the law of the State, vested in the creditors, to be administered by the syndic, as their trustee.</p>\n<p>Nor can the imperfect or erroneous description in the schedule have any influence on the decision. For it is well settled, by decisions of the courts of Louisiana, that all the property of the insolvent, whether included in his schedule or not, passes to his <span class=\"star-pagination\">*161</span> creditors by the cession. 4 Ann. Rep. 492, 493; 11 Louisiana Rep. 521; 8 Rob. 128; 9 Ib. 223. Consequently, if, under the ambiguous or erroneous description in the schedule, this lot must be regarded as omitted, it still passed by the cession, and Corney had no remaining interest in it.</p>\n<p>Neither can there be any constitutional objection to this law of the State. The validity of a state law of this description has been fully recognized in the case of Peale v. Phipps and others, 14 How. 368, and in the previous cases therein referred to, and cannot now be considered as an open question.</p>\n<p>We see no error, therefore, in the judgment of the circuit court, and it must be affirmed.</p>\n<p></p>\n<h2>Order.</h2>\n<p>This cause came on to be heard on the transcript of the record from the circuit court of the United States for the eastern district of Louisiana, and was argued by counsel. On consideration whereof, it is now here ordered and adjudged by this court that the judgment of the said circuit court in this cause be and the same is hereby affirmed with costs.</p>\n</div>", "time_retrieved": "2010-04-28T09:00:53", "nature_of_suit": "", "plain_text": "", "html_with_citations": "<div>\n<center><b><span class=\"citation no-link\"><span class=\"volume\">58</span> <span class=\"reporter\">U.S.</span> <span class=\"page\">157</span></span> (1854)</b></center>\n<center><b><span class=\"citation no-link\"><span class=\"volume\">17</span> <span class=\"reporter\">How.</span> <span class=\"page\">157</span></span></b></center>\n<center><h1>THE PRESIDENT, DIRECTORS, AND COMPANY OF THE BANK OF TENNESSEE, PLAINTIFFS IN ERROR,<br>\nv.<br>\nLEWIS B. HORN.</h1></center>\n<center><p><b>Supreme Court of United States.</b></p></center>\n<center></center>\n<p><span class=\"star-pagination\">*159</span> Upon this bill of exceptions, the case came up to this court, and was submitted by Mr. Dunbar, upon a printed argument of Messrs. Stockton and Steele, for the plaintiffs in error, and argued by Mr. Janin, for the defendant.</p>\n<p>Mr. Chief Justice TANEY delivered the opinion of the court.</p>\n<p>The facts in this case, as they appear on the record, are as follows: \u0097</p>\n<p>Peter Corney, jr., who resided in New Orleans, on the 7th of November, 1851, filed a petition under the insolvent law of Louisiana, in the second district court, declaring his inability to meet his engagements, and praying that a cession of his property might be accepted by the court, for the benefit of his creditors, and that in the mean time all proceedings against him should be stayed. To this petition, a schedule of his property <span class=\"star-pagination\">*160</span> was annexed, in which it is apparent that the lot in question was intended to be included, but which is so erroneously described that it can hardly be identified, by the schedule alone, as a part of his estate.</p>\n<p>The district court, on the day the petition was presented, accepted the cession, and ordered a meeting of the creditors on the 13th of December following. The meeting was held accordingly, and a syndic appointed, and a report of the proceedings made to the court. On the 8th of March following the court authorized a sale of the property now in dispute, by the syndic; and at that sale, in May, 1852, the defendant in error became the purchaser.</p>\n<p>The insolvent, at the time of his petition, was indebted to the Bank, the plaintiff in error, in a large sum of money, for which a suit was then pending in the circuit court of the United States for the eastern district of Louisiana. The Bank proceeded in its suit and obtained judgment; but the judgment was rendered after the cession had been accepted and the syndic appointed by the creditors. The Bank, however, issued an execution, under which this property was seized by the marshal, in February, 1852, and sold in the April following. The Bank was the purchaser at this sale, and obtained possession of the lot under it.</p>\n<p>The defendant in error, after his purchase from the syndic, brought suit for the premises, and upon a trial in the circuit court of the United States for the eastern district of Louisiana, recovered a judgment; the court being of opinion that the property in question vested in the creditors, upon the cession and acceptance above mentioned, and was not liable to seizure under the execution which issued upon the judgment afterwards obtained by the plaintiff in error.</p>\n<p>By an act of the legislature of Louisiana, passed on the 29th of March, 1826, all the property of an insolvent petitioner mentioned in his schedule is fully vested in the creditors, from and after the cession and acceptance; and the syndic is directed to take possession of it, and to administer and sell it, for the benefit of the creditors. At the time, therefore, when the Bank obtained judgment against Corney, the insolvent, he had no interest in the lot in question upon which the judgment could be a lien, or which could be seized upon, on execution issuing on that judgment. The right and title to it had, by operation of the law of the State, vested in the creditors, to be administered by the syndic, as their trustee.</p>\n<p>Nor can the imperfect or erroneous description in the schedule have any influence on the decision. For it is well settled, by decisions of the courts of Louisiana, that all the property of the insolvent, whether included in his schedule or not, passes to his <span class=\"star-pagination\">*161</span> creditors by the cession. 4 Ann. Rep. 492, 493; 11 Louisiana Rep. 521; 8 Rob. 128; 9 Ib. 223. Consequently, if, under the ambiguous or erroneous description in the schedule, this lot must be regarded as omitted, it still passed by the cession, and Corney had no remaining interest in it.</p>\n<p>Neither can there be any constitutional objection to this law of the State. The validity of a state law of this description has been fully recognized in the case of Peale v. Phipps and others, <span class=\"citation no-link\"><span class=\"volume\">14</span> <span class=\"reporter\">How.</span> <span class=\"page\">368</span></span>, and in the previous cases therein referred to, and cannot now be considered as an open question.</p>\n<p>We see no error, therefore, in the judgment of the circuit court, and it must be affirmed.</p>\n<p></p>\n<h2>Order.</h2>\n<p>This cause came on to be heard on the transcript of the record from the circuit court of the United States for the eastern district of Louisiana, and was argued by counsel. On consideration whereof, it is now here ordered and adjudged by this court that the judgment of the said circuit court in this cause be and the same is hereby affirmed with costs.</p>\n</div>", "sha1": "9f145d1530ca8dd73c6d7a8da615c7c7f2861483", "date_modified": "2014-12-21T01:31:15.900583", "precedential_status": "Published", "absolute_url": "/opinion/86917/bank-of-tennessee-v-horn/", "citation_count": 2, "supreme_court_db_id": null, "extracted_by_ocr": false, "docket": "/api/rest/v2/docket/2508005/", "html": "<p class=\"case_cite\">58 U.S. 157</p>\n <p class=\"case_cite\">17 How. 157</p>\n <p class=\"case_cite\">15 L.Ed. 70</p>\n <p class=\"parties\">THE PRESIDENT, DIRECTORS, AND COMPANY OF THE BANK OF<br>TENNESSEE, PLAINTIFFS IN ERROR,<br>v.<br>LEWIS B. HORN.</p>\n <p class=\"date\">December Term, 1854</p>\n <div class=\"prelims\">\n <p class=\"indent\">THIS case was brought up, by writ of error, from the circuit court of the United States for the eastern district of Louisiana.</p>\n <p class=\"indent\">The facts are stated in the opinion of the court.</p>\n <p class=\"indent\">Horn, who was the purchaser of the property under the syndic, instituted a petitory suit in the third judicial district court of the State of Louisiana, against Bernard and Hare, who were tenants under the Bank of Tennessee. The Bank appeared to the suit, and prayed for the removal of the case to the circuit court of the United States for the eastern district of Louisiana, which was ordered.</p>\n <p class=\"indent\">The bill of exceptions which was taken upon the trial, showed the prayers addressed to the court by the counsel for the Bank, and the rulings of the court thereon. The bill was as follows:&#8212;&#8212;</p>\n <p class=\"indent\">Be it remembered, that on the trial of this cause, the defendant, the Bank of Tennessee, preferred to the court the following propositions of law arising on the agreed statement of facts, on which it was insisted that this case should be decided in favor of said Bank, and against the plaintiff, Lewis B. Horn, to wit:&#8212;&#8212;</p>\n <p class=\"indent\">1. The surrender of property by Peter Corney, in the state court of Louisiana, did not transfer to his creditors the ownership of any part or portion thereof, whether it was described or referred to in the schedule or not, but the same remained the property of Corney notwithstanding the surrender.</p>\n <p class=\"indent\">2. The words 'all the property of such insolvent debtor, mentioned in said schedule, shall be fully vested in his creditors,' used by the legislature of Louisiana, in the act of 1826, in regard to insolvent debtors, cannot and ought not to be construed to have reference to any property which is not mentioned in the schedule; but property not named in the schedule remains in the situation provided for by the laws of Louisiana in force prior to the passage of the act of 1826, and the rights of parties thereto were not altered by the passage of said act.</p>\n <p class=\"indent\">3. The only right which the creditors of Corney had in the property which was surrendered, was one analogous to that of pledge; that is, a right to take possession of and sell the property, according to the forms of law, and apply the proceeds to the payment of their debts, and was not a right of ownership.</p>\n <p class=\"indent\">4. That the surrender of Corney did not transfer to the creditors possession of any property whatever, whether mentioned in the schedule or not; but only conferred on them the right to take possession thereof, and to sell it in due course of law, to pay the debts due to them.</p>\n <p class=\"indent\">5. The right of the state court to cause to be sold such property as they had reduced into possession, did not oust the jurisdiction of the United States circuit court, in the case of the <i>Bank of Tennessee v. P. Corney,</i> but that court rightfully proceeded to render judgment against said Corney, and to execute the same, by seizing and selling the land in controversy.</p>\n <p class=\"indent\">6. Whatever may be the law in regard to the property described in the schedule, and reduced into the possession of the creditors or syndic, the circuit court had an undoubted right to execute its judgment, by causing the seizure and sale of property not reduced into the possession of the syndic, and not described on the schedule.</p>\n <p class=\"indent\">7. The act of the Louisiana legislature of 1826, in regard to insolvent debtors, was not intended to change the law in regard to the rights of any persons named therein, to the property of the insolvent, or to change in any manner the mode of proceeding in the state court to enforce those rights; the legislature having been extremely careful, by provisos, to retain exactly the old law in regard to the rights of property; but the said act was intended only to effect a change in the remedies or final process used in this court, by changing the names of rights; and therefore the court was bound altogether to disregard the said act of the Louisiana legislature, so far as that act affects the process of this court.</p>\n <p class=\"indent\">8. The syndic and auctioneer and Horn, as vendor and vendee, had no right to treat the marshal's sale as a nullity, or in any way to complain of it, after the sale by the marshal to the Bank of Tennessee had regularly been made, without any legal opposition on their part.</p>\n <p class=\"indent\">9. The acceptance of the surrender, by the second district court of New Orleans, and all orders made and all proceedings had in that court, have reference only to the property named in the inventory, unless some other property is expressly named in the proceeding itself; and therefore, they could have no effect whatever on the right of the marshal to execute process, by a seizure of property not named in the inventory, and not expressly referred to.</p>\n <p class=\"indent\">And prayed that the said propositions should be sustained, and the cause finally decided in favor of the Bank; but the court ruled all these propositions against the Bank of Tennessee, and held the following positions to be law applicable to the case:&#8212;&#8212;</p>\n <p class=\"indent\">1. That the surrender, in the second district court of New Orleans, divested Corney of all his rights of property, and vested those rights in the creditors.</p>\n <p class=\"indent\">2. That because we had no lien and no right of payment in preference to others, therefore we had no right to execute our judgment in the circuit court, by a sale of Corney's property, although the fact of Corney's insolvency was not made known to the court, and no objection was made to our proceeding.</p>\n <p class=\"indent\">3. That the property was in <i>gremio legis</i>, by virtue of the constructive possession arising from the surrender in the second district court of New Orleans.</p>\n <p class=\"indent\">4. That it is but fair to assume that the property now in dispute was designed to be included by Corney in his schedule.</p>\n <p class=\"indent\">To all of which propositions as well as to the whole opinion of the court, which was reduced to writing, and copy of which is annexed to the bill of exceptions, the counsel of the Bank of Tennessee objected, on the ground that the said propositions made by the court, and its opinion, were contrary to law and justice, and tendered this, his bill of exceptions, to be signed by the court, which is accordingly done.</p>\n <p class=\"indent\">This bill in allowed so as to have the same construction as if the case had been submitted to a jury, and these exceptions had been taken on the trial.</p>\n <p class=\"indent\">J. A. CAMPBELL, <i>Judge presiding</i>.</p>\n <p class=\"indent\">Upon this bill of exceptions, the case came up to this court, and was submitted by <i>Mr. Dunbar</i>, upon a printed argument of Messrs. <i>Stockton</i> and <i>Steele</i>, for the plaintiffs in error, and argued by <i>Mr. Janin</i>, for the defendant.</p>\n <p class=\"indent\">Mr. Chief Justice TANEY delivered the opinion of the court.</p>\n </div>\n <div class=\"num\" id=\"p1\">\n <span class=\"num\">1</span>\n <p class=\"indent\">The facts in this case, as they appear on the record, are as follows:&#8212;&#8212;</p>\n </div>\n <div class=\"num\" id=\"p2\">\n <span class=\"num\">2</span>\n <p class=\"indent\">Peter Corney, jr., who resided in New Orleans, on the 7th of November, 1851, filed a petition under the insolvent law of Louisiana, in the second district court, declaring his inability to meet his engagements, and praying that a cession of his property might be accepted by the court, for the benefit of his creditors, and that in the mean time all proceedings against him should be stayed. To this petition, a schedule of his property was annexed, in which it is apparent that the lot in question was intended to be included, but which is so erroneously described that it can hardly be identified, by the schedule alone, as a part of his estate.</p>\n </div>\n <div class=\"num\" id=\"p3\">\n <span class=\"num\">3</span>\n <p class=\"indent\">The district court, on the day the petition was presented, accepted the cession, and ordered a meeting of the creditors on the 13th on December following. The meeting was held accordingly, and a syndic appointed, and a report of the proceedings made to the court. On the 8th of March following the court anthorized a sale of the property now in dispute, by the syndic; and at that sale, in May, 1852, the defendant in error became the purchaser.</p>\n </div>\n <div class=\"num\" id=\"p4\">\n <span class=\"num\">4</span>\n <p class=\"indent\">The insolvent, at the time of his petition, was indebted to the Bank, the plaintiff in error, in a large sum of money, for which a suit was then pending in the circuit court of the United States for the eastern district of Louisiana. The Bank proceeded in its suit and obtained judgment; but the judgment was rendered after the cession had been accepted and the syndic appointed by the creditors. The Bank, however, issued an execution, under which this property was seized by the marshal, in February, 1852, and sold in the April following. The Bank was the purchaser at this sale, and obtained possession of the lot under it.</p>\n </div>\n <div class=\"num\" id=\"p5\">\n <span class=\"num\">5</span>\n <p class=\"indent\">The defendant in error, after his purchase from the syndic, brought suit for the premises, and upon a trial in the circuit court of the United States for the eastern district of Louisiana, recovered a judgment; the court being of opinion that the property in question vested in the creditors, upon the cession and acceptance above mentioned, and was not liable to seizure under the execution which issued upon the judgment afterwards obtained by the plaintiff in error.</p>\n </div>\n <div class=\"num\" id=\"p6\">\n <span class=\"num\">6</span>\n <p class=\"indent\">By an act of the legislature of Louisiana, passed on the 29th of March, 1826, all the property of an insolvent petitioner mentioned in his schedule is fully vested in the creditors, from and after the cession and acceptance; and the syndic is directed to take possession of it, and to administer and sell it, for the benefit of the creditors. At the time, therefore, when the Bank obtained judgment against Corney, the insolvent, he had no interest in the lot in question upon which the judgment could be a lien, or which could be seized upon, on execution issuing on that judgment. The right and title to it had, by operation of the law of the State, vested in the creditors, to be administered by the syndic, as their trustee.</p>\n </div>\n <div class=\"num\" id=\"p7\">\n <span class=\"num\">7</span>\n <p class=\"indent\">Nor can the imperfect or erroneous description in the schedule have any influence on the decision. For it is well settled, by decisions of the courts of Louisiana, that all the property of the insolvent, whether included in his schedule or not, passes to his creditors by the cession. 4 Ann. Rep. 492, 493; 11 Louisiana Rep. 521; 8 Rob. 128; 9 Ib. 223. Consequently, if, under the ambiguous or erroneous description in the schedule, this lot must be regarded as omitted, it still passed by the cession, and Corney had no remaining interest in it.</p>\n </div>\n <div class=\"num\" id=\"p8\">\n <span class=\"num\">8</span>\n <p class=\"indent\">Neither can there be any constitutional objection to this law of the State. The validity of a state law of this description has been fully recognized in the case of <i>Peale v. Phipps and others,</i> 14 How. 368, and in the previous cases therein referred to, and cannot now be considered as an open question.</p>\n </div>\n <div class=\"num\" id=\"p9\">\n <span class=\"num\">9</span>\n <p class=\"indent\">We see no error, therefore, in the judgment of the circuit court, and it must be affirmed.</p>\n </div>\n <p class=\"center\"><i>Order</i>.</p>\n <div class=\"num\" id=\"p10\">\n <span class=\"num\">10</span>\n <p class=\"indent\">This cause came on to be heard on the transcript of the record from the circuit court of the United States for the eastern district of Louisiana, and was argued by counsel. On consideration whereof, it is now here ordered and adjudged by this court that the judgment of the said circuit court in this cause be and the same is hereby affirmed with costs.</p>\n </div>\n ", "resource_uri": "/api/rest/v2/document/86917/" }
{"title":"Sunshine Live - Classics (2012-11-10)","uid":7815677,"size":342217797,"categoryP":"audio","categoryS":"music","magnet":"?xt=urn:btih:885a1405b307c8676df9c3a974aa6d232c2cc05b&amp;dn=Sunshine+Live+-+Classics+%282012-11-10%29&amp;tr=udp%3A%2F%2Ftracker.openbittorrent.com%3A80&amp;tr=udp%3A%2F%2Fopen.demonii.com%3A1337&amp;tr=udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969&amp;tr=udp%3A%2F%2Fexodus.desync.com%3A6969","seeders":1,"leechers":1,"uploader":"sunshine-live","files":-1,"time":1352653549,"description":"Sunshine Live - Classics (2012-11-10)\n\n*commercials and news removed*\n\nBit-Rate: 200-250 kbit/s VBR\nSamplerate: 48000 Hz\nRuntime: 3:23:49\n\n\nPlaylist: &lt;a href=&quot;\nhttp://www.sunshine-live.de/onair/&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://www.sunshine-live.de/onair/&lt;/a&gt; (select: 10.11.2012 09:00 Uhr)\n\nDJ Rolando a.k.a. Aztec Mystic - Jaguar\nKai Tracid - Tiefenrausch (Oliver Lieb Rmx)\nRMB and Sharam - Shadows\nC.O.P. Project - Pornostar\nSM-Trax - Got The Groove (Sm in Motion Mix)\nVentura - Birds (Pan-O-Rama Mix)\nVoi feat. DJ Frost &amp; Talla 2XLC - Maid Of Orleans\nResistance D - Impression (Extended Vox)\nCosmic Gate - Somewhere Over The Rainbow (Club Mix)\nDJ Sakin &amp; Friends - Miami (Russenmafia Rmx)\nYakooza - Cocaine (DJ Wag RMX)\nSunbeam - Outside World\nAnastasia - Fly To The Sky (Anastasia Rmx)\nGreen Court feat. De/Vision - Inside Your Gates (Cosmic Gate Remix)\nMauro Picotto - Proximus (Medley With Adiemus)\nWarp Brothers - We Will Survive\nNightclub - French Kiss (Misar Mix)\nAlter Ego - Betty Ford\nA.S.Y.S. - Acid Nightmare\nScot Project - L (Want Your Love)\nBase Attack - Nobody Listens To Techno\nmirko milano - stopp &amp; go (arne lii mix)\n4 Strings - Diving (original vocal mix)\nKillerloop meets John B. Norman - Chi Mai (Trance Mix)\nDJ Motion-One - Ultimate Melody\nTrio - Da Da Da (I don't love you, you don't love me)\nOut of the Ordinary - DA DA DA\nThe Prodigy - Everybody in the Place\nSpace Frog - Follow me\nJ.T.S. - Bow C Bow\n\n\n &lt;a href=&quot;\nhttp://www.sunshine-live.de/onair/dj-music/classics/&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://www.sunshine-live.de/onair/dj-music/classics/&lt;/a&gt;","torrent":{"xt":"urn:btih:885a1405b307c8676df9c3a974aa6d232c2cc05b","amp;dn":"Sunshine+Live+-+Classics+%282012-11-10%29","amp;tr":["udp%3A%2F%2Ftracker.openbittorrent.com%3A80","udp%3A%2F%2Fopen.demonii.com%3A1337","udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969","udp%3A%2F%2Fexodus.desync.com%3A6969"],"infoHash":"885a1405b307c8676df9c3a974aa6d232c2cc05b","infoHashBuffer":{"type":"Buffer","data":[136,90,20,5,179,7,200,103,109,249,195,169,116,170,109,35,44,44,192,91]},"announce":[],"urlList":[]}}
{ "ip": "89.117.52.221", "country_code": "LT", "country_name": "Republic of Lithuania", "region_code": "KU", "region_name": "Kaunas", "city": "Juskonys", "zip_code": "", "time_zone": "Europe/Vilnius", "latitude": 55.2338, "longitude": 24.2108, "metro_code": 0 }
[[["street", 10671], ["sesame", 9922], ["brought", 8927], ["letter", 8712], ["today", 8695], ["jim", 7378], ["big", 7222], ["lehrer", 7001], ["like", 6963], ["bird", 6099], ["president", 5468], ["get", 5089], ["think", 5059], ["don't", 4655], ["tonight", 4604], ["going", 4535], ["say", 4365], ["school", 4247], ["want", 3816], ["year", 3613], ["people", 3572], ["need", 3537], ["know", 3478], ["one", 3422], ["time", 3413], ["love", 3362], ["would", 3066], ["it's", 3038], ["fact", 2975], ["plan", 2910], ["hey", 2825], ["job", 2745], ["good", 2731], ["tweet", 2715], ["he's", 2648], ["minute", 2625], ["moderator", 2565], ["right", 2561], ["last", 2479], ["four", 2463], ["tax", 2335], ["cut", 2312], ["can't", 2266], ["governor", 2250], ["won", 2134], ["really", 2129], ["even", 2092], ["maryland", 2077], ["said", 2068], ["row", 2065], ["candidate", 2049], ["see", 2024], ["care", 1950], ["look", 1900], ["you're", 1764], ["make", 1676], ["much", 1664], ["pb", 1599], ["every", 1590], ["way", 1511], ["win", 1462], ["thing", 1439], ["vote", 1400], ["number", 1392], ["per", 1378], ["best", 1350], ["medicare", 1313], ["tonight's", 1273], ["next", 1231], ["talking", 1231], ["talk", 1224], ["check", 1215], ["let", 1170], ["middle", 1156], ["guess", 1139], ["wouldn't", 1129], ["child", 1111], ["health", 1091], ["poor", 1069], ["obamacare", 1067], ["screwed", 1060], ["great", 1051], ["grown", 1041], ["guy", 986], ["still", 976], ["watching", 972], ["didn't", 959], ["well", 954], ["woman", 953], ["keep", 935], ["better", 934], ["twitter", 933], ["got", 904], ["presidential", 834], ["stop", 815], ["day", 789], ["could", 777], ["house", 758], ["american", 739], ["shut", 718]], [["@blgblrd", 14537], ["@mittromney", 4834], ["@bigbirdromney", 2135], ["@governoromalley", 2088], ["@barackobama", 1564], ["@huffingtonpost", 1520], ["@dickmorristweet", 1409], ["@thefix", 1136], ["@ppact", 1082], ["@gov", 868], ["@danabrams", 790], ["@kumailn", 760], ["@tyleroakley", 588], ["@firedbigbird", 553], ["@washingtonpost", 536], ["@jrubinblogger", 512], ["@onionpolitics", 509], ["@yaboymitt", 448], ["@thedailyedge", 443], ["@baratunde", 421], ["@yaboyobama", 409], ["@mtv", 397], ["@katthumor", 389], ["@aguywithnolife", 388], ["@huffpostpol", 367], ["@charlesmblow", 358], ["@hughhewitt", 344], ["@abc", 338], ["@billyy", 330], ["@dannyzuker", 330], ["@romneyresponse", 319], ["@parisjackson", 317], ["@sherrieshepherd", 305], ["@hardball", 294], ["@angryblacklady", 290], ["@upworthy", 273], ["@abbyleemiller", 265], ["@nickkristof", 258], ["@capehartj", 243], ["@indecision", 243], ["@occupywallst", 242], ["@emilyslist", 235], ["@toddbarry", 232], ["@shoq", 227], ["@politico", 224], ["@zbyronwolf", 219], ["@beardedstoner", 216], ["@rickklein", 211], ["@leftsentthis", 204], ["@markdavis", 199], ["@andylevy", 196], ["@arrghpaine", 188], ["@cbsnews", 182], ["@wkamaubell", 182], ["@salon", 179], ["@judgmental", 175], ["@helloross", 172], ["@msnbc", 172], ["@boonepickens", 171], ["@bbcmarkmardell", 169], ["@kitchenaidusa", 168], ["@princesscowboy", 168], ["@bernardgoldberg", 167], ["@zahrabilloo", 157], ["@jameshaning", 157], ["@abcworldnews", 154], ["@webmd", 152], ["@toddschnitt", 152], ["@dougbenson", 152], ["@rejectedjokes", 148], ["@cschweitz", 147], ["@whpresscorps", 146], ["@elonjames", 146], ["@lheron", 144], ["@maddow", 141], ["@allisonkilkenny", 141], ["@lizzwinstead", 139], ["@hilaryr", 138], ["@yowan", 136], ["@itsgabrielleu", 135], ["@kristenschaaled", 133], ["@nickgillespie", 133], ["@aseitzwald", 132], ["@kerstinshamberg", 132], ["@refinery29", 132], ["@cnn", 129], ["@priorities2012", 122], ["@fixaaron", 121], ["@shelbyfero", 121], ["@steveweinstein", 121], ["@yahoonews", 120], ["@kristinaribali", 119], ["@hsmoghul", 119], ["@bbcworld", 119], ["@bigbird", 118], ["@rwwatchma", 117], ["@mmflint", 117], ["@glennbeck", 115], ["@pharrell", 114], ["@alexblagg", 112]], [["#debates", 123000], ["#supportbigbird", 12339], ["#denverdebate", 4685], ["#romney", 2530], ["#obama", 2098], ["#debate2012", 1985], ["#debate", 1620], ["#serious", 1357], ["#pbs", 1224], ["#obamacare", 1192], ["#debates2012", 1102], ["#tcot", 989], ["#presidentialdebate2012", 976], ["#bigbird", 864], ["#p2", 720], ["#obama2012", 615], ["#election2012", 590], ["#teamobama", 551], ["#presidentialdebates2012", 526], ["#hp2012", 501], ["#mittromney", 443], ["#mockthevote", 427], ["#romneyryan2012", 380], ["#factcheck", 339], ["#presidentialdebate", 302], ["#savebigbird", 295], ["#bigbird2016", 295], ["#cantafford4more", 262], ["#denverdebates", 262], ["#msnbc", 256], ["#gop", 248], ["#youtubepolitics", 240], ["#romney2012", 238], ["#debatedenver", 235], ["#latism", 226], ["#fb", 226], ["#cnndebate", 224], ["#ajstream", 215], ["#mitt", 215], ["#shitstorm2012", 184], ["#shevotes", 164], ["#nbcpolitics", 164], ["#twib2012", 158], ["#cnbc2012", 152], ["#politics", 148], ["#g442", 144], ["#cnn", 141], ["#potus", 139], ["#mapoli", 130], ["#fail", 129], ["#mittlies", 126], ["#supportb", 125], ["#paulryan", 121], ["#romneywinning", 120], ["#presidential", 118], ["#retweet", 117], ["#foxnews", 115], ["#ndaaruling", 113], ["#pickensplan", 112], ["#denver", 108], ["#debat", 107], ["#medicare", 103], ["#current2012", 100], ["#obamawinning", 100], ["#debatewatch", 100], ["#theblazetv", 98], ["#women2012", 96], ["#msnbc2012", 96], ["#jimlehrer", 94], ["#teaparty", 93], ["#healthcare", 91], ["#vote", 88], ["#america", 83], ["#cspan2012", 78], ["#ndaa", 75], ["#zinger", 74], ["#freejimlehrer", 73], ["#cspan", 71], ["#bedebate2012", 71], ["#ronpaul", 69], ["#education", 67], ["#forwardnotback", 67], ["#teamromney", 66], ["#thankyou", 65], ["#mermaidprob", 63], ["#expandthedebate", 63], ["#pdslive", 61], ["#twisters", 58], ["#edu", 58], ["#denverd", 58], ["#aca", 56], ["#lol", 55], ["#amyanddan", 55], ["#occupysesamestreet", 54], ["#soberdrinkinggames", 54], ["#nobama", 54], ["#snl", 53], ["#college", 52], ["#hewitt", 52], ["#presidentialdebates", 52]], [["Romney", 59665], ["Obama", 23540]]]
{"userName": "@PhaniKumar", "bio": "Developer, self taught photographer, and a gadget lover, loves learning new things. Likes traveling & meeting people. :)", "outputProfileName": "phanikumar", "bigrams": ["@P", "Ph", "ha", "an", "ni", "iK", "Ku", "um", "ma", "ar", "Ph", "ha", "an", "ni", "i", "K", "Ku", "um", "ma", "ar"], "pictureURL": "https://pbs.twimg.com/profile_images/2623629578/87x0r2xwtscf9cepqzwa_400x400.jpeg", "location": "Bangalore", "fullName": "Phani Kumar", "externalUrl": "about.me/phanikumar"}
{"San_Buenaventura_(Ventura)": {"Ventura Raceway": "Ventura Raceway is located at Seaside Park in Ventura, California. The 1/5 mile, high banked clay oval is owned and operated by Jim Naylor, who is also the track announcer. Ventura Raceway is also home to Cory Kruseman's Sprint Car Driving School and the VRA sprint cars."}}
{ "add": { "doc": { "id": "19423cdcc303cb08480d9c8dd504b1397650d8413f71cc4068a51fd694c7aa6e", "url": "https://upload.wikimedia.org/wikipedia/commons/thumb/f/f9/St_Helens_and_nearby_area_from_space.jpg/220px-St_Helens_and_nearby_area_from_space.jpg", "previous": " ", "after": " Mount St Helens is 45 miles 72 km west of Mount Adams in the western part of the Cascade Range These sister and brother volcanic mountains are approximately 50 miles 80 km from Mount Rainier the highest of Cascade volcanoes Mount Hood the nearest major volcanic peak in Oregon is 60 miles 100 km southeast of Mount St Helens ", "color": "gray|0.44709 grey|0.44709 dim|0.27986 gray|0.27986 dim|0.27986 grey|0.27986 dark|0.085584 gray|0.085584 dark|0.085584 grey|0.085584 slate|0.074187 gray|0.074187 light|0.028896 slate|0.028896 gray|0.028896 rosy|0.019979 brown|0.019979 silver|0.014755 dark|0.01129 khaki|0.01129 yellow|0.0073101 ", "after_weights": " Mount|1 St|0.98305 Helens|0.9661 is|0.94915 45|0.9322 miles|0.91525 72|0.89831 km|0.88136 west|0.86441 of|0.84746 Mount|0.83051 Adams|0.81356 in|0.79661 the|0.77966 western|0.76271 part|0.74576 of|0.72881 the|0.71186 Cascade|0.69492 Range|0.67797 These|0.66102 sister|0.64407 and|0.62712 brother|0.61017 volcanic|0.59322 mountains|0.57627 are|0.55932 approximately|0.54237 50|0.52542 miles|0.50847 80|0.49153 km|0.47458 from|0.45763 Mount|0.44068 Rainier|0.42373 the|0.40678 highest|0.38983 of|0.37288 Cascade|0.35593 volcanoes|0.33898 Mount|0.32203 Hood|0.30508 the|0.28814 nearest|0.27119 major|0.25424 volcanic|0.23729 peak|0.22034 in|0.20339 Oregon|0.18644 is|0.16949 60|0.15254 miles|0.13559 100|0.11864 km|0.10169 southeast|0.084746 of|0.067797 Mount|0.050847 St|0.033898 Helens|0.016949 |0", "previous_weights": " " } } }
{"type":"FeatureCollection","features":[{"type":"Feature","id":"411203","properties":{"name":"陕州区","cp":[111.103851,34.720244],"childNum":1},"geometry":{"type":"Polygon","coordinates":["@@SEOGIAGCQGCCGIACACCCCAEAE@SBIAC@ACBALMBA@EBGFMPOHG@CEAKBEDC@KFEDSFcLeJEBEBKHIDSDGBC@A@ACAE@AACCAC@C@EBCFAFA@ADE@I@CAAAAEAACCOIIIEEC@GAE@GBGFEBM@QAMCGGKIEEEICEKIMEUEGEEEEEƒ_[GKEGCEEGGECQAE@EBEDGJCBA@CAIEIEIAG@M@QA[BGBCBCFAHCNABG@KGMKQMEE@C@EFY@EACA@G@oLcLEBCACCIWCK@E@CBE@AAAEEMIGECAMA@HANCD@FBDBH@FAFCDEDGB]@K@IACBAB@DBFFLHLHFJBPDFB@BADCBIFGHEBGBMHE@C@GBE@ADADGLCBKFCB@DBH@DCDIHCD@DAFCP@DDDFL@B@HAJ@FBDHFBD@FAFCDMNKPAHCVCNENEPGFMFKHGHCFEJIJIFSHKBK@IDEDCDAJBDFDDD@B@BADGBCBADAD@DBFJNJRBFAH@@@FLHBF@B@BE@GBEBGFEF@FBLJD^L`JfD\\D\\BN@HFDDDRFTNXHADABABA@ABA@AFCF@FCBADCBCDEBC@G@CDGDCFEJCPAF@HEFG@CBCHGHEJANCHAJEHGHMDCFCDA@A@CAGACD@D@HBF@DABA@ACEECCABE@AFAF@HBFDB@JA@C@O@YBGBA@@B@DBB@B@BAB@B@B@DBBDBFFdBBBBDBFBD@BBBDADCHCH@D@BDBD@L@LCLCDADBBDDDDBJ@PAHABBB@DD@DBBF@FBH@DDDDBF@DABGBMBIBGFCD@FBFDBJBH@DD@D@BSLOFSFID@BDDJDJDH@PELANB^BH@NCHEH@T@F@HCF@BD@B@DDD@DABUBCBAB@BBDDBHDBDBNBTDFFDBDADADAHAJDBFBB@DBBBDFDBBBBBDBBBDBB@D@B@B@B@BABBJBFBB@BBBB@BBBFHBBB@DAF@F@FADAHCDCFEFCB@D@B@B@LAJ@HBFDD@F@F@F@FBD@BDHH@DBB@BD@BBB@B@D@BBDDJHBBDBDBF@FBD@LDF@H@LAFADA@A@CDCFAEKACBM@AAAECGCAA@ABCFGDCDABBHFB@B@HGBEFCFCBA@ACK@C@EFCHE@A@ECAIEGGAEBSFQBELKJEDABC@I@CPUBC@CCGCCEEAA@ADCDCJCDCBEDGDENCPAJ@XLFBLADAFGFODCLIHCF@LHF@FAHIDCFAJ@\\@HAREBABC@CCCAEAEBCDEBEBE@EHK@C@ACCKACAAEAEBEFIHE`O"],"encodeOffsets":[[114422,35431]]}}],"UTF8Encoding":true}
["3f3d22fdbc2a3ead759c4eed1a53fdce9b0048be"]
{ "name":"print test", "version":"1.0.0", "icon":"scrapy.png", "commands":[ "python print_test.py" ] }
[ "http://2.bp.blogspot.com/-n2_p0qXr3Ns/VEfCsh9iDZI/AAAAAAAAi4Q/TRcsGSll7Ps/s0/000.jpg", "http://2.bp.blogspot.com/-fzqFzbHXOMM/VEfCtB1XMBI/AAAAAAAAi4c/85MYPQVwwhk/s0/001.png", "http://2.bp.blogspot.com/-GG6w9vG76BM/VEfCt2AKuMI/AAAAAAAAi4s/78omWnM-12s/s0/002.png", "http://2.bp.blogspot.com/-dd0a_y2n9CA/VEfCujlbxMI/AAAAAAAAi44/as1UcF020dg/s0/003.png", "http://2.bp.blogspot.com/-PmT321jJWw4/VEfCvXoY8eI/AAAAAAAAi5M/z7ZtZghdRHg/s0/004.png", "http://2.bp.blogspot.com/-9roQRlCWDTs/VEfCwmUK3bI/AAAAAAAAi5g/N62qjvNm26A/s0/005.png", "http://2.bp.blogspot.com/-mOwK6OQ4Ke8/VEfCxoIJUnI/AAAAAAAAi5w/iLdveSbN0y4/s0/006.png", "http://2.bp.blogspot.com/-MBb1mfYQ6yQ/VEfCy8e0hII/AAAAAAAAi6E/9pQPVjOXNWs/s0/007.png", "http://2.bp.blogspot.com/-0P3ypIsb8SM/VEfCz5TATAI/AAAAAAAAi6Q/OMSZxkJwE28/s0/008.png", "http://2.bp.blogspot.com/-967co8qpBts/VEfC0_1MoHI/AAAAAAAAi6c/Ry8Qd04QhY8/s0/009.jpg" ]
[ "https://2.bp.blogspot.com/-m6mdDYPlmRE/WwzCj_1j-AI/AAAAAAAHMqA/yw-awPQPSIgC8QLVO-Ol_-FQ6g3bqORlgCHMYCw/s0/000.png", "https://i.imgur.com/cKHhfwn.png" ]
{ "data": [ { "id": 528, "title": "Допинг", "kp_id": "782926", "imdb_id": "tt3083008", "world_art_id": null, "type": "movie", "add": "2016-04-04 12:05:30", "orig_title": "The Program", "year": "2015-09-13", "translations": [ "Профессиональный (многоголосый закадровый) (iTunes)" ], "quality": "bd", "translation": "Профессиональный (многоголосый закадровый) (iTunes)", "update": "2016-04-05 08:22:33", "iframe_src": "" }, { "id": 522, "title": "Телохранитель", "kp_id": "843791", "imdb_id": "tt4085084", "world_art_id": null, "type": "movie", "add": "2016-04-04 11:41:58", "orig_title": "Maryland", "year": "2015-05-16", "translations": [ "Профессиональный (многоголосый закадровый)" ], "quality": "bd", "translation": "Профессиональный (многоголосый закадровый)", "update": "2016-04-05 05:32:31", "iframe_src": "" }, { "id": 518, "title": "Убить Кейна", "kp_id": "898941", "imdb_id": "tt3586930", "world_art_id": null, "type": "movie", "add": "2016-04-04 11:38:11", "orig_title": "Kill Kane", "year": "2016-01-18", "translations": [ "Любительский (многоголосый закадровый) (Parovoz Production)" ], "quality": "webdl", "translation": "Любительский (многоголосый закадровый) (Parovoz Production)", "update": "2016-04-05 08:30:07", "iframe_src": "" }, { "id": 515, "title": "Богатырша", "kp_id": "704920", "imdb_id": "tt5546430", "world_art_id": null, "type": "movie", "add": "2016-04-04 11:35:26", "orig_title": "Bogatyrsha", "year": "2016-01-01", "translations": [ "Оригинальная дорожка" ], "quality": "bd", "translation": "Оригинальная дорожка", "update": "2016-04-05 06:02:52", "iframe_src": "" }, { "id": 507, "title": "Новогодний отрыв", "kp_id": "799506", "imdb_id": "tt3169832", "world_art_id": null, "type": "movie", "add": "2016-04-04 11:26:08", "orig_title": "Incidencias", "year": "2016-01-01", "translations": [ "Полное дублирование" ], "quality": "webdl", "translation": "Полное дублирование", "update": "2016-04-05 06:07:04", "iframe_src": "" }, { "id": 504, "title": "Холодный фронт", "kp_id": "861608", "imdb_id": "tt4703424", "world_art_id": null, "type": "movie", "add": "2016-04-04 11:23:21", "orig_title": "Kholodnyy front", "year": "2016-01-07", "translations": [ "Оригинальная дорожка" ], "quality": "webdl", "translation": "Оригинальная дорожка", "update": "2016-04-04 16:56:03", "iframe_src": "" }, { "id": 496, "title": "Золушка: Полный вперед!", "kp_id": "475537", "imdb_id": "tt1435990", "world_art_id": null, "type": "movie", "add": "2016-04-03 20:44:31", "orig_title": "Cendrillon au Far West", "year": "2012-06-01", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 09:37:08", "iframe_src": "" }, { "id": 495, "title": "Барашек Шон", "kp_id": "762778", "imdb_id": "tt2872750", "world_art_id": null, "type": "movie", "add": "2016-04-03 20:29:21", "orig_title": "Shaun the Sheep Movie", "year": "2015-01-24", "translations": [ "Оригинальная дорожка" ], "quality": "bd", "translation": "Оригинальная дорожка", "update": "2016-04-04 09:23:06", "iframe_src": "" }, { "id": 494, "title": "Ральф", "kp_id": "586260", "imdb_id": "tt1772341", "world_art_id": null, "type": "movie", "add": "2016-04-03 20:23:32", "orig_title": "Wreck-It Ralph", "year": "2012-11-01", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 09:24:15", "iframe_src": "" }, { "id": 493, "title": "Новые приключения Золушки", "kp_id": "3932", "imdb_id": "tt0308353", "world_art_id": null, "type": "movie", "add": "2016-04-03 20:10:41", "orig_title": "Happily N'Ever After", "year": "2006-12-16", "translations": [ "Полное дублирование" ], "quality": "hdtv", "translation": "Полное дублирование", "update": "2016-04-04 09:53:57", "iframe_src": "" }, { "id": 487, "title": "Барби и команда шпионов", "kp_id": "946783", "imdb_id": "tt5042436", "world_art_id": null, "type": "movie", "add": "2016-04-03 09:29:56", "orig_title": "Barbie: Spy Squad", "year": "2016-01-15", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 10:25:26", "iframe_src": "" }, { "id": 486, "title": "Барби и щенки в поисках сокровищ", "kp_id": "941524", "imdb_id": "tt5042426", "world_art_id": null, "type": "movie", "add": "2016-04-03 09:26:44", "orig_title": "Barbie & Her Sisters in the Great Puppy Adventure", "year": "2015-10-08", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 10:24:23", "iframe_src": "" }, { "id": 485, "title": "Тёмный рыцарь: Возрождение легенды. Часть 2", "kp_id": "683395", "imdb_id": "tt2166834", "world_art_id": null, "type": "movie", "add": "2016-04-03 09:21:33", "orig_title": "Batman: The Dark Knight Returns, Part 2", "year": "2013-01-29", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 09:45:58", "iframe_src": "" }, { "id": 484, "title": "Тёмный рыцарь: Возрождение легенды. Часть 1", "kp_id": "673750", "imdb_id": "tt2313197", "world_art_id": null, "type": "movie", "add": "2016-04-03 09:20:25", "orig_title": "Batman: The Dark Knight Returns, Part 1", "year": "2012-09-06", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 09:45:22", "iframe_src": "" }, { "id": 455, "title": "Империя волков", "kp_id": "77574", "imdb_id": "tt0402158", "world_art_id": null, "type": "movie", "add": "2016-04-01 19:08:36", "orig_title": "L'empire des loups", "year": "2005-04-20", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 13:34:53", "iframe_src": "" }, { "id": 450, "title": "Бугимен", "kp_id": "18979", "imdb_id": "tt0357507", "world_art_id": null, "type": "movie", "add": "2016-04-01 18:55:00", "orig_title": "Boogeyman", "year": "2005-02-04", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 12:40:29", "iframe_src": "" }, { "id": 429, "title": "Остров Ним", "kp_id": "281236", "imdb_id": "tt0410377", "world_art_id": null, "type": "movie", "add": "2016-04-01 17:34:46", "orig_title": "Nim's Island", "year": "2008-03-30", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 17:30:48", "iframe_src": "" }, { "id": 413, "title": "Константин: Повелитель тьмы", "kp_id": "3793", "imdb_id": "tt0360486", "world_art_id": null, "type": "movie", "add": "2016-04-01 16:05:37", "orig_title": "Constantine", "year": "2005-02-08", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 07:49:18", "iframe_src": "" }, { "id": 406, "title": "Далласский клуб покупателей", "kp_id": "260162", "imdb_id": "tt0790636", "world_art_id": null, "type": "movie", "add": "2016-04-01 15:21:12", "orig_title": "Dallas Buyers Club", "year": "2013-09-07", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 12:05:48", "iframe_src": "" }, { "id": 385, "title": "Монстры", "kp_id": "516472", "imdb_id": "tt1470827", "world_art_id": null, "type": "movie", "add": "2016-04-01 12:17:25", "orig_title": "Monsters", "year": "2010-09-10", "translations": [ "Полное дублирование" ], "quality": "bd", "translation": "Полное дублирование", "update": "2016-04-04 12:13:43", "iframe_src": "" } ] }
{"brief_title": "High-Dose Combination Chemotherapy Plus Peripheral Stem Cell Transplantation in Treating Patients With Advanced Cancer", "brief_summary": "RATIONALE: Drugs used in chemotherapy use different ways to stop tumor cells from dividing so they stop growing or die. Peripheral stem cell transplantation may allow the doctor to give higher doses of chemotherapy drugs and kill more tumor cells. PURPOSE: Phase I trial to study the effectiveness of combination chemotherapy plus peripheral stem cell transplantation in treating patients who have advanced cancer.", "detailed_description": "OBJECTIVES: - Evaluate the feasibility of administering 2 courses of high dose chemotherapy consisting of etoposide, cisplatin, and cyclophosphamide followed by ifosfamide, carboplatin, and paclitaxel (IC-T), each administered with filgrastim (G-CSF) and autologous stem cell support, to patients with advanced carcinomas. - Describe the toxicity of these high dose chemotherapy regimens. - Define the maximum tolerated dose of paclitaxel deliverable in this high dose regimen. - Describe the pharmacokinetics of escalating doses of paclitaxel given as a 24-hour continuous infusion. - Determine the disposition of carboplatin administered in the IC-T regimen. OUTLINE: At least 4 weeks prior to chemotherapy, patients undergo stem cell collection following filgrastim (G-CSF) mobilization. Sufficient stem cells to support 2 courses of chemotherapy are required. Autologous bone marrow is collected as an adjuvant if stem cell harvest is inadequate. Patients then receive high dose cisplatin, etoposide, and cyclophosphamide over 10 days, followed the next day by infusion of one fourth of the allotted stem cells, with the remaining allotment infused 2 days later. G-CSF is given for granulocyte support. Beginning no sooner than 14 weeks from the start of the first course of chemotherapy, stable and responding patients receive high dose paclitaxel, carboplatin, and ifosfamide over 5 days, followed 2 days later with one-fourth of the allotted stem cells, with the remaining allotment infused the following day. G-CSF is given for granulocyte support. Groups of 3-6 patients are treated with escalating doses of paclitaxel until the maximum tolerated dose for this regimen is determined. Patients are followed monthly for 1 year, every 3 months for 1 year, then as needed at the physician's discretion for at least 5 years. PROJECTED ACCRUAL: Three to six patients will be entered at each dose of paclitaxel studied.", "condition": ["Cancer"], "intervention_type": ["Biological", "Drug", "Drug", "Drug", "Drug", "Drug", "Drug", "Drug", "Procedure"], "intervention_name": ["filgrastim", "carboplatin", "cisplatin", "cyclophosphamide", "etoposide", "ifosfamide", "mesna", "paclitaxel", "peripheral blood stem cell transplantation"], "arm_group_label": ["Sequential high dose chemotherapy", "Sequential high dose chemotherapy", "Sequential high dose chemotherapy", "Sequential high dose chemotherapy", "Sequential high dose chemotherapy", "Sequential high dose chemotherapy", "Sequential high dose chemotherapy", "Sequential high dose chemotherapy", "Sequential high dose chemotherapy"], "criteria": "DISEASE CHARACTERISTICS: - Histologically confirmed advanced carcinomas of the following types: - Breast carcinoma that is ineligible for or patient has refused participation in a higher priority protocol in the following categories: - Stage II disease with at least 10 involved lymph nodes and no evidence of disease (NED) following surgery - Stage III disease rendered surgically NED with or without radiotherapy - Stage IV disease following partial response (PR) or complete response (CR) to surgery, chemotherapy, or radiotherapy - Prior high dose chemotherapy allowed at discretion of investigator - No chemoresistant disease rendered surgically NED - Locoregionally recurrent disease within 2 years of breast conservation with or without chemotherapy - Stage III/IV ovarian cancer - PR/CR following debulking surgery and/or chemotherapy - Ineligible for or refused participation in higher priority protocols - Primary soft tissue sarcoma with high-grade disease greater than 10 cm or that is metastatic - Rendered surgically NED or achieved PR/CR on any chemotherapeutic or immunotherapeutic regimen - Ineligible for or refused participation in higher priority protocols - Malignant melanoma in the following categories: - Ulcerative primary tumor with any number of completely resected metastatic lymph nodes - Stage II disease with more than 4 involved nodes rendered NED - Stage III disease rendered surgically NED or achieved PR/CR on any chemotherapeutic or immunotherapeutic regimen - Osteosarcoma that is ineligible for or refused participation in higher priority protocols - Resected primary with less than 50% tumor necrosis on pathologic review - Metastatic disease rendered surgically NED or PR/CR on any chemotherapeutic, radiotherapeutic, or immunotherapeutic regimen - The following diseases rendered surgically NED or that achieved PR/CR on any chemotherapeutic, radiotherapeutic, or immunotherapeutic regimen also eligible: - Small cell bone carcinoma - Metastatic Ewing's sarcoma - Metastatic gastrointestinal malignancy - Recurrent Wilms' tumor - No CNS metastases - No current histologically confirmed bone marrow metastases - Prior bone metastases with resolution at time of entry permitted PATIENT CHARACTERISTICS: Age: - Physiologic 18 to 55 Performance status: - Karnofsky 80%-100% Hematopoietic: - Absolute neutrophil count greater than 1,500/mm3 - Platelet count greater than 120,000/mm3 - Hemoglobin greater than 10 g/dL Hepatic: - Bilirubin less than 1.5 mg/dL - AST/ALT less than 3 times normal Renal: - Creatinine less than 1.4 mg/dL - Creatinine clearance at least 70 mL/min - No history of hemorrhagic cystitis Cardiovascular: - Ejection fraction at least 55% by MUGA - No significant cardiac disease Pulmonary: - FEV1 greater than 2 L - pO2 (room air) greater than 70 mm Hg - pCO2 (room air) less than 42 mm Hg - DLCO greater than 60% of predicted Other: - No potentially disabling psychosocial history - No organic or functional CNS dysfunction or other medical problem that would present party at undue risk - HIV negative - Hepatitis B surface antigen negative - No hearing loss greater than 40 decibels - No contraindication to the following procedures: - Collection by apheresis of up to 16 x 10 to the 8th mononuclear cells mobilized by G-CSF - Collection of autologous bone marrow, if needed - No second malignancy except: - Nonmelanomatous skin cancer - Carcinoma in situ of the cervix - Not pregnant or nursing - Adequate contraception required of fertile patients PRIOR CONCURRENT THERAPY: Biologic therapy: - See Disease Characteristics - At least 4 weeks since prior immunotherapy Chemotherapy: - See Disease Characteristics - No more than 3 prior chemotherapy regimens (excluding adjuvant therapy) - No more than 200 mg per square meter of prior cisplatin - No more than 800 mg per square meter of prior carboplatin - No prior exposure to greater than 1,000 mg per square meter of \"24-hour paclitaxel equivalents\" (using a 1:1.3 ratio between paclitaxel doses given by 24-hour infusion and by 3-hour infusion) - At least 4 weeks since prior chemotherapy Endocrine therapy: - Not specified Radiotherapy: - No prior radiotherapy to more than 20% of bone marrow - At least 4 weeks since prior radiotherapy Surgery: - See Disease Characteristics", "gender": "All", "minimum_age": "18 Years", "maximum_age": "55 Years", "healthy_volunteers": "No", "keyword": "stage IV pancreatic cancer", "mesh_term": ["Etoposide phosphate", "Isophosphamide mustard", "Cisplatin", "Cyclophosphamide", "Carboplatin", "Etoposide", "Ifosfamide"], "id": "NCT00002854"}
{ "status": "ok", "message": "System is responding", "ack": 1601386336 }
{ "name": "prison-visits-email", "version": "0.1.0", "devDependencies": { "grunt": "~0.4.1", "grunt-coffee-jshint": "~0.1.1", "grunt-coffeelint": "0.0.7", "grunt-contrib-jasmine": "^0.8.1", "grunt-contrib-jshint": "~0.7.1", "grunt-contrib-watch": "~0.5.3", "grunt-notify": "~0.2.15", "grunt-shell": "~0.5.0", "jasmine-jquery": "^2.0.6", "jquery-browser": "^1.10.2-1", "yamljs": "^0.1.5" } }
{"name":"RESAAS","permalink":"resaas","crunchbase_url":"http://www.crunchbase.com/company/resaas","homepage_url":"http://www.resaas.com","blog_url":"","blog_feed_url":"","twitter_username":"resaas","category_code":"enterprise","number_of_employees":14,"founded_year":null,"founded_month":null,"founded_day":null,"deadpooled_year":null,"deadpooled_month":null,"deadpooled_day":null,"deadpooled_url":null,"tag_list":"real-estate, social-network, mortgage-professional, real-estate-agents","alias_list":null,"email_address":"cory.brandolini@resaas.com","phone_number":"","description":"A social network for real estate","created_at":"Fri Nov 11 23:16:15 UTC 2011","updated_at":"Mon Nov 21 00:39:17 UTC 2011","overview":"<p>RESAAS is an enterprise social network for real estate\nprofessionals, mortgage specialists, home buyers and\nsellers to connect and communicate in real time.</p>\n\n<p>According to the national board of realtors, 84 percent\nof realtors are now taking advantage of social media\nto promote their business.</p>\n\n<p>RESAAS aims to make it even easier to stay connected\nwith all the people you do business with by creating\na social network designed specifically for real estate\nprofessionals and mortgage specialists.</p>\n\n<p>Agents and brokers can broadcast announcements, new\nlistings, open houses, price changes, sale notifications,\nand mortgage rates to their entire network as well\nas all the major social networks with a click of a\nbutton. RESAAS also features an innovative question\nand answer platform called RESAAS Questions where\nbuyers can connect with agents to form relationships.\nAgents will have powerful tools at their disposal to find\nthe questions they are most interested in answering.\nUsers will be able to get even the toughest questions\nserviced by agents who care, and find agents to\nconnect with in our agent directory.</p>\n\n<p>RESAAS is also a full featured listing service where\nagents can post pocket listings and share them easily\nwith their network. Our mobile apps allow for on the\nfly updates to listings or streaming questions, and even\nallow for the home owner to get involved in keeping\nthe property listing updated and fresh.</p>","image":{"available_sizes":[[[150,47],"assets/images/resized/0016/1992/161992v2-max-150x150.jpg"],[[250,79],"assets/images/resized/0016/1992/161992v2-max-250x250.jpg"],[[450,143],"assets/images/resized/0016/1992/161992v2-max-450x450.jpg"]],"attribution":null},"products":[],"relationships":[],"competitions":[],"providerships":[],"total_money_raised":"$0","funding_rounds":[],"investments":[],"acquisition":null,"acquisitions":[],"offices":[],"milestones":[],"ipo":null,"video_embeds":[],"screenshots":[],"external_links":[]}
{"abs":"We propose a new Monte Carlo algorithm for complex discrete distributions. The algorithm is motivated by the N-Fold Way, which is an ingenious event-driven MCMC sampler that avoids rejection moves at any specific state. The N-Fold Way can however get \"trapped\" in cycles. We surmount this problem by modifying the sampling process. This correction does introduce bias, but the bias is subsequently corrected with a carefully engineered importance sampler.","title":"Large-Flip Importance Sampling","id":228058925,"url":"https://www.researchgate.net/publication/228058925_Large-Flip_Importance_Sampling","names":["Firas Hamze","Nando de Freitas"],"references":{"224656674":"Learning algorithms for Boltzmann machines","2824425":"AIS-BN: An Adaptive Importance Sampling Algorithm for Evidential Reasoning in Large Bayesian Networks","220319974":"Latent Dirichlet Allocation","228057950":"Conditional Random Fields: Probabilistic Models for Segmenting and Labeling Sequence Data","228770227":"Bayesian Clustering with Variable and Transformation Selections","225304570":"Non-Uniform Random Variate Generation","1825409":"Sequential monte carlo samplers","1824256":"Extended Ensemble Monte Carlo","1959228":"Semi-Supervised Learning -- A Statistical Physics Approach","220693571":"Tabu search I","224877198":"A New Algorithm for Monte Carlo Simulation of King Spin Systems","231001263":"On the computational complexity of Ising spin glass models","13254310":"Nonuniversal Critical Dynamics in Monte Carlo Simulation","221618137":"Conditional mean field","236118717":"Weighing and Integrating Evidence for Stochastic Simulation in Bayesian Networks","6026283":"Optimization by Simulated Annealing,” Science 220, 671-680","10856084":"Rejection-free Monte Carlo algorithms for models with continuous degrees of freedom","2777817":"The Swendsen-Wang process does not always mix rapidly","200744578":"A Learning algorithm for Boltzmann machines","221620547":"Latent Dirichlet Allocation","46620991":"Monte Carlo Methods in Statistical Physics","234898362":"Tabu search part II","221345675":"Sparse Bayesian Learning for Regression and Classification using Markov Chain Monte Carlo.","1869025":"Nonequilibrium Equality for Free Energy Differences","222486588":"Taillard, E.D.: Robust taboo search for the QAP. Parallel Comput. 17, 443-455","221442060":"Iterated robust tabu search for MAX-SAT"},"citedIn":{"275281208":"Sequential Monte Carlo for Maximum Weight Subgraphs with Application to Solving Image Jigsaw Puzzles","51958902":"Self-Avoiding Random Dynamics on Integer Complex Systems"},"index":425}
{"name":"IBL Builder","permalink":"ibl-builder","crunchbase_url":"http://www.crunchbase.com/company/ibl-builder","homepage_url":"http://www.iblbuilder.com","blog_url":"","blog_feed_url":"","twitter_username":null,"category_code":"web","number_of_employees":3,"founded_year":2008,"founded_month":7,"founded_day":19,"deadpooled_year":null,"deadpooled_month":null,"deadpooled_day":null,"deadpooled_url":null,"tag_list":"ibl, inbound-links, inlinks, backlinks, backlinking, linkjuice, one-way-linking, genuine-inbound-links","alias_list":"","email_address":"team@iblbuilder.com","phone_number":"","description":"Build Inbound Links","created_at":"Tue Apr 28 12:23:59 UTC 2009","updated_at":"Thu Apr 30 19:38:45 UTC 2009","overview":"<p>IBL Builder makes non-reciprocal linking, reciprocal. It is a complete inbound linkbuilding system, backed with link management tools to make managing continuous inbound link growth and management easy.</p>\n\n<p>Born out of the frustration of trying to get genuine inbound links, IBL Builder has been built from the ground up to revolutionise the way people get inbound links. IBL Builder is not a reciprocal, triangle or automated linking tool. </p>\n\n<p>Anyone who owns a website or blog can benefit from using IBL Builder to gain and manage relevant inound links, with targeted anchor text, to boost their search engine rankings.</p>","image":null,"products":[],"relationships":[],"competitions":[],"providerships":[],"total_money_raised":"$0","funding_rounds":[],"investments":[],"acquisition":null,"acquisitions":[],"offices":[],"milestones":[],"ipo":null,"video_embeds":[],"screenshots":[],"external_links":[]}
[ "http://2.bp.blogspot.com/-5hD4hR4e48U/UJIxILelbMI/AAAAAAAAAfI/bGH5ffxb1HY/s0/000.png", "http://2.bp.blogspot.com/-cM1-jPXyasY/UJIxJJ6Q4BI/AAAAAAAAAfY/TBMgLJyFQDA/s0/001.png", "http://2.bp.blogspot.com/-bNCu1WKJ4B4/UJIxJzksAeI/AAAAAAAAAfo/ZSII3BzVcfI/s0/002.png", "http://2.bp.blogspot.com/-j_IU9RYk4bg/UJIxK4i3v8I/AAAAAAAAAf4/-7AQu8zYBtk/s0/003.png", "http://2.bp.blogspot.com/-ca72iLCO9AY/UJIxMPx8PUI/AAAAAAAAAgI/VhYuF-0eeKM/s0/004.png", "http://2.bp.blogspot.com/-TvIoHel3yGc/UJIxNwdJJNI/AAAAAAAAAgg/IIGO7Kr1cIg/s0/005.png", "http://2.bp.blogspot.com/-YE5SqnZW25s/UJIxPJ6bDxI/AAAAAAAAAgw/Xg-SXa-RYpM/s0/006.png", "http://2.bp.blogspot.com/-T8OmBgrTxe4/UJIxQHVWrDI/AAAAAAAAAhA/XF6BJryBFOw/s0/007.png", "http://2.bp.blogspot.com/-kNmJUfhSDew/UJIxRMVccKI/AAAAAAAAAhQ/4qK8JvhKzkE/s0/008.png", "http://2.bp.blogspot.com/-jdF8EKDEs0M/UJIxSDJNIqI/AAAAAAAAAhY/aqsMDaihBrE/s0/009.png", "http://2.bp.blogspot.com/-SXAfe91vCj0/UJIxTMG53_I/AAAAAAAAAho/0nKLHqA2D2U/s0/010.png", "http://2.bp.blogspot.com/-sswUJ2nymSs/UJIxUCpxIUI/AAAAAAAAAh8/3fxYd37jnTM/s0/011.png", "http://2.bp.blogspot.com/-tEscPV1vStI/UJIxVUkSJ_I/AAAAAAAAAiM/1oypPzlt4oU/s0/012.png", "http://2.bp.blogspot.com/-qudYge5Pl2Y/UJIxWlWqx1I/AAAAAAAAAic/8TdhK0Er_CE/s0/013.png", "http://2.bp.blogspot.com/-JYAATXZpZHU/UJIxX30srAI/AAAAAAAAAis/xpQzv3KSH9w/s0/014.png", "http://2.bp.blogspot.com/-poHcZcq9ESg/UJIxYwfNUWI/AAAAAAAAAi8/pMJq0KoSNow/s0/015.png", "http://2.bp.blogspot.com/-IZHvMhDELe4/UJIxZxQzVRI/AAAAAAAAAjM/D8PuMm18YVc/s0/016.png", "http://2.bp.blogspot.com/-_bm1oeigauQ/UJIxazbq4PI/AAAAAAAAAjc/hB1ahnQPOKA/s0/017.png", "http://2.bp.blogspot.com/-w6yv3848XiE/UJIxb25P_YI/AAAAAAAAAjo/Ld42tfFueg4/s0/018.png", "http://2.bp.blogspot.com/-oCMTgpYX5d0/UJIxcsZ_wiI/AAAAAAAAAj8/EVIVdfqBXj0/s0/019.png", "http://2.bp.blogspot.com/-aiVAInGIHKo/UJIxeK974SI/AAAAAAAAAkY/MKnmbCDjxcY/s0/020.png", "http://2.bp.blogspot.com/-aUGpgVMT9jE/UJIxfUkoJDI/AAAAAAAAAkg/ASvCBYUR9h0/s0/021.png", "http://2.bp.blogspot.com/-ODlvV_qBCzg/UJIxgMVpPoI/AAAAAAAAAks/AbKtcM70J70/s0/022.png", "http://2.bp.blogspot.com/-PNG1SZ_Gleo/UJIxhJYw58I/AAAAAAAAAlI/U09ujwXI6yA/s0/023.png", "http://2.bp.blogspot.com/-rUMJuqI0nps/UJIxidj3PWI/AAAAAAAAAlY/PqgXfMlTvFE/s0/024.png", "http://2.bp.blogspot.com/-HJVu-Fea3Qc/UJIxj7W__DI/AAAAAAAAAls/D5_n2zgOnio/s0/025.png", "http://2.bp.blogspot.com/-jBgK6OtbX1Y/UJIxlAZ2oOI/AAAAAAAAAmA/YJFXFQqupdk/s0/026.png", "http://2.bp.blogspot.com/-3ODgRhHjGcc/UJIxmFdamAI/AAAAAAAAAmM/3ZAZfzkWmb4/s0/027.png", "http://2.bp.blogspot.com/-HpUjSO3H5Io/UJIxnY4eTVI/AAAAAAAAAmc/Z5TRsb5VNZI/s0/028.png", "http://2.bp.blogspot.com/-0xgI2V1GOnI/UJIxopKaS_I/AAAAAAAAAmw/w72nryi8v4o/s0/029.png", "http://2.bp.blogspot.com/-CStlkvAdPSc/UJIxqBkGocI/AAAAAAAAAnA/WX4hV1Gtgog/s0/030.png", "http://2.bp.blogspot.com/-DTzHfRnPGug/UJIxrI09LxI/AAAAAAAAAnQ/M-tKdX6FqUQ/s0/031.png", "http://2.bp.blogspot.com/-hTbdRl5JfFQ/UJIxsfD1fEI/AAAAAAAAAno/K7qTW9HLqP8/s0/032.png", "http://2.bp.blogspot.com/-wJcnHrQV3Jk/UJIxtoq2_zI/AAAAAAAAAn0/hrWjPz_2MvA/s0/033.png", "http://2.bp.blogspot.com/-oJEwr7hQIMA/UJIxuz8iCqI/AAAAAAAAAoA/01UxW0nx1Ps/s0/034.png", "http://2.bp.blogspot.com/-kdgjwog1PuE/UJIxwPBML3I/AAAAAAAAAoU/yyvF75kEAXI/s0/035.png", "http://2.bp.blogspot.com/-JKmatUB0AQg/UJIxxjEgysI/AAAAAAAAAok/2knbQhbhFe8/s0/036.png", "http://2.bp.blogspot.com/-tjXCGGxnlaE/UJIxyRWq4tI/AAAAAAAAAos/feQzQjd95VE/s0/037.png", "http://2.bp.blogspot.com/-NcUIjqw_pu0/UJIxzoRhM7I/AAAAAAAAAo0/hN4Cq-dLf3E/s0/038.png", "http://2.bp.blogspot.com/-YG7wbNUKK-M/UJIx0Sb-EnI/AAAAAAAAApE/RLfXRmK_aGA/s0/039.png", "http://2.bp.blogspot.com/-jlzDeZdzPtk/UJIx1sedgwI/AAAAAAAAApU/OjNKPTJvW9E/s0/040.png", "http://2.bp.blogspot.com/-FJzW23_xdw0/UJIx2olnKdI/AAAAAAAAApg/aJ4_3Io6tD4/s0/041.png", "http://2.bp.blogspot.com/-Zh0Gd8bqExk/UJIx3d9GeKI/AAAAAAAAAps/NGJYbafvem0/s0/042.png", "http://2.bp.blogspot.com/-T4ToidQNoz4/UJIx4RZSFvI/AAAAAAAAAp8/QuHVFMKsLDg/s0/043.png", "http://2.bp.blogspot.com/-cjc4qlhiUTg/UJIx5PFj6wI/AAAAAAAAAqM/Q0t_N2G7k2M/s0/044.png", "http://2.bp.blogspot.com/-tEdl6FnEi0A/UJIx6qwykPI/AAAAAAAAAqo/noIfrnr3nrU/s0/045.png", "http://2.bp.blogspot.com/-f-9Qb0_lp0c/UJIx7gPKXOI/AAAAAAAAAq4/zW_OSlv3wFU/s0/046.png", "http://2.bp.blogspot.com/-NZtD3R19NYw/UJIx8uGtfWI/AAAAAAAAArI/Sp0p5oZzC9A/s0/047.png", "http://2.bp.blogspot.com/-UxMg39AHlQk/UJIx9tMklpI/AAAAAAAAArg/feDm49D5WYs/s0/048.png", "http://2.bp.blogspot.com/-OgKVW55N2i4/UJIx-n_iwnI/AAAAAAAAArk/zlms-V1g384/s0/049.png", "http://2.bp.blogspot.com/-aROD3sVmx9w/UJIx_Ym3aRI/AAAAAAAAArw/URqeFeiUBFc/s0/050.png", "http://2.bp.blogspot.com/-I4WsX4veBFw/UJIyAEkb0pI/AAAAAAAAAsA/gRmpwSgBO64/s0/051.png" ]
{"dta.poem.15414": {"metadata": {"author": {"name": "R\u00fcckert, Friedrich", "birth": "N.A.", "death": "N.A."}, "title": "49.", "genre": "Lyrik", "period": "N.A.", "pub_year": "1839", "urn": "urn:nbn:de:kobv:b4-200905195122", "language": ["de:0.99"], "booktitle": "N.A."}, "poem": {"stanza.1": {"line.1": {"text": "Wer in die W\u00fcste flieht, den B\u00f6sen zu entwallen,", "tokens": ["Wer", "in", "die", "W\u00fcs\u00b7te", "flieht", ",", "den", "B\u00f6\u00b7sen", "zu", "ent\u00b7wal\u00b7len", ","], "token_info": ["word", "word", "word", "word", "word", "punct", "word", "word", "word", "word", "punct"], "pos": ["PWS", "APPR", "ART", "NN", "VVFIN", "$,", "ART", "NN", "PTKZU", "VVINF", "$,"], "meter": "-+-+-+-+-+-+-", "measure": "alexandrine.iambic.hexa"}, "line.2": {"text": "Wird dort in die Gewalt der b\u00f6sen Geister fallen.", "tokens": ["Wird", "dort", "in", "die", "Ge\u00b7walt", "der", "b\u00f6\u00b7sen", "Geis\u00b7ter", "fal\u00b7len", "."], "token_info": ["word", "word", "word", "word", "word", "word", "word", "word", "word", "punct"], "pos": ["VAFIN", "ADV", "APPR", "ART", "NN", "ART", "ADJA", "NN", "VVINF", "$."], "meter": "-+-+-+-+-+-+-", "measure": "alexandrine.iambic.hexa"}}}}}
{ "order": "96125" ,"word": "cheeto" ,"count": "10" }
{"name":"Pre Play Sports","permalink":"pre-play-sports","crunchbase_url":"http://www.crunchbase.com/company/pre-play-sports","homepage_url":"http://preplaysports.com","blog_url":"http://blog.preplaysports.com","blog_feed_url":"http://blog.preplaysports.com/rss","twitter_username":"preplaysports","category_code":"mobile","number_of_employees":15,"founded_year":2010,"founded_month":null,"founded_day":null,"deadpooled_year":null,"deadpooled_month":null,"deadpooled_day":null,"deadpooled_url":null,"tag_list":"mobile, application, fantasy-sports, football, augmented-reality","alias_list":null,"email_address":"contact@preplaysports.com","phone_number":"6469264068","description":"Live prediction applications","created_at":"Sun Aug 22 14:54:57 UTC 2010","updated_at":"Wed Jul 11 18:24:54 UTC 2012","overview":"<p>Pre Play Sports is the future of fantasy sports, giving fans the ultimate chance to prove they can predict what will happen next in a live game. Utilizing social media technology, Pre Play Sports makes watching live games more interactive and exciting. </p>\n\n<p>Whether you&#8217;re in your living room, at a bar or at the stadium, Pre Play Sports will connect you with your friends and fans around the world as it tests your power to predict a live game play-by-play.</p>","image":{"available_sizes":[[[150,150],"assets/images/resized/0009/9008/99008v4-max-150x150.jpg"],[[200,200],"assets/images/resized/0009/9008/99008v4-max-250x250.jpg"],[[200,200],"assets/images/resized/0009/9008/99008v4-max-450x450.jpg"]],"attribution":null},"products":[],"relationships":[{"is_past":false,"title":"Advisor","person":{"first_name":"Gary","last_name":"Vaynerchuk","permalink":"gary-vaynerchuk-4","image":null}}],"competitions":[],"providerships":[],"total_money_raised":"$0","funding_rounds":[],"investments":[],"acquisition":null,"acquisitions":[],"offices":[],"milestones":[],"ipo":null,"video_embeds":[],"screenshots":[],"external_links":[]}
{ "serial_number":"SCP-00-BNQ-1227", "timestamp":"2018-12-19T05:25:22.000Z", "location":{ "x":-7146.09973606747, "y":-9850.46680575144, "z":-354.083508191826 }, "creator":"ShotSpotter, Inc.", "license":"CC BY 4.0", "description":"3 rounds from 45 cal automatic handgun discharged during City of Pittsburgh gunshot location test 129, location relative to arbitrary origin.", "original_file_md5":"321d517c8970e474d20703a5cab7a23a" }
{ "id": "65544da1-4df8-15ab-34be-c96d911c53fb", "offset": "1417", "occurred": "2015-11-13T16:55:28.393Z", "processed": "2015-11-13T16:55:28.393Z", "device": { "amazon_channel": "8e6fe120-cbee-aad1-1f13-addf990f8c62" }, "body": { "push_id": "8eadae36-d6fb-47ce-80bc-68425ceec6b2" }, "type": "RICH_DELETE" }
{ "#abstract": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Abstract", "url": "https://drafts.csswg.org/css-extensions-1/#abstract" } }, "#conform-classes": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Conformance classes", "url": "https://drafts.csswg.org/css-extensions-1/#conform-classes" } }, "#conform-future-proofing": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Implementations of Unstable and Proprietary Features", "url": "https://drafts.csswg.org/css-extensions-1/#conform-future-proofing" } }, "#conform-partial": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Partial Implementations", "url": "https://drafts.csswg.org/css-extensions-1/#conform-partial" } }, "#conform-responsible": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Requirements for Responsible Implementation of CSS", "url": "https://drafts.csswg.org/css-extensions-1/#conform-responsible" } }, "#conform-testing": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Implementations of CR-level Features", "url": "https://drafts.csswg.org/css-extensions-1/#conform-testing" } }, "#conformance": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Conformance", "url": "https://drafts.csswg.org/css-extensions-1/#conformance" } }, "#contents": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Table of Contents", "url": "https://drafts.csswg.org/css-extensions-1/#contents" } }, "#custom-atrules": { "current": { "number": "7", "spec": "CSS Extensions 1", "text": "Custom At-Rules", "url": "https://drafts.csswg.org/css-extensions-1/#custom-atrules" } }, "#custom-combinators": { "current": { "number": "6", "spec": "CSS Extensions 1", "text": "Custom Selector Combinators", "url": "https://drafts.csswg.org/css-extensions-1/#custom-combinators" } }, "#custom-functions": { "current": { "number": "5", "spec": "CSS Extensions 1", "text": "Custom Functions", "url": "https://drafts.csswg.org/css-extensions-1/#custom-functions" } }, "#custom-property": { "current": { "number": "4", "spec": "CSS Extensions 1", "text": "Custom Properties", "url": "https://drafts.csswg.org/css-extensions-1/#custom-property" } }, "#custom-selectors": { "current": { "number": "3", "spec": "CSS Extensions 1", "text": "Custom Selectors", "url": "https://drafts.csswg.org/css-extensions-1/#custom-selectors" } }, "#custom-selectors-cssom": { "current": { "number": "3.2", "spec": "CSS Extensions 1", "text": "CSSOM", "url": "https://drafts.csswg.org/css-extensions-1/#custom-selectors-cssom" } }, "#document-conventions": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Document conventions", "url": "https://drafts.csswg.org/css-extensions-1/#document-conventions" } }, "#extension-name": { "current": { "number": "2", "spec": "CSS Extensions 1", "text": "Extension Names", "url": "https://drafts.csswg.org/css-extensions-1/#extension-name" } }, "#index": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Index", "url": "https://drafts.csswg.org/css-extensions-1/#index" } }, "#index-defined-elsewhere": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Terms defined by reference", "url": "https://drafts.csswg.org/css-extensions-1/#index-defined-elsewhere" } }, "#index-defined-here": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Terms defined by this specification", "url": "https://drafts.csswg.org/css-extensions-1/#index-defined-here" } }, "#intro": { "current": { "number": "1", "spec": "CSS Extensions 1", "text": "Introduction", "url": "https://drafts.csswg.org/css-extensions-1/#intro" } }, "#issues-index": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Issues Index", "url": "https://drafts.csswg.org/css-extensions-1/#issues-index" } }, "#normative": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Normative References", "url": "https://drafts.csswg.org/css-extensions-1/#normative" } }, "#references": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "References", "url": "https://drafts.csswg.org/css-extensions-1/#references" } }, "#script-custom-selectors": { "current": { "number": "3.1", "spec": "CSS Extensions 1", "text": "Script-based Custom Selectors", "url": "https://drafts.csswg.org/css-extensions-1/#script-custom-selectors" } }, "#status": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Status of this document", "url": "https://drafts.csswg.org/css-extensions-1/#status" } }, "#subtitle": { "current": { "number": "", "spec": "CSS Extensions 1", "text": "Editor’s Draft, 11 October 2017", "url": "https://drafts.csswg.org/css-extensions-1/#subtitle" } } }
{"cacheUntil":1537624866892,"data":{"coordinates":"pkg:npm/chalk@2.4.1","description":"Terminal string styling done right. Much color.","reference":"https://ossindex.sonatype.org/component/pkg:npm/chalk@2.4.1","vulnerabilities":[],"version":"2.4.1","name":"chalk","format":"npm","depPaths":["/concurrently/chalk","/css-loader/postcss/chalk","/css-loader/icss-utils/postcss/chalk","/css-loader/postcss-modules-extract-imports/postcss/chalk","/css-loader/postcss-modules-local-by-default/postcss/chalk","/css-loader/postcss-modules-scope/postcss/chalk","/css-loader/postcss-modules-values/postcss/chalk","/jest-cli/chalk","/jest-cli/jest-config/chalk","/jest-cli/jest-config/jest-jasmine2/chalk","/jest-cli/jest-config/jest-jasmine2/jest-each/chalk","/jest-cli/jest-config/jest-resolve/chalk","/jest-cli/jest-message-util/chalk","/jest-cli/jest-message-util/@babel/code-frame/@babel/highlight/chalk","/jest-cli/jest-runtime/chalk","/jest-cli/jest-snapshot/chalk","/jest-cli/jest-snapshot/jest-diff/chalk","/jest-cli/jest-snapshot/jest-matcher-utils/chalk","/jest-cli/jest-util/chalk","/jest-cli/jest-validate/chalk","/jest-cli/jest-watcher/chalk","/vuepress/@babel/core/@babel/code-frame/@babel/highlight/chalk","/vuepress/autoprefixer/postcss/chalk","/vuepress/chalk","/vuepress/mini-css-extract-plugin/@webpack-contrib/schema-utils/chalk","/vuepress/postcss-loader/postcss/chalk","/vuepress/vue-loader/@vue/component-compiler-utils/postcss/chalk","/vuepress/webpack-serve/@webpack-contrib/config-loader/chalk","/vuepress/webpack-serve/chalk","/vuepress/webpack-serve/update-notifier/boxen/chalk","/vuepress/webpack-serve/update-notifier/chalk","/vuepress/webpackbar/chalk","/vuepress/webpackbar/consola/chalk","/vuepress/webpackbar/table/chalk","/webpack-cli/chalk","/webpack-cli/inquirer/chalk","/webpack-dev-server/webpack-log/chalk","/webpack-dev-server/webpack-log/log-symbols/chalk"]}}
[{ "id": "3330d5a3-f38e-48fd-a3e6-000000000001", "data": [ { "text": "I don't know. For me it used to be the other way around. I was a coffee addict. I have to have my frappacino in the afternoon, my Americano in the morning and all these different types of coffee in the day, but then eventually I got the same problem. I wasn't able to fall asleep, but you know I found out that tea actually has caffeine in it, so it has the same effect, so I guess it really depends on the day. If I'm really sleepy and I need to wake up in the morning, I prefer coffee but if it's just to relax at night, I would rather have a cup of tea.", "userDefined": false } ], "isTemplate": false, "count": 0 },]
{ "files": { "src/pkg/go/build/deps_test.go": { "status": "A", "num_chunks": 1, "no_base_file": false, "property_changes": "", "num_added": 403, "num_removed": 0, "id": 11004, "is_binary": false } }, "url": null, "created": "2012-03-06 04:12:55.353752", "owner": "rsc", "num_comments": 0, "patchset": 13002, "owner_email": "rsc@golang.org", "issue": 5732062, "message": "diff -r 75c176cc7e69 https://code.google.com/p/go/", "modified": "2012-03-06 04:12:55.354099" }
{ "first_traded_price": 7.0e5, "highest_price": 712999.0, "isin": "IRO3MSZ96121", "last_traded_price": 712999.0, "lowest_price": 685009.0, "trade_volume": 15005.0, "unix_time": 1529280000 }
[{"pid":0,"ph":"i","name":"Memory sample","ts":1522867463861000,"args":{"JVM stats":"heap_memory_usage: 415167728\nnon_heap_memory_usage: 155952616\nloaded_class_count: 14959\nthread_count: 22\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867463992000,"args":{"JVM stats":"heap_memory_usage: 425863256\nnon_heap_memory_usage: 155948144\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867463992001,"args":{"JVM stats":"heap_memory_usage: 426187384\nnon_heap_memory_usage: 155948144\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464152000,"args":{"JVM stats":"heap_memory_usage: 433664072\nnon_heap_memory_usage: 155985224\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464164000,"args":{"JVM stats":"heap_memory_usage: 434312360\nnon_heap_memory_usage: 155985224\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464173000,"args":{"JVM stats":"heap_memory_usage: 434636472\nnon_heap_memory_usage: 155988936\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464176000,"args":{"JVM stats":"heap_memory_usage: 434636472\nnon_heap_memory_usage: 155988936\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464179000,"args":{"JVM stats":"heap_memory_usage: 434960544\nnon_heap_memory_usage: 155988936\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464180000,"args":{"JVM stats":"heap_memory_usage: 434960544\nnon_heap_memory_usage: 155990344\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464182000,"args":{"JVM stats":"heap_memory_usage: 434960544\nnon_heap_memory_usage: 155991048\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464183000,"args":{"JVM stats":"heap_memory_usage: 434960544\nnon_heap_memory_usage: 155991048\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464624000,"args":{"JVM stats":"heap_memory_usage: 95182016\nnon_heap_memory_usage: 155999624\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 1\n gc_time: 118\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464627000,"args":{"JVM stats":"heap_memory_usage: 95650112\nnon_heap_memory_usage: 155999624\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464635000,"args":{"JVM stats":"heap_memory_usage: 96476112\nnon_heap_memory_usage: 156002560\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464638000,"args":{"JVM stats":"heap_memory_usage: 96476112\nnon_heap_memory_usage: 156002560\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464664000,"args":{"JVM stats":"heap_memory_usage: 97945784\nnon_heap_memory_usage: 156008640\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464664001,"args":{"JVM stats":"heap_memory_usage: 97945784\nnon_heap_memory_usage: 156009984\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867464678000,"args":{"JVM stats":"heap_memory_usage: 98618400\nnon_heap_memory_usage: 156001856\nloaded_class_count: 14959\nthread_count: 27\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465035000,"args":{"JVM stats":"heap_memory_usage: 121663488\nnon_heap_memory_usage: 156145720\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465041000,"args":{"JVM stats":"heap_memory_usage: 121844144\nnon_heap_memory_usage: 156145720\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465044000,"args":{"JVM stats":"heap_memory_usage: 121844144\nnon_heap_memory_usage: 156145720\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465045000,"args":{"JVM stats":"heap_memory_usage: 121844144\nnon_heap_memory_usage: 156145720\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465054000,"args":{"JVM stats":"heap_memory_usage: 122175512\nnon_heap_memory_usage: 156146488\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465062000,"args":{"JVM stats":"heap_memory_usage: 122331584\nnon_heap_memory_usage: 156146488\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465072000,"args":{"JVM stats":"heap_memory_usage: 122688152\nnon_heap_memory_usage: 156161176\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465076000,"args":{"JVM stats":"heap_memory_usage: 122688152\nnon_heap_memory_usage: 156161176\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465128000,"args":{"JVM stats":"heap_memory_usage: 124110680\nnon_heap_memory_usage: 156165576\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465141000,"args":{"JVM stats":"heap_memory_usage: 125289688\nnon_heap_memory_usage: 156166280\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465144000,"args":{"JVM stats":"heap_memory_usage: 125289688\nnon_heap_memory_usage: 156166280\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465149000,"args":{"JVM stats":"heap_memory_usage: 125445792\nnon_heap_memory_usage: 156166280\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465179000,"args":{"JVM stats":"heap_memory_usage: 126574048\nnon_heap_memory_usage: 156166280\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465183000,"args":{"JVM stats":"heap_memory_usage: 126574048\nnon_heap_memory_usage: 156166280\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465283000,"args":{"JVM stats":"heap_memory_usage: 127526296\nnon_heap_memory_usage: 156196232\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867465287000,"args":{"JVM stats":"heap_memory_usage: 127526296\nnon_heap_memory_usage: 156196232\nloaded_class_count: 14959\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466246000,"args":{"JVM stats":"heap_memory_usage: 134570528\nnon_heap_memory_usage: 156205184\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466257000,"args":{"JVM stats":"heap_memory_usage: 135244024\nnon_heap_memory_usage: 156179968\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466258000,"args":{"JVM stats":"heap_memory_usage: 135244024\nnon_heap_memory_usage: 156160000\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466260000,"args":{"JVM stats":"heap_memory_usage: 135244024\nnon_heap_memory_usage: 156145984\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466263000,"args":{"JVM stats":"heap_memory_usage: 135244024\nnon_heap_memory_usage: 156151360\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466268000,"args":{"JVM stats":"heap_memory_usage: 135400584\nnon_heap_memory_usage: 156208384\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466419000,"args":{"JVM stats":"heap_memory_usage: 137947904\nnon_heap_memory_usage: 156322880\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466841000,"args":{"JVM stats":"heap_memory_usage: 157166184\nnon_heap_memory_usage: 156375920\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466889000,"args":{"JVM stats":"heap_memory_usage: 158781944\nnon_heap_memory_usage: 156378480\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867466997000,"args":{"JVM stats":"heap_memory_usage: 161657440\nnon_heap_memory_usage: 156426744\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867467000000,"args":{"JVM stats":"heap_memory_usage: 161871584\nnon_heap_memory_usage: 156427848\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867467012000,"args":{"JVM stats":"heap_memory_usage: 162766488\nnon_heap_memory_usage: 156427848\nloaded_class_count: 14959\nthread_count: 31\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867472304000,"args":{"JVM stats":"heap_memory_usage: 172647440\nnon_heap_memory_usage: 156468888\nloaded_class_count: 14959\nthread_count: 30\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867472324000,"args":{"JVM stats":"heap_memory_usage: 173538368\nnon_heap_memory_usage: 156447120\nloaded_class_count: 14959\nthread_count: 30\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867472333000,"args":{"JVM stats":"heap_memory_usage: 173538368\nnon_heap_memory_usage: 156450896\nloaded_class_count: 14959\nthread_count: 30\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867472334000,"args":{"JVM stats":"heap_memory_usage: 173538368\nnon_heap_memory_usage: 156450896\nloaded_class_count: 14959\nthread_count: 30\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867472334001,"args":{"JVM stats":"heap_memory_usage: 173538368\nnon_heap_memory_usage: 156450896\nloaded_class_count: 14959\nthread_count: 30\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1522867472473000,"args":{"JVM stats":"heap_memory_usage: 175163800\nnon_heap_memory_usage: 156452120\nloaded_class_count: 14962\nthread_count: 24\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":1,"tid":29,"id":2,"name":"base plugin project configure","args":{"span_id":"2","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463862000,"dur":5000},{"pid":1,"tid":29,"id":3,"name":"base plugin project base extension creation","args":{"span_id":"3","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463867000,"dur":4000},{"pid":1,"tid":29,"id":5,"name":"task manager create tasks","args":{"span_id":"5","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463871000,"dur":4000},{"pid":1,"tid":29,"id":4,"name":"base plugin project tasks creation","args":{"span_id":"4","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463871000,"dur":4000},{"pid":1,"tid":29,"id":8,"name":"variant manager create variants","args":{"span_id":"8","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463883000,"dur":5000},{"pid":1,"tid":29,"id":9,"name":"variant manager create tests tasks","args":{"span_id":"9","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463888000,"dur":100},{"pid":1,"tid":29,"id":11,"name":"app task manager create merge manifest task","args":{"span_id":"11","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463890000,"dur":1000},{"pid":1,"tid":29,"id":12,"name":"app task manager create generate res values task","args":{"span_id":"12","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463891000,"dur":100},{"pid":1,"tid":29,"id":13,"name":"app task manager create create renderscript task","args":{"span_id":"13","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463891000,"dur":100},{"pid":1,"tid":29,"id":14,"name":"app task manager create merge resources task","args":{"span_id":"14","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463891000,"dur":1000},{"pid":1,"tid":29,"id":15,"name":"app task manager create merge assets task","args":{"span_id":"15","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463892000,"dur":100},{"pid":1,"tid":29,"id":16,"name":"app task manager create build config task","args":{"span_id":"16","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463892000,"dur":1000},{"pid":1,"tid":29,"id":17,"name":"app task manager create process res task","args":{"span_id":"17","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463893000,"dur":4000},{"pid":1,"tid":29,"id":18,"name":"app task manager create aidl task","args":{"span_id":"18","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463897000,"dur":1000},{"pid":1,"tid":29,"id":19,"name":"app task manager create shader task","args":{"span_id":"19","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463898000,"dur":100},{"pid":1,"tid":29,"id":20,"name":"app task manager create ndk task","args":{"span_id":"20","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463898000,"dur":1000},{"pid":1,"tid":29,"id":21,"name":"app task manager create external native build task","args":{"span_id":"21","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463899000,"dur":100},{"pid":1,"tid":29,"id":22,"name":"app task manager create merge jnilibs folders task","args":{"span_id":"22","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463899000,"dur":1000},{"pid":1,"tid":29,"id":23,"name":"app task manager create compile task","args":{"span_id":"23","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463900000,"dur":35000},{"pid":1,"tid":29,"id":24,"name":"app task manager create packaging task","args":{"span_id":"24","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463935000,"dur":6000},{"pid":1,"tid":29,"id":25,"name":"app task manager create lint task","args":{"span_id":"25","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463941000,"dur":100},{"pid":1,"tid":29,"id":10,"name":"variant manager create tasks for variant","args":{"span_id":"10","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867463888000,"dur":53000},{"pid":1,"tid":29,"id":26,"name":"variant manager create tasks for variant","args":{"span_id":"26","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463941000,"dur":6000},{"pid":1,"tid":29,"id":27,"name":"variant manager create tasks for variant","args":{"span_id":"27","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463947000,"dur":15000},{"pid":1,"tid":29,"id":7,"name":"variant manager create android tasks","args":{"span_id":"7","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463882000,"dur":81000},{"pid":1,"tid":29,"id":28,"name":"variant manager external native config values","args":{"span_id":"28","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463964000,"dur":100},{"pid":1,"tid":29,"id":6,"name":"base plugin create android tasks","args":{"span_id":"6","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867463877000,"dur":87000},{"pid":1,"tid":0,"id":29,"name":"task: build info loader","args":{"span_id":"29","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 7\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867463988000,"dur":3000},{"pid":1,"tid":0,"id":30,"name":"task: unknown task type","args":{"span_id":"30","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867463992000,"dur":100},{"pid":1,"tid":0,"id":31,"name":"task: app pre build","args":{"span_id":"31","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 92\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867463994000,"dur":158000},{"pid":1,"tid":0,"id":32,"name":"task: aidl compile","args":{"span_id":"32","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 1\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464154000,"dur":9000},{"pid":1,"tid":0,"id":33,"name":"task: renderscript compile","args":{"span_id":"33","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 54\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464167000,"dur":6000},{"pid":1,"tid":0,"id":34,"name":"task: check manifest","args":{"span_id":"34","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 8\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464174000,"dur":2000},{"pid":1,"tid":0,"id":35,"name":"task: generate build config","args":{"span_id":"35","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 24\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464177000,"dur":2000},{"pid":1,"tid":0,"id":36,"name":"task: prepare lint jar","args":{"span_id":"36","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 119\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464179000,"dur":1000},{"pid":1,"tid":0,"id":37,"name":"task: generate res values","args":{"span_id":"37","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 26\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464182000,"dur":100},{"pid":1,"tid":0,"id":38,"name":"task: unknown task type","args":{"span_id":"38","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464183000,"dur":100},{"pid":1,"tid":0,"id":39,"name":"task: merge resources","args":{"span_id":"39","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 40\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464186000,"dur":437000},{"pid":1,"tid":0,"id":40,"name":"task: compatible screens manifest","args":{"span_id":"40","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 9\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464625000,"dur":2000},{"pid":1,"tid":0,"id":41,"name":"task: merge manifests","args":{"span_id":"41","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 39\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464631000,"dur":4000},{"pid":1,"tid":0,"id":42,"name":"task: splits discovery","args":{"span_id":"42","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 87\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464637000,"dur":1000},{"pid":1,"tid":0,"id":43,"name":"task: process android resources","args":{"span_id":"43","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 51\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464643000,"dur":21000},{"pid":1,"tid":0,"id":44,"name":"task: unknown task type","args":{"span_id":"44","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867464664000,"dur":100},{"pid":1,"tid":0,"id":45,"name":"task: java pre compile","args":{"span_id":"45","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 76\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867464666000,"dur":11000},{"pid":1,"tid":0,"id":46,"name":"task: android java compile","args":{"span_id":"46","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 3\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867464680000,"dur":354000},{"pid":1,"tid":0,"id":47,"name":"task: merge source set folders","args":{"span_id":"47","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 41\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465037000,"dur":4000},{"pid":1,"tid":0,"id":48,"name":"task: shader compile","args":{"span_id":"48","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 55\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465043000,"dur":1000},{"pid":1,"tid":0,"id":49,"name":"task: unknown task type","args":{"span_id":"49","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465045000,"dur":100},{"pid":1,"tid":0,"id":50,"name":"task: merge source set folders","args":{"span_id":"50","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 41\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465047000,"dur":7000},{"pid":1,"tid":0,"id":51,"name":"task: package application","args":{"span_id":"51","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 45\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465056000,"dur":6000},{"pid":1,"tid":0,"id":52,"name":"task: check manifest in instant run mode","args":{"span_id":"52","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 72\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867465062000,"dur":10000},{"pid":1,"tid":0,"id":53,"name":"task: transform","args":{"span_id":"53","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465074000,"dur":2000},{"pid":1,"tid":30,"id":55,"name":"transform prep: instant run verifier","args":{"span_id":"55","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 20\nis_incremental: true\n"},"ph":"X","ts":1522867465102000,"dur":1000},{"pid":1,"tid":30,"id":57,"name":"task file verification","args":{"span_id":"57","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1522867465104000,"dur":100},{"pid":1,"tid":30,"id":56,"name":"transform: instant run verifier","args":{"span_id":"56","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 20\nis_incremental: true\n"},"ph":"X","ts":1522867465103000,"dur":9000},{"pid":1,"tid":0,"id":54,"name":"task: transform","args":{"span_id":"54","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867465077000,"dur":51000},{"pid":1,"tid":0,"id":58,"name":"task: transform","args":{"span_id":"58","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465129000,"dur":12000},{"pid":1,"tid":0,"id":59,"name":"task: ndk compile","args":{"span_id":"59","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 43\ndid_work: false\nskipped: true\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867465143000,"dur":1000},{"pid":1,"tid":0,"id":60,"name":"task: merge source set folders","args":{"span_id":"60","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 41\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465146000,"dur":3000},{"pid":1,"tid":0,"id":61,"name":"task: transform","args":{"span_id":"61","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465151000,"dur":28000},{"pid":1,"tid":0,"id":62,"name":"task: unknown task type","args":{"span_id":"62","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867465181000,"dur":2000},{"pid":1,"tid":0,"id":63,"name":"task: transform","args":{"span_id":"63","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465188000,"dur":95000},{"pid":1,"tid":0,"id":64,"name":"task: transform","args":{"span_id":"64","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867465284000,"dur":3000},{"pid":1,"tid":30,"id":66,"name":"transform prep: instant run","args":{"span_id":"66","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 5\nis_incremental: true\n"},"ph":"X","ts":1522867465375000,"dur":15000},{"pid":1,"tid":30,"id":67,"name":"transform: instant run","args":{"span_id":"67","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 5\nis_incremental: true\n"},"ph":"X","ts":1522867465390000,"dur":833000},{"pid":1,"tid":0,"id":65,"name":"task: transform","args":{"span_id":"65","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867465291000,"dur":955000},{"pid":1,"tid":30,"id":69,"name":"transform prep: instant run dex","args":{"span_id":"69","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 3\nis_incremental: true\n"},"ph":"X","ts":1522867466252000,"dur":100},{"pid":1,"tid":30,"id":70,"name":"transform: instant run dex","args":{"span_id":"70","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 3\nis_incremental: true\n"},"ph":"X","ts":1522867466252000,"dur":1000},{"pid":1,"tid":0,"id":68,"name":"task: transform","args":{"span_id":"68","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466248000,"dur":9000},{"pid":1,"tid":0,"id":71,"name":"task: unknown task type","args":{"span_id":"71","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466258000,"dur":100},{"pid":1,"tid":0,"id":72,"name":"task: pre cold swap","args":{"span_id":"72","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 48\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466259000,"dur":1000},{"pid":1,"tid":0,"id":73,"name":"task: fast deploy runtime extractor","args":{"span_id":"73","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 21\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867466262000,"dur":1000},{"pid":1,"tid":0,"id":74,"name":"task: generate instant run app info","args":{"span_id":"74","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 25\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867466266000,"dur":2000},{"pid":1,"tid":31,"id":76,"name":"transform prep: instant run slicer","args":{"span_id":"76","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 4\nis_incremental: true\n"},"ph":"X","ts":1522867466349000,"dur":1000},{"pid":1,"tid":31,"id":77,"name":"transform: instant run slicer","args":{"span_id":"77","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 4\nis_incremental: true\n"},"ph":"X","ts":1522867466350000,"dur":29000},{"pid":1,"tid":0,"id":75,"name":"task: transform","args":{"span_id":"75","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466270000,"dur":149000},{"pid":1,"tid":31,"id":79,"name":"transform prep: dex archive builder","args":{"span_id":"79","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 29\nis_incremental: true\n"},"ph":"X","ts":1522867466512000,"dur":2000},{"pid":1,"tid":31,"id":80,"name":"transform: dex archive builder","args":{"span_id":"80","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 29\nis_incremental: true\n"},"ph":"X","ts":1522867466514000,"dur":288000},{"pid":1,"tid":0,"id":78,"name":"task: transform","args":{"span_id":"78","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466421000,"dur":419000},{"pid":1,"tid":31,"id":82,"name":"transform prep: external libs merger","args":{"span_id":"82","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 34\nis_incremental: true\n"},"ph":"X","ts":1522867466882000,"dur":1000},{"pid":1,"tid":31,"id":83,"name":"transform: external libs merger","args":{"span_id":"83","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 34\nis_incremental: true\n"},"ph":"X","ts":1522867466883000,"dur":4000},{"pid":1,"tid":0,"id":81,"name":"task: transform","args":{"span_id":"81","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466842000,"dur":47000},{"pid":1,"tid":29,"id":85,"name":"transform prep: dex merger","args":{"span_id":"85","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 30\nis_incremental: true\n"},"ph":"X","ts":1522867466937000,"dur":3000},{"pid":1,"tid":29,"id":86,"name":"transform: dex merger","args":{"span_id":"86","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 30\nis_incremental: true\n"},"ph":"X","ts":1522867466940000,"dur":52000},{"pid":1,"tid":0,"id":84,"name":"task: transform","args":{"span_id":"84","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466891000,"dur":106000},{"pid":1,"tid":0,"id":87,"name":"task: validate signing","args":{"span_id":"87","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 67\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867466997000,"dur":3000},{"pid":1,"tid":29,"id":89,"name":"transform prep: instant run dependencies apk builder","args":{"span_id":"89","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 23\nis_incremental: true\n"},"ph":"X","ts":1522867467007000,"dur":2000},{"pid":1,"tid":29,"id":90,"name":"transform: instant run dependencies apk builder","args":{"span_id":"90","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 23\nis_incremental: true\n"},"ph":"X","ts":1522867467009000,"dur":2000},{"pid":1,"tid":0,"id":88,"name":"task: transform","args":{"span_id":"88","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867467001000,"dur":11000},{"pid":1,"tid":29,"id":92,"name":"transform prep: instant run slice split apk builder","args":{"span_id":"92","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 24\nis_incremental: true\n"},"ph":"X","ts":1522867467022000,"dur":1000},{"pid":1,"tid":29,"id":93,"name":"transform: instant run slice split apk builder","args":{"span_id":"93","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 24\nis_incremental: true\n"},"ph":"X","ts":1522867467023000,"dur":5278000},{"pid":1,"tid":0,"id":91,"name":"task: transform","args":{"span_id":"91","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867467014000,"dur":5290000},{"pid":1,"tid":0,"id":94,"name":"task: package application","args":{"span_id":"94","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 45\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1522867472306000,"dur":18000},{"pid":1,"tid":0,"id":95,"name":"task: build info writer","args":{"span_id":"95","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 26\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 70\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867472324000,"dur":9000},{"pid":1,"tid":0,"id":96,"name":"task: unknown task type","args":{"span_id":"96","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867472333000,"dur":100},{"pid":1,"tid":0,"id":97,"name":"task: unknown task type","args":{"span_id":"97","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1522867472334000,"dur":100},{"pid":1,"tid":29,"id":98,"name":"base plugin build finished","args":{"span_id":"98","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1522867472346000,"dur":100}]
[ "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-v9ajCoaYMgI%2fVkdfVzEy43I%2fAAAAAAADttU%2fsyqoRKoMbZM%2fs16000%2f0093-001.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-80oNIZzFT9I%2fVkdZrT5Kx_I%2fAAAAAAADr6M%2fXDSFNU0TqNE%2fs16000%2f0093-002.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-tZs7df7XtA8%2fVkdZH7jxzkI%2fAAAAAAADrvI%2fYVOYs_PgAr8%2fs16000%2f0093-003.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-YJtnrYSTD30%2fVkdeLeslchI%2fAAAAAAADtVo%2f-jm9DXbPMtY%2fs16000%2f0093-004.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-Nr_gHwDoCoE%2fVkdeFl5SI6I%2fAAAAAAADtHA%2fi_u7MSSeDJI%2fs16000%2f0093-005.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-Wp5jLtThOYU%2fVkdcLz__ZDI%2fAAAAAAADsmQ%2f4g2-jRTYkX8%2fs16000%2f0093-006.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-aKABHBowt_g%2fVkdZ96nCiOI%2fAAAAAAADr0g%2f_iM5uyk2Ch0%2fs16000%2f0093-007.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-fdgrIWbGbgc%2fVkdcYk80lDI%2fAAAAAAADsxc%2fKmNNX90J4aU%2fs16000%2f0093-008.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-QWPCJStwnnU%2fVkdfte-FrPI%2fAAAAAAADt1k%2f8gxiuTCrPbU%2fs16000%2f0093-009.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-B165tT43IO8%2fVkdbtnjE1uI%2fAAAAAAADsjY%2fQNegVjGLol8%2fs16000%2f0093-010.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-YSIGauFE4KM%2fVkdfMWsTcUI%2fAAAAAAADtpg%2fSJwzRO0ztmg%2fs16000%2f0093-011.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-uDxGoLhpv7U%2fVkdcVipTDuI%2fAAAAAAADswU%2ffvRPclbCYdo%2fs16000%2f0093-012.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-FMFA4ts0ziQ%2fVkdbp93C5AI%2fAAAAAAADsh8%2f_fUovL2mflc%2fs16000%2f0093-013.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-8Qdhgfm8IeI%2fVkdaUJdh-pI%2fAAAAAAADsHg%2f_32wtvM1vMM%2fs16000%2f0093-014.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-82cRSMIb7Gg%2fVkdbk2xfODI%2fAAAAAAADsgc%2ff_vrAMsOQ70%2fs16000%2f0093-015.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-4tgKtBYqcZg%2fVkde9NnCDaI%2fAAAAAAADtk4%2fKYc2cNQH7W0%2fs16000%2f0093-016.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-4eU-2B5qf7k%2fVkdZhRWJj2I%2fAAAAAAADroY%2ffSL_3Prp6YQ%2fs16000%2f0093-017.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-_UAB019N2pw%2fVkdcPFg0_UI%2fAAAAAAADsew%2f03_XBcDgia4%2fs16000%2f0093-018.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-lO4ncWMeGys%2fVkdZt0ojKtI%2fAAAAAAADr7U%2fvcQ60L1rjsk%2fs16000%2f0093-019.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-JP1iVuiyAE8%2fVkdYgH9P-qI%2fAAAAAAADrkU%2fDW6_nkJ_WCc%2fs16000%2f0093-020.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-Wv6PRNIU5SE%2fVkdb85Rs2nI%2fAAAAAAADsn0%2fSQfY7WU5K0g%2fs16000%2f0093-021.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-pqax6TQSl00%2fVkdfckoHSjI%2fAAAAAAADtvw%2fJ1bYDrRTXoU%2fs16000%2f0093-022.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-GXoUZ1RI08k%2fVkdf9LYxBSI%2fAAAAAAADtqY%2fq4ZE2M9mjjs%2fs16000%2f0093-023.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-n9yaiZBXogY%2fVkdfpIbLX4I%2fAAAAAAADtpA%2fScBAz9gnpuk%2fs16000%2f0093-024.jpg&imgmax=25000", "https://images1-focus-opensocial.googleusercontent.com/gadgets/proxy?container=focus&gadget=a&no_expand=1&resize_h=0&rewriteMime=image%2F*&url=http%3a%2f%2f2.bp.blogspot.com%2f-OcwLufmOm-g%2fVkdbU26yFpI%2fAAAAAAADsbU%2fMT5dLjb3ZAA%2fs16000%2f0093-025.jpg&imgmax=25000" ]
{ "name": "Texas", "children": [ { "name": "Food expense ", "children": [ {"name": "Home-Cereals", "description": "cereals", "size": 578 }, {"name": "Home-Fruit and vegetable", "description": "cereals", "size": 807 }, {"name": "Home-Meats", "description": "meats", "size": 908 }, {"name": "Home-Diary Product", "description": "diary", "size": 437 }, {"name": "Home-Other", "description": "other", "size": 1499 }, {"name": "Food from vending machine", "description": "vending", "size": 430 }, {"name": "Food from takeout", "description": "takeout", "size": 1335 }, {"name": "Food from restaurant", "description": "restaurant", "size": 420 }, {"name": "Food from cafeteria", "description": "cafeteria", "size": 333 }, {"name": "Snack food", "description": "snack", "size": 195 } ] }, { "name": "Health related expense", "children": [ {"name": "Drug", "description": "drug", "size": 466 }, {"name": "Health insurance", "description": "health insurance", "size": 2284 }, {"name": "Medical service", "description": "medical service", "size": 847 } ] }, { "name": "Transport related expense", "children": [ {"name": "public transport", "description": "public transport", "size": 684 }, {"name": "gas and oil", "description": "gas and oil", "size": 2768 }, {"name": "vehicle purchase", "description": "vehicle purchase", "size": 3636 }, {"name": "vehicle rental", "description": "vehicle rental", "size": 346 }, {"name": "other", "description": "ohter", "size": 2781 } ] }, { "name": "Housing related expense", "children": [ {"name": "house", "description": "house", "size": 11154 }, {"name": "furniture", "description": "furniture", "size": 1722 } ] } ] }
[{"pid":0,"ph":"i","name":"Memory sample","ts":1524598541741000,"args":{"JVM stats":"heap_memory_usage: 173445304\nnon_heap_memory_usage: 103109944\nloaded_class_count: 12710\nthread_count: 23\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542079000,"args":{"JVM stats":"heap_memory_usage: 187211376\nnon_heap_memory_usage: 104208256\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542081000,"args":{"JVM stats":"heap_memory_usage: 187492064\nnon_heap_memory_usage: 104213848\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542327000,"args":{"JVM stats":"heap_memory_usage: 195919848\nnon_heap_memory_usage: 104456368\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542353000,"args":{"JVM stats":"heap_memory_usage: 196200584\nnon_heap_memory_usage: 104463440\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542391000,"args":{"JVM stats":"heap_memory_usage: 196200584\nnon_heap_memory_usage: 104472088\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542402000,"args":{"JVM stats":"heap_memory_usage: 196200584\nnon_heap_memory_usage: 104512448\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542413000,"args":{"JVM stats":"heap_memory_usage: 196200584\nnon_heap_memory_usage: 104516664\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542416000,"args":{"JVM stats":"heap_memory_usage: 196200584\nnon_heap_memory_usage: 104525624\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542420000,"args":{"JVM stats":"heap_memory_usage: 196200584\nnon_heap_memory_usage: 104531256\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542421000,"args":{"JVM stats":"heap_memory_usage: 196200584\nnon_heap_memory_usage: 104536352\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542575000,"args":{"JVM stats":"heap_memory_usage: 200974432\nnon_heap_memory_usage: 104631144\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542581000,"args":{"JVM stats":"heap_memory_usage: 200974432\nnon_heap_memory_usage: 104647752\nloaded_class_count: 12777\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542759000,"args":{"JVM stats":"heap_memory_usage: 207597720\nnon_heap_memory_usage: 105089808\nloaded_class_count: 12782\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598542766000,"args":{"JVM stats":"heap_memory_usage: 207597720\nnon_heap_memory_usage: 105117416\nloaded_class_count: 12782\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598543967000,"args":{"JVM stats":"heap_memory_usage: 228564784\nnon_heap_memory_usage: 105377032\nloaded_class_count: 12789\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598543968000,"args":{"JVM stats":"heap_memory_usage: 228564784\nnon_heap_memory_usage: 105377864\nloaded_class_count: 12789\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598543993000,"args":{"JVM stats":"heap_memory_usage: 229972512\nnon_heap_memory_usage: 105384000\nloaded_class_count: 12789\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544057000,"args":{"JVM stats":"heap_memory_usage: 233343144\nnon_heap_memory_usage: 105433080\nloaded_class_count: 12792\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544070000,"args":{"JVM stats":"heap_memory_usage: 233343144\nnon_heap_memory_usage: 105439224\nloaded_class_count: 12792\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544078000,"args":{"JVM stats":"heap_memory_usage: 233343144\nnon_heap_memory_usage: 105460368\nloaded_class_count: 12792\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544079000,"args":{"JVM stats":"heap_memory_usage: 233343144\nnon_heap_memory_usage: 105461840\nloaded_class_count: 12792\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544099000,"args":{"JVM stats":"heap_memory_usage: 233908632\nnon_heap_memory_usage: 105511688\nloaded_class_count: 12792\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544120000,"args":{"JVM stats":"heap_memory_usage: 234189320\nnon_heap_memory_usage: 105573104\nloaded_class_count: 12794\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544144000,"args":{"JVM stats":"heap_memory_usage: 234763560\nnon_heap_memory_usage: 105694456\nloaded_class_count: 12798\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544152000,"args":{"JVM stats":"heap_memory_usage: 235044568\nnon_heap_memory_usage: 105720792\nloaded_class_count: 12801\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544211000,"args":{"JVM stats":"heap_memory_usage: 238414032\nnon_heap_memory_usage: 105752560\nloaded_class_count: 12802\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544233000,"args":{"JVM stats":"heap_memory_usage: 239256208\nnon_heap_memory_usage: 105801304\nloaded_class_count: 12804\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544242000,"args":{"JVM stats":"heap_memory_usage: 239256208\nnon_heap_memory_usage: 105810120\nloaded_class_count: 12805\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544253000,"args":{"JVM stats":"heap_memory_usage: 239537464\nnon_heap_memory_usage: 105821352\nloaded_class_count: 12806\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544287000,"args":{"JVM stats":"heap_memory_usage: 241221696\nnon_heap_memory_usage: 105854872\nloaded_class_count: 12807\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544292000,"args":{"JVM stats":"heap_memory_usage: 241221696\nnon_heap_memory_usage: 105860488\nloaded_class_count: 12807\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544351000,"args":{"JVM stats":"heap_memory_usage: 242464920\nnon_heap_memory_usage: 105938928\nloaded_class_count: 12807\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544385000,"args":{"JVM stats":"heap_memory_usage: 62518712\nnon_heap_memory_usage: 105959888\nloaded_class_count: 12807\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 1\n gc_time: 24\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544489000,"args":{"JVM stats":"heap_memory_usage: 68717968\nnon_heap_memory_usage: 106035096\nloaded_class_count: 12807\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544552000,"args":{"JVM stats":"heap_memory_usage: 69640480\nnon_heap_memory_usage: 106186952\nloaded_class_count: 12836\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544553000,"args":{"JVM stats":"heap_memory_usage: 69640480\nnon_heap_memory_usage: 106187968\nloaded_class_count: 12836\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544558000,"args":{"JVM stats":"heap_memory_usage: 69829536\nnon_heap_memory_usage: 106200168\nloaded_class_count: 12837\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544564000,"args":{"JVM stats":"heap_memory_usage: 69829536\nnon_heap_memory_usage: 106202568\nloaded_class_count: 12837\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544571000,"args":{"JVM stats":"heap_memory_usage: 70195272\nnon_heap_memory_usage: 106203544\nloaded_class_count: 12837\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544696000,"args":{"JVM stats":"heap_memory_usage: 73930016\nnon_heap_memory_usage: 106223552\nloaded_class_count: 12837\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544887000,"args":{"JVM stats":"heap_memory_usage: 79687808\nnon_heap_memory_usage: 106344528\nloaded_class_count: 12837\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598544954000,"args":{"JVM stats":"heap_memory_usage: 81222552\nnon_heap_memory_usage: 106367120\nloaded_class_count: 12837\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545021000,"args":{"JVM stats":"heap_memory_usage: 82706584\nnon_heap_memory_usage: 106374352\nloaded_class_count: 12837\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545056000,"args":{"JVM stats":"heap_memory_usage: 83452600\nnon_heap_memory_usage: 106489504\nloaded_class_count: 12865\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545067000,"args":{"JVM stats":"heap_memory_usage: 83790824\nnon_heap_memory_usage: 106489536\nloaded_class_count: 12865\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545078000,"args":{"JVM stats":"heap_memory_usage: 83944104\nnon_heap_memory_usage: 106520288\nloaded_class_count: 12865\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545105000,"args":{"JVM stats":"heap_memory_usage: 84738248\nnon_heap_memory_usage: 106610952\nloaded_class_count: 12866\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545155000,"args":{"JVM stats":"heap_memory_usage: 85547952\nnon_heap_memory_usage: 106800784\nloaded_class_count: 12886\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545156000,"args":{"JVM stats":"heap_memory_usage: 85701264\nnon_heap_memory_usage: 106800784\nloaded_class_count: 12886\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545156001,"args":{"JVM stats":"heap_memory_usage: 85701264\nnon_heap_memory_usage: 106800784\nloaded_class_count: 12886\nthread_count: 28\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":0,"ph":"i","name":"Memory sample","ts":1524598545279000,"args":{"JVM stats":"heap_memory_usage: 90535440\nnon_heap_memory_usage: 107620240\nloaded_class_count: 13047\nthread_count: 23\ngarbage_collection_stats {\n name: \"PS Scavenge\"\n gc_collections: 0\n gc_time: 0\n}\ngarbage_collection_stats {\n name: \"PS MarkSweep\"\n gc_collections: 0\n gc_time: 0\n}\n"}},{"pid":1,"tid":2,"id":2,"name":"base plugin project configure","args":{"span_id":"2","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541742000,"dur":19000},{"pid":1,"tid":2,"id":3,"name":"base plugin project base extension creation","args":{"span_id":"3","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541761000,"dur":17000},{"pid":1,"tid":2,"id":5,"name":"task manager create tasks","args":{"span_id":"5","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541778000,"dur":7000},{"pid":1,"tid":2,"id":4,"name":"base plugin project tasks creation","args":{"span_id":"4","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541778000,"dur":7000},{"pid":1,"tid":2,"id":8,"name":"variant manager create variants","args":{"span_id":"8","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541800000,"dur":16000},{"pid":1,"tid":2,"id":9,"name":"variant manager create tests tasks","args":{"span_id":"9","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541816000,"dur":4000},{"pid":1,"tid":2,"id":11,"name":"app task manager create merge manifest task","args":{"span_id":"11","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541825000,"dur":3000},{"pid":1,"tid":2,"id":12,"name":"app task manager create generate res values task","args":{"span_id":"12","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541828000,"dur":100},{"pid":1,"tid":2,"id":13,"name":"app task manager create create renderscript task","args":{"span_id":"13","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541828000,"dur":1000},{"pid":1,"tid":2,"id":14,"name":"app task manager create merge resources task","args":{"span_id":"14","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541830000,"dur":2000},{"pid":1,"tid":2,"id":15,"name":"app task manager create merge assets task","args":{"span_id":"15","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541832000,"dur":1000},{"pid":1,"tid":2,"id":16,"name":"app task manager create build config task","args":{"span_id":"16","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541833000,"dur":100},{"pid":1,"tid":2,"id":17,"name":"app task manager create process res task","args":{"span_id":"17","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541833000,"dur":11000},{"pid":1,"tid":2,"id":18,"name":"app task manager create aidl task","args":{"span_id":"18","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541844000,"dur":1000},{"pid":1,"tid":2,"id":19,"name":"app task manager create shader task","args":{"span_id":"19","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541845000,"dur":1000},{"pid":1,"tid":2,"id":20,"name":"app task manager create ndk task","args":{"span_id":"20","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541846000,"dur":1000},{"pid":1,"tid":2,"id":21,"name":"app task manager create external native build task","args":{"span_id":"21","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541847000,"dur":100},{"pid":1,"tid":2,"id":22,"name":"app task manager create merge jnilibs folders task","args":{"span_id":"22","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541847000,"dur":7000},{"pid":1,"tid":2,"id":23,"name":"app task manager create compile task","args":{"span_id":"23","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541854000,"dur":106000},{"pid":1,"tid":2,"id":24,"name":"app task manager create packaging task","args":{"span_id":"24","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541960000,"dur":15000},{"pid":1,"tid":2,"id":25,"name":"app task manager create lint task","args":{"span_id":"25","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541975000,"dur":100},{"pid":1,"tid":2,"id":10,"name":"variant manager create tasks for variant","args":{"span_id":"10","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n"},"ph":"X","ts":1524598541820000,"dur":156000},{"pid":1,"tid":2,"id":26,"name":"variant manager create tasks for variant","args":{"span_id":"26","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541976000,"dur":7000},{"pid":1,"tid":2,"id":27,"name":"variant manager create tasks for variant","args":{"span_id":"27","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541983000,"dur":23000},{"pid":1,"tid":2,"id":7,"name":"variant manager create android tasks","args":{"span_id":"7","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541800000,"dur":209000},{"pid":1,"tid":2,"id":28,"name":"variant manager external native config values","args":{"span_id":"28","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598542011000,"dur":100},{"pid":1,"tid":2,"id":6,"name":"base plugin create android tasks","args":{"span_id":"6","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598541793000,"dur":218000},{"pid":1,"tid":0,"id":29,"name":"task: build info loader","args":{"span_id":"29","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 7\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598542063000,"dur":16000},{"pid":1,"tid":0,"id":30,"name":"task: unknown task type","args":{"span_id":"30","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542080000,"dur":1000},{"pid":1,"tid":0,"id":31,"name":"task: app pre build","args":{"span_id":"31","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 92\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542083000,"dur":244000},{"pid":1,"tid":0,"id":32,"name":"task: aidl compile","args":{"span_id":"32","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 1\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542331000,"dur":22000},{"pid":1,"tid":0,"id":33,"name":"task: renderscript compile","args":{"span_id":"33","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 54\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542361000,"dur":30000},{"pid":1,"tid":0,"id":34,"name":"task: check manifest","args":{"span_id":"34","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 8\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542396000,"dur":6000},{"pid":1,"tid":0,"id":35,"name":"task: generate build config","args":{"span_id":"35","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 24\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542406000,"dur":7000},{"pid":1,"tid":0,"id":36,"name":"task: prepare lint jar","args":{"span_id":"36","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 119\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542414000,"dur":2000},{"pid":1,"tid":0,"id":37,"name":"task: generate res values","args":{"span_id":"37","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 26\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542419000,"dur":1000},{"pid":1,"tid":0,"id":38,"name":"task: unknown task type","args":{"span_id":"38","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542421000,"dur":100},{"pid":1,"tid":0,"id":39,"name":"task: merge resources","args":{"span_id":"39","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 40\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542426000,"dur":149000},{"pid":1,"tid":0,"id":40,"name":"task: compatible screens manifest","args":{"span_id":"40","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 9\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542578000,"dur":3000},{"pid":1,"tid":0,"id":41,"name":"task: merge manifests","args":{"span_id":"41","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 39\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598542586000,"dur":173000},{"pid":1,"tid":0,"id":42,"name":"task: splits discovery","args":{"span_id":"42","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 87\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598542764000,"dur":2000},{"pid":1,"tid":0,"id":43,"name":"task: process android resources","args":{"span_id":"43","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 51\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598542775000,"dur":1191000},{"pid":1,"tid":0,"id":44,"name":"task: unknown task type","args":{"span_id":"44","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598543967000,"dur":1000},{"pid":1,"tid":0,"id":45,"name":"task: java pre compile","args":{"span_id":"45","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 76\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598543970000,"dur":23000},{"pid":1,"tid":0,"id":46,"name":"task: android java compile","args":{"span_id":"46","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 3\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598543999000,"dur":58000},{"pid":1,"tid":0,"id":47,"name":"task: merge source set folders","args":{"span_id":"47","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 41\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544061000,"dur":9000},{"pid":1,"tid":0,"id":48,"name":"task: shader compile","args":{"span_id":"48","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 55\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544073000,"dur":5000},{"pid":1,"tid":0,"id":49,"name":"task: unknown task type","args":{"span_id":"49","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544078000,"dur":1000},{"pid":1,"tid":0,"id":50,"name":"task: merge source set folders","args":{"span_id":"50","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 41\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544083000,"dur":16000},{"pid":1,"tid":0,"id":51,"name":"task: package application","args":{"span_id":"51","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 45\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544105000,"dur":15000},{"pid":1,"tid":0,"id":52,"name":"task: check manifest in instant run mode","args":{"span_id":"52","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 72\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598544121000,"dur":23000},{"pid":1,"tid":0,"id":53,"name":"task: transform","args":{"span_id":"53","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544148000,"dur":4000},{"pid":1,"tid":0,"id":54,"name":"task: transform","args":{"span_id":"54","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544156000,"dur":55000},{"pid":1,"tid":0,"id":55,"name":"task: transform","args":{"span_id":"55","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544212000,"dur":21000},{"pid":1,"tid":0,"id":56,"name":"task: ndk compile","args":{"span_id":"56","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 43\ndid_work: false\nskipped: true\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598544238000,"dur":4000},{"pid":1,"tid":0,"id":57,"name":"task: merge source set folders","args":{"span_id":"57","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 41\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544247000,"dur":6000},{"pid":1,"tid":0,"id":58,"name":"task: transform","args":{"span_id":"58","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544257000,"dur":30000},{"pid":1,"tid":0,"id":59,"name":"task: unknown task type","args":{"span_id":"59","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598544289000,"dur":3000},{"pid":1,"tid":0,"id":60,"name":"task: transform","args":{"span_id":"60","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544297000,"dur":53000},{"pid":1,"tid":0,"id":61,"name":"task: transform","args":{"span_id":"61","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544352000,"dur":32000},{"pid":1,"tid":0,"id":62,"name":"task: transform","args":{"span_id":"62","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544387000,"dur":102000},{"pid":1,"tid":3,"id":64,"name":"transform prep: instant run dex","args":{"span_id":"64","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 3\nis_incremental: false\n"},"ph":"X","ts":1524598544509000,"dur":39000},{"pid":1,"tid":3,"id":65,"name":"transform: instant run dex","args":{"span_id":"65","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","transform":"type: 3\nis_incremental: false\n"},"ph":"X","ts":1524598544548000,"dur":2000},{"pid":1,"tid":0,"id":63,"name":"task: transform","args":{"span_id":"63","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598544496000,"dur":56000},{"pid":1,"tid":0,"id":66,"name":"task: unknown task type","args":{"span_id":"66","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598544553000,"dur":100},{"pid":1,"tid":0,"id":67,"name":"task: pre cold swap","args":{"span_id":"67","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 48\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598544554000,"dur":4000},{"pid":1,"tid":0,"id":68,"name":"task: fast deploy runtime extractor","args":{"span_id":"68","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 21\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544562000,"dur":2000},{"pid":1,"tid":0,"id":69,"name":"task: generate instant run app info","args":{"span_id":"69","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 25\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544568000,"dur":2000},{"pid":1,"tid":0,"id":70,"name":"task: transform","args":{"span_id":"70","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544574000,"dur":122000},{"pid":1,"tid":0,"id":71,"name":"task: transform","args":{"span_id":"71","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544699000,"dur":187000},{"pid":1,"tid":0,"id":72,"name":"task: transform","args":{"span_id":"72","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544889000,"dur":65000},{"pid":1,"tid":0,"id":73,"name":"task: transform","args":{"span_id":"73","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598544956000,"dur":65000},{"pid":1,"tid":0,"id":74,"name":"task: validate signing","args":{"span_id":"74","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 67\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598545022000,"dur":34000},{"pid":1,"tid":0,"id":75,"name":"task: transform","args":{"span_id":"75","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598545058000,"dur":9000},{"pid":1,"tid":0,"id":76,"name":"task: transform","args":{"span_id":"76","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 65\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598545070000,"dur":8000},{"pid":1,"tid":0,"id":77,"name":"task: package application","args":{"span_id":"77","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 45\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598545080000,"dur":25000},{"pid":1,"tid":0,"id":78,"name":"task: build info writer","args":{"span_id":"78","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","variant":"id: 1\nis_debug: true\nminify_enabled: false\nuse_multidex: false\nuse_legacy_multidex: false\nvariant_type: APPLICATION\nmin_sdk_version {\n api_level: 15\n}\ntarget_sdk_version {\n api_level: 26\n}\ndex_builder: DX_DEXER\ndex_merger: DX_MERGER\n","task":"type: 70\ndid_work: true\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598545106000,"dur":49000},{"pid":1,"tid":0,"id":79,"name":"task: unknown task type","args":{"span_id":"79","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: true\nup_to_date: true\nfailed: false\n"},"ph":"X","ts":1524598545155000,"dur":100},{"pid":1,"tid":0,"id":80,"name":"task: unknown task type","args":{"span_id":"80","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n","task":"type: 0\ndid_work: false\nskipped: false\nup_to_date: false\nfailed: false\n"},"ph":"X","ts":1524598545156000,"dur":100},{"pid":1,"tid":2,"id":81,"name":"base plugin build finished","args":{"span_id":"81","project":"id: 1\nandroid_plugin_version: \"3.0.1\"\nandroid_plugin: APPLICATION\nplugin_generation: FIRST\nbuild_tools_version: \"26.0.2\"\ncompile_sdk: \"android-26\"\nsplits {\n}\n"},"ph":"X","ts":1524598545240000,"dur":100}]
[ { "year": "1958", "artist": "Domenico Modugno", "title": "Nel Blu Dipinto Di Blu (Volare)", "genre": "Pop", "lyrics": "Penso che un sogno cos� non ritorni mai pi� Mi dipingevo le mani e la faccia di blu Poi d'improvviso venivo dal vento rapito E incominciavo a volare nel cielo infinito Volare, oh, oh! Cantare, oh, oh, oh, oh! Nel blu, dipinto di blu Felice di stare lass� E volavo, volavo felice Pi� in alto del sole ed ancora pi� su Mentre il mondo pian piano spariva Lontano laggi� Una musica dolce suonava soltanto per me Volare, oh, oh! Cantare, oh, oh, oh, oh! Nel blu, dipinto di blu Felice di stare lass� Ma tutti I sogni nell'alba svaniscon perch� Quando tramonta la luna li porta con s� Ma io continuo a sognare negli occhi tuoi belli Che sono blu come un cielo trapunto di stelle Volare, oh, oh! Cantare, oh, oh, oh, oh! Nel blu degli occhi tuoi blu Felice di stare quaggi� E continuo a volare felice pi� in alto del sole ed ancora pi� su Mentre il mondo pian piano scompare negli occhi tuoi blu La tua voce � una musica dolce che suona per me Volare, oh, oh! Cantare, oh, oh, oh, oh! Nel blu degli occhi tuoi blu Felice di stare quaggi� Nel blu degli occhi tuoi blu Felice di stare quaggi� Con te! ir Corrigir" }, { "year": "1959", "artist": "Johnny Horton", "title": "The Battle of New Orleans", "genre": "Country", "lyrics": "In 1814 we took a little trip Along with Colonel Jackson down the mighty Mississippi We took a little bacon and we took a little beans And we caught the bloody British in the town of New Orleans We fired our guns and the British kept a-comin' There wasn't nigh as many as there was a while ago We fired once more and they began to runnin' On down the Mississippi to the Gulf of Mexico We looked down the river and we seed the British come And there must have been a hundred of 'em beatin' on the drum They stepped so high and they made their bugles ring We stood behind our cotton bales and didn't say a thing We fired our guns and the British kept a-comin' There wasn't nigh as many as there was a while ago We fired once more and they began to runnin' On down the Mississippi to the Gulf of Mexico Old Hickory said we could take 'em by surprise If we didn't fire our muskets till we looked 'em in the eyes We held our fire till we seed their faces well Then we opened up our squirrel guns and gave 'em Well, we Fired our guns and the British kept a-comin' There wasn't nigh as many as there was a while ago We fired once more and they began to runnin' On down the Mississippi to the Gulf of Mexico Yeah they ran through the briers and they ran through the brambles And they ran through the bushes where a rabbit couldn't go They ran so fast that the hounds couldn't catch 'em On down the Mississippi to the Gulf of Mexico We fired our cannon till the barrel melted down So we grabbed an alligator and we fought another round We filled his head with cannonballs 'n' powdered his behind And when we touched the powder off, the gator lost his mind We fired our guns and the British kept a-comin' There wasn't nigh as many as there was a while ago We fired once more and they began to runnin' On down the Mississippi to the Gulf of Mexico Yeah they ran through the briers and they ran through the brambles And they ran through the bushes where a rabbit couldn't go They ran so fast that the hounds couldn't catch 'em On down the Mississippi to the Gulf of Mexico Hut, hut, three, four Sound off, three, four Hut, hut, three, four Sound off, three, four Hut, hut, three, four" }, { "year": "1960", "artist": "Percy Faith", "title": "Theme from A Summer Place", "genre": "Easy Listening", "lyrics": "There's a summer place Where it may rain or storm Yet I'm safe and warm For within that summer place Your arms reach out to me And my heart is free from all care For it knows There are no gloomy skies When seen through the eyes Of those who are blessed with love And the sweet secret of A summer place Is that it's anywhere When two people share All their hopes All their dreams All their love There's a summer place Where it may rain or storm Yet I'm safe and warm In your arms, in your arms In your arms, in your arms In your arms, in your arms" }, { "year": "1961", "artist": "Bobby Lewis", "title": "Tossin' and Turnin'", "genre": "R&B", "lyrics": "I couldn't sleep at all last night Got to thinkin' of you Baby things weren't right Well I was tossin' and turnin' Turnin' and tossin' A tossin' and turnin' all night I kicked the blankets on the floor Turned my pillow upside down I never never did before 'Cause I was tossin' and turnin' Turnin' and tossin' A-tossin' and turnin' all night Jumped out of bed Turned on the light I pulled down the shade Went to the kitchen for a bite Rolled up the shade Turned off the light I jumped back into bed It was the middle of the night The clock downstairs was strikin' four Couldn't get you off my mind I heard the milkman at the door 'Cause I was tossin' and turnin' Turnin' and tossin' A tossin' and turnin' all night Jumped out of bed Turned on the light I pulled down the shade Went to the kitchen for a bite Rolled up the shade Turned off the light I jumped back into bed It was the middle of the night The clock downstairs was strikin' four I couldn't get you off my mind I heard the milkman at the door\n'Cause I was tossin' and turnin' Turnin' and tossin' A tossin' and turnin' all, yay, yay, yay I was a tossin' and turnin' Turnin' and tossin' A tossin' and turnin' all night I was a tossin' and turnin' Turnin' and tossin' A tossin' and turnin' all night" }, { "year": "1962", "artist": "Mr. Acker Bilk", "title": "Stranger On The Shore", "genre": "Pop", "lyrics": "Here I stand, watching the tide go out So all alone and blue Just dreaming dreams of you I watched your ship as it sailed out to sea Taking all my dreams And taking all of me The sighing of the waves The wailing of the wind The tears in my eyes burn Pleading, My love, return Why, oh, why must I go on like this? Shall I just be a lonely stranger on the shore? The sighing of the waves The wailing of the wind The tears in my eyes burn Pleading, My love, return Why, oh, why must I go on like this? Shall I just be a lonely stranger on the shore?" }, { "year": "1963", "artist": "Jimmy Gilmer And The Fireballs", "title": "Sugar Shack", "genre": "Rock", "lyrics": "There's a crazy little shack beyond the tracks And ev'rybody calls it the sugar shack Well, it's just a coffeehouse and it's made out of wood Expresso coffee tastes mighty good That's not the reason why I've got to get back To that sugar shack, whoa baby To that sugar shack. There's this cute little girlie, she's a'workin' there A black leotard and her feet are bare I'm gonna drink a lotta coffee, spend a little cash Make that girl love me when I put on some trash You can understand why I've got to get back To that sugar shack, whoa baby To that sugar shack, yeah honey To that sugar shack, whoa yes To that sugar shack. Now that sugar shack queen is a'married to me, yeah yeah We just sit around and dream of those old memories Ah, but one of these days I'm gonna lay down tracksIn the direction of that sugar shack Just me and her yes we're gonna go backTo that sugar shack, Whoa uh oh To that sugar shack, yeah honey To our sugar shack Yeh, yeh, yeh, our sugar shack" }, { "year": "1964", "artist": "The Beatles", "title": "I Want To Hold Your Hand", "genre": "Pop", "lyrics": "Oh yeah, I'll tell you something I think you'll understand When I say that something I wanna hold your hand I wanna hold your hand I wanna hold your hand Oh please, say to me You'll let me be your man And please, say to me You'll let me hold your hand You let me hold your hand I wanna hold your hand And when I touch you I feel happy Inside It's such a feeling that my love I can't hide I can't hide I can't hide Yeah, you've got that something I think you'll understand When I say that something I wanna hold your hand I wanna hold your hand I wanna hold your hand And when I touch you I feel happy Inside It's such a feeling that my love I can't hide I can't hide I can't hide Yeah, you've got that something I think you'll understand When I feel that something I wanna hold your hand I wanna hold your hand I wanna hold your hand I wanna hold your hand" }, { "year": "1965", "artist": "Sam The Sham And The Pharaohs", "title": "Wooly Bully", "genre": "Rock", "lyrics": "Uno dos one two tres quatro Hey Wooly Bully Watch it now, watch it Here it comes, here it comes Watch it now, he'll get ya Matty told Hatty, about a thing she saw Had two big horns, and a wooly jaw Wooly Bully, Wooly Bully Yeah that's right Wooly Bully, Wooly Bully, Wooly Bully Hatty told Matty, let's don't take no chance Let's not be L-7, come and learn this dance Wooly Bully, Wooly Bully Wooly Bully, Wooly Bully, Wooly Bully Watch it now, watch it, watch it, watch it Ay Hey Rar rar rar Matty told Hatty, it's the thing to do Get you someone really, to pull the wool with you Wooly Bully, Wooly Bully Wooly Bully, Wooly Bully, Wooly Bully Watch it now, watch it, here he comes You got it, you got it" }, { "year": "1966", "artist": "Sgt. Barry Sadler", "title": "The Ballad Of The Green Berets", "genre": "Pop", "lyrics": "Fighting soldiers from the sky Fearless men who jump and die Men who mean just what they say The brave men of the Green Beret Silver wings upon their chest These are men, America's best One hundred men will test today But only three win the Green Beret Trained to live off nature's land Trained in combat, hand-to-hand Men who fight by night and day Courage peak from the Green Berets Silver wings upon their chest These are men, America's best One hundred men will test today But only three win the Green Beret Back at home a young wife waits Her Green Beret has met his fate He has died for those oppressed Leaving her his last request Put silver wings on my son's chest Make him one of America's best He'll be a man they'll test one day Have him win the Green Beret" }, { "year": "1967", "artist": "Lulu", "title": "To Sir With Love", "genre": "Pop", "lyrics": "Those schoolgirl days of telling tales and biting nails are gone But in my mind I know they will still live on and on But how do you thank someone who has taken you from crayons to perfume? It isn't easy, but I'll try If you wanted the sky I would write across the sky in letters That would soar a thousand feet high To Sir, With Love The time has come for closing books and long last looks must end And as I leave I know that I am leaving my best friend A friend who taught me right from wrong and weak from strong That's a lot to learn, but what can I give you in return? If you wanted the moon I would try to make a start But I would rather you let me give my heart To Sir, With Love" }, { "year": "1968", "artist": "The Beatles", "title": "Hey Jude", "genre": "Rock", "lyrics": "Hey, Jude, don't make it bad Take a sad song and make it better Remember to let her into your heart Then you can start to make it better Hey, Jude, don't be afraid You were made to go out and get her The minute you let her under your skin Then you begin to make it better And anytime you feel the pain, Hey, Jude, Don't carry the world upon your shoulders For well you know that it's a fool Who plays it cool By making his world a little colder Nah, nah nah, nah nah, nah nah, nah nah Hey, Jude, don't let me down You have found her, now go and get her Remember to let her into your heart Then you can start to make it better So let it out and let it in, Hey, Jude, begin You're waiting for someone to perform with And don't you know that it's just you, Hey, Jude, you'll do The movement you need is on your shoulder Nah, nah nah, nah nah, nah nah, nah nah yeah Hey, Jude, don't make it bad Take a sad song and make it better Remember to let her under your skin Then you'll begin to make it better, better, better, better, better oh! Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude yeah, yeah, yeah Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude don't make it bad, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude take a sad song and make it better Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude oh, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Jude, hey, Jude, whoa Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude ooh Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude Nah, nah nah, nah nah, nah, nah, nah nah, Hey, Jude" }, { "year": "1969", "artist": "The Archies", "title": "Sugar, Sugar", "genre": "Rock", "lyrics": "Sugar, ah honey honey You are my candy girl And you got me wanting you Honey, ah sugar sugar You are my candy girl And you've got me wanting you I just can't believe the loveliness of loving you I just can't believe it's true I just can't believe the one to love this feeling to I just can't believe it's true Ah sugar, ah honey honey You are my candy girl And you've got me wanting you Ah honey, ah sugar sugar You are my candy girl And you've got me wanting you When I kissed you, girl, I knew how sweet a kiss could be I know how sweet a kiss can be Like the summer sunshine pour your sweetness over me Pour your sweetness over me Oh sugar, pour a little sugar on it honey Pour a little sugar on it baby I'm gonna make your life so sweet, yeah yeah yeah Pour a little sugar on it oh yeah Pour a little sugar on it honey Pour a little sugar on it baby I'm gonna make your life so sweet, yeah yeah yeah Pour a little sugar on it honey Ah sugar, ah honey honey You are my candy girl And you've got me wanting you Oh honey, honey, sugar sugar Honey, honey, sugar sugar You are my candy girl" }, { "year": "1970", "artist": "Simon & Garfunkel", "title": "Bridge Over Troubled Water", "genre": "Folk", "lyrics": "When you're weary, feeling small When tears are in your eyes, I'll dry them all all I'm on your side, oh, when times get rough And friends just can't be found Like a bridge over troubled water I will lay me down Like a bridge over troubled water I will lay me down When you're down and out When you're on the street When evening falls so hard I will comfort you ooo I'll take your part, oh, when darkness comes And pain is all around Like a bridge over troubled water I will lay me down Like a bridge over troubled water I will lay me down Sail on silver girl Sail on by Your time has come to shine All your dreams are on their way See how they shine Oh, if you need a friend I'm sailing right behind Like a bridge over troubled water I will ease your mind Like a bridge over troubled waterI will ease your mind" }, { "year": "1971", "artist": "Three Dog Night", "title": "Joy To The World", "genre": "Pop", "lyrics": "Jeremiah was a bullfrog Was a good friend of mine I never understood a single word he said But I helped him a-drink his wine And he always had some mighty fine wine Singin' Joy to the world All the boys and girls now Joy to the fishes in the deep blue sea Joy to you and me If I were the king of the world Tell you what I'd do I'd throw away the cars and the bars and the war Make sweet love to you Sing it now Joy to the world All the boys and girls Joy to the fishes in the deep blue sea Joy to you and me You know I love the ladies Love to have my fun I'm a high life flyer and a rainbow rider A straight shootin' son-of-a-gun I said a straight shootin' son-of-a-gun Joy to the world All the boys and girls Joy to the fishes in the deep blue sea Joy to you and me Joy to the world All the boys and girls Joy to the fishes in the deep blue sea Joy to you and me Joy to the world All the boys and girls Joy to the world Joy to you and me Joy to the world All the boys and girls now Joy to the fishes in the deep blue sea Joy to you and me Joy to the world All the boys and girls Joy to the fishes in the deep blue sea Joy to you and me I want to tell you Joy to the world All the boys and girls Joy to the fishes in the deep blue sea Joy to you and me Joy to the world All the boys and girls Joy to the fishes in the deep blue sea Joy to you and me Joy to the world All the boys and girls" }, { "year": "1972", "artist": "Roberta Flack", "title": "The First Time Ever I Saw Your Face", "genre": "Soul", "lyrics": "The first time, ever I saw your face I thought the sun rose in your eyes And the moon and the stars Were the gifts you gave To the dark, and the endless skies My Love And the first time, ever I kissed your mouth I felt the earth move in my hands Like the trembling heart Of a captive bird That was there, at my command My Love And the first time, ever I lay with you I felt your heart so close to mine And I knew our joy Would fill the earth And last, til the end of time My Love And last, 'til the end of time My love The first time, ever I saw Your face Your face Your face Your face" }, { "year": "1973", "artist": "Tony Orlando & Dawn", "title": "Tie A Yellow Ribbon Round The Ole Oak Tree", "genre": "Pop", "lyrics": "I'm comin' home, I've done my time Now I've got to know what is and isn't mine If you received my letter telling you I'd soon be free Then you'll know just what to do If you still want me If you still want me Whoa, tie a yellow ribbon 'round the ole oak tree It's been three long years Do ya still want me still want me If I don't see a ribbon 'round the ole oak tree I'll stay on the bus Forget about us Put the blame on me If I don't see a yellow ribbon 'round the ole oak tree Bus driver, please look for me 'cause I couldn't bear to see what I might see I'm really still in prison And my love, she holds the key A simple yellow ribbon's what I need to set me free I wrote and told her please Whoa, tie a yellow ribbon 'round the ole oak tree It's been three long years Do ya still want me still want me If I don't see a ribbon 'round the ole oak tree I'll stay on the bus Forget about us Put the blame on me If I don't see a yellow ribbon 'round the ole oak tree Now the whole damned bus is cheerin' And I can't believe I see A hundred yellow ribbons 'round the ole oak tree I'm comin' home, mmm, mmm Tie a ribbon 'round the ole oak tree Tie a ribbon 'round the ole oak tree Tie a ribbon 'round the ole oak tree Tie a ribbon 'round the ole oak tree Tie a ribbon 'round the ole oak tree Tie a ribbon 'round the ole oak tree" }, { "year": "1974", "artist": "Barbra Streisand", "title": "The Way We Were", "genre": "Pop", "lyrics": "Memories Light the corners of my mind Misty water-colored memories Of the way we were Scattered pictures Of the smiles we left behind Smiles we gave to one another For the way we were Can it be that It was all so simple then? Or has time re-written every line? If we had the chance to do it all again Tell me, would we? Could we? Memories May be beautiful and yet What's too painful to remember We simply choose to forget So it's the laughter We will remember Whenever we remember The way we were The way we were" }, { "year": "1975", "artist": "Captain & Tennille", "title": "Love Will Keep Us Together", "genre": "Pop", "lyrics": "Love Love will keep us together Think of me, babe whenever Some sweet talking girl comes along Singing his song Don't mess around You just got to be strong Just stop Cause I really love you Stop, I'll be thinking of you Look in my heart And let love keep us together You You belong to me now Ain't gonna set you free now When those girls start hanging around Talking me down Hear with your heart And you won't hear a sound Just stop Cause I really love you Stop, I'll be thinking of you Look in my heart And let love keep us together Young and beautiful Someday your looks will be gone When the others turn you off Who'll be turnin' you on I will, I will, I will I will, be there to share forever Love will keep us together I said it before And I'll say it again While others pretend I need you now and I need you then Just stop Cause I really love you Stop, I'll be thinking of you Look in my heart And let love keep us together Whatever Whatever, I will, I will, I will, I will You better stop Cause I really love you Stop, I've been thinkin' of you Look in my heart And let love keep us together Whatever Whatever, I will, I will, I will" }, { "year": "1976", "artist": "Wings", "title": "Silly Love Songs", "genre": "Rock", "lyrics": "You'd think that people Would've had enough of silly love songs But I look around me And I see it isn't so Some people want to fill the world With silly love songs And what's wrong with that? I'd like to know Cause here I go again I love you I love you I love you I love you I love you I can't explain The feeling's plain to me Now can't you see? I love you Ah, she gave me more She gave it all to me Now can't you see? What's wrong with that? I need to know Cause here I go again I love you I love you Love doesn't come in a minute Sometimes it doesn't come at all I only know that when I'm in it It isn't silly Love isn't silly Love isn't silly at all How can I tell you about my loved one? How can I tell you about my loved one? I love you How can I tell you about my loved one? I love you How can I tell you about my loved one? I love you I love you I love you I can't explain, the feeling's plain to me, say, can't you see? I love you Ah, he gave me more, he gave it all to me, say, can't you see? I love you I can't explain, the feeling's plain to me, say, can't you see? How can I tell you about my loved one? I love you Ah, he gave me more, he gave it all to me, say, can't you see? How can I tell you about my loved one? I love you I can't explain, the feeling's plain to me, say, can't you see? How can I tell you about my loved one? I love you Ah, he gave me more, he gave it all to me, say, can't you see? How can I tell you about my loved one? You'd think that people Would've had enough of silly love songs But I look around me And I see it isn't so Oh, no Some people want to fill the world With silly love songs And what's wrong with that?" }, { "year": "1977", "artist": "Rod Stewart", "title": "Tonight's The Night (Gonna Be Alright)", "genre": "Pop", "lyrics": "Stay away from my window Stay away from my back door too Disconnect the telephone line Relax baby and draw that blind Kick off your shoes and sit right down Loosen off that pretty French gown Let me pour you a good long drink Ooh baby don't you hesitate cause Tonights the night It's gonna be alright Cause I love you girl Ain't nobody gonna stop us now C'mon angel my hearts on fire Don't deny your man's desire You'd be a fool to stop this tide Spread your wings and let me come inside Tonights the night It's gonna be alright Cause I love you girl Ain't nobody gonna stop us now Don't say a word my virgin child Just let your inhibitions run wild The secret is about to unfold Upstairs before the night's too old Tonights the night It's gonna be alright Cause I love you woman Ain't nobody gonna stop us now" }, { "year": "1978", "artist": "Andy Gibb", "title": "Shadow Dancing", "genre": "Pop", "lyrics": "You got me looking at that heaven in your eyes I was chasing your direction, I was telling you no lies And I was loving you When the words are said, baby, I lose my head And in a world of people, there's only you and I There ain't nothing come between us in the end How can I hold you when you ain't even mine? Only you can see me through I leave it up to you Do it light, taking me through the night Shadow dancing, baby you do it right, uh-huh Give me more, drag me across the floor Shadow dancing, all this and nothing more All that I need is just one moment in your arms I was chasing your affection, I was doing you no harm And I was loving you Make it shine, make it rain, baby I know my way I need that sweet sensation of living in your love I can't breath when you're away, it pulls me down You are the question and the answer am I Only you can see me through I leave it up to you Do it light, taking me through the night Shadow dancing, baby you do it right Give me more, drag me across the floor Shadow dancing, all this and nothing more And in this world of people, there's only you and I There ain't nothing come between us in the end How can I hold you when you ain't even mine? Only you can see me through I leave it up to you, oh Do it light, taking me through the night Shadow dancing, baby you do it right Give me more, drag me across the floor Shadow dancing, all this and nothing more Do it light, taking me through the night Shadow dancing, baby you do it right Give me more, drag me across the floor Shadow dancing, all this and nothing more Do it light, taking me through the night Shadow dancing, baby you do it right Give me more, drag me across the floor Shadow dancing, all this and nothing more Do it light, taking me through the night Shadow dancing, baby you do it right Give me more, drag me across the floor Shadow dancing, all this and nothing more" }, { "year": "1979", "artist": "The Knack", "title": "My Sharona", "genre": "Rock", "lyrics": "Hoo, my little pretty one, my pretty one When you gonna give me some time, Sharona? Hoo, you make my motor run, my motor run Gun it comin' off of the line, Sharona Never gonna stop, give it up, such a dirty mind I always get it up for the touch of the younger kind My, my, my, aye aye, woo! my Sharona Come a little closer, huh, a-will ya, huh? Close enough to look in my eyes, Sharona Keepin' it a mystery, it gets to me Runnin' down the length of my thigh, Sharona Never gonna stop, give it up, such a dirty mind I always get it up for the touch of the younger kind My, my, my, aye aye, woo! my Sharona my Sharona Yeah! When you gonna give to me, give to me Is it just a matter of time, Sharona? Is it destiny, destiny Or is it just a game in my mind, Sharona? Never gonna stop, give it up, such a dirty mind I always get it up for the touch of the younger kind My, my, my, aye aye, woo!my, my, my, aye aye, woo! my Sharona my Sharona my Sharona my Sharona Hooooooohhh, my Sharona Hooooooohhh, my Sharona Hooooooohhh, my Sharona" }, { "year": "1980", "artist": "Blondie", "title": "Call Me", "genre": "Rock", "lyrics": "Colour me your colour, baby Colour me your car Colour me your colour, darling I know who you are Come up off your colour chart I know where you're comin' from Call me call me on the line Call me, call me any, anytime Call me call me my love You can call me any day or night Call me Cover me with kisses, baby Cover me with love Roll me in designer sheets I'll never get enough Emotions come, I don't know why Cover up love's alibi Call me call me on the line Call me, call me any, anytime Call me call me oh my love When you're ready we can share the wine Call me Ooooooooooo, he speaks the languages of love Ooooooooooo, amore, chiamami, chiamami Ooooooooooo, appelle moi mon cherie, appelle moi Anytime, anyplace, anywhere, any way Anytime, anyplace, anywhere, any day Call me call me my love Call me, call me any, anytime Call me call me for a ride Call me, call me for some overtime Call me call me my love Call me, call me in a sweet design Call me call me, call me for your lover's lover's alibi Call me call me on the line Call me, call me any, anytime Call me call me Oh, call me, oohoohah Call me call me my love Call me, call me any, anytime" }, { "year": "1981", "artist": "Kim Carnes", "title": "Bette Davis Eyes", "genre": "Pop", "lyrics": "Her hair is Harlow gold Her lips sweet surprise Her hands are never cold She's got Bette Davis eyes She'll turn the music on you You won't have to think twice She's pure as New York snow She got Bette Davis eyes And she'll tease you She'll unease you All the better just to please you She's precocious, and she knows just What it takes to make a pro blush She got Greta Garbo's standoff sighs She's got Bette Davis eyes She'll let you take her home It whets her appetite She'll lay you on the throne She got Bette Davis eyes She'll take a tumble on you Roll you like you were dice Until you come out blue She's got Bette Davis eyes She'll expose you, when she snows you Off your feet with the crumbs she throws you She's ferocious, and she knows just What it takes to make a pro blush All the boys think she's a spy She's got Bette Davis eyes And she'll tease you She'll unease you All the better just to please you She's precocious, and she knows just What it takes to make a pro blush All the boys think she's a spy She's got Bette Davis eyes She'll tease you She'll unease you Just to please you She's got Bette Davis eyes She'll expose you When she snows you She knows you She's got Bette Davis eyes" }, { "year": "1982", "artist": "Olivia Newton-John", "title": "Physical", "genre": "Pop", "lyrics": "I'm saying all the things that I know you'll like Making good conversation I gotta handle you just right You know what I mean I took you to an intimate restaurant Then to a suggestive movie There's nothing left to talk about Unless it's horizontally Let's get physical, physical I wanna get physical Let's get into physical Let me hear your body talk, your body talk Let me hear your body talk I've been patient, I've been good Tried to keep my hands on the table It's gettin' hard this holdin' back If you know what I mean I'm sure you'll understand my point of view We know each other mentally You gotta know that you're bringin' out The animal in me Let's get physical, physical I wanna get physical Let's get into physical Let me hear your body talk, your body talk Let me hear your body talk Let's get physical, physical I wanna get physical Let's get into physical Let me hear your body talk, your body talk Let me hear your body talk Let's get physical, physical I wanna get physical Let's get into physical Let me hear your body talk, your body talk Let me hear your body talk Let's get animal, animal I wanna get animal Let's get into animal Let me hear your body talk Let me hear your body talk" }, { "year": "1983", "artist": "The Police", "title": "Every Breath You Take", "genre": "Rock", "lyrics": "Every breath you take Every move you make Every bond you break Every step you take I'll be watching you. Every single day Every word you say Every game you play Every night you stay I'll be watching you. Oh can't you see You belong to me? How my poor heart aches with every step you take. Every move you make Every vow you break Every smile you fake Every claim you stake I'll be watching you. Since you've gone I've been lost without a trace. I dream at night, I can only see your face. I look around but it's you I can't replace. I feel so cold, and I long for your embrace. I keep crying baby, baby, please Oh can't you see You belong to me? How my poor heart aches with every step you take. Every move you make Every vow you break Every smile you fake Every claim you stake I'll be watching you. Every move you make Every step you take I'll be watching you I'll be watching you Every breath you take Every move you make Every bond you break Every step you take I'll be watching you. Every single day Every word you say Every game you play Every night you stay I'll be watching you. Every move you make Every vow you break Every smile you fake Every claim you stake I'll be watching you. Every single day Every word you say Every game you play Every night you stay I'll be watching you Every breath you take Every move you make Every bond you break Every step you take I'll be watching you." }, { "year": "1984", "artist": "Prince", "title": "When Doves Cry", "genre": "Pop", "lyrics": "Dig if you will the picture Of you and I engaged in a kiss The sweat of your body covers me Can you my darling Can you picture this? Dream if you can a courtyard An ocean of violets in bloom Animals strike curious poses They feel the heat The heat between me and you How can you just leave me standing? Alone in a world that's so cold? So cold Maybe I'm just too demanding Maybe I'm just like my father, too bold Maybe you're just like my mother She's never satisfied She's never satisfied Why do we scream at each other This is what it sounds like When doves cry Touch if you will my stomach Feel how it trembles inside You've got the butterflies all tied up Don't make me chase you Even doves have pride How can you just leave me standing? Alone in a world so cold? World so cold Maybe I'm just too demanding Maybe I'm just like my father, too bold Maybe you're just like my mother She's never satisfied She's never satisfied Why do we scream at each other This is what it sounds like When doves cry How can you just leave me standing? Alone in a world that's so cold? A world that's so cold Maybe you're just too demanding Maybe, maybe I'm like my father Maybe I'm just like my father, too bold Ya know he's too bold Maybe you're just like my mother Maybe you're just like my mother She's never satisfied She's never, never satisfied Why do we scream at each other Why do we scream, why This is what it sounds like When doves cry When doves cry Doves cry, doves cry When doves cry Doves cry, doves cry Don't Cry Don't Cry When doves cry When doves cry When doves cry When Doves cry Doves cry, doves cry, doves cry Don't cry Darling don't cry Don't cry Don't cry Don't don't cry" }, { "year": "1985", "artist": "Wham!", "title": "Careless Whisper", "genre": "Pop", "lyrics": "Time can never mend the careless whispers, of a good friend To the heart and mind, ignorance is kind There's no comfort in the truth Pain is all you'll find Should've known better I feel so unsure As I take your hand and lead you to the dance floor As the music dies, something in your eyes Calls to mind the silver screen And all its sad good-byes I'm never gonna dance again Guilty feet have got no rhythm Though it's easy to pretend I know your not a fool Should've known better than to cheat a friend And waste the chance that I've been given So I'm never gonna dance again The way I danced with you Time can never mend The careless whispers of a good friend To the heart and mind Ignorance is kind There's no comfort in the truth Pain is all you'll find I'm never gonna dance again Guilty feet have got no rhythm Though it's easy to pretend I know your not a fool Should've known better than to cheat a friend And waste this chance that I've been given So I'm never gonna dance again The way I danced with you Never without your love Tonight the music seems so loud I wish that we could lose this crowd Maybe it's better this way We'd hurt each other with the things we'd want to say We could have been so good together We could have lived this dance forever But no one's gonna dance with me Please stay And I'm never gonna dance again Guilty feet have got no rhythm Though it's easy to pretend I know your not a fool Should've known better than to cheat a friend And waste the chance that I've been given So I'm never gonna dance again The way I danced with you Now that you're gone Now that you're gone Now that you're gone What I did's so wrong That you had to leave me alone" }, { "year": "1986", "artist": "Dionne and Friends", "title": "That's What Friends Are For", "genre": "Pop", "lyrics": "And I never thought I'd feel this way And as far as I'm concerned I'm glad I got the chance to say That I do believe, I love you And if I should ever go away Well, then close your eyes and try To feel the way we do today And then if you can remember Keep smiling, keep shining Knowing you can always count on me, for sure That's what friends are for For good times and bad times I'll be on your side forever more That's what friends are for Well, you came in loving me And now there's so much more I see And so by the way I thank you Oh and then for the times when we're apart Well, then close your eyes and know The words are coming from my heart And then if you can remember Keep smiling and keep shining Knowing you can always count on me, for sure That's what friends are for In good times and bad times I'll be on your side forever more That's what friends are for Keep smiling, keep shining Knowing you can always count on me, for sure That's what friends are for For good times and bad times I'll be on your side forever more That's what friends are for Keep smiling, keep shining Knowing you can always count on me, for sure 'Cause I tell you, that's what friends are for Whoa, good times and the bad times I'll be on your side forever more That's what friends are for" }, { "year": "1987", "artist": "Bangles", "title": "Walk Like An Egyptian", "genre": "Rock", "lyrics": "All the old paintings on the tombs, They do the sand dance, Don't you know? If they move too quick They're falling down like a domino. All the bazaar men by the Nile, They got the money on a bet. Gold crocodiles they snap their teeth On your cigarette. Foreign types with their hookah pipes say Walk like an Egyptian. The blond waitresses take their trays They spin around and they cross the floor; They got the moves. You drop your drink then they bring you more. All the school kids so sick of books, They like the punk and the metal band. When the buzzer rings, They're walking like an Egyptian. All the kids in the marketplace say: Walk like an Egyptian. Slide your feet up the street Bend your back Shift your arm and then you pull it back. Life's hard you know So strike a pose on a Cadillac. If you want to find all the cops They're hanging out in the donut shop. They sing and dance Spin the clubs cruise down the block. All the Japanese with their yen The party boys call the Kremlin And the Chinese know They walk the line like Egyptian. All the cops in the donut shop say: Walk like an Egyptian Walk like an Egyptian." }, { "year": "1988", "artist": "George Michael", "title": "Faith", "genre": "Pop", "lyrics": "Well I guess it would be nice If I could touch your body I know not everybody Has got a body like you But I've got to think twice Before I give my heart away And I know all the games you play Because I play them too Oh but I Need some time off from that emotion Time to pick my heart up off the floor Oh when that love comes down Without devotion Well it takes a strong man baby But I'm showing you the door Cause I gotta have faith I gotta have faith Cause I gotta have faith, faith Cause I gotta have faith, faith, faith Baby, I know you're asking me to stay Say please, please, please don't go away You say I'm giving you the blues Maybe You mean every word you say Can't help but think of yesterday And another who tied me down to loverboy rules Before this river Becomes an ocean Before you throw my heart back on the floor Oh oh baby I reconsider My foolish notion Well I need someone to hold me But I'll wait for something more Yes I've gotta have faith Mmm, I gotta have faith Cause I gotta have faith, faith, faith I gotta have faith-a-faith-a-faith Before this river Becomes an ocean Before you throw my heart back on the floor Oh oh baby I reconsider My foolish notion Well I need someone to hold me But I'll wait for something more Cause I gotta have faith Mmm I gotta have faith Because I got to have faith-a-faith-a-faith I gotta have faith-a-faith-a-faith" }, { "year": "1989", "artist": "Chicago", "title": "Look Away", "genre": "Rock", "lyrics": "When you called me up this morning, Told me 'bout the new love you found, I'm said \"I'm happy for you, I'm really happy for you.\" Found someone else, I guess I won't be coming 'round. I guess it's over, baby; It's really over, baby, whoa... And from what you said I know you've gotten over me; It'll never be the way it used to be. So if it's gotta be this way, Don't worry, baby, I can take the news okay. But if you see me walking by, And the tears are in my eyes, Look away, baby, look away. If we meet on the streets someday, And I don't know what to say, Look away, baby, look away. Don't look at me; I don't want you to see me this way. When we both agreed as lovers, We were better off as friends, That's how it had to be, Yeah, that's how it had to be. I tell you I'm fine But sometimes I just pretend; Wish you were holding me, Wish you were still holding me, whoa... I just never thought, That I would be replaced so soon; I wasn't prepared to hear those words from you. I know I wanted to be free; Yeah, baby, this is how we wanted it to be. When you called me up this morning, Told me 'bout the new love you found. I said \"I'm happy for you, I'm really happy for you.\" When you called me up this morning, Told me 'bout the new love you found. I said \"I'm happy for you, I'm really happy for you." }, { "year": "1990", "artist": "Wilson Phillips", "title": "Hold On", "genre": "Pop", "lyrics": "I know this pain Why do lock yourself up in these chains? No one can change your life except for you Don't ever let anyone step all over you Just open your heart and your mind Is it really fair to feel this way inside? Some day somebody's gonna make you want to Turn around and say goodbye Until then baby are you going to let them Hold you down and make you cry Don't you know? Don't you know things can change Things'll go your way If you hold on for one more day Can you hold on for one more day Things'll go your way Hold on for one more day You could sustain Or are you comfortable with the pain? You've got no one to blame for your unhappiness You got yourself into your own mess Lettin' your worries pass you by Don't you think it's worth your time To change your mind? I know that there is pain But you hold on for one more day and Break free the chains Yeah I know that there is pain But you hold on for one more day and you Break free, break from the chains Some day somebody's gonna make you want to Turn around and say goodbye Until then baby are you going to let them Hold you down and make you cry Don't you know? Don't you know things can change Things'll go your way If you hold on for one more day yeah If you hold on Don't you know things can change Things'll go your way If you hold on for one more day, If you hold on Can you hold on Hold on baby Won't you tell me now Hold on for one more day 'Cause It's gonna go your way Don't you know things can change Things'll go your way If you hold on for one more day Can't you change it this time Make up your mind Hold on Hold on Baby hold on" }, { "year": "1991", "artist": "Bryan Adams", "title": "Everything I Do (I Do it for You)", "genre": "Pop", "lyrics": "Look into my eyes you will see What you mean to me. Search your heart, search your soul And when you find me there you'll search no more. Don't tell me it's not worth tryin' for. You can't tell me it's not worth dyin' for. You know it's true: Everything I do, I do it for you. Look into your heart you will find There's nothin' there to hide. Take me as I am, take my life. I would give it all, I would sacrifice. Don't tell me it's not worth fightin' for I can't help it, there's nothin' I want more You know it's true: Everything I do, I do it for you, oh, yeah. There's no love like your love And no other could give more love. There's nowhere unless you're there All the time, all the way, yeah. Look into your heart, baby... Oh, you can't tell me it's not worth tryin' for. I can't help it, there's nothin' I want more. Yeah, I would fight for you, I'd lie for you, Walk the wire for you, yeah, I'd die for you. You know it's true. Everything I do, oh, I do it for you. Everything I do, darling. You will see it's true. You will see it's true. Yeah! Search your heart and your soul You can't tell it's not worth dying for I'll be there I'd walk the fire for you I'd die for you Oh, yeah. I'm going all the time, all the way." }, { "year": "1992", "artist": "Boyz II Men", "title": "End of The Road", "genre": "R&B", "lyrics": "Girl you know we belong together I have no time for you to be playing With my heart like this You'll be mine forever baby, you just see We belong together And you know that I'm right Why do you play with my heart Why do you play with my mind? Said we'd be forever Said it'd never die How could you love me and leave me And never say good-bye? When I can't sleep at night without holding you tight Girl, each time I try I just break down and cry Pain in my head oh I'd rather be dead Spinnin' around and around Although we've come to the end of the road Still I can't let you go It's unnatural, you belong to me, I belong to you Come to the end of the road Still I can't let you go It's unnatural, you belong to me, I belong to you Girl, I know you really love me You just don't realize You've never been there before It's only your first time Maybe I'll forgive you, hmm Maybe you'll try We should be happy together Forever, you and I Can you love me again like you loved me before This time I want you to love me much more This time instead just come to my bed And baby just don't let me, don't let me down Although we've come to the end of the road Still I can't let you go It's unnatural, you belong to me, I belong to you Come to the end of the road Still I can't let you go It's unnatural, you belong to me, I belong to you Girl I'm here for you All those times of night when you just hurt me And just run out with that other fella Baby I knew about it, I just didn't care You just don't understand how much I love you do you? I'm here for you I'm not out to go out and cheat on you all night Just like you did baby but that's all right Hey, I love you anyway And I'm still gonna be here for you 'till my dying day baby Right now, I'm just in so much pain baby Cause you just won't come back to me Will you? Just come back to me Lonely Yes baby my heart is lonely Lonely My heart hurts baby Lonely Yes I feel pain too Baby please" }, { "year": "1993", "artist": "Whitney Houston", "title": "I Will Always Love You", "genre": "Pop", "lyrics": "If I should stay I would only be in your way So I'll go but I know I'll think of you every step of the way And I will always love you I will always love you You My darling, you Bittersweet memories That is all I'm taking with me So good-bye Please don't cry We both know I'm not what you, you need And I will always love you I will always love you You I hope life treats you kind And I hope you have all you've dreamed of And I wish you joy and happiness But above all this I wish you love And I will always love you I will always love you I will always love you I will always love you I will always love you I, I will always love you You Darling, I love you I'll always I'll always love you" }, { "year": "1994", "artist": "Ace of Base", "title": "The Sign", "genre": "Rock", "lyrics": "Shock! I got a new life You would hardly recognize me I'm so glad How could a person like me care for you Why do I bother When you're not the one for me Oooo, is enough, enough I saw the sign and it opened up my eyes I saw the sign Life is demanding without understanding I saw the sign and it opened up my eyes I saw the sign No one's gonna drag you up to get into the light where you belong But where do you belong Under the pale moon For so many years I've wondered who you are How can a person like you bring me joy Under the pale moon Where I see a lot of stars Is enough, enough I saw the sign and it opened up my eyes I saw the sign Life is demanding without understanding I saw the sign and it opened up my eyes I saw the sign No one's gonna drag you up to get into the light where you belong But where do you belong Oh, oh, oh, oh. I saw the sign and it opened up my mind And I am happy now living without you I've left you, ooohhh I saw the sign and it opened up my eyes I saw the sign No one's gonna drag you up to get into the light where you belong I saw the sign - I saw the sign - I saw the sign I saw the sign - I saw the sign I saw the sign - I saw the sign - I saw the sign And it opened up my eyes I saw the sign Shock! I got a new life You would hardly recognize me I'm so glad How could a person like me care for you Why do I bother When you're not the one for me Oooo, is enough, enough I saw the sign and it opened up my eyes I saw the sign Life is demanding without understanding I saw the sign and it opened up my eyes I saw the sign No one's gonna drag you up to get into the light where you belong But where do you belong Under the pale moon For so many years I've wondered who you are How can a person like you bring me joy Under the pale moon Where I see a lot of stars Is enough, enough I saw the sign and it opened up my eyes I saw the sign Life is demanding without understanding I saw the sign and it opened up my eyes I saw the sign No one's gonna drag you up to get into the light where you belong But where do you belong Oh, oh, oh, oh. I saw the sign and it opened up my mind And I am happy now living without youI've left you, ooohhh I saw the sign and it opened up my eyes I saw the sign No one's gonna drag you up to get into the light where you belong I saw the sign - I saw the sign - I saw the sign I saw the sign - I saw the sign I saw the sign - I saw the sign - I saw the sign And it opened up my eyes I saw the sign" }, { "year": "1995", "artist": "Coolio", "title": "Gangsta's Paradise", "genre": "Hip Hop", "lyrics": "As I walk through the valley of the shadow of death I take a look at my life and realize there's nothin' left Cause I've been blastin' and laughin' so long That even my momma thinks that my mind is gone But I ain't never crossed a man that didn't deserve it Me be treated like a punk, you know that's unheard of You better watch how you talkin' and where you walkin' Or you and your homies might be lined in chalk I really hate to trip, but I gotta lock As they croak, I see myself in the pistol smoke Fool, I'm the kinda G that little homies wanna be like On my knees in the night, sayin' prayers in the street light Keep spending most our lives Livin' in a gangsta's paradise Been spending most their lives Livin' in a gangsta's paradise We keep spending most our lives Livin' in a gangsta's paradise We keep spending most our lives Livin' in a gangsta's paradise Look at the situation they got me facin' I can't live a normal life, I was raised by the street So I gotta be down with the hood team Too much television watching, got me chasing dreams I'm a educated fool with money on my mind Got my ten in my hand and a gleam in my eye I'm a loc'd out gangsta, set trippin' banger And my homies are down, so don't arouse my anger Fool, death ain't nothin' but a heart beat away I'm livin' life do or die, what can I say? I'm 23 now, will I live to see 24? The way things is going I don't know Tell me why are we so blind to see That the ones we hurt are you and me? Keep spending most our lives Livin' in a gangsta's paradise Been spending most their lives Livin' in a gangsta's paradise We keep spending most our lives Livin' in a gangsta's paradise We keep spending most our lives Livin' in a gangsta's paradise Power and the money, money and the power Minute after minute, hour after hour Everybody's running, but half of them ain't lookin' It's going on in the kitchen, but I don't know what's cookin' They say I gotta learn, but nobody's here to teach me If they can't understand it, how can they reach me? I guess they can't, I guess they won't I guess they front; that's why I know my life is out of luck, fool! Keep spending most our lives Livin' in a gangsta's paradise Been spending most their lives Livin' in a gangsta's paradise We keep spending most our lives Livin' in a gangsta's paradise We keep spending most our lives Livin' in a gangsta's paradise Tell me why are we so blind to see That the ones we hurt are you and me? Tell me why are we so blind to see\nThat the ones we hurt are you and me?" }, { "year": "1996", "artist": "Los Del Rio", "title": "Macarena", "genre": "Pop", "lyrics": "(I am not trying to seduce you) When I dance they call me Macarena And the boys they say que estoy buena They all want me, they can't have me So they all come and dance beside me Move with me, chant with me And if you're good I'll take you home with me Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) Now don't you worry about my boyfriend The boy whose name is Vitorino Ha! I don't want him, can't stand him He was no good so I, ha ha ha Now come on, what was I supposed to do? He was out of town and his two friends were so fine Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) (Ay! Ay!) (Ay! Ay!) (Ay! Ay!) (I am not trying to seduce you) (Ay!) Macarena Macarena Macarena (Ay!) Macarena Macarena Macarena Macaren, Macaren, Macaren, Macarena Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) (Ay!) Come and find me, my name is Macarena Always at the party con las chicas que son buena Come join me, dance with me And all you fellows chant along with me Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!) Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay! Dale a tu cuerpo alegria Macarena Que tu cuerpo es pa' darle alegria cosa buena Dale a tu cuerpo alegria, Macarena Hey Macarena! (Ay!)" }, { "year": "1997", "artist": "Elton John", "title": "Candle in the Wind 1977/\nSomething About the Way You Look Tonight", "genre": "Pop", "lyrics": "Goodbye Norma Jeane Though I never knew you at all You had the grace to hold yourself While those around you crawled They crawled out of the woodwork And they whispered into your brain They set you on the treadmill And they made you change your name And it seems to me you lived your life Like a candle in the wind Never knowing who to cling to When the rain set in And I would have liked to have known you But I was just a kid Your candle burned out long before Your legend ever did Loneliness was tough The toughest role you ever played Hollywood created a superstar And pain was the price you paid Even when you died Oh the press still hounded you All the papers had to say Was that Marilyn was found in the nude And it seems to me you lived your life Like a candle in the wind Never knowing who to cling to When the rain set in And I would have liked to have known you But I was just a kid Your candle burned out long before Your legend ever did Goodbye Norma Jeane Though I never knew you at all You had the grace to hold yourself While those around you crawled Goodbye Norma Jeane From the young man in the 22nd row Who sees you as something more than sexual More than just our Marilyn Monroe And it seems to me you lived your life Like a candle in the wind Never knowing who to cling to When the rain set in And I would have liked to have known you But I was just a kid Your candle burned out long before Your legend ever did And I would have liked to have known you But I was just a kid Your candle burned out long before Your legend ever did" }, { "year": "1998", "artist": "Next", "title": "Too Close", "genre": "R&B", "lyrics": "I wonder if she could tell I'm hard right now Yeah, come on, dance for me, baby, yeah You feel that? All right, come on, don't stop now You done did it, come on, yeah, all right, hold on Baby, when we're grindin', I get so excited Ooh how I like it, I try but I can't fight it Oh, you're dancin' real close, 'plus it's real, real slow You're makin' it hard for meOh the songs on you requested\nYou're dancin' like you're naked It's almost like we're sexin' (oh yeah) Yeah, boo, I like it, no, I can't deny it But I know you can tell I'm excited, oh girl (Step back, you're dancin' kinda close) (I feel a little poke comin' through on you) Now girl, I know you felt it But boo, you know, I can't help it You know what I wanna do Baby, when we're grindin', I get so excited Ooh how I like it, I try but I can't fight it Oh, you're dancin' real close, 'plus it's real, real slow You know you're makin' it hard for me Baby, us dancin' so close ain't a good idea 'Cuz I'mma want you now and here The way that you shake it on me Makes me want you so bad sexually, oh girl (Step back, you're dancin' kinda close) (I feel a little poke comin' through on you) Now girl, I know you felt it But boo, you know, I can't help it You know what I wanna do, oh yes Baby, when we're grindin', I get so excited Ooh how I like it, I try but I can't fight it Oh, you're dancin' real close, 'plus it's real, real slow You know you're makin' it hard for me Baby don't stop Baby, when we're grindin', I get so excited Ooh how I like it, I try but I can't fight it Oh, you're dancin' real close, 'plus it's real, real slow You're makin' it hard for me I love when you shake it like that I see that you like it like that) I love when you shake it like that (I see that you like it like that) Baby i like it" }, { "year": "1999", "artist": "Cher", "title": "Believe", "genre": "Pop", "lyrics": "After love, after love... No matter how hard I try You keep pushing me aside And I can't break through There's no talking to you So sad that you're leaving Takes time to believe it But after all is said and done You're going to be the lonely one, oh oh Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no What am I supposed to do? Sit around and wait for you? And I can't do that There's no turning back I need time to move on I need love to feel strong Cause I've had time to think it through And maybe I'm too good for you oh oh Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no But I know that I'll get through this Cause I know that I am strong I don't need you anymore Oh I don't need you anymore I don't need you anymore No I don't need you anymore Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no Do you believe in life after love? I can feel something inside me say I really don't think you're strong enough, no" }, { "year": "2000", "artist": "Faith Hill", "title": "Breathe", "genre": "Country", "lyrics": "I can feel the magic floating in the air Being with you gets me that way I watch the sunlight dance across your face and I've Never been this swept away All my thoughts just seem to settle on the breeze When I'm lying wrapped up in your arms The whole world just fades away The only thing I hear Is the beating of your heart 'Cause I can feel you breathe It's washing over me Suddenly I'm melting into you There's nothing left to prove Baby all we need is just to be Caught up in the touch The slow and steady rush Baby, isn't that the way that love's supposed to be I can feel you breathe Just breathe In a way I know my heart is waking upAs all the walls come tumbling downI'm closer than I've ever felt before And I know And you know There's no need for words right now 'Cause I can feel you breathe It's washing over me Suddenly I'm melting into you There's nothing left to prove Baby all we need is just to be Caught up in the touch The slow and steady rush Baby, isn't that the way that love's supposed to be I can feel you breathe Just breathe Caught up in the touch The slow and steady rush Baby, isn't that the way that love's supposed to be I can feel you breathe Just breathe I can feel the magic floating in the air Being with you gets me that way" }, { "year": "2001", "artist": "Lifehouse", "title": "Hanging by a Moment", "genre": "Rock", "lyrics": "Desperate for changing, starving for truth I'm closer to where I started, I'm chasing after you I'm falling even more in love with you Letting go of all I've held on to I'm standing here until you make me move I'm hanging by a moment here with you Forgetting all I'm lacking, completely incomplete I'll take your invitation, you take all of me now I'm falling even more in love with you Letting go of all I've held on to I'm standing here until you make me move I'm hanging by a moment here with you I'm living for the only thing I know I'm running and not quite sure where to go And I don't know what I'm diving into Just hanging by a moment here with you There's nothing else to lose, there's nothing else to find There's nothing in the world that can change my mind There is nothing else There is nothing else There is nothing else Desperate for changing, starving for truth I'm closer to where I started, I'm chasing after you I'm falling even more in love with you Letting go of all I've held on to I'm standing here until you make me move I'm hanging by a moment here with you I'm living for the only thing I know I'm running and not quite sure where to go And I don't know what I'm diving into Just hanging by a moment here with you Just hanging by a moment Just hanging by a moment I'm hanging by a moment Just hanging by a moment here with you" }, { "year": "2002", "artist": "Nickleback", "title": "How You Remind Me", "genre": "Rock", "lyrics": "Never made it as a wise man I couldn't cut it as a poor man stealing Tired of living like a blind man I'm sick of sight without a sense of feeling And this is how you remind me This is how you remind me Of what I really am This is how you remind me Of what I really am It's not like you to say sorry I was waiting on a different story This time I'm mistaken For handing you a heart worth breaking And I've been wrong, I've been down, Been to the bottom of every bottle These five words in my head Scream are we having fun yet? Yeah, yeah, yeah, no, no Yeah, yeah, yeah, no, no It's not like you didn't know that I said I love you and I swear I still do And it must have been so bad Cause living with me must have damn near killed you And this is how, you remind me Of what I really am This is how, you remind me Of what I really am It's not like you to say sorry I was waiting on a different story This time I'm mistaken For handing you a heart worth breaking And I've been wrong, I've been down, Been to the bottom of every bottle These five words in my head Scream are we having fun yet? Yeah, yeah, yeah, no, no Yeah, yeah, yeah, no, no Yeah, yeah, yeah, no, no Yeah, yeah, yeah, no, no Never made it as a wise man I couldn't cut it as a poor man stealing And this is how you remind me This is how you remind me This is how you remind me Of what I really am This is how you remind me Of what I really am It's not like you to say sorry I was waiting on a different story This time I'm mistaken For handing you a heart worth breaking And I've been wrong, I've been down, Been to the bottom of every bottle These five words in my head Scream are we having fun yet? Yeah, yeah, are we having fun yet? Yeah, yeah, are we having fun yet? Yeah, yeah, are we having fun yet? Yeah, yeah, no, no." }, { "year": "2003", "artist": "50 Cent", "title": "In Da Club", "genre": "Hip Hop", "lyrics": "Go, go, go, go go, go, go, shawty It�s your birthday We gon� party like it�s yo birthday We gon� sip Bacardi like it�s your birthday And you know we don�t give a fuck It�s not your birthday! You can find me in the club, bottle full of bub Look mami I got the X if you into taking drugs I�m into having sex, I ain�t into making love So come give me a hug if you into to getting rubbed You can find me in the club, bottle full of bub Look mami I got the X if you into taking drugs I�m into having sex, I ain�t into making love So come give me a hug if you into to getting rubbed When I pull out up front, you see the Benz on dubs When I roll twenty deep, it�s twenty knives in the club Niggas heard I fuck with Dre, now they want to show me love When you sell like Eminem, and the hoes they want to fuck But homie ain�t nothing change hold down, G�s up I see Xzibit in the Cutt that nigga roll that weed up If you watch how I move you�ll mistake me for a player or pimp Been hit wit a few shells but I don�t walk wit a limp In the hood then the ladies saying 50 you hot They like me, I want them to love me like they love �Pac But holla in New York them niggas�ll tell ya I�m loco And the plan is to put the rap game in a choke hold I�m feelin� focused man, my money on my mind I got a mill out the deal and I�m still on the grind Now shawty said she feeling my style, she feeling my flow Her girlfriend want to get bi and they ready to go You can find me in the club, bottle full of bub Look mami I got the X if you into taking drugs I�m into having sex, I ain�t into making love So come give me a hug if you into to getting rubbed You can find me in the club, bottle full of bub Look mami I got the X if you into taking drugs I�m into having sex, I ain�t into making love So come give me a hug if you into to getting rubbed My flow, my show brought me the dough That bought me all my fancy things My crib, my cars, my pools, my jewels Look, nigga, I came up and I ain�t changed And you should love it, way more then you hate it Nigga you mad? I thought that you�d be happy I made it I�m that cat by the bar toasting to the good life You that fagot ass nigga trying to pull me back right? When my junk get to pumping in the club it�s on I wink my eye at ya bitch, if she smiles she gone If the roof on fire, let the motherfucker burn If you talking bout money homie, I ain�t concerned I�m a tell you what Banks told me cause go �head switch the style up If the niggas hate then let �em hate Watch the money pile up Or we go upside there wit a bottle of bub You know where we fucking be You can find me in the club, bottle full of bub Look mami I got the X if you into taking drugs I�m into having sex, I ain�t into making love So come give me a hug if you into to getting rubbed You can find me in the club, bottle full of bub Look mami I got the X if you into taking drugs I�m into having sex, I ain�t into making love So come give me a hug if you into to getting rubbed Don�t try to act like you ain�t know where we been either, nigga In the club all the time, nigga, so it�s a problem pop off, nigga, G-Unit!" }, { "year": "2004", "artist": "Usher", "title": "Yeah", "genre": "Hip Hop", "lyrics": "Peace up! A Town Down! Yeah, Yeah! OK! Usher! Usher! Usher! Usher! Yeah, yeah, yeah! Yeah, yeah! Yeah! Yeah, yeah, yeah! Yeah, yeah! Yeah! Up in the club with my homies, tryna get a lil' V-I, but keep it down on the low key low key, 'cause you know how it feels. I saw shorty she was checkin' up on me, from the game she was spittin' in my ear you would think that she knew me. So we decided to chill Conversation got heavy, she had me feelin' like she's ready to blow! Watch out! Oh! Watch out! She's saying, Come get me! Come get me. So I got up and followed her to the floor, she said, Baby, let's go. That's when I told her I said Yeah yeah, shorty got down low and said come and get me Yeah yeah, I got so caught up I forgot she told me Yeah yeah, her and my girl used to be the best of homies Yeah yeah, next thing I knew she was all up on me screaming: Yeah, yeah, yeah! Yeah, yeah! Yeah! Yeah, yeah, yeah! Yeah, yeah! Yeah! So she's all up in my head now, got me thinking that it might be a good idea to take her with me, 'Cause she's ready to leave ready to leave But I gotta keep it real now, 'cause on a one to ten she's a certified twenty, but that just ain't me. Hey. Because I don't know if I take that chance just where is it gonna lead, But what I do know is the way she dance makes shorty alright with me. The way she get low! I'm like yeah, just work that out for me. She asked for one more dance and I'm Like yeah, how the hell am I supposed to leave? And I said Hey, Luda! Watch out! My outfit's ridiculous, in the club lookin' so conspicuous. And Rowl! These women all on the prowl, if you hold the head steady I'm a milk the cow. Forget about the game, I'm a spit the truth, I won't stop till I get 'em in they birthday suits. So gimmie the rhythm and it'll be off with their clothes, then bend over to the front and touch your toes. I left the Jag and I took the Rolls, if they ain't cutting then I put em on foot patrol. How you like me now, when my pinky's valued over three hundred thousand, Let's drank you the one to please, Ludacris fill cups like double D's. Me and Ush once more and we leave 'em dead, we want a lady in the street but a freak in the bed to say Take that and rewind it back, Lil' Jon got the beat to make ya booty go clap Take that and rewind it back, Ursher got the voice to make ya booty go clap Take that and rewind it back, Ludacris got the flow to make ya booty go clap Take that and rewind it back, Lil' Jon got the beat to make ya booty go clap" }, { "year": "2005", "artist": "Mariah Carey", "title": "We Belong Together", "genre": "Pop", "lyrics": "I didn't mean it When I said I didn't love you so I should have held on tight I never should've let you goI didn't know nothing I was stupid I was foolish I was lying to myself I couldn't have fathomed that I would ever Be without your love Never imagined I'd be Sitting here beside myself 'Guess I didn't know you 'Guess I didn't know me But I thought I knew everything I never felt The feeling that I'm feeling Now that I don't Hear your voice Or have your touch and kiss your lips 'Cause I don't have a choice Oh, what I wouldn't give To have you lying by my side Right here, 'cause baby When you left I lost a part of me It's still so hard to believe Come back baby please, 'cause We belong together Who else am I gonna lean on When times get rough? Who's gonna talk to me on the phone Till the sun comes up? Who's gonna take your place? There ain't nobody better Oh baby, baby We belong together I can't sleep at night When you are on my mind Bobby Womack's on the radio Singing to me 'If you think you're lonely now' Wait a minute This is too deep, too deep I gotta change the station So I turn the dial Trying to catch a break And then I hear Babyface I only think of you And it's breaking my heart I'm trying to keep it together But I'm falling apart I'm feeling all out of my element I'm throwing things Crying Trying to figure out Where the hell I went wrong The pain reflected in this song Ain't even half of what I'm feeling inside I need you Need you back in my life in my life, in my life, baby When you left I lost a part of me It's still so hard to believe Come back baby please, 'cause We belong together Who else am I gonna lean on When times get rough? Who's gonna talk to me on the phone Till the sun comes up? Who's gonna take your place? There ain't nobody better Oh baby, baby We belong together Baby! When you left I lost a part of me It's still so hard to believe Come back, baby, please, 'cause We belong together Who am I gonna lean on When times get rough? Who's gonna talk to me Till the sun comes up? Who's gonna take your place? There ain't nobody better. Oh baby, baby We belong together" }, { "year": "2006", "artist": "Daniel Powter", "title": "Bad Day", "genre": "Pop", "lyrics": "Where is the moment we needed the most You kick up the leaves and the magic is lost They tell me your blue skies fade to grey They tell me your passion's gone away And I don't need no carryin' on You stand in the line just to hit a new low You're faking a smile with the coffee to go You tell me your life's been way off line You're falling to pieces every time And I don't need no carryin' on 'Cause you had a bad day You're taking one down You sing a sad song just to turn it around You say you don't know You tell me don't lie You work at a smile and you go for a ride You had a bad day The camera don't lie You're coming back down and you really don't mind You had a bad day You had a bad day Well, you need a blue sky holiday The point is they laugh at what you say And I don't need no carryin' on You had a bad day You're taking one down You sing a sad song just to turn it around You say you don't know You tell me don't lie You work at a smile and you go for a ride You had a bad day The camera don't lie You're coming back down and you really don't mind You had a bad day oh, on a holiday Sometimes the system goes on the blink And the whole thing turns out wrong You might not make it back and you know That you could be well, oh, that strong And I'm not wrong yeah, yeah, yeah, yeah So where is the passion when you need it the most Oh, you and I You kick up the leaves and the magic is lost Cause you had a bad day You're taking one down You sing a sad song just to turn it around You say you don't know You tell me don't lie You work at a smile and you go for a ride You had a bad day You've seen what you like And how does it feel for one more time You had a bad day You had a bad day Had a bad day Had a bad day Had a bad day Had a bad day Had a bad day" }, { "year": "2007", "artist": "Beyonce", "title": "Irreplaceable", "genre": "Pop", "lyrics": "To the left, to the left To the left, to the left mmmmmm To the left, to the left Everything you own in the box to the left In the closet that's my stuff Yes, if I bought it, please don't touch And keep talking that mess that's fine But could you walk and talk at the same time And, it's my name that's on that jag So come move your bags, let me call you a cab Standing in the front yard Tellin' me, how I'm such a fool Talkin' 'bout, I'll never ever find a man like you You got me twisted You must not know about me, you must not know about me I could have another you in a minute Matter of fact, he'll be here in a minute, baby You must not know about me, you must not know about me I can have another you by tomorrow So don't you ever for a second get to thinking You're irreplaceable So go ahead and get gone Call up that chick and see if she's home Oops, I bet you thought, that I didn't know What did you think I was putting you out for Because you was untrue Rollin' her around in the car that I bought you Baby drop them keys Hurry up before your taxi leaves Standing in the front yard Tellin' me, how I'm such a fool Talkin' bout, I'll never ever find a man like you You got me twisted You must not know about me, you must not know about me I could have another you in a minute Matter of fact, he'll be here in a minute, baby You must not know about me, you must not know about me I can have another you by tomorrow So don't you ever for a second get to thinking You're irreplaceable So since I'm not your everything How about I'll be nothing Nothing at all to you Baby I won't shed a tear for you I won't lose a wink of sleep 'Cause the truth of the matter is Replacing you is so easy To the left, to the left To the left, to the left mmmmmm To the left, to the left Everything you own in the box to the left To the left, to the left Don't you ever for a second get to thinking You're irreplaceable You must not know about me, you must not know about me I could have another you in a minute Matter of fact, he'll be here in a minute, baby You must not know about me, you must not know about me I can have another you by tomorrow So don't you ever for a second get to thinking baby You must not know about me, you must not know about me I could have another you in a minute Matter of fact, he'll be here in a minute You can pack all your bags We're finished 'Cause you made your bed Now lay in it I can have another you by tomorrow Don't you ever for a second get to thinking You're irreplaceable" }, { "year": "2008", "artist": "Flow Rida ft. T Payne", "title": "Low", "genre": "Hip Hop", "lyrics": "Mmmmmmmm Let me talk to 'em Let me talk to 'em Let it rain Mmmmmmm Let me talk to 'em C'mon! Shawty had them apple bottom jeans jeans Boots with the fur with the fur The whole club was looking at her She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low Them baggy sweat pants And the Reebok's with the straps with the straps She turned around and gave that big booty a smack hey She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low I ain't never seen nothing that'll make me go This crazy all night spending my dough Had the million dollar vibe and a body to go Them birthday cakes they stole the show So sexual She was flexible professional Drinking X and O Hold up, wait a minute, do I see what I think? Whoa Did her thing. I seen shawty get low Ain't the same when it's up that close Make it rain I'm making it snow Work the pole I got the bank roll I'mma say that I prefer them no clothes I'm into that I love women exposed She threw it back at me I gave her more Cash ain't a problem I know where it go She had them Shawty had them apple bottom jeans jeans Boots with the fur with the fur The whole club was looking at her She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low Them baggy sweat pants And the Reebok's with the straps with the straps She turned around and gave that big booty a smack hey She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low Hey shawty what I gotta do to get you home My jeans full of guap and they're ready for shones Cadillacs Maybach for the sexy grown Patron on the rocks that'll make you moan One stack come on, two stacks come on, three stacks come on Now that's three grand What you think I'm playing, baby girl, I'm the man I'll bend the rubber bands That's what I told her Her legs on my shoulder I knew it was over That Henny and Cola got me like a soldier She ready for Rover, I couldn't control her So lucky on me I was just like a clover Shawty was hot like a toaster Sorry but I had to fold her Like a pornography poster She showed her Shawty had them apple bottom jeans jeans Boots with the fur with the fur The whole club was looking at her She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low Them baggy sweat pants And the Reebok's with the straps with the straps She turned around and gave that big booty a smack hey She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low Whoa, shawty, yeah, she was worth the money Little mama took my cash And I ain't want it back The way she bent that back Got all them paper stacks Tattoo above her crack I had to handle that I was on it, sexy woman Let me show it make me want it Two in the morning I'm zoned in Them Ros� bottles foaming She wouldn't stop Made it drop Shawty did that pop and lock Had to break her off that guap Gal was fine just like my Glock Shawty had them apple bottom jeans jeans Boots with the fur with the fur The whole club was looking at her She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low Them baggy sweat pants And the Reebok's with the straps with the straps She turned around and gave that big booty a smack hey She hit the floor she hit the floor Next thing you know Shawty got low, low, low, low, low, low, low, low C'mon" }, { "year": "2009", "artist": "Black Eyed Peas", "title": "Boom Boom Pow", "genre": "Pop", "lyrics": "Gotta get that, gotta get that Gotta get that Gotta get that, that, that, that that (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) That (Boom boom boom) That (Boom boom boom) (Boom boom) Yo, I got that hit to beat the block You can get that bass on the low I got that rock 'n roll, that future flow That digital spit, next level visual shit I got that (Boom boom boom) How the beat bang? (Boom boom boom) I like that boom boom pow Them chickens jacking my style They try to copy my swagger I'm on that next shit now I'm so three thousand and eight You so two thousand and late I got that boom boom boom That future boom boom boom Let me get it now (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) That (Boom boom boom) That (Boom boom boom) (Boom boom) I'm on that supersonic boom Y'all hear that spaceship (Zoom!) When I step inside the room, them girls go apeshit, mmm Y'all stuck on Super 8 shit, that lo fi stupid 8 bit I'm on that HD flat, this beat go boom boom bap I'm a beast when you turn me on Into the future, cybertron Harder, faster, better, stronger Sexy ladies, extra longer Cause, we got the beat that bounce We got the beat that pound We got the beat, that 808 That boom boom in your town People in the place If you wanna get down Put your hands in the air William., drop the beat now! Yup, yup I be rockin them beats! Yup, yup I be rockin them beats! yup, yup, yup, ha, ha, ha Here we go, here we go, satellite radio Y'all gettin hit wit the (Boom, boom!) Beats so big, I'm stepping on leprechauns Shitting on y'all wit the (Boom, boom!) Shitting on y'all wit the (Boom, boom!) Shitting on y'all wit the This beat be bumping, bumping This beat go boom boom! Let the beat rock Let the beat rock Let the beat rock This beat be bumping, bumping This beat go boom boom! I like that boom boom pow Them chickens jacking my style They try to copy my swagger I'm on that next shit now I'm so three thousand and eight You so two thousand and late I got that boom boom boom That future boom boom boom Let me get it now (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) Gotta get that (Boom boom boom) That (Boom boom boom) That (Boom boom boom) (Boom boom) Let the beat rock (Let the beat rock) Let the beat rock (Let the beat...) Let the beat rock (Let the beat rock, rock, rock)" }, { "year": "2010", "artist": "Kesha", "title": "Tik Tok", "genre": "Pop", "lyrics": "Wake up in the morning feelin' like P Diddy (hey, what up, girl?) Grab my glasses, I'm out the door, I'm gonna hit this city (let's go) Before I leave, brush my teeth with a bottle of Jack 'Cause when I leave for the night, I ain't coming back I'm talkin' pedicure on our toes, toes Tryin' on all our clothes, clothes Boys blowin' up our phones, phones Drop-toppin', playin' our favorite CDs Pullin' up to the parties Tryna get a little bit tipsy Don't stop, make it pop DJ, blow my speakers up Tonight, I'ma fight Till we see the sunlight Tick tock on the clock But the party don't stop, no Oh, whoa, whoa, oh Oh, whoa, whoa, oh Don't stop, make it pop DJ, blow my speakers up Tonight, I'ma fight Till we see the sunlight Tick tock on the clock But the party don't stop, no Oh, whoa, whoa, oh Oh, whoa, whoa, oh Ain't got a care in world but got plenty of beer Ain't got no money in my pocket but I'm already here And now the dudes are linin' up 'cause they hear we got swagger But we kick 'em to the curb unless they look like Mick Jagger I'm talkin' about errbody gettin' crunk, crunk Boys tryin' to touch my junk, junk Gonna smack him if he gettin' too drunk, drunk Now, now we go until they kick us out, out Or the police shut us down, down Police shut us down, down Po-po shut us Don't stop, make it pop\nDJ, blow my speakers up Tonight, I'ma fight Till we see the sunlight Tick tock on the clock But the party don't stop, no Oh, whoa, whoa, oh Oh, whoa, whoa, oh Don't stop, make it pop DJ, blow my speakers up Tonight, I'ma fight Till we see the sunlight Tick tock on the clock But the party don't stop, no Oh, whoa, whoa, oh Oh, whoa, whoa, oh (DJ) You build me up, you break me down My heart, it pounds, yeah, you got me With my hands up, you got me now You got that sound, yeah, you got me (DJ) You build me up, you break me down My heart, it pounds, yeah, you got me With my hands up, put your hands up Put your hands up Now, the party don't start till I walk in Don't stop, make it pop DJ, blow my speakers up Tonight, I'ma fight Till we see the sunlight Tick tock on the clock But the party don't stop, no Oh, whoa, whoa, oh Oh, whoa, whoa, oh Don't stop, make it pop DJ, blow my speakers up Tonight, I'ma fight Till we see the sunlight Tick tock on the clock But the party don't stop, no Oh, whoa, whoa, oh Oh, whoa, whoa, oh" }, { "year": "2011", "artist": "Adele", "title": "Rolling in the Deep", "genre": "Pop", "lyrics": "There's a fire starting in my heart Reaching a fever pitch, and it's bringing me out the dark Finally, I can see you crystal clear Go ahead and sell me out, and I'll lay your ship [shit] bare See how I'll leave with every piece of you Don't underestimate the things that I will do There's a fire starting in my heart Reaching a fever pitch, and it's bringing me out the dark The scars of your love remind me of us They keep me thinking that we almost had it all The scars of your love, they leave me breathless I can't help feeling We could have had it all (You're gonna wish you never had met me) Rolling in the deep (Tears are gonna fall, rolling in the deep) You had my heart inside of your hand (You're gonna wish you never had met me) And you played it to the beat (Tears are gonna fall, rolling in the deep) Baby, I have no story to be told But I've heard one on you Now I'm gonna make your head burn Think of me in the depths of your despair Make a home down there As mine sure won't be shared (You're gonna wish you never had met me) The scars of your love remind me of us (Tears are gonna fall, rolling in the deep) They keep me thinking that we almost had it all (You're gonna wish you never had met me) The scars of your love, they leave me breathless (Tears are gonna fall, rolling in the deep) I can't help feeling We could have had it all (You're gonna wish you never had met me) Rolling in the deep (Tears are gonna fall, rolling in the deep) You had my heart inside of your hand (You're gonna wish you never had met me) And you played it to the beat (Tears are gonna fall, rolling in the deep) Could have had it all Rolling in the deep You had my heart inside of your hand But you played it with a beating Throw your soul through every open door Count your blessings to find what you look for Turn my sorrow into treasured gold You'll pay me back in kind and reap just what you sow (You're gonna wish you never had met me) We could have had it all (Tears are gonna fall, rolling in the deep) We could have had it all (You're gonna wish you never had met me) It all, it all, it all (Tears are gonna fall, rolling in the deep) We could have had it all (You're gonna wish you never had met me) Rolling in the deep (Tears are gonna fall, rolling in the deep) You had my heart inside of your hand (You're gonna wish you never had met me) And you played it to the beat (Tears are gonna fall, rolling in the deep) We could have had it all (You're gonna wish you never had met me) Rolling in the deep (Tears are gonna fall, rolling in the deep) You had my heart inside of your hand (You're gonna wish you never had met me) But you played it You played it You played it You played it to the beat" }, { "year": "2012", "artist": "Gotye", "title": "Somebody I Used to Know", "genre": "Pop", "lyrics": "Now and then I think of when we were together Like when you said you felt so happy you could die Told myself that you were right for me But felt so lonely in your company But that was love and it's an ache I still remember You can get addicted to a certain kind of sadness Like resignation to the end, always the end So when we found that we could not make sense Well you said that we would still be friends But I'll admit that I was glad it was over But you didn't have to cut me off Make out like it never happened and that we were nothing And I don't even need your love But you treat me like a stranger and that feels so rough No you didn't have to stoop so low Have your friends collect your records and then change your number I guess that I I don't need that though Now you're just somebody that I used to know Now you're just somebody that I used to know Now you're just somebody that I used to know Now and then I think of all the times you screwed me over But had me believing it was always something that I'd done But I don't wanna live that way Reading into every word you say You said that you could let it go And I wouldn't catch you hung up on somebody that you used to know But you didn't have to cut me off Make out like it never happened and that we were nothing And I don't even need your love But you treat me like a stranger and that feels so rough And you didn't have to stoop so low Have your friends collect your records and then change your number I guess that I don't need that though Now you're just somebody that I used to know Somebody (I used to know) Somebody (Now you're just somebody that I used to know) Somebody (used to know) Somebody (Now you're just somebody that I used to know) (I used to know) (That I used to know) (I used to know) Now and then I think of all the times you screwed me overcBut had me believing it was always something that I'd donecBut I don't wanna live that waycReading into every word you saycYou said that you could let it gocAnd I wouldn't catch you hung up on somebody that you used to knowcBut you didn't have to cut me offcMake out like it never happened and that we were nothing And I don't even need your love But you treat me like a stranger and that feels so rough And you didn't have to stoop so low Have your friends collect your records and then change your number I guess that I don't need that though Now you're just somebody that I used to know Somebody (I used to know) Somebody (Now you're just somebody that I used to know) Somebody (I used to know) Somebody (Now you're just somebody that I used to know) (I used to know) (That I used to know) (I used to know) Somebody" }, { "year": "2013", "artist": "Macklemore", "title": "Thrift Shop", "genre": "Hip Hop", "lyrics": "Hey, Macklemore, can we go thrift shopping? What what, what, what What what, what, what What what, what, what What what, what, what What what, what, what What what, what, what What what, what, what What what, what, what Bada, bada, bada dada I'm gonna pop some tags Only got 20 dollars in my pocket I'm, I'm, I'm hunting Looking for a come up This is fucking awesome Now, walk into the club, like, What up, I got a big cock! Nah, I�m just pumped, I bought some shit from a thrift shop Ice on the fringe is so damn frosty The people like, Damn, that�s a cold ass honkey! Rolling in hella deep, headed to the mezzanine Dressed in all pink; except my gator shoes, those are green Draped in a leopard mink, girl standing next to me Probably should've washed this, smells like R. Kelly sheets Pissssss) But shit, it was 99 cents! Fuck it, coppin' it, washin' it �Bout to go and get some compliments Passing up on those moccasins Someone else has been walking in Bummy and grungy, fuck it, man I am stunting and flossing and saving my money And I�m hella happy; that�s a bargain, bitch! Ima take your grandpa's style, I�ma take your grandpa's style No, for real, ask your grandpa Can I have his hand-me-downs? (Thank you!) Velour jumpsuit and some house slippers Dookie brown leather jacket that I found diggin' They had a broken keyboard, I bought a broken keyboard I bought a skeet blanket, then I bought a knee board Hello, hello, my ace man, my mellow John Wayne ain�t got nothing on my fringe game, hell no I could take some Pro Wings, make them cool, sell those The sneaker heads would be like, Ah, he got the Velcros. I'm gonna pop some tags Only got 20 dollars in my pocket I'm, I'm, I'm hunting Looking for a come up This is fucking awesome What you know about rocking a wolf on your noggin? What you knowing about wearing a fur fox skin? I�m digging, I�m digging I�m searching right through that luggage One man�s trash, that�s another man�s come up Thank your granddad for donating that plaid button Up shirt, �cause right now, I�m up in here stuntin' I�m at the Goodwill, you can find me in the bins I�m not, I�m not stuck on searchin' in that section (Mens) Your grammy, your aunty, your momma, your mammy I�ll take those flannel zebra jammies Second hand and I�ll rock that, motherfucker The built-in onesie with the socks on the motherfucker I hit the party and they stop in that motherfucker They be like, Oh, that Gucci? That�s hella tight I�m like, Yo, that�s 50 dollars for a t-shirt. Limited edition, let�s do some simple addition 50 dollars for a t-shirt, that�s just some ignorant bitch shit I call that getting swindled and pimped, shit I call that getting tricked by business That shirt�s hella dough, and having the same one as six other people in this club is a hella don�t Peep game, come take a look through my telescope Tryin' to get girls from a brand? Man, you hella won�t! Man, you hella won't! Goodwill, poppin' tags, yeah! I'm gonna pop some tags Only got 20 dollars in my pocket I'm, I'm, I'm hunting Looking for a come up This is fucking awesome I wear your granddad's clothes I look incredible I�m in this big ass coat From that thrift shop down the road I'm gonna pop some tags Only got 20 dollars in my pocket I'm, I'm, I'm hunting Looking for a come up This is fucking awesome Is that your grandma's coat?" }, { "year": "2014", "artist": "Pharrell", "title": "Happy", "genre": "Pop", "lyrics": "It might seem crazy what I'm 'bout to say Sunshine she's here, you can take a break I'm a hot air balloon that could go to space With the air, like I don't care, baby, by the way (Because I'm happy) Clap along if you feel like a room without a roof (Because I'm happy) Clap along if you feel like happiness is the truth (Because I'm happy) Clap along if you know what happiness is to you (Because I'm happy) Clap along if you feel like that's what you wanna do Here come bad news, talking this and that (Yeah!) Well, give me all you got, don't hold it back (Yeah!) Well, I should probably warn ya, I'll be just fine Yeah! No offense to you, don�t waste your time, here's why Because I'm happy) Clap along if you feel like a room without a roof (Because I'm happy) Clap along if you feel like happiness is the truth (Because I'm happy) Clap along if you know what happiness is to you (Because I'm happy) Clap along if you feel like that's what you wanna do Bring me down Can't nothing bring me down My level's too high to bring me down Can't nothing bring me down, I said Bring me down Can't nothing bring me down My level's too high to bring me down Can't nothing bring me down, I said (Because I'm happy) Clap along if you feel like a room without a roof (Because I'm happy) Clap along if you feel like happiness is the truth (Because I'm happy) Clap along if you know what happiness is to you (Because I'm happy) Clap along if you feel like that's what you wanna do (Because I'm happy) Clap along if you feel like a room without a roof (Because I'm happy) Clap along if you feel like happiness is the truth (Because I'm happy) Clap along if you know what happiness is to you (Because I'm happy) Clap along if you feel like that's what you wanna do Bring me down Can't nothing bring me down My level's too high to bring me down Can't nothing bring me down, I said Bring me down Can't nothing bring me down My level's too high to bring me down Can't nothing bring me down, I said (Because I'm happy) Clap along if you feel like a room without a roof (Because I'm happy) Clap along if you feel like happiness is the truth (Because I'm happy) Clap along if you know what happiness is to you (Because I'm happy) Clap along if you feel like that's what you wanna do (Because I'm happy) Clap along if you feel like a room without a roof (Because I'm happy) Clap along if you feel like happiness is the truth (Because I'm happy) Clap along if you know what happiness is to you (Because I'm happy) Clap along if you feel like that's what you wanna do" }, { "year": "2015", "artist": "Bruno Mars", "title": "Uptown Funk", "genre": "Pop", "lyrics": "Doh Doh doh doh, doh doh doh, doh doh Doh doh doh, doh doh doh, doh doh Doh doh doh, doh doh doh, doh doh Doh doh doh, doh duh Aaaaaaow! This hit That ice cold Michelle Pfeiffer That white gold This one for them hood girls Them good girls Straight masterpieces Stylin', wilin Livin' in up in the city Got chucks on with Saint Laurent Gotta kiss myself I'm so pretty I'm too hot hot damn Call the po-lice and the fireman I'm too hot hot damn Make a dragon wanna retire, man I'm too hot hot damn Say my name you know who I am I'm too hot hot damn And my band 'bout that money Break it down Girls hit your hallelujah ooh Girls hit your hallelujah ooh Girls hit your hallelujah ooh 'Cause Uptown Funk gon' give it to ya 'Cause Uptown Funk gon' give it to ya 'Cause Uptown Funk gon' give it to ya Saturday night and we in the spot Don't believe me just watch Come on Doh Doh doh doh, doh doh doh, doh doh Hah! Don't believe me just watch Doh Doh doh doh, doh doh doh, doh doh Hah! Don't believe me just watch Don't believe me just watch Don't believe me just watch Don't believe me just watch Hey, hey, hey, oh! Stop Wait a minute Fill my cup put some liquor in it Take a sip, sign a check Julio, Get the stretch! Ride to Harlem, Hollywood, Jackson, Mississippi If we show up, we gon' show out Smoother than a fresh jar of Skippy I'm too hot hot damn Call the po-lice and the fireman I'm too hot hot damn Make a dragon wanna retire, man I'm too hot hot damn Bitch, say my name you know who I am I'm too hot hot damn And my band 'bout that money Break it down Girls hit your hallelujah ooh Girls hit your hallelujah ooh Girls hit your hallelujah ooh Cause Uptown Funk gon' give it to ya Cause Uptown Funk gon' give it to ya Cause Uptown Funk gon' give it to ya Saturday night and we in the spot Don't believe me just watch come on Doh Doh doh doh, doh doh doh, doh doh Hah! Don't believe me just watch Doh Doh doh doh, doh doh doh, doh doh Hah! Don't believe me just watch Don't believe me just watch Don't believe me just watch Don't believe me just watch Hey, hey, hey, oh! Before we leave Let me tell y'all a little something Uptown Funk you up, Uptown Funk you up Uptown Funk you up, Uptown Funk you up, uh I said Uptown Funk you up, Uptown Funk you up Uptown Funk you up, Uptown Funk you up Come on, dance Jump on it If you sexy then flaunt it If you freaky then own it Don't brag about it, come show me Come on, dance Jump on it If you sexy then flaunt it Well it's Saturday night and we in the spot Don't believe me just watch come on Doh Doh doh doh, doh doh doh, doh doh Hah! Don't believe me just watch Doh Doh doh doh, doh doh doh, doh doh Hah! Don't believe me just watch Don't believe me just watch Don't believe me just watch Don't believe me just watch Hey, hey, hey, oh! Uptown Funk you up, Uptown Funk you up say whaa?! Uptown Funk you up, Uptown Funk you up Uptown Funk you up, Uptown Funk you up say whaa?! Uptown Funk you up, Uptown Funk you up Uptown Funk you up, Uptown Funk you up say whaa?! Uptown Funk you up, Uptown Funk you up Uptown Funk you up, Uptown Funk you up say whaa?! Uptown Funk you up Aaaaaaow!" } ]
{"streams":[{"title":"XXX | PRIVATE LA4","url":"http://iptv.elotroiptv.com:25461/live/yoandres754/IkwMA0rQPJ/17055.m3u8"}]}
{"artist": "Ansel Collins", "timestamp": "2011-08-02 08:41:10.049534", "similars": [], "tags": [], "track_id": "TROKBFW128F426F296", "title": "Black Out"}
{ "settings": { "create_spoiler": true, "world_count": 1, "randomize_settings": false, "logic_rules": "glitchless", "open_forest": "open", "open_kakariko": false, "open_door_of_time": true, "zora_fountain": "closed", "gerudo_fortress": "fast", "bridge": "medallions", "bridge_tokens": 50, "trials_random": false, "trials": 0, "starting_age": "child", "shuffle_interior_entrances": "off", "shuffle_grotto_entrances": false, "shuffle_dungeon_entrances": false, "shuffle_overworld_entrances": false, "mix_entrance_pools": false, "decouple_entrances": false, "owl_drops": false, "warp_songs": false, "spawn_positions": false, "triforce_hunt": false, "triforce_goal_per_world": 20, "bombchus_in_logic": false, "one_item_per_dungeon": false, "mq_dungeons_random": false, "mq_dungeons": 0, "shopsanity": "off", "tokensanity": "off", "shuffle_scrubs": "off", "shuffle_cows": false, "shuffle_song_items": false, "shuffle_kokiri_sword": true, "shuffle_ocarinas": false, "shuffle_weird_egg": false, "shuffle_gerudo_card": false, "shuffle_beans": false, "shuffle_mapcompass": "startwith", "shuffle_smallkeys": "dungeon", "shuffle_bosskeys": "dungeon", "shuffle_ganon_bosskey": "remove", "enhance_map_compass": false, "all_reachable": true, "logic_no_night_tokens_without_suns_song": false, "logic_lens": "chest-wasteland", "disabled_locations": [], "allowed_tricks": [], "no_escape_sequence": true, "no_guard_stealth": true, "no_epona_race": true, "no_first_dampe_race": true, "useful_cutscenes": false, "fast_chests": true, "free_scarecrow": false, "start_with_fast_travel": false, "start_with_rupees": false, "start_with_wallet": false, "start_with_deku_equipment": false, "chicken_count_random": false, "chicken_count": 7, "big_poe_count_random": false, "big_poe_count": 1, "ocarina_songs": false, "correct_chest_sizes": false, "clearer_hints": true, "ice_trap_appearance": "major_only", "hints": "always", "hint_dist": "tournament", "text_shuffle": "none", "damage_multiplier": "normal", "starting_tod": "default", "item_pool_value": "balanced", "junk_ice_traps": "off", "logic_earliest_adult_trade": "prescription", "logic_latest_adult_trade": "claim_check" }, "item_pool": { "Arrows (10)": 6, "Arrows (30)": 6, "Arrows (5)": 1, "Biggoron Sword": 1, "Bolero of Fire": 1, "Bomb Bag": 3, "Bombchus (10)": 3, "Bombchus (20)": 1, "Bombchus (5)": 1, "Bombs (10)": 2, "Bombs (20)": 2, "Bombs (5)": 2, "Boomerang": 1, "Bottle with Fairy": 1, "Bottle with Letter": 1, "Bottle with Milk": 1, "Bottle with Red Potion": 1, "Bow": 3, "Deku Nut Capacity": 2, "Deku Nuts (10)": 1, "Deku Nuts (5)": 1, "Deku Shield": 4, "Deku Stick Capacity": 2, "Dins Fire": 1, "Double Defense": 1, "Eponas Song": 1, "Farores Wind": 1, "Fire Arrows": 1, "Goron Tunic": 1, "Hammer": 1, "Heart Container": 8, "Hover Boots": 1, "Hylian Shield": 2, "Ice Arrows": 1, "Ice Trap": 6, "Iron Boots": 1, "Kokiri Sword": 1, "Lens of Truth": 1, "Light Arrows": 1, "Magic Meter": 2, "Minuet of Forest": 1, "Mirror Shield": 1, "Nayrus Love": 1, "Nocturne of Shadow": 1, "Piece of Heart (Treasure Chest Game)": 1, "Piece of Heart": 35, "Prelude of Light": 1, "Prescription": 1, "Progressive Hookshot": 2, "Progressive Scale": 2, "Progressive Strength Upgrade": 3, "Progressive Wallet": 2, "Recovery Heart": 11, "Requiem of Spirit": 1, "Rupee (1)": 1, "Rupees (20)": 6, "Rupees (200)": 6, "Rupees (5)": 16, "Rupees (50)": 7, "Sarias Song": 1, "Serenade of Water": 1, "Slingshot": 3, "Song of Storms": 1, "Song of Time": 1, "Stone of Agony": 1, "Suns Song": 1, "Weird Egg": 1, "Zeldas Lullaby": 1, "Zora Tunic": 1 }, "item_list": [ { "category": "Items", "items": [ "Deku Nut Capacity", "Deku Stick Capacity", "Bombchus", "Boomerang", "Bomb Bag", "Bow", "Slingshot", "Ocarina", "Fire Arrows", "Ice Arrows", "Light Arrows", "Dins Fire", "Nayrus Love", "Farores Wind", "Progressive Hookshot", "Lens of Truth", "Hammer", "Bottle", "Bottle with Letter", "Bottle with Red Potion", "Bottle with Green Potion", "Bottle with Blue Potion", "Bottle with Fairy", "Bottle with Fish", "Bottle with Blue Fire", "Bottle with Bugs", "Bottle with Big Poe", "Bottle with Poe", "Bottle with Milk", "Pocket Egg", "Pocket Cucco", "Cojiro", "Odd Mushroom", "Odd Potion", "Poachers Saw", "Broken Sword", "Prescription", "Eyeball Frog", "Eyedrops", "Claim Check", "Weird Egg", "Zeldas Letter", "Keaton Mask", "Skull Mask", "Spooky Mask", "Bunny Hood", "Mask of Truth", "Goron Mask", "Zora Mask", "Gerudo Mask" ] }, { "category": "Equipment", "items": [ "Kokiri Sword", "Biggoron Sword", "Deku Shield", "Hylian Shield", "Mirror Shield", "Goron Tunic", "Zora Tunic", "Iron Boots", "Hover Boots", "Stone of Agony", "Gerudo Membership Card", "Progressive Strength Upgrade", "Progressive Wallet", "Progressive Scale", "Magic Meter", "Double Defense" ] }, { "category": "Dungeons", "items": [ "Heart Container (Boss)", "Boss Key (Forest Temple)", "Boss Key (Fire Temple)", "Boss Key (Water Temple)", "Boss Key (Spirit Temple)", "Boss Key (Shadow Temple)", "Boss Key (Ganons Castle)", "Compass (Deku Tree)", "Compass (Dodongos Cavern)", "Compass (Jabu Jabus Belly)", "Compass (Forest Temple)", "Compass (Fire Temple)", "Compass (Water Temple)", "Compass (Spirit Temple)", "Compass (Shadow Temple)", "Compass (Bottom of the Well)", "Compass (Ice Cavern)", "Map (Deku Tree)", "Map (Dodongos Cavern)", "Map (Jabu Jabus Belly)", "Map (Forest Temple)", "Map (Fire Temple)", "Map (Water Temple)", "Map (Spirit Temple)", "Map (Shadow Temple)", "Map (Bottom of the Well)", "Map (Ice Cavern)", "Small Key (Forest Temple)", "Small Key (Fire Temple)", "Small Key (Water Temple)", "Small Key (Spirit Temple)", "Small Key (Shadow Temple)", "Small Key (Bottom of the Well)", "Small Key (Gerudo Training Grounds)", "Small Key (Gerudo Fortress)", "Small Key (Ganons Castle)" ] }, { "category": "Refills", "items": ["Deku Nuts (5)", "Deku Nuts (10)","Deku Stick (1)", "Deku Seeds (30)","Bombs (5)", "Bombs (10)", "Bombs (20)", "Bombchus (5)","Bombchus (10)", "Bombchus (20)","Magic Bean", "Arrows (5)", "Arrows (10)", "Arrows (30)" ] }, { "category": "Unused", "items": ["Deliver Letter","Sell Big Poe", "Milk", "Rupee (Treasure Chest Game)", "Piece of Heart (Treasure Chest Game)" ] }, { "category": "Collectables", "items": [ "Ice Trap", "Heart Container", "Piece of Heart", "Recovery Heart", "Gold Skulltula Token", "Rupee (1)", "Rupees (5)", "Rupees (20)", "Rupees (50)", "Rupees (200)", "Magic Bean Pack" ] }, { "category": "Songs", "items": [ "Zeldas Lullaby", "Eponas Song", "Sarias Song", "Suns Song", "Song of Time", "Song of Storms", "Minuet of Forest", "Bolero of Fire", "Serenade of Water", "Requiem of Spirit", "Nocturne of Shadow", "Prelude of Light", "Scarecrow Song" ] }, { "category": "Rewards", "items": [ "Kokiri Emerald", "Goron Ruby", "Zora Sapphire", "Forest Medallion", "Fire Medallion", "Water Medallion", "Spirit Medallion", "Shadow Medallion", "Light Medallion" ] } ], "locations": {} }
[{"kind": "Listing", "data": {"modhash": "", "whitelist_status": "all_ads", "children": [{"kind": "t3", "data": {"domain": "self.milliondollarextreme", "approved_at_utc": null, "banned_by": null, "media_embed": {}, "thumbnail_width": null, "subreddit": "milliondollarextreme", "selftext_html": "&lt;!-- SC_OFF --&gt;&lt;div class=\"md\"&gt;&lt;p&gt;Instead of making a good thread why don&amp;#39;t you tell us again how you are upset the content isn&amp;#39;t the way you want it to be&lt;/p&gt;\n&lt;/div&gt;&lt;!-- SC_ON --&gt;", "selftext": "Instead of making a good thread why don't you tell us again how you are upset the content isn't the way you want it to be", "likes": null, "suggested_sort": null, "user_reports": [], "secure_media": null, "is_reddit_media_domain": false, "link_flair_text": null, "id": "6sl04l", "banned_at_utc": null, "view_count": null, "archived": false, "clicked": false, "report_reasons": null, "title": "\"The posts here are such shit, this sub is ruined\"", "num_crossposts": 0, "saved": false, "can_mod_post": false, "is_crosspostable": false, "pinned": false, "score": 2, "approved_by": null, "over_18": false, "hidden": false, "num_comments": 6, "thumbnail": "self", "subreddit_id": "t5_2vsta", "hide_score": false, "edited": 1502282438.0, "link_flair_css_class": null, "author_flair_css_class": "", "contest_mode": false, "gilded": 0, "locked": false, "downs": 0, "brand_safe": true, "secure_media_embed": {}, "removal_reason": null, "can_gild": false, "thumbnail_height": null, "parent_whitelist_status": "all_ads", "name": "t3_6sl04l", "spoiler": false, "permalink": "/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/", "num_reports": null, "whitelist_status": "all_ads", "stickied": false, "created": 1502308969.0, "url": "https://www.reddit.com/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/", "author_flair_text": "sick little faggot", "quarantine": false, "author": "ikeepgettingbanned3", "created_utc": 1502280169.0, "subreddit_name_prefixed": "r/milliondollarextreme", "distinguished": null, "media": null, "upvote_ratio": 0.6, "mod_reports": [], "is_self": true, "visited": false, "subreddit_type": "public", "is_video": false, "ups": 2}}], "after": null, "before": null}}, {"kind": "Listing", "data": {"modhash": "", "whitelist_status": "all_ads", "children": [{"kind": "t1", "data": {"subreddit_id": "t5_2vsta", "approved_at_utc": null, "banned_by": null, "removal_reason": null, "link_id": "t3_6sl04l", "likes": null, "replies": {"kind": "Listing", "data": {"modhash": "", "whitelist_status": "all_ads", "children": [{"kind": "t1", "data": {"subreddit_id": "t5_2vsta", "approved_at_utc": null, "banned_by": null, "removal_reason": null, "link_id": "t3_6sl04l", "likes": null, "replies": {"kind": "Listing", "data": {"modhash": "", "whitelist_status": "all_ads", "children": [{"kind": "t1", "data": {"subreddit_id": "t5_2vsta", "approved_at_utc": null, "banned_by": null, "removal_reason": null, "link_id": "t3_6sl04l", "likes": null, "replies": "", "user_reports": [], "saved": false, "id": "dldkawn", "banned_at_utc": null, "gilded": 0, "archived": false, "report_reasons": null, "author": "[deleted]", "can_mod_post": false, "ups": 3, "parent_id": "t1_dldjfxm", "score": 3, "approved_by": null, "downs": 0, "body": "We just had a post hit 15k upvotes, bringing to light our exist to untold thousands of normalfags. ", "edited": false, "author_flair_css_class": null, "collapsed": false, "is_submitter": false, "collapsed_reason": null, "body_html": "&lt;div class=\"md\"&gt;&lt;p&gt;We just had a post hit 15k upvotes, bringing to light our exist to untold thousands of normalfags. &lt;/p&gt;\n&lt;/div&gt;", "stickied": false, "can_gild": false, "subreddit": "milliondollarextreme", "score_hidden": false, "permalink": "/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/dldkawn/", "subreddit_type": "public", "name": "t1_dldkawn", "created": 1502312595.0, "author_flair_text": null, "created_utc": 1502283795.0, "subreddit_name_prefixed": "r/milliondollarextreme", "controversiality": 0, "depth": 2, "mod_reports": [], "num_reports": null, "distinguished": null}}, {"kind": "t1", "data": {"subreddit_id": "t5_2vsta", "approved_at_utc": null, "banned_by": null, "removal_reason": null, "link_id": "t3_6sl04l", "likes": null, "replies": {"kind": "Listing", "data": {"modhash": "", "whitelist_status": "all_ads", "children": [{"kind": "t1", "data": {"subreddit_id": "t5_2vsta", "approved_at_utc": null, "banned_by": null, "removal_reason": null, "link_id": "t3_6sl04l", "likes": null, "replies": {"kind": "Listing", "data": {"modhash": "", "whitelist_status": "all_ads", "children": [{"kind": "t1", "data": {"subreddit_id": "t5_2vsta", "approved_at_utc": null, "banned_by": null, "removal_reason": null, "link_id": "t3_6sl04l", "likes": null, "replies": "", "user_reports": [], "saved": false, "id": "dldkvjz", "banned_at_utc": null, "gilded": 0, "archived": false, "report_reasons": null, "author": "Myszy", "can_mod_post": false, "ups": 2, "parent_id": "t1_dldkkyu", "score": 2, "approved_by": null, "downs": 0, "body": "Well when I posted that it was something like 1150. Right now it says 899.", "edited": false, "author_flair_css_class": "", "collapsed": false, "is_submitter": false, "collapsed_reason": null, "body_html": "&lt;div class=\"md\"&gt;&lt;p&gt;Well when I posted that it was something like 1150. Right now it says 899.&lt;/p&gt;\n&lt;/div&gt;", "stickied": false, "can_gild": true, "subreddit": "milliondollarextreme", "score_hidden": false, "permalink": "/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/dldkvjz/", "subreddit_type": "public", "name": "t1_dldkvjz", "created": 1502313401.0, "author_flair_text": "data is a right-wing conspiracy", "created_utc": 1502284601.0, "subreddit_name_prefixed": "r/milliondollarextreme", "controversiality": 0, "depth": 4, "mod_reports": [], "num_reports": null, "distinguished": null}}], "after": null, "before": null}}, "user_reports": [], "saved": false, "id": "dldkkyu", "banned_at_utc": null, "gilded": 0, "archived": false, "report_reasons": null, "author": "ikeepgettingbanned3", "can_mod_post": false, "ups": 1, "parent_id": "t1_dldkbq4", "score": 1, "approved_by": null, "downs": 0, "body": "I'm on mobile, what are we at now?", "edited": false, "author_flair_css_class": "", "collapsed": false, "is_submitter": true, "collapsed_reason": null, "body_html": "&lt;div class=\"md\"&gt;&lt;p&gt;I&amp;#39;m on mobile, what are we at now?&lt;/p&gt;\n&lt;/div&gt;", "stickied": false, "can_gild": true, "subreddit": "milliondollarextreme", "score_hidden": false, "permalink": "/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/dldkkyu/", "subreddit_type": "public", "name": "t1_dldkkyu", "created": 1502312990.0, "author_flair_text": "sick little faggot", "created_utc": 1502284190.0, "subreddit_name_prefixed": "r/milliondollarextreme", "controversiality": 0, "depth": 3, "mod_reports": [], "num_reports": null, "distinguished": null}}], "after": null, "before": null}}, "user_reports": [], "saved": false, "id": "dldkbq4", "banned_at_utc": null, "gilded": 0, "archived": false, "report_reasons": null, "author": "Myszy", "can_mod_post": false, "ups": 1, "parent_id": "t1_dldjfxm", "score": 1, "approved_by": null, "downs": 0, "body": "r/ books has about 1200 active online right now, for comparison", "edited": false, "author_flair_css_class": "", "collapsed": false, "is_submitter": false, "collapsed_reason": null, "body_html": "&lt;div class=\"md\"&gt;&lt;p&gt;r/ books has about 1200 active online right now, for comparison&lt;/p&gt;\n&lt;/div&gt;", "stickied": false, "can_gild": true, "subreddit": "milliondollarextreme", "score_hidden": false, "permalink": "/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/dldkbq4/", "subreddit_type": "public", "name": "t1_dldkbq4", "created": 1502312627.0, "author_flair_text": "data is a right-wing conspiracy", "created_utc": 1502283827.0, "subreddit_name_prefixed": "r/milliondollarextreme", "controversiality": 0, "depth": 2, "mod_reports": [], "num_reports": null, "distinguished": null}}], "after": null, "before": null}}, "user_reports": [], "saved": false, "id": "dldjfxm", "banned_at_utc": null, "gilded": 0, "archived": false, "report_reasons": null, "author": "ikeepgettingbanned3", "can_mod_post": false, "ups": 1, "parent_id": "t1_dldihhe", "score": 1, "approved_by": null, "downs": 0, "body": "I would. This sub is so tiny, it's just a blip on reddit", "edited": false, "author_flair_css_class": "", "collapsed": false, "is_submitter": true, "collapsed_reason": null, "body_html": "&lt;div class=\"md\"&gt;&lt;p&gt;I would. This sub is so tiny, it&amp;#39;s just a blip on reddit&lt;/p&gt;\n&lt;/div&gt;", "stickied": false, "can_gild": true, "subreddit": "milliondollarextreme", "score_hidden": false, "permalink": "/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/dldjfxm/", "subreddit_type": "public", "name": "t1_dldjfxm", "created": 1502311306.0, "author_flair_text": "sick little faggot", "created_utc": 1502282506.0, "subreddit_name_prefixed": "r/milliondollarextreme", "controversiality": 0, "depth": 1, "mod_reports": [], "num_reports": null, "distinguished": null}}], "after": null, "before": null}}, "user_reports": [], "saved": false, "id": "dldihhe", "banned_at_utc": null, "gilded": 0, "archived": false, "report_reasons": null, "author": "[deleted]", "can_mod_post": false, "ups": 1, "parent_id": "t3_6sl04l", "score": 1, "approved_by": null, "downs": 0, "body": "i wouldnt be surprised if this place got shoahed within the month anyway", "edited": false, "author_flair_css_class": null, "collapsed": false, "is_submitter": false, "collapsed_reason": null, "body_html": "&lt;div class=\"md\"&gt;&lt;p&gt;i wouldnt be surprised if this place got shoahed within the month anyway&lt;/p&gt;\n&lt;/div&gt;", "stickied": false, "can_gild": false, "subreddit": "milliondollarextreme", "score_hidden": false, "permalink": "/r/milliondollarextreme/comments/6sl04l/the_posts_here_are_such_shit_this_sub_is_ruined/dldihhe/", "subreddit_type": "public", "name": "t1_dldihhe", "created": 1502309764.0, "author_flair_text": null, "created_utc": 1502280964.0, "subreddit_name_prefixed": "r/milliondollarextreme", "controversiality": 0, "depth": 0, "mod_reports": [], "num_reports": null, "distinguished": null}}], "after": null, "before": null}}]
{ "docId": "669", "sentences": [ { "index": 0, "tokens": [ { "index": 1, "word": "fire", "originalText": "fire", "characterOffsetBegin": 1, "characterOffsetEnd": 5, "before": " ", "after": " " }, { "index": 2, "word": "consumes", "originalText": "consumes", "characterOffsetBegin": 6, "characterOffsetEnd": 14, "before": " ", "after": " " }, { "index": 3, "word": "big", "originalText": "big", "characterOffsetBegin": 15, "characterOffsetEnd": 18, "before": " ", "after": " " }, { "index": 4, "word": "happy", "originalText": "happy", "characterOffsetBegin": 19, "characterOffsetEnd": 24, "before": " ", "after": " " }, { "index": 5, "word": "farm", "originalText": "farm", "characterOffsetBegin": 25, "characterOffsetEnd": 29, "before": " ", "after": " " }, { "index": 6, "word": "where", "originalText": "where", "characterOffsetBegin": 30, "characterOffsetEnd": 35, "before": " ", "after": " " }, { "index": 7, "word": "families", "originalText": "families", "characterOffsetBegin": 36, "characterOffsetEnd": 44, "before": " ", "after": " " }, { "index": 8, "word": "send", "originalText": "send", "characterOffsetBegin": 45, "characterOffsetEnd": 49, "before": " ", "after": " " }, { "index": 9, "word": "sick", "originalText": "sick", "characterOffsetBegin": 50, "characterOffsetEnd": 54, "before": " ", "after": " " }, { "index": 10, "word": "dogs", "originalText": "dogs", "characterOffsetBegin": 55, "characterOffsetEnd": 59, "before": " ", "after": " " }, { "index": 11, "word": "to", "originalText": "to", "characterOffsetBegin": 60, "characterOffsetEnd": 62, "before": " ", "after": " " }, { "index": 12, "word": "run", "originalText": "run", "characterOffsetBegin": 63, "characterOffsetEnd": 66, "before": " ", "after": " " }, { "index": 13, "word": "free", "originalText": "free", "characterOffsetBegin": 67, "characterOffsetEnd": 71, "before": " ", "after": " " }, { "index": 14, "word": "and", "originalText": "and", "characterOffsetBegin": 72, "characterOffsetEnd": 75, "before": " ", "after": " " }, { "index": 15, "word": "play", "originalText": "play", "characterOffsetBegin": 76, "characterOffsetEnd": 80, "before": " ", "after": "" } ] } ] }
{ "title": "Bandung Indonesian Restaurant", "tags": [ "Vegetarian-Friendly" ], "typeOfFood": "\n Vegan-friendly, Beer/Wine, Delivery, Take-out, Indonesian, Non-veg\n ", "description": "Serves meat, veg options available. Casual nice interior decorated with Indonesian arts, crafts, and batiks. Dishes are seasoned with spices that are typical in Indonesia and most dishes are made to order, therefore can accommodate vegans and vegetarians. Tempeh is made in-house.", "priceRange": "Moderate", "streetAddress": "600 Williamson St", "postalCode": "53703", "phone": "tel:608-255-6910", "venueHours": "\n \n Mon-Thu 11:00am-2:00pm, 5:00pm-9:00pm, Fri 11:00am-10:00pm, Sat 5:00pm-10:00pm, Sun 5:00pm-9:00pm\n ", "listingFeatures": [ "Outdoor seating", "Wheelchair accessible", "Accepts credit cards" ], "gmaps": "http://maps.googleapis.com/maps/api/staticmap?center=43.076754,-89.374115&zoom=15&size=458x118&maptype=roadmap&markers=icon:http%3A%2F%2Fgoo.gl%2F1RDrbh%7Cshadow:true%7C43.076754,-89.374115&sensor=false&key=AIzaSyBrIo4v01Yet3zb6VunVdenxRtXWFnwfxk" }
{ "first_traded_price": 2199.0, "highest_price": 2205.0, "isin": "IRO1HJPT0001", "last_traded_price": 2205.0, "lowest_price": 2160.0, "trade_volume": 696238.0, "unix_time": 1405987200 }
{"name":"chevron_right","subject":7,"date":"17122009-022620","paths":{"Pen":{"strokes":[{"x":-304,"y":-402,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":0,"stroke_id":0},{"x":-218,"y":-475,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":1,"stroke_id":0},{"x":-183,"y":-503,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":2,"stroke_id":0},{"x":-153,"y":-518,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":3,"stroke_id":0},{"x":-140,"y":-528,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":4,"stroke_id":0},{"x":-130,"y":-521,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":5,"stroke_id":0},{"x":-140,"y":-509,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":6,"stroke_id":0},{"x":-162,"y":-482,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":7,"stroke_id":0},{"x":-202,"y":-445,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":8,"stroke_id":0},{"x":-248,"y":-398,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":9,"stroke_id":0},{"x":-313,"y":-343,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":10,"stroke_id":0},{"x":-388,"y":-278,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":11,"stroke_id":0},{"x":-475,"y":-209,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":12,"stroke_id":0},{"x":-570,"y":-137,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":13,"stroke_id":0},{"x":-666,"y":-64,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":14,"stroke_id":0},{"x":-763,"y":5,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":15,"stroke_id":0},{"x":-854,"y":70,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":16,"stroke_id":0},{"x":-938,"y":129,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":17,"stroke_id":0},{"x":-1012,"y":182,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":18,"stroke_id":0},{"x":-1071,"y":233,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":19,"stroke_id":0},{"x":-1113,"y":275,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":20,"stroke_id":0},{"x":-1140,"y":313,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":21,"stroke_id":0},{"x":-1152,"y":349,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":22,"stroke_id":0},{"x":-1149,"y":383,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":23,"stroke_id":0},{"x":-1129,"y":418,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":24,"stroke_id":0},{"x":-1099,"y":455,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":25,"stroke_id":0},{"x":-1056,"y":496,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":26,"stroke_id":0},{"x":-1003,"y":540,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":27,"stroke_id":0},{"x":-948,"y":592,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":28,"stroke_id":0},{"x":-887,"y":647,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":29,"stroke_id":0},{"x":-823,"y":706,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":30,"stroke_id":0},{"x":-757,"y":769,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":31,"stroke_id":0},{"x":-695,"y":835,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":32,"stroke_id":0},{"x":-635,"y":902,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":33,"stroke_id":0},{"x":-580,"y":968,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":34,"stroke_id":0},{"x":-527,"y":1034,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":35,"stroke_id":0},{"x":-480,"y":1095,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":36,"stroke_id":0},{"x":-437,"y":1150,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":37,"stroke_id":0},{"x":-400,"y":1202,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":38,"stroke_id":0},{"x":-375,"y":1237,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":39,"stroke_id":0},{"x":-342,"y":1269,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":40,"stroke_id":0},{"x":-313,"y":1287,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":41,"stroke_id":0},{"x":-281,"y":1297,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":42,"stroke_id":0},{"x":-281,"y":1297,"w":null,"z":null,"alpha":null,"beta":null,"gamma":null,"t":43,"stroke_id":0}]}},"device":{"osBrowserInfo":"Fujitsu-Siemens Stylistic ST5022 Tablet PC","resolutionHeight":null,"resolutionWidth":null,"windowHeight":null,"windowWidth":null,"pixelRatio":null,"mouse":false,"pen":true,"finger":false,"acceleration":false,"webcam":false}}
{"749060":{"success":true,"data":{"type":"dlc","name":"Boy Next Door - Gold Skin DLC","steam_appid":749060,"required_age":0,"is_free":false,"detailed_description":"This DLC include new skin for Van - Gold Skin with red boots.(New skin will be available on all game maps)<br \/>\r\nWhen you buy this DLC you can play only for Gold Van, If you want play for original Van - you need delete DLC and if you will want play for Gold Van again - you will need install this DLC.","about_the_game":"This DLC include new skin for Van - Gold Skin with red boots.(New skin will be available on all game maps)<br \/>\r\nWhen you buy this DLC you can play only for Gold Van, If you want play for original Van - you need delete DLC and if you will want play for Gold Van again - you will need install this DLC.","short_description":"This DLC include new skin for Van - Gold Skin with red boots","fullgame":{"appid":"726760","name":"Boy Next Door"},"supported_languages":"English, Russian","header_image":"https:\/\/steamcdn-a.akamaihd.net\/steam\/apps\/749060\/header.jpg?t=1510083563","website":null,"pc_requirements":{"minimum":"<strong>Minimum:<\/strong><br><ul class=\"bb_ul\"><li><strong>OS:<\/strong> Windows XP or higher<br><\/li><li><strong>Processor:<\/strong> 1.2GHz processor<br><\/li><li><strong>Memory:<\/strong> 512 MB RAM<br><\/li><li><strong>Graphics:<\/strong> DirectX\u00ae 9.0c compatible<br><\/li><li><strong>Storage:<\/strong> 50 MB available space<br><\/li><li><strong>Additional Notes:<\/strong> minimum 1280x720 screen resolution<\/li><\/ul>"},"mac_requirements":[],"linux_requirements":[],"developers":["Nikita \"Ghost_RUS\""],"publishers":["Ghost_RUS Games"],"price_overview":{"currency":"EUR","initial":99,"final":99,"discount_percent":0,"initial_formatted":"","final_formatted":"0,99\u20ac"},"packages":[219939],"package_groups":[{"name":"default","title":"Buy Boy Next Door - Gold Skin DLC","description":"","selection_text":"Select a purchase option","save_text":"","display_type":0,"is_recurring_subscription":"false","subs":[{"packageid":219939,"percent_savings_text":"","percent_savings":0,"option_text":"Boy Next Door - Gold Skin DLC - 0,99\u20ac","option_description":"","can_get_free_license":"0","is_free_license":false,"price_in_cents_with_discount":99}]}],"platforms":{"windows":true,"mac":false,"linux":false},"categories":[{"id":2,"description":"Single-player"},{"id":21,"description":"Downloadable Content"},{"id":22,"description":"Steam Achievements"}],"genres":[{"id":"72","description":"Nudity"},{"id":"25","description":"Adventure"},{"id":"4","description":"Casual"},{"id":"23","description":"Indie"}],"screenshots":[{"id":0,"path_thumbnail":"https:\/\/steamcdn-a.akamaihd.net\/steam\/apps\/749060\/ss_d5b74c70fbabf615dee6515fb8af21817869fd75.600x338.jpg?t=1510083563","path_full":"https:\/\/steamcdn-a.akamaihd.net\/steam\/apps\/749060\/ss_d5b74c70fbabf615dee6515fb8af21817869fd75.1920x1080.jpg?t=1510083563"}],"achievements":{"total":0},"release_date":{"coming_soon":false,"date":"7 Nov, 2017"},"support_info":{"url":"","email":"ghostnikitaeagle@gmail.com"},"background":"https:\/\/steamcdn-a.akamaihd.net\/steam\/apps\/749060\/page_bg_generated_v6b.jpg?t=1510083563","content_descriptors":{"ids":[1,5],"notes":null}}}}
{ "first_traded_price": 925.0, "highest_price": 938.0, "isin": "IRO1FNAR0001", "last_traded_price": 899.0, "lowest_price": 892.0, "trade_volume": 719311.0, "unix_time": 1487721600 }
{ "name": "smartcart_project", "version": "1.0.0", "description": "progetto iot su smart car, client in .net", "main": "Program.cs", "scripts": { "test": "echo \"Error: no test specified\" && exit 1" }, "author": "Filippo Bonfante", "license": "ISC" }
[ { "request": { "method": "Explorer.getTransferByID", "params": [ "68d187f580bd0dc4ebc630abc4a756475ea06bdc65bcfbda4ae404459d7b89e1" ], "jsonrpc": "2.0", "id": "0" }, "response": { "jsonrpc": "2.0", "id": "0", "result": { "version": 0, "ID": "68d187f580bd0dc4ebc630abc4a756475ea06bdc65bcfbda4ae404459d7b89e1", "nonce": 0, "sender": "io1qyqsqqqqmcje5a3ckssvwtq0lzw6m6smtqv7vthrl7sypg", "recipient": "io1qyqsqqqq8wd3sve9t4zrzny4eve5c6pz58l4v0e4w3q58q", "amount": "100000000000000000000000000", "senderPubKey": "", "signature": "", "payload": "", "gasLimit": 0, "gasPrice": "0", "isCoinbase": false, "fee": "", "timestamp": 1524676419, "blockID": "3b3f7bdf2d5c69e9d72f678083373014605bda3a7e42909c3ced2116e22ebca3", "isPending": false } } } ]
[ { "jungle_id":437255, "level":"Upper-Intermediate" } ]
{ "name": "Lucas Viana", "age": 18, "nationality": "Brazilian" }
{ "order": "9917" ,"word": "hae" ,"count": "515" }
{"title":"Women.Seeking.Women.94.XXX.DVDRip.x264-CHiKANi.mp4","uid":8679772,"size":1528194849,"categoryP":"porn","categoryS":"movies","magnet":"?xt=urn:btih:03b7092ba52c622d623d358b046a2c567add95ba&amp;dn=Women.Seeking.Women.94.XXX.DVDRip.x264-CHiKANi.mp4&amp;tr=udp%3A%2F%2Ftracker.openbittorrent.com%3A80&amp;tr=udp%3A%2F%2Fopen.demonii.com%3A1337&amp;tr=udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969&amp;tr=udp%3A%2F%2Fexodus.desync.com%3A6969","seeders":0,"leechers":1,"uploader":"KlixXxo","files":1,"time":1373667635,"description":"Gallery and Description:\n &lt;a href=&quot;\nhttp://www.244pix.com/viewer.php?file=0eri2nye33iv.jpg&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://www.244pix.com/viewer.php?file=0eri2nye33iv.jpg&lt;/a&gt;\n &lt;a href=&quot;\nhttp://www.244pix.com/viewer.php?file=vmrg784rfgar.jpeg&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://www.244pix.com/viewer.php?file=vmrg784rfgar.jpeg&lt;/a&gt;\n\n\nTitle: Women Seeking Women 94\nYear: 2013\nGenre: Lesbo\nStarring: Dyanna Lauren, India Summer, Elexis Monroe, Shyla Jennings, Aaliyah Love, Sovereign Syre, Prinzess, Sadie Holmes\n\nAbout the film: Beautiful woman woman sex which is sure to excite you!\n\nIssued: USA / Girlfriends Films\nDuration: 2:52:32\nLanguage: English\n\nfile\nQuality: DVDRip\nFormat: MP4\nVideo: MPEG4, 704x396, 29.970 fps, 1 048 Kbps\nAudio: 48 kHz, 2 ch, ~ 128 kbps","torrent":{"xt":"urn:btih:03b7092ba52c622d623d358b046a2c567add95ba","amp;dn":"Women.Seeking.Women.94.XXX.DVDRip.x264-CHiKANi.mp4","amp;tr":["udp%3A%2F%2Ftracker.openbittorrent.com%3A80","udp%3A%2F%2Fopen.demonii.com%3A1337","udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969","udp%3A%2F%2Fexodus.desync.com%3A6969"],"infoHash":"03b7092ba52c622d623d358b046a2c567add95ba","infoHashBuffer":{"type":"Buffer","data":[3,183,9,43,165,44,98,45,98,61,53,139,4,106,44,86,122,221,149,186]},"announce":[],"urlList":[]}}
{ "first_traded_price": 5513.0, "highest_price": 5698.0, "isin": "IRO7CTSP0001", "last_traded_price": 5110.0, "lowest_price": 5015.0, "trade_volume": 5582221.0, "unix_time": 1547596800 }
{ "first_traded_price": 1494.0, "highest_price": 1494.0, "isin": "IRO1BMEL0001", "last_traded_price": 1494.0, "lowest_price": 1494.0, "trade_volume": 31946.0, "unix_time": 1375056000 }
{ "id": 24551021, "type": "Feature", "properties": { "name":"Puerto Nuevo Sur", "placetype":"neighbourhood", "woe:id":24551021, "woe:name":"Puerto Nuevo Sur, San Juan, San Juan, PR, Puerto Rico", "woe:place_id":"gcyzITybBZm.iIIUQQ", "woe:placetype":"neighbourhood", "woe:placetype_id":22 }, "bbox": [-66.083794,18.412613,-66.078705,18.415018], "geometry": {"alpha":1e-05,"bbox":[-66.083793640137,18.412612915039,-66.078704833984,18.415018081665],"coordinates":[[[[-66.082214,18.415018],[-66.078705,18.412613],[-66.082527,18.414312],[-66.083794,18.413963],[-66.082558,18.414656],[-66.082214,18.415018]]]],"created":1292502729,"edges":6,"is_donuthole":0,"link":{"href":"http://farm6.static.flickr.com/5121/shapefiles/24551021_20101216_3c22e921ca.tar.gz"},"points":5,"type":"MultiPolygon"} }
{ "Url": "http://www.baomoi.com/Chang-le-cong-an-cu-viec-danh-chet-nguoi-roi-noi-do-thi-hanh-cong-vu-la-xong/58/13552423.epi", "Time": "13/04/2014 13:09", "Title": "Chẳng lẽ công an cứ việc đánh chết người rồi nói do “thi hành công vụ” là xong?", "Category": "Tin tức > Pháp luật", "Description": "(PLO)- Bạn đọc không đồng tình với luận điểm của tác giả bài báo cho rằng: Còng tay dân vào ban đêm đưa về đồn không có lệnh bắt, được hiểu là “mời lên làm viêc”. Không có sự giao nhiệm vụ cụ thể, tùy tiện cùng nhau đi bắt người được cho là 'rủ nhau đi đánh án'. Đánh đến chết người bị bắt được ông hiểu là “làm chết người trong khi thi hành công vụ”.", "Content": "<tr><td><p>Sau khi Pháp Luật TP.HCM đăng bài “<strong>Góc nhìn mới của Nguyên Phó Chánh án TANDTC về vụ 5 công an đánh chết ngườ</strong>i”, TS đã nhận được hàng trăm comment phản hồi của bạn đọc xung quanh <strong><a href='http://plo.vn/phap-luat-chu-nhat/goc-nhin-moi-cua-nguyen-pho-chanh-an-tandtc-ve-vu-5-cong-an-danh-chet-nguoi-460654.html'>bài viết này</a></strong>. Đa phần các ý kiến đều không thỏa mãn với những phân tích của tác giả bài viết, đồng thời đặt ra yêu cầu các công an làm sai, cướp đi sinh mạng của một con người thì càng phải xử nghiêm vì “biết luật mà lại phạm luật”.</p> <p><strong>Những luận điểm chính của nguyên Phó Chánh án</strong></p> <p>Trong bài phân tích của mình, nguyên Phó Chánh án TANDTC Đặng Quang Phương cho rằng trong vụ việc 5 công an Phú Yên dùng nhục hình, cácý kiến quy kết công an đã phạm vào tội bắt người trái pháp luật là không chính xác. </p> <p>“Bởi việc bắt giữ này được thực hiện bởi người thi hành công vụ, là kết quả của một quá trình điều tra, xác minh ban đầu. Bản thân anh Kiều lúc đó bị tình nghi tham gia một vụ trộm cắp. <strong>Các công an quả thực có vi phạm thủ tục tố tụng và phải chịu trách nhiệm pháp lý về các vi phạm đó nhưng không phải là trách nhiệm hình sự. </strong>Mặt khác, trong thực tiễn phòng, chống tội phạm, cơ quan điều tra vẫn thường sử dụng nghiệp vụ “mời lên làm việc” với người tình nghi. Việc này hoàn toàn khác với hành vi bắt người trái pháp luật theo kiểu giữa người dân với nhau bên ngoài xã hội”- ông Phương lý giải.</p> <em> <p><span class='storyInlinePhoto'><img src='http://plo.vn/uploaded/thanhhoa/2014_04_13/cong%20an_qzsy.jpg?width=500' ></span><br> <em><em>Người thân anh Ngô Thanh Kiều tại phiên tòa sơ thẩm với di ảnh và hình ảnh thi thể anh Kiều chứng tỏ anh đã bị tra tấn, đánh đập rất dã man. Ảnh: TẤN LỘC</em></em></p> </em> <p>Cũng theo ông Phương, việc bắt giữ anh Kiều, cho dù có vi phạm thủ tục tố tụng, vẫn hoàn toàn nằm trong việc thi hành công vụ.Bản thân anh Kiều bị tình nghi trộm cắp, đang cần được xác minh làm rõ. Do đó, việc năm công an đánh đập anh Kiều cần được coi là hành vi dùng nhục hình - một tội danh trong chương các tội xâm phạm hoạt động tư pháp của BLHS.</p> <p>&quot;Tuy nhiên, khi truy tố, xét xử vụ này, cần lưu ý dùng nhục hình chỉ được giới hạn trong các hành vi đánh đập, bỏ đói, hành hạ cơ thể… mà hậu quả của nó là không gây thương tích hoặc có thì tỉ lệ thương tật chỉ dưới 31%. Còn khi hậu quả nặng nề hơn, từ 31% trở lên thì hành vi dùng nhục hình đã chuyển hóa thành tội phạm khác. Cụ thể, <strong>trường hợp này đã đủ dấu hiệu cấu thành tội làm chết người trong khi thi hành công vụ (Điều 97 BLHS)</strong>, có khung hình phạt cao nhất tới 15 năm tù, nghiêm khắc hơn so với tội dùng nhục hình (cao nhất 12 năm tù)”- ông Phương phân tích.</p> <p>Tuy nhiên, những phân tích nêu trên không nhận được sự đồng tình của bạn đọc. Bởi nói một cách ngắn gọn như bạn đọc<strong> Le Anh Xuan</strong>, có thể tóm tắt luận điểm của tác giả bài báo như sau: Còng tay dân vào ban đêm đưa về đồn không có lệnh bắt, được hiểu là “mời lên làm viêc”. Không có sự giao nhiệm vụ cụ thể, tùy tiện cùng nhau đi bắt người được cho là &quot;rủ nhau đi đánh án&quot;. Đánh đến chết người bị bắt được ông hiểu là “làm chết người trong khi thi hành công vụ”. <br> <br> </p> <p><strong>Bắt giữ người trái pháp luật - luật chỉ áp dụng cho dân?</strong></p> <p><strong>Về luận điểm “</strong><strong>không có chuyện bắt giữ người trái pháp luật</strong><strong>”</strong>, nhiều ý kiến bạn đọc cảm thán, như lời bạn đọc <strong>T.A:</strong> “Bắt người không đúng, không có căn cứ pháp luật mà lại không phạm tội bắt người trái pháp luật thì gọi là gì hả trời?”. Bạn đọc <strong>Sh</strong> cũng đặt câu hỏi: “Ý ông là tội bắt người trái pháp luật chỉ có dân với dân, công an chỉ là bắt người sai quy tắc thôi. Vậy có công bằng không?” </p> <p>Phân tích rất kỹ về luận điểm này, bạn đọc <strong>Hồ Quang Huy</strong> cho rằng đến thời điểm anh Kiều bị bắt chưa có lệnh bắt anh ấy, thậm chí anh Kiều cũng không phải bị can. Tức anh là một công dân có đầy đủ các quyền như hàng chục triệu công dân khác. “Chính vì vậy bắt anh Kiều là trái pháp luật, chứ không đơn thuần là vi phạm thủ tục tố tụng”- bạn đọc Huy khẳng định.<br> Cụ thể hơn, bạn đọc Huy cho biết: Vi phạm thủ tục tố tụng chỉ áp dụng với trường hợp khi người bị bắt thuộc diện pháp luật cho phép bắt (theo lệnh hợp pháp, bắt khẩn cấp, phạm tội quả tang và bắt theo lệnh truy nã) nhưng có thiếu sót về một hoặc nhiều thủ tục nào đó. Như vậy công an bắt anh Kiều là thuộc tội &quot;Bắt người trái pháp luật&quot; theo điều 123 BLHS. Anh bắt người không thuộc đối tượng được pháp luật cho phép là bắt người trái pháp luật chứ còn gì nữa.</p> <p> Cũng theo bạn đọc Huy, chúng ta đừng gán tư cách nghi can của anh Kiều với việc bắt này, bởi việc này sẽ có cái nhìn thiên lệnh, thiếu khách quan, trong khi nghi can cũng có thân phận pháp lý như công dân bình thường. “Tôi cho rằng các công an nói trên đã bắt người trái PL theo điều 123 BLHS. Khi anh đã bắt người trái pháp luật thì cuộc làm việc của anh với anh Kiều không thể là thi hành công vụ được”- bạn đọc Huy nhấn mạnh.</p> <p><strong>Đánh người đến chết sao gọi là thi hành công vụ?</strong></p> <p>Về luận điểm 5 công an đánh chết người “<strong>đã đủ dấu hiệu cấu thành tội làm chết người trong khi thi hành công vụ (Điều 97 BLHS)</strong>, nhiều ý kiến bạn đọc cũng không đồng tình.</p> <p>Theo bạn đọc<strong> Dân SG</strong>: “Tội làm chết người trong khi thi hành công vụ (Điều 97 BLHS), là nói đến việc <strong>vô ý làm chết người</strong> chứ không phải bắt người trái pháp luật rồi bỏ đói, đánh đập dã man đến chết (72 vết thương tích; nội tạng bầm dập; chấn thương sọ não; dạ dày không có thức ăn). Đây rõ ràng là tội giết người chứ không thể là tội làm chết người trong khi thi hành công vụ được.</p> <p>Cùng quan điểm, bạn đọc <strong>Hồ Quang Huy</strong> phân tích: Trong quá trình làm việc, 5 công an liên tục đánh anh Kiều rất tàn nhẫn và vào cả những chỗ hiểm yếu nhất. Như vậy họ phải ý thức được việc làm của họ là có thể dẫn đến chết người, nhưng họ vẫn thực hiện đến cùng. Do đó phải quy họ tội giết người theo điều 93 BLHS.</p> <p>Bày tỏ sự bức xúc của mình, bạn đọc<strong>Nguyên Dân</strong> viết: Ông Phương nói như vậy là không đúng. Không lẽ anh cứ lấy việc đang thực thi công vụ rồi anh bất chấp tất cả, kể cả tính mạng của người dân để thực thi nhiệm vụ? Nói như ông, luật pháp được ban hành ra chỉ là để phục vụ cho chính quyền, còn nhân dân chúng tôi thì mặc kệ, không được bảo vệ?</p> <p>“Ở đây ông nói quá vô tâm. &quot;Xét xử tội làm chết người trong khi thi hành công vụ mới chính xác” - mức án cho tội này chỉ tối đa là 15 năm tù, so với tội giết người (chung thân hoặc tử hình) thì công lý cho chúng tôi ở đâu khi những &quot;công bộc&quot; được trao quyền nắm giữ công lý lại nhân danh công lý vi phạm pháp luật, và khi gây hậu quả nghiêm trọng (là đánh chết người) thì lại chỉ bị xử tội như là rất vô ý “làm chết người trong khi thi hành công vụ”?”- bạn đọc <strong>Nguyên Dân</strong> đặt câu hỏi.</p> <p>Theo bạn đọc<strong> Hong</strong>, anh Kiều được triệu tập lên công an làm việc lúc 8 giờ sáng nhưng 3 giờ sáng đã bị nhóm công an đến tận nhà bắt còng tay áp giải; ở trụ sở làm việc năm công an thay phiên đánh cả buổi, không cho ăn uống gì, cũng không có biên bản làm việc nào; hậu quả anh Kiều chết với 72 thương tích trên cơ thể. “Tôi nghĩ chẳng có quy định của pháp luật nào về thi hành công vụ theo kiểu đó, vì vậy không thể nói làm chết người trong lúc thi hành công vụ được. Hơn nữa với 72 thương tích đó cũng không thể nói lỡ tay hay vô ý làm chết người được”- bạn đọc <strong>Hong</strong> lưu ý.</p> <br /> <p><strong>Không ai được đứng trên pháp luật</strong></p> <p>Theo ý kiến bạn đọc, “lẽ ra, những người được giao quyền nắm giữ, định đoạt sinh mệnh người khi chấp pháp càng phải cẩn trọng hơn khi thực thi công vụ mới đúng”.</p> <p>Bạn đọc <strong>Nguyên Dân</strong> cho rằng, mọi công dân đều phải bình đẳng trước pháp luật. Là những người chấp pháp anh càng phải coi trọng điều này khi chấp pháp. Không ai có quyền được ở trên pháp luật và cũng không ai không được pháp luật bảo vệ.</p> <p>“Để người dân tin tưởng hệ thống tư pháp thì những sai phạm của tập thể, cá nhân thuộc các cơ quan tiến hành tố tụng đã điều tra, truy tố, xét xử oan sai, nếu vi phạm đều phải bị xử lý nghiêm minh, đúng người, đúng tội, chứ không thể còn có một quy định pháp luật khác chỉ để xét xử “phạm tội khi thi hành công vụ”. Phạm tội là “tội phạm”, công vụ là không vụ lợi và phải công tâm, lẽ ra, một người đã từng làm chánh án Tòa càng phải hiểu rõ điều đó hơn người dân chúng tôi mới phải”- bạn đọc <strong>Nguyên Dân</strong> kết luận.</p> <p>Chia sẻ với ý kiến trên, bạn đọc <strong>Lê Hải</strong> bày tỏ: “Tôi đồng ý với bạn với ý: &quot;Mọi công dân đều bình đẳng trước pháp luật. Không thể còn có một qui định pháp luật khác chỉ để xét xử &quot;phạm tội khi thi hành công vụ&quot;. Theo tôi, người thi hành công vụ mà phạm tội thì vẫn phải xử như người bình thường. Thậm chí còn phải có thêm hình thức tăng nặng hình phạt. Vì họ là người hiểu rất rõ luật pháp mà vẫn cố tình vi phạm. Có như thế tình trạng oan sai mới chấm dứt. Giả sử Quốc hội ra luật tăng nặng hình phạt cho những người thi hành công vụ mà vi phạm (biết luật vẫn phạm luật) thì chắc chắn tình trạng oan sai sẽ giảm hẳn”.</p> <p>***</p> <p>Theo dự kiến, ngày mai Thứ 2 (14-4), Chánh Tòa Hình sự Nguyễn Bá Thân cùng Đoàn công tác của TAND Tối cao sẽ vào Phú Yên trực tiếp kiểm tra, nghiên cứu hồ sơ, phối hợp với TAND tỉnh Phú Yên hướng dẫn giải quyết vụ án 5 công an đánh chết anh Ngô Thanh Kiều theo đúng tinh thần pháp luật. Chúng ta hãy cùng chờ xem diễn biến của vụ việc với niềm hy vọng công lý sẽ được thực thi để không còn ai phải chết oan như thế nữa. </p> <p><strong>T.Hoa (Tổng hợp) </strong></p> </div><br /></td></tr>", "KeyWords": [ "thi hành công vụ", "bạn đọc", "chết người", "bắt", "trái pháp luật", "pháp luật", "công an", "nhục hình", "luận điểm", "bộ luật hình sự", "đánh chết", "TP HCM", "Tòa án nhân dân tối cao", "comment", "Phú Yên" ], "Trends": [ { "word": "Bà Rịa Vũng Tàu", "weith": "2" }, { "word": "Ban Chỉ huy quân sự", "weith": "6" }, { "word": "bắt giữ", "weith": "4" }, { "word": "Bệnh viện Chợ Rẫy", "weith": "1" }, { "word": "bộ luật hình sự", "weith": "1" }, { "word": "Cát Tường", "weith": "1" }, { "word": "cướp", "weith": "2" }, { "word": "Facebook", "weith": "6" }, { "word": "giết người", "weith": "2" }, { "word": "He-rô-in", "weith": "3" }, { "word": "hiếp dâm", "weith": "5" }, { "word": "Mai Dịch", "weith": "3" }, { "word": "Nguyễn Mạnh Tường", "weith": "2" }, { "word": "Nha Trang", "weith": "4" }, { "word": "phòng cháy chữa cháy", "weith": "6" }, { "word": "Quỳnh Lưu", "weith": "6" }, { "word": "Soha", "weith": "6" }, { "word": "sông Sài Gòn", "weith": "3" }, { "word": "Tân Thành", "weith": "1" }, { "word": "Thạch Hà", "weith": "6" }, { "word": "Thủ Đức", "weith": "3" }, { "word": "thu giữ", "weith": "6" }, { "word": "Tiền Giang", "weith": "6" }, { "word": "tòa án nhân dân", "weith": "4" }, { "word": "trái phép", "weith": "3" }, { "word": "trinh sát", "weith": "4" }, { "word": "trộm cắp", "weith": "4" }, { "word": "xe đạp điện", "weith": "1" }, { "word": "xe SH", "weith": "5" }, { "word": "xét xử", "weith": "3" } ] }
{ "bookmarks.activitybar.title": "Закладки", "bookmarks.views.Explorer.name": "Проводник", "bookmarks.views.HelpAndFeedback.name": "Help and Feedback", "bookmarks.viewsWelcome.bookmarksExplorer.contents.whenEmpty": "In order to use Bookmarks, you have to open a folder or workspace first.\n[Open a Folder](command:_bookmarks.openFolderWelcome)\n[Open a Workspace](command:workbench.action.openWorkspace)\nTo learn more about how to use Bookmarks in VS Code [read the docs](http://github.com/alefragnani/vscode-bookmarks/#bookmarks).", "bookmarks.viewsWelcome.bookmarksExplorer.contents.whenNoFileOpen": "No bookmarks yet.\nIn order to use Bookmarks, you have to open a file in the editor.\n[Open a File](command:workbench.action.quickOpen)\nTo learn more about how to use Bookmarks in VS Code [read the docs](http://github.com/alefragnani/vscode-bookmarks/#bookmarks).", "bookmarks.viewsWelcome.bookmarksExplorer.contents.whenHasFileOpen": "No bookmarks yet.\nIn order to use Bookmarks, place the cursor in any location in the file and run the command:\n[Bookmarks: Toggle](command:bookmarks.toggle)\nTo learn more about how to use Bookmarks in VS Code [read the docs](http://github.com/alefragnani/vscode-bookmarks/#bookmarks).", "bookmarks.editor.context.label": "Закладки", "bookmarks.editor.title.label": "Закладки", "bookmarks.commands.category.bookmarks": "Закладки", "bookmarks.commands.category.bookmarks.selection": "Закладки (Выделение)", "bookmarks.commands.toggle.title": "добавить/убрать", "bookmarks.commands.jumpToNext.title": "Перейти к следующей", "bookmarks.commands.jumpToPrevious.title": "Перейти к предыдущей", "bookmarks.commands.jumpTo.title": "Перейти к документу/строке", "bookmarks.commands.selectLines.title": "Выделить линию", "bookmarks.commands.expandSelectionToNext.title": "Сделать выделение до следующего", "bookmarks.commands.expandSelectionToPrevious.title": "Сделать выделение до предыдущего", "bookmarks.commands.shrinkSelection.title": "Уменьшить выделение", "bookmarks.commands.list.title": "Список", "bookmarks.commands.toggleLabeled.title": "Переключить маркер", "bookmarks.commands.refresh.title": "Обновить", "bookmarks.commands.openSettings.title": "Открыть настройки", "bookmarks.commands.clear.title": "Очистить", "bookmarks.commands.clearFromFile.title": "Очистить", "bookmarks.commands.deleteBookmark.title": "Удалить", "bookmarks.commands.editLabel.title": "Изменить маркер", "bookmarks.commands.listFromAllFiles.title": "Список из всех файлов", "bookmarks.commands.clearFromAllFiles.title": "Очистить из всех файлов", "bookmarks.commands.whatsNew.title": "Что нового", "bookmarks.commands.whatsNewContextMenu.title": "Что нового", "bookmarks.commands.openFolderWelcome.title": "Открыть папку", "bookmarks.commands.supportBookmarks.title": "Поддержка закладок", "bookmarks.configuration.title": "Закладки", "bookmarks.configuration.saveBookmarksInProject.description": "Разрешить локальное сохранение (и восстановление) закладок в открытом Проекте/Папке вместо VSCoda", "bookmarks.configuration.gutterIconPath.description": "Путь к другому изображению, которое будет представлено в виде маркера закладки", "bookmarks.configuration.backgroundLineColor.description": "Цвет фона (background) строки на которую установлена закладка. Используйте rgba(), чтобы задать прозрачные цвета фона для хорошего сочетания с другим оформлением. Пример: rgba(21, 126, 251, 0,1)", "bookmarks.configuration.backgroundLineColor.deprecation": "Вместо этого используйте `bookmarks.lineBackground` в `workbench.colorCustomizations`", "bookmarks.configuration.navigateThroughAllFiles.description": "Разрешить навигатору искать закладки во всех файлах проекта, а не только в текущем", "bookmarks.configuration.wrapNavigation.description": "Разрешить навигацию по первой и последней закладкам в области (текущий файл или все файлы)", "bookmarks.configuration.useWorkaroundForFormatters.description": "Использовать обходной путь для форматировщиков таких как Prettier, который не уведомляет об изменениях документа и путает поведение прикреплённой закладки", "bookmarks.configuration.showCommandsInContextMenu.description": "Specifies whether Bookmarks commands are displayed on the context menu", "bookmarks.configuration.sidebar.expanded.description": "Specifies whether the Side Bar show be displayed expanded", "bookmarks.configuration.multicursor.toggleMode.description": "Specifies how multi cursor handles already bookmarked lines", "bookmarks.configuration.multicursor.toggleMode.enumDescriptions.allLinesAtOnce": "Creates bookmarks in all selected lines at once, if at least one of the lines don't have a bookmark", "bookmarks.configuration.multicursor.toggleMode.enumDescriptions.eachLineIndependently": "Literally toggles a bookmark in each line, instead of making all lines equal", "bookmarks.configuration.label.suggestion.description": "Specifies how labels are suggested when creating bookmarks", "bookmarks.configuration.label.suggestion.enumDescriptions.dontUse": "Don't use the selection (original behavior)", "bookmarks.configuration.label.suggestion.enumDescriptions.useWhenSelected": "Use the selected text (if available) directly, no confirmation required", "bookmarks.configuration.label.suggestion.enumDescriptions.suggestWhenSelected": "Suggests the selected text (if available). You still need to confirm.", "bookmarks.configuration.label.suggestion.enumDescriptions.suggestWhenSelectedOrLineWhenNoSelected": "Suggests the selected text (if available) or the entire line (when has no selection). You still need to confirm.", "bookmarks.colors.lineBackground.description": "Цвет фона для отмеченной строки", "bookmarks.colors.lineBorder.description": "Цвет фона для границы вокруг линии с закладкой", "bookmarks.colors.overviewRuler.description": "Обзор цвета маркера линейки для закладок" }
{"locality": "Glendora", "region": {"fips": "06", "abbr": "CA", "name": "California"}, "localities": ["Glendora"], "postal_code": "91741", "lat": 34.140207, "lng": -117.85704, "type": "STANDARD", "counties": []}
{ "first_traded_price": 8570.0, "highest_price": 8768.0, "isin": "IRO1NBEH0001", "last_traded_price": 8561.0, "lowest_price": 8561.0, "trade_volume": 259259.0, "unix_time": 1502668800 }
{"name":"Nicholas_Tse", "image_location":"http://localhost:8081/static/lfw/Nicholas_Tse/Nicholas_Tse_0001.png"}
{ "id": 30, "name": "room 30", "description": "room 30", "mob_id": 0, "north": 0, "south": 0, "east": 31, "west": 9 }
{ "first_traded_price": 2721.0, "highest_price": 2849.0, "isin": "IRO3KHZZ0001", "last_traded_price": 2722.0, "lowest_price": 2721.0, "trade_volume": 37089.0, "unix_time": 1502668800 }
{ "name": "me", "version": "0.0.0", "main": "index.js", "license": "MIT", "scripts": { "start": "node server.js" }, "dependencies": { "body-parser": "^1.19.0", "cors": "^2.8.5", "dotenv": "^8.0.0", "ejs": "^2.6.2", "express": "^4.17.1", "express-handlebars": "^3.1.0", "express-session": "^1.16.2", "faker": "^4.1.0", "hbs": "^4.1.1", "microtime": "^3.0.0", "mysql2": "^1.6.5", "session-file-store": "^1.3.1", "zarinpal-checkout": "^0.2.7" } }
{ "title":"Good News!", "content":"Good News! DaDaPush releasing new version", "actions":[ {"name":"website","url":"https://www.dadapush.com/","type":"link"}, {"name":"documentation","url":"https://www.dadapush.com/documentation","type":"link"} ] }
{ "id": 23397158, "type": "Feature", "properties": { "name":"Hammond", "placetype":"locality", "woe:id":23397158, "woe:name":"Hammond, Ontario, Canada", "woe:place_id":"YGxpUy2bAp9c0xg5dg", "woe:placetype":"locality", "woe:placetype_id":7 }, "bbox": [-75.25386,45.401672,-75.220383,45.418892], "geometry": {"alpha":0.00015,"bbox":[-75.253860473633,45.401672363281,-75.22038269043,45.418891906738],"coordinates":[[[[-75.238884,45.402699],[-75.25386,45.409145],[-75.239868,45.407249],[-75.225708,45.418892],[-75.225639,45.416664],[-75.220383,45.401672],[-75.238884,45.402699]]]],"created":1292524332,"edges":7,"is_donuthole":0,"link":{"href":"http://farm6.static.flickr.com/5201/shapefiles/23397158_20101216_8f9ba4c26d.tar.gz"},"points":13,"type":"MultiPolygon"} }
{ "id": 974542013, "type": "Feature", "properties": { "addr:full":"473 Forest Hill Dr Kitchener ON N2M 4H3", "addr:housenumber":"473", "addr:postcode":"n2m 4h3", "addr:street":"Forest Hill Dr", "edtf:cessation":"uuuu", "edtf:inception":"uuuu", "geom:area":0.0, "geom:area_square_m":0.0, "geom:bbox":"-80.517036438,43.4276199341,-80.517036438,43.4276199341", "geom:latitude":43.42762, "geom:longitude":-80.517036, "iso:country":"CA", "mz:hierarchy_label":1, "mz:is_current":-1, "sg:address":"473 Forest Hill Dr", "sg:city":"Kitchener", "sg:classifiers":[ { "category":"Retail", "subcategory":"Laundry & Dry Cleaning", "type":"Services" } ], "sg:owner":"simplegeo", "sg:phone":"+1 519 578 1254", "sg:postcode":"N2M 4H3", "sg:province":"ON", "sg:tags":[ "cleaners", "rug", "carpet" ], "src:geom":"simplegeo", "wof:belongsto":[ 85874971, 102191575, 85633041, 101740709, 85682057, 101735989 ], "wof:breaches":[], "wof:concordances":{ "sg:id":"SG_4bAgmCgLMMKKVA6pEzfrCD_43.427620_-80.517036@1293573121" }, "wof:country":"CA", "wof:created":1472239416, "wof:geomhash":"3449f5538761f21793240f5bef23919b", "wof:hierarchy":[ { "continent_id":102191575, "country_id":85633041, "locality_id":101740709, "neighbourhood_id":85874971, "region_id":85682057, "venue_id":974542013 }, { "continent_id":102191575, "country_id":85633041, "locality_id":101735989, "neighbourhood_id":85874971, "region_id":85682057, "venue_id":974542013 } ], "wof:id":974542013, "wof:lastmodified":1499439526, "wof:name":"Muldoon's Cleaning Svc", "wof:parent_id":85874971, "wof:placetype":"venue", "wof:repo":"whosonfirst-data-venue-ca", "wof:superseded_by":[], "wof:supersedes":[], "wof:tags":[ "cleaners", "rug", "carpet" ] }, "bbox": [ -80.517036438, 43.4276199341, -80.517036438, 43.4276199341 ], "geometry": {"coordinates":[-80.51703643800001,43.4276199341],"type":"Point"} }
{"uuid":"25c40d65-5855-4af9-aca1-a423c91e1a3c","name":"Gradle suite","children":["b356c2f7-16e5-41b6-bb81-4d0ff1ff6cbb"],"befores":[],"afters":[],"links":[],"start":1627735120145,"stop":1627735184716}
{"title": "Using label structure to address class imbalance", "review": "This is a clear and well written paper that attempts to improve our ability to predict in the setting of massive multi-label data which, as the authors highlight, is an increasingly import problem in biology and healthcare. \n\nStrengths:\nThe idea of using the hierarchical structure of the labels is innovative and well-motivated. The experimental design and description of the methods is excellent. \n\nWeaknesses:\nOverall the results are not consistently strong and there is a key baseline missing. The approach only seems help in the \"rare label, small data\" regime, which limits the applicability of the method but is still worthy of consideration. \n\nMy biggest reservation is that the authors did not include a baseline where the classes are reweighted according to their frequency. Multilabel binary cross-entropy is very easy to modify to incorporate class weights (e.g. upweight the minority class for each label) and without this baseline I am unable to discern how well the method works relative to this simple baseline.\n\nOne more dataset would also strengthen the results, and since I am suggesting more work I will also try to be helpful and be specific. Predicting mesh terms from abstracts would qualify as a massive multilabel task and there is plenty of public data available here: https://www.nlm.nih.gov/databases/download/pubmed_medline.html \n\nFinally, there is one relevant paper that the authors may wish to consider in their review section: https://www.biorxiv.org/content/early/2018/07/10/365965", "rating": "4: Ok but not good enough - rejection", "confidence": "4: The reviewer is confident but not absolutely certain that the evaluation is correct"}
{"word":"handsomeness","results":[{"definition":"the quality of having regular well-defined features (especially of a man)","partOfSpeech":"noun","synonyms":["good looks"],"typeOf":["beauty"],"derivation":["handsome"]}],"syllables":{"count":3,"list":["hand","some","ness"]},"pronunciation":{"all":"'hænsəmnɛs"},"frequency":1.9}
{ "id": 202857747, "type": "Feature", "properties": { "addr:full":"2535 Shaughnessy St Port Coquitlam BC V3C 3G1", "addr:housenumber":"", "addr:postcode":"2535;v3c 3g1", "addr:street":"Shaughnessy St", "edtf:cessation":"uuuu", "edtf:inception":"uuuu", "geom:area":0.0, "geom:bbox":"-122.782494,49.261658,-122.782494,49.261658", "geom:latitude":49.261658, "geom:longitude":-122.782494, "iso:country":"CA", "mz:hierarchy_label":1, "mz:is_current":-1, "sg:address":"2535 Shaughnessy St", "sg:city":"Port Coquitlam", "sg:classifiers":[ { "category":"Food & Beverages", "subcategory":"Groceries & Convenience Stores", "type":"Retail Goods" } ], "sg:owner":"simplegeo", "sg:phone":"+1 604 942 6126", "sg:postcode":"V3C 3G1", "sg:province":"BC", "sg:tags":[ "grocer" ], "src:geom":"simplegeo", "wof:belongsto":[ 85894799, 102191575, 85633041, 101741053, 85682117 ], "wof:breaches":[], "wof:concordances":{ "sg:id":"SG_3r17YWSuKDrcNy97Q2kQ5U_49.261658_-122.782494@1293573121" }, "wof:country":"CA", "wof:geomhash":"3c585b2607d46dad81b01ee8ece59e29", "wof:hierarchy":[ { "continent_id":102191575, "country_id":85633041, "locality_id":101741053, "neighbourhood_id":85894799, "region_id":85682117, "venue_id":202857747 } ], "wof:id":202857747, "wof:lastmodified":1472335302, "wof:name":"Super Valu", "wof:parent_id":85894799, "wof:placetype":"venue", "wof:repo":"whosonfirst-data-venue-ca", "wof:superseded_by":[], "wof:supersedes":[], "wof:tags":[ "grocer" ] }, "bbox": [ -122.782494, 49.261658, -122.782494, 49.261658 ], "geometry": {"coordinates":[-122.782494,49.261658],"type":"Point"} }
{"comment": "4", "idNoticia": "3253", "tags": [], "url": "http://www.valor.com.br/empresas/3274342/petrobras-nao-suportaria-pagar-sozinha-o-bonus-de-libra-afirma-graca ", "autor": " Rafael Bitencourt ", "titulo": "Petrobras não suportaria pagar sozinha o bônus de Libra, afirma Graça", "corpo": "BRASÍLIA - A Petrobras não suportaria entrar sozinha no primeiro leilão do campo de Libra, a primeira licitação do pré-sal pelo regime de partilha, afirmou a presidente da estatal, Graça Foster. “Para a Petrobras, 100% de Libra é possível do ponto de vista técnico e operacional, sim. Do ponto de vista dos atuais indicadores econômicos e financeiros, não suportaria um bônus de R$ 15 bilhões”, avaliou Graça Foster ao se referir ao preço do bônus de assinatura fixado no edital da Agência Nacional de Petróleo (ANP). No leilão de Libra, marcado do para o dia 21 de outubro, a Petrobras deverá arcar com o mínimo de 30% do bônus de assinatura (R$ 4,5 bilhões), percentual correspondente à participação mínima da estatal nos contratos do novo regime de partilha. Graça Foster ressaltou que busca fazer o melhor para o sucesso de exploração dos poços da área de Libra, dentro da atual realidade da empresa. “Tenho o dever de buscar as melhores escolhas para a companhia no momento”, disse. Ao ser questionada se poderia haver um momento melhor para realizar o leilão para a Petrobras, Graça Foster disse que “não tem poder algum” de decidir sobre o melhor momento para fazer o leilão, decisão que cabe ao governo. “Não tenho autoridade para dizer qual o melhor momento”, ponderou a executiva em audiência pública no Senado.", "data": "2013-09-18 12:16:00"}
{"title":"MassageCreep.Morgan.Lee.Wand.Massage.XXX.1080p.XXXtremes.mp4","uid":11767602,"size":1400351049,"categoryP":"porn","categoryS":"movies","magnet":"?xt=urn:btih:aa93ccb8f440594997145be0c29a716cc59ed6e1&amp;dn=MassageCreep.Morgan.Lee.Wand.Massage.XXX.1080p.XXXtremes.mp4&amp;tr=udp%3A%2F%2Ftracker.openbittorrent.com%3A80&amp;tr=udp%3A%2F%2Fopen.demonii.com%3A1337&amp;tr=udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969&amp;tr=udp%3A%2F%2Fexodus.desync.com%3A6969","seeders":0,"leechers":1,"uploader":"XXXmegathor","files":1,"time":1426920648,"description":"MassageCreep.Morgan.Lee.Wand.Massage.XXX.1080p.XXXtremes\n\nSCREENIES &lt;a href=&quot;\nhttp://xxxmegathor.com/?v=MassageCreep.Morgan.Lee.Wand.Massage.XXX.1080p.XXXtremes_s.jpg&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://xxxmegathor.com/?v=MassageCreep.Morgan.Lee.Wand.Massage.XXX.1080p.XXXtremes_s.jpg&lt;/a&gt;","torrent":{"xt":"urn:btih:aa93ccb8f440594997145be0c29a716cc59ed6e1","amp;dn":"MassageCreep.Morgan.Lee.Wand.Massage.XXX.1080p.XXXtremes.mp4","amp;tr":["udp%3A%2F%2Ftracker.openbittorrent.com%3A80","udp%3A%2F%2Fopen.demonii.com%3A1337","udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969","udp%3A%2F%2Fexodus.desync.com%3A6969"],"infoHash":"aa93ccb8f440594997145be0c29a716cc59ed6e1","infoHashBuffer":{"type":"Buffer","data":[170,147,204,184,244,64,89,73,151,20,91,224,194,154,113,108,197,158,214,225]},"announce":[],"urlList":[]}}
{"artist": "Chet Baker", "timestamp": "2011-08-03 07:30:45.944084", "similars": [["TRNBRNY12903D0226B", 1], ["TRVYSST12903C9E687", 1], ["TROTTHR128F9301624", 1], ["TRQRCHJ128F92CE3C2", 0.98421499999999995], ["TRFFTYB128F4261C3F", 0.079894800000000002], ["TRLCPOE12903CC5F68", 0.069109400000000001], ["TRBHGCY128EF351662", 0.066183400000000003], ["TRZPEDZ12903CF9F87", 0.057088], ["TRPEPEX12903CE0ABD", 0.057088], ["TRSLLTT128F426BF51", 0.057088], ["TRWVZGR12903C9F7CB", 0.051757400000000002], ["TRAHZUK128F424BF7E", 0.051757400000000002], ["TRRBUNV12903CD556B", 0.048161000000000002], ["TRAUMGR12903CB30A6", 0.048161000000000002], ["TRQLZPI128F42997EA", 0.047729800000000003], ["TRIHFXE128F4259810", 0.047729800000000003], ["TRBLUQT128F9306130", 0.047665100000000002], ["TRPYWIJ128F1459856", 0.047665100000000002], ["TRVPXXD12903CDC671", 0.047282999999999999], ["TROVFDI128F935307E", 0.047282999999999999], ["TRXFZSP128F933D3BC", 0.047282999999999999], ["TREKHEF128E0783E49", 0.046917800000000003], ["TRVHABY12903CA4B86", 0.046917800000000003], ["TRVATRE128F4273953", 0.042953499999999999], ["TROFDVN12903CDC5DF", 0.042794400000000003], ["TRFTKCH12903CCF902", 0.042788], ["TRYTFRF12903D028A2", 0.042788], ["TRSWKNA128F9309B44", 0.042125200000000002], ["TRPGARH128F93398C7", 0.041631099999999997], ["TRUJTKU128F92D475A", 0.041631099999999997], ["TRKEGQT128F4232586", 0.041631099999999997], ["TRBXJSD12903CBB21F", 0.0414905], ["TRASZMU12903CE9B46", 0.0414905], ["TRKPUPZ128F1496288", 0.041262899999999998], ["TRCCCPY128F92E7BFF", 0.041252799999999999], ["TRVZOXV128F932030B", 0.040835499999999997], ["TRFTQAR128F149336C", 0.039683400000000001], ["TREKIBI128F1498C0B", 0.0395924], ["TRQYMRP128F93042EB", 0.038256699999999998], ["TRVQOJB128F4232589", 0.038256699999999998], ["TROUUFX12903CC9CB2", 0.038256699999999998], ["TRQDJGE128E078A563", 0.0379776], ["TRQGRVA12903CEC3A9", 0.037801099999999997], ["TRIOXGH128F92C6B73", 0.037801099999999997], ["TRNROTK12903CE82A6", 0.037801099999999997], ["TRNNJTD12903CCFF0A", 0.037801099999999997], ["TRVKVKY128F9342880", 0.037801099999999997], ["TRKZVNV128F932845B", 0.036719700000000001], ["TRKLZYI128F428458A", 0.036633199999999998], ["TRHCHQJ128F930ADFB", 0.036522499999999999], ["TRCWYJA128F92F27D6", 0.036393300000000003], ["TRTFSRU128F9318EFA", 0.036393300000000003], ["TRVPJLE12903CD5310", 0.034950799999999997], ["TRYAGRH128F145710B", 0.034853299999999997], ["TRWMTNF128F9324C09", 0.034039100000000003], ["TRJICAV128F932030A", 0.034039100000000003], ["TRUAHNP128F92F4778", 0.0336809], ["TRCIAKN128F9351680", 0.033345199999999998], ["TRVMKOT128F933E652", 0.032249699999999999], ["TRBEZNQ128F42ACA85", 0.032040800000000001], ["TRWMSHI128F42ACA86", 0.031469900000000002], ["TRIPUHG128F1499BD4", 0.031321799999999997], ["TRUUNHP128F424DF2D", 0.031321799999999997], ["TRVZCDQ128F92F2A04", 0.031172399999999999], ["TRABHPA12903CEC222", 0.030436899999999999], ["TRENJUJ128F9310C51", 0.030436899999999999], ["TRSDMJQ12903CB5470", 0.030436899999999999], ["TRVTWQH128F92E65F8", 0.030436899999999999], ["TRHPAED128F424DF11", 0.029588699999999999], ["TRHUXNX128F931AA8D", 0.029588699999999999], ["TRCWHLN128F1498453", 0.029588699999999999], ["TRCAMFG128F146E24B", 0.029588699999999999], ["TRMZVXL128F92F5816", 0.028621500000000001], ["TRQWKSE12903CE6D37", 0.028621500000000001], ["TRICOGJ12903CBCE36", 0.028621500000000001], ["TRLBGAA12903D13D8A", 0.0278278], ["TRFXVBM128F93042D6", 0.0255547], ["TRXXURW128F4291C1D", 0.0255547], ["TRLTXMJ128F932BEDA", 0.0245756], ["TRUHXLM12903CE91A4", 0.023996900000000002], ["TREZLHQ12903CD6628", 0.022329100000000001], ["TREIVRO128F4270BD8", 0.022101300000000001], ["TRFNRTE12903CE6D40", 0.021894899999999998], ["TRCVITE128F4266EE5", 0.0216002], ["TRJLAIN128F93120DB", 0.0216002], ["TRRWVZW128F4214003", 0.0213116], ["TRBIDLE12903CB7F92", 0.0213116], ["TRDCQTA128F4213FEE", 0.0213116], ["TRYFIPR128F4213FF7", 0.0213116], ["TRRDURF128F93330A2", 0.021191600000000001], ["TROIHZU12903CDCA9A", 0.0211697], ["TRZRPUG128F42AAE44", 0.021085], ["TRFCRNI128F1498609", 0.020999799999999999], ["TRLWESX128F934A08D", 0.020999799999999999], ["TRUNPMI128F9333098", 0.020279599999999998], ["TROASXG128F932E1CE", 0.020076699999999999], ["TRRIJKC128E0792F61", 0.019415000000000002], ["TRVXEZD128F145D65F", 0.0191332], ["TRBTUOW128F145AFD8", 0.0183392], ["TRUPJUD128F4230C0A", 0.018261199999999998], ["TRQQTKT128F426E347", 0.0180278], ["TRISZKM12903CCCC15", 0.0180278], ["TRYSOUD128F92E1756", 0.0180278], ["TRXKQTU12903CE453C", 0.0010297800000000001], ["TRUNWTA128F427AB6C", 0.0010290799999999999], ["TRITYIV128F149EABC", 0.00099176199999999998], ["TRYEXFG12903CE21A7", 0.00088046399999999996], ["TRBDTIH128C7196C2C", 0.00084887500000000002], ["TRUUBWH128F93114A6", 0.00083589600000000003], ["TRJLXSC128F145B129", 0.00083519400000000004], ["TRUGOGF128F4289D9F", 0.000831962], ["TRXUHDD128F4289D9A", 0.000831962], ["TROOYTA128F4289D99", 0.00083188499999999998], ["TRDXHAF128F1497075", 0.00083187300000000001], ["TRBCDDZ128F93062FA", 0.00083181699999999999], ["TRIMCVK128F421EDBB", 0.00083181599999999998], ["TRVCRXL128F92C57B6", 0.00083179900000000004], ["TRHTKOF128F92C57B1", 0.00083179599999999999], ["TRIZVPS128F9304D3F", 0.00083179100000000002], ["TRRAPAB128F422D793", 0.00083178699999999996], ["TRUVSSD128F421805B", 0.00083178699999999996], ["TRBFMOC128F4253BEE", 0.00083178400000000002], ["TRMXSUU128F4253BED", 0.00083178400000000002], ["TROVYRS128F9342044", 0.00083177800000000003], ["TRYIWOT128F4218E7A", 0.00083175700000000003], ["TRUWNXO128F4218E86", 0.00083175700000000003], ["TRSNFBW128EF355783", 0.00083173399999999999], ["TRMBHXL128F92FCC4F", 0.00082559099999999998], ["TRXBGSG128F1468865", 0.00082173200000000004], ["TRKZEDM128F14537F8", 0.00081695400000000005], ["TRXUYII128EF34073F", 0.00081610099999999996], ["TRRWTCZ128F4266199", 0.00081530600000000002], ["TRRTPBS12903CDA8BB", 0.00081375299999999996], ["TRVRVHX128F14582AB", 0.00081375299999999996], ["TRXFBTX128F424CD0C", 0.00081086999999999999], ["TRSENVO128F42B95C9", 0.00080986899999999995], ["TRDOYDO12903CE4191", 0.00080920099999999995], ["TRDADBO128C7196C2E", 0.00080639000000000004]], "tags": [["jazz", "100"], ["cool jazz", "28"], ["chet baker", "27"], ["trumpet", "23"], ["piano", "10"], ["vocal jazz", "7"], ["jazz vocal", "7"], ["sweet", "5"], ["male vocalists", "4"], ["sophistopop", "4"], ["jazz vocal male", "2"], ["chet", "2"], ["sweet track", "2"], ["oldies", "2"], ["relax", "2"], ["cool", "2"], ["jazz radio", "1"], ["smooth n groovy", "1"], ["that jazz", "1"], ["mal merken", "1"], ["out of our heads", "1"], ["pulsar00", "1"], ["j4zz13", "1"], ["francesa", "1"], ["teh luv", "1"], ["blues", "1"], ["update", "1"], ["chet bake", "1"], ["murakami soundtrack", "1"], ["favorite vocalists", "1"], ["real jazz", "1"], ["starbucks", "1"], ["After Midnight", "1"], ["Adamo", "1"], ["swing", "1"], ["Thankyou", "1"], ["chet singer", "1"], ["Jazz after midnight", "1"], ["2010 sunday lunch", "1"], ["cassidoodle", "1"], ["Chet Baker - But Not For Me", "1"], ["low jazz", "1"], ["EBxJazz", "1"], ["exiljazz", "1"], ["fra-la-la", "1"], ["Chet baker-But not for me", "1"], ["noches de verano", "1"], ["CHET BAKER PLAYS COOL JAZZ LOVE SONGS", "1"], ["Swazz", "1"], ["old sentimental", "1"], ["taggen", "1"], ["hazz", "1"], ["But Not For Me", "1"], ["jazz 1953", "1"], ["waldi", "1"], ["chez Nata-san", "1"], ["v0k4l j4zz", "1"], ["burlesque", "1"], ["4 Star", "1"], ["chanson francaise", "1"], ["smoothjazz", "1"], ["Remakes", "1"], ["male vocalist", "1"], ["dance dance dance", "1"], ["freedom", "1"], ["instrumental", "1"], ["modern jazz", "1"], ["50s", "1"], ["jazz piano", "1"], ["gorgeous", "1"], ["vocal", "1"], ["Ballad", "1"], ["nu jazz", "1"], ["heartbroken", "1"], ["romantic", "1"], ["france", "1"], ["favorite songs", "1"], ["chill", "1"], ["jazzy", "1"], ["60s", "1"], ["i love jazz 4", "1"], ["play it again", "1"], ["todo", "1"], ["jazz trumpet", "1"], ["My Jazz", "1"], ["I love Jazz", "1"], ["Jazzz", "1"], ["general jazz", "1"], ["VK", "1"], ["me myself and i", "1"], ["my theme song", "1"], ["west coast", "1"], ["Sommer", "1"], ["jazz classic", "1"], ["flaneur", "1"], ["Hot stuff", "1"], ["saxophone player", "0"], ["american jazz", "0"], ["1052 after midnight", "0"], ["Tomatito", "0"]], "track_id": "TRHCKVL128F92FC04E", "title": "But Not for Me"}
{"article_id": "M.1579518744.A.C15", "article_title": "Re: [問卦] 中國當局要怎麼控制這次的肺炎疫情", "author": "Vett (Vett)", "board": "Gossiping", "content": ": : 不然真的無解 : : 中國當局會如何控制這次的疫情? : : 直接封城嗎? : : https://i.imgur.com/Gn0MlsK.jpg : WHO認證傳染最快的地方不是大陸 : http://www.epochtimes.com/b5/3/5/20/n315595.htm : WHO:台灣SARS傳染速度最快 : 再者啦 會傳染也躲不掉 就治療啊 還能怎樣? : 這種病毒性肺炎你也沒啥招 就分析分析看看是啥組成 看能不能懟出特效藥 : 至於想看熱鬧的 : 我來教你怎麼看吧 : 如果大陸宣傳系統把吹得最神的院士鍾南山搬出來的話就是事情大條了 : 沒搬出來的就是沒事兒 昨天說了試劑盒發下後今天大陸各省就會有病例了 沒錯吧 不過今天我看到了更大條的 https://i.imgur.com/HpZRdEy.png 哎呀 我這破嘴 今天就把鍾南山搬出來了 建議蔡英文要準備好全面測量大陸港澳入境人士的體溫了 要出大事了..... ", "date": "Mon Jan 20 19:12:20 2020", "ip": "91.121.50.14", "message_count": {"all": 9, "boo": 0, "count": 4, "neutral": 5, "push": 4}, "messages": [{"push_content": "中國..", "push_ipdatetime": "223.137.49.237 01/20 19:13", "push_tag": "推", "push_userid": "biaw"}, {"push_content": "不懂,這幾個人很厲害ㄇ", "push_ipdatetime": "223.137.129.252 01/20 19:14", "push_tag": "→", "push_userid": "james732"}, {"push_content": "他哪位?", "push_ipdatetime": "36.239.37.88 01/20 19:15", "push_tag": "→", "push_userid": "jeff52"}, {"push_content": "求說明?", "push_ipdatetime": "110.50.155.49 01/20 19:16", "push_tag": "→", "push_userid": "zorkers"}, {"push_content": "增加勞改營洗腦沒病", "push_ipdatetime": "27.242.222.99 01/20 19:17", "push_tag": "→", "push_userid": "BlacKlonely"}, {"push_content": "當年SARS他好像是中國最主要的相關權威", "push_ipdatetime": "42.73.103.133 01/20 19:18", "push_tag": "推", "push_userid": "kyo06"}, {"push_content": "把人送進古墓", "push_ipdatetime": "1.170.175.35 01/20 19:18", "push_tag": "推", "push_userid": "warbreaker"}, {"push_content": "需要徵召他出動代表嚴重性可能不下當年?", "push_ipdatetime": "42.73.103.133 01/20 19:18", "push_tag": "→", "push_userid": "kyo06"}, {"push_content": "你消息很准!", "push_ipdatetime": "180.217.146.196 01/20 19:39", "push_tag": "推", "push_userid": "xiemark"}], "url": "https://www.ptt.cc/bbs/Gossiping/M.1579518744.A.C15.html"}
{ "first_traded_price": 1670.0, "highest_price": 1670.0, "isin": "IRO1SGOS0001", "last_traded_price": 1622.0, "lowest_price": 1622.0, "trade_volume": 135763.0, "unix_time": 1548028800 }
{ "first_traded_price": 5754.0, "highest_price": 5754.0, "isin": "IRO1SEIL0001", "last_traded_price": 5754.0, "lowest_price": 5754.0, "trade_volume": 345.0, "unix_time": 1432944000 }
{"success":true,"result":{"Q_10101015369971-4":{"resources":[],"questions":[{"id":"Q_10101015369971-4","subjectId":101,"knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100108470158","tagId":0,"main":1,"featureIds":[]},{"id":"KP_10100107612715","tagId":0,"main":1,"featureIds":[]},{"id":"KP_10100096584762","tagId":0,"main":1,"featureIds":[]},{"id":"KP_10100096589088","tagId":0,"main":1,"featureIds":[]}],"testMethods":[{"id":"TM_10100000672366","main":1}],"solutionMethods":[],"resourceIds":null,"resourceIndex":0,"listenUrl":null,"listenName":null,"listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"paperIds":null,"books":null,"booksNew":null,"contentTypeId":1010008,"contentType2Id":0,"difficultyInt":5,"description":"读下面的文段,完成练习","notFitMobile":0,"seconds":159,"complex":1,"nid":null,"lastEditorId":null,"finalAuditorId":"569456c02ed9b674eb5de530","roughAuditorIds":null,"content":{"content":"<p style=\"text-indent: 2em; text-align: justify;\"><span style=\"text-indent: 2em;\">结束这堂课时,我给孩子们提了个(意见、建议):“为了给父母一份(特殊、特别)的惊喜,你们最好用一种不被父母察觉的方式了解他们的生日,而祝贺的方式可以是多种多样的,但记住一点,</span><span style=\"text-indent: 2em; text-decoration: underline;\">只要你表达了自己的爱,(在、再)稚拙的礼物他们也会觉得珍贵无比的。” </span></p>","contentDesc":"","analysis":"","subContents":[{"content":"<p>按顺序从文中括号里选择正确的字词填写</p><p>(1)__$$__</p><p>(2)__$$__</p><p>(3)__$$__</p>","answers":[{"answer":"建议","subAnswers":["建议"],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100076426312","tagId":0,"main":1,"featureIds":[]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null},{"answer":"特别","subAnswers":["特别"],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100076154435","tagId":0,"main":1,"featureIds":[]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null},{"answer":"再","subAnswers":["再"],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100047852461","tagId":0,"main":1,"featureIds":["KPF_10100000004118"]},{"id":"KP_10100048114299","tagId":0,"main":0,"featureIds":["KPF_10100000004118"]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":4,"analysis":"","optionType":"word","options":[],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101006,101005],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他","其他"]},{"content":"<p>“察觉”在文中的意思是_____</p>","answers":[{"answer":"0","subAnswers":[],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":1,"analysis":"","optionType":"sentence","options":[{"option":"发觉,看出来。","file":{"fileId":"","url":"","filename":"","seconds":0}},{"option":"检查,察看。","file":{"fileId":"","url":"","filename":"","seconds":0}}],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101007],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他"]},{"content":"<p>“稚拙”在文中的意思是_____</p>","answers":[{"answer":"1","subAnswers":[],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100078305180","tagId":0,"main":1,"featureIds":[]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":1,"analysis":"","optionType":"sentence","options":[{"option":"幼稚的,缓慢的样子。","file":{"fileId":"","url":"","filename":"","seconds":0}},{"option":"幼稚而拙劣。","file":{"fileId":"","url":"","filename":"","seconds":0}}],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101006],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他"]},{"content":"<p>对文中画线句子正确的理解是_____</p>","answers":[{"answer":"1","subAnswers":[],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":1,"analysis":"","optionType":"sentence","options":[{"option":"孩子们送的礼物不会有多么贵重或精美,因此,父母不会在意。","file":{"fileId":"","url":"","filename":"","seconds":0}},{"option":"对爸爸妈妈来说,重要的并不是孩子们能为他们做多么了不起的事,而是能够感受到孩子们的关心和爱。","file":{"fileId":"","url":"","filename":"","seconds":0}}],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101011],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他"]}]},"docId":"Q_10101015369971","version":4,"wordId":null,"pictureUrl":null,"tagId":null,"createdAt":1462321708940,"deletedAt":null,"olCreatedAt":1515301534316,"olUpdatedAt":1515301534316,"sentenceIds":null,"sentenceContents":null,"practiceTypeIds":null,"categoryId":0,"fromId":0,"paragraph":null,"articleName":null,"descriptionFile":{"fileId":"","url":"","filename":"","seconds":0},"analysisSeconds":0,"readySeconds":0,"wikiType":null,"others":{"writing_style":"AC_20300000283078"},"skillIds":null,"weighted":null,"additions":null,"answers":[["建议","特别","再"],["0"],["1"],["1"]],"tags":[101006,101005,101007,101011]}]}}}{"success":true,"result":{"Q_10101015369971-4":{"resources":[],"questions":[{"id":"Q_10101015369971-4","subjectId":101,"knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100108470158","tagId":0,"main":1,"featureIds":[]},{"id":"KP_10100107612715","tagId":0,"main":1,"featureIds":[]},{"id":"KP_10100096584762","tagId":0,"main":1,"featureIds":[]},{"id":"KP_10100096589088","tagId":0,"main":1,"featureIds":[]}],"testMethods":[{"id":"TM_10100000672366","main":1}],"solutionMethods":[],"resourceIds":null,"resourceIndex":0,"listenUrl":null,"listenName":null,"listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"paperIds":null,"books":null,"booksNew":null,"contentTypeId":1010008,"contentType2Id":0,"difficultyInt":5,"description":"读下面的文段,完成练习","notFitMobile":0,"seconds":159,"complex":1,"nid":null,"lastEditorId":null,"finalAuditorId":"569456c02ed9b674eb5de530","roughAuditorIds":null,"content":{"content":"<p style=\"text-indent: 2em; text-align: justify;\"><span style=\"text-indent: 2em;\">结束这堂课时,我给孩子们提了个(意见、建议):“为了给父母一份(特殊、特别)的惊喜,你们最好用一种不被父母察觉的方式了解他们的生日,而祝贺的方式可以是多种多样的,但记住一点,</span><span style=\"text-indent: 2em; text-decoration: underline;\">只要你表达了自己的爱,(在、再)稚拙的礼物他们也会觉得珍贵无比的。” </span></p>","contentDesc":"","analysis":"","subContents":[{"content":"<p>按顺序从文中括号里选择正确的字词填写</p><p>(1)__$$__</p><p>(2)__$$__</p><p>(3)__$$__</p>","answers":[{"answer":"建议","subAnswers":["建议"],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100076426312","tagId":0,"main":1,"featureIds":[]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null},{"answer":"特别","subAnswers":["特别"],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100076154435","tagId":0,"main":1,"featureIds":[]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null},{"answer":"再","subAnswers":["再"],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100047852461","tagId":0,"main":1,"featureIds":["KPF_10100000004118"]},{"id":"KP_10100048114299","tagId":0,"main":0,"featureIds":["KPF_10100000004118"]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":4,"analysis":"","optionType":"word","options":[],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101006,101005],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他","其他"]},{"content":"<p>“察觉”在文中的意思是_____</p>","answers":[{"answer":"0","subAnswers":[],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":1,"analysis":"","optionType":"sentence","options":[{"option":"发觉,看出来。","file":{"fileId":"","url":"","filename":"","seconds":0}},{"option":"检查,察看。","file":{"fileId":"","url":"","filename":"","seconds":0}}],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101007],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他"]},{"content":"<p>“稚拙”在文中的意思是_____</p>","answers":[{"answer":"1","subAnswers":[],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[{"id":"KP_10100078305180","tagId":0,"main":1,"featureIds":[]}],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":1,"analysis":"","optionType":"sentence","options":[{"option":"幼稚的,缓慢的样子。","file":{"fileId":"","url":"","filename":"","seconds":0}},{"option":"幼稚而拙劣。","file":{"fileId":"","url":"","filename":"","seconds":0}}],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101006],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他"]},{"content":"<p>对文中画线句子正确的理解是_____</p>","answers":[{"answer":"1","subAnswers":[],"richTexts":null,"scorePercentage":1,"classification":"","knowledgePoints":null,"knowledgePointsNew":[],"testMethods":[],"solutionMethods":[],"classificationListenUrl":null}],"subContentTypeId":1,"analysis":"","optionType":"sentence","options":[{"option":"孩子们送的礼物不会有多么贵重或精美,因此,父母不会在意。","file":{"fileId":"","url":"","filename":"","seconds":0}},{"option":"对爸爸妈妈来说,重要的并不是孩子们能为他们做多么了不起的事,而是能够感受到孩子们的关心和爱。","file":{"fileId":"","url":"","filename":"","seconds":0}}],"hideOptionNumber":0,"listenUrl":"","listenName":"","listenSeconds":0,"exploreSeconds":0,"answersSeconds":0,"oralDict":{"seconds":null,"variables":null,"keywords":null,"options":null,"voiceText":null,"sentencePatterns":null,"picUrl":null,"picName":null,"beginListenUrl":null,"endListenUrl":null,"scorePercentage":null,"readySeconds":null,"listenFile":null,"contentDesc":null,"answers":null,"voiceTextsNew":null,"jsgf":null,"videoUrl":null,"videoCoverUrl":null,"highlightPos":null},"submitWays":[0],"tags":[101011],"analysisList":null,"pictureUrl":"","extras":{},"tagsDesc":["其他"]}]},"docId":"Q_10101015369971","version":4,"wordId":null,"pictureUrl":null,"tagId":null,"createdAt":1462321708940,"deletedAt":null,"olCreatedAt":1515301534316,"olUpdatedAt":1515301534316,"sentenceIds":null,"sentenceContents":null,"practiceTypeIds":null,"categoryId":0,"fromId":0,"paragraph":null,"articleName":null,"descriptionFile":{"fileId":"","url":"","filename":"","seconds":0},"analysisSeconds":0,"readySeconds":0,"wikiType":null,"others":{"writing_style":"AC_20300000283078"},"skillIds":null,"weighted":null,"additions":null,"answers":[["建议","特别","再"],["0"],["1"],["1"]],"tags":[101006,101005,101007,101011]}]}}}
[{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.497288","street":{"id":952016,"name":"On or near Niagara Avenue"},"longitude":"-0.314319"},"context":"","outcome_status":null,"persistent_id":"","id":52653504,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.499551","street":{"id":951958,"name":"On or near Creighton Road"},"longitude":"-0.307247"},"context":"","outcome_status":null,"persistent_id":"","id":52653436,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.503557","street":{"id":951829,"name":"On or near Chamberlain Road"},"longitude":"-0.323827"},"context":"","outcome_status":null,"persistent_id":"","id":52654194,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.501522","street":{"id":923560,"name":"On or near Parking Area"},"longitude":"-0.306699"},"context":"","outcome_status":null,"persistent_id":"","id":52653425,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.497466","street":{"id":952034,"name":"On or near South Road"},"longitude":"-0.304198"},"context":"","outcome_status":null,"persistent_id":"","id":52653396,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.498015","street":{"id":951908,"name":"On or near North Road"},"longitude":"-0.304250"},"context":"","outcome_status":null,"persistent_id":"","id":52653399,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.498981","street":{"id":951949,"name":"On or near Northfield Avenue"},"longitude":"-0.314501"},"context":"","outcome_status":null,"persistent_id":"","id":52653498,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.493875","street":{"id":950854,"name":"On or near Windmill Road"},"longitude":"-0.313998"},"context":"","outcome_status":null,"persistent_id":"","id":52653474,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.495344","street":{"id":952024,"name":"On or near Ealing Park Gardens"},"longitude":"-0.311668"},"context":"","outcome_status":null,"persistent_id":"","id":52653471,"location_subtype":"","month":"2016-10"},{"category":"anti-social-behaviour","location_type":"Force","location":{"latitude":"51.495057","street":{"id":952020,"name":"On or near Junction Road"},"longitude":"-0.308610"},"context":"","outcome_status":null,"persistent_id":"","id":52653445,"location_subtype":"","month":"2016-10"},{"category":"bicycle-theft","location_type":"Force","location":{"latitude":"51.497277","street":{"id":952026,"name":"On or near Chandos Avenue"},"longitude":"-0.307908"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"69076e3902714dc219971f13b3127e544fe9aa9ffbb902447888495d71acf224","id":52702087,"location_subtype":"","month":"2016-10"},{"category":"bicycle-theft","location_type":"Force","location":{"latitude":"51.496002","street":{"id":951897,"name":"On or near Boston Manor Road"},"longitude":"-0.324940"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"a142d53d685398df9a71f42d90f25bc653756084c7bab2ed5ad0ddc46e0cc119","id":52744960,"location_subtype":"","month":"2016-10"},{"category":"bicycle-theft","location_type":"Force","location":{"latitude":"51.495466","street":{"id":952032,"name":"On or near Carlyle Road"},"longitude":"-0.305814"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"4ce5849bd273b94ecf641c002b4f72924a985352c25aa9c9439a8d73da562fd7","id":52772650,"location_subtype":"","month":"2016-10"},{"category":"bicycle-theft","location_type":"Force","location":{"latitude":"51.498535","street":{"id":951943,"name":"On or near Wellington Road"},"longitude":"-0.312256"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-11"},"persistent_id":"fc588d9a3bdbfdc9ee34b102db76ab38344e9e8849c93a864495878e90f3b9dc","id":52702041,"location_subtype":"","month":"2016-10"},{"category":"bicycle-theft","location_type":"Force","location":{"latitude":"51.501522","street":{"id":923560,"name":"On or near Parking Area"},"longitude":"-0.306699"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"14240d82b2010dbea27ee51eb1b89fb80c4f74a4e4efb34287b5d91363b4dc56","id":52745911,"location_subtype":"","month":"2016-10"},{"category":"burglary","location_type":"Force","location":{"latitude":"51.502998","street":{"id":951811,"name":"On or near Northcroft Road"},"longitude":"-0.320577"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"9409125b7830366bc2da95ac60c86620f8624c53af8a55df7a4767ea4d8a8346","id":52755798,"location_subtype":"","month":"2016-10"},{"category":"burglary","location_type":"Force","location":{"latitude":"51.500137","street":{"id":951957,"name":"On or near Derwent Road"},"longitude":"-0.314170"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-12"},"persistent_id":"460c06134ba211b5816af0c499fcddc508989ced473956d2f11ffeaf1877b708","id":52771651,"location_subtype":"","month":"2016-10"},{"category":"burglary","location_type":"Force","location":{"latitude":"51.495400","street":{"id":952033,"name":"On or near Sterling Place"},"longitude":"-0.300040"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"81935544405814eb8ba58e94a5e370a685a848f9e477d54135d2c278c08e91d4","id":52743886,"location_subtype":"","month":"2016-10"},{"category":"burglary","location_type":"Force","location":{"latitude":"51.495400","street":{"id":952033,"name":"On or near Sterling Place"},"longitude":"-0.300040"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"1d1c88eed78a91352d669352bd73d8ca1c5d6e155ee796cc27e19f0301d7a0c2","id":52716284,"location_subtype":"","month":"2016-10"},{"category":"burglary","location_type":"Force","location":{"latitude":"51.501157","street":{"id":923906,"name":"On or near Cantley Road"},"longitude":"-0.328296"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"1ad01f1abf18e5e606474362b3dec150eae7df49eccd8a6dc04cb1c0d0a2208e","id":52756003,"location_subtype":"","month":"2016-10"},{"category":"criminal-damage-arson","location_type":"BTP","location":{"latitude":"51.499400","street":{"id":1488731,"name":"Northfields (lu Station)"},"longitude":"-0.314137"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"","id":66310034,"location_subtype":"LU STATION","month":"2016-10"},{"category":"criminal-damage-arson","location_type":"Force","location":{"latitude":"51.493688","street":{"id":950870,"name":"On or near Darwin Road"},"longitude":"-0.309092"},"context":"","outcome_status":{"category":"Offender sent to prison","date":"2016-10"},"persistent_id":"ac1f99d124e3d095f9c7d911e6008cfcad20098dbea2910c4c7eb3c315b97152","id":52765866,"location_subtype":"","month":"2016-10"},{"category":"criminal-damage-arson","location_type":"Force","location":{"latitude":"51.501853","street":{"id":951790,"name":"On or near Erlesmere Gardens"},"longitude":"-0.325388"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"cf66aff47dc6e1ab74af5b5aa34408f5d949df996d60534eb3a543a1f7396d6b","id":52713600,"location_subtype":"","month":"2016-10"},{"category":"criminal-damage-arson","location_type":"Force","location":{"latitude":"51.502710","street":{"id":951852,"name":"On or near Whitehall Road"},"longitude":"-0.328109"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"85c6d42fa78ed77d0e0ba7b3a79e9e47c0642c5b84fc73d4c74b77f007bfeb4a","id":52763450,"location_subtype":"","month":"2016-10"},{"category":"criminal-damage-arson","location_type":"Force","location":{"latitude":"51.498994","street":{"id":951967,"name":"On or near South Ealing Road"},"longitude":"-0.306043"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"0b0462e708d8442ae0f056bf6d2da21040e054de6df282cae7864cb5c6f4e16d","id":52685367,"location_subtype":"","month":"2016-10"},{"category":"criminal-damage-arson","location_type":"Force","location":{"latitude":"51.499709","street":{"id":951950,"name":"On or near Northfield Avenue"},"longitude":"-0.315108"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"0d09db088fee741c3e9414b8bbb776829e88f7b9598e5b7b71b8c44f25e5aec6","id":52742926,"location_subtype":"","month":"2016-10"},{"category":"drugs","location_type":"Force","location":{"latitude":"51.498210","street":{"id":951947,"name":"On or near Redwood Grove"},"longitude":"-0.315884"},"context":"","outcome_status":{"category":"Offender given a caution","date":"2016-10"},"persistent_id":"34e3cb0cc870341c3c57ace171820d2badd534407622c055c9c42c85540e86cf","id":52734003,"location_subtype":"","month":"2016-10"},{"category":"drugs","location_type":"Force","location":{"latitude":"51.497853","street":{"id":952027,"name":"On or near Blondin Avenue"},"longitude":"-0.314845"},"context":"","outcome_status":{"category":"Local resolution","date":"2016-11"},"persistent_id":"011ccdfa6b06e0cdee838b249d729ad293a18cab93519baff51653a8320d9178","id":52683896,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.496651","street":{"id":952019,"name":"On or near Lawrence Road"},"longitude":"-0.307542"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"612a3866600185a0a5bb604ccce3a7afbc8e8112000dc1f0734dfe1a4173241e","id":52738222,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.496002","street":{"id":951897,"name":"On or near Boston Manor Road"},"longitude":"-0.324940"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"013bd95acbfb7cbc9ef4c0db92ca7bdf5bd85ffa3b530c7af9e8dc4ca9a3a8f7","id":52702022,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.495466","street":{"id":952032,"name":"On or near Carlyle Road"},"longitude":"-0.305814"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-11"},"persistent_id":"5f9ec89ce6d842d87929a4b89d3ef6f9ec5cfd4e8a082f3f42c0b3659bfed875","id":52705081,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.501150","street":{"id":951797,"name":"On or near Altenburg Avenue"},"longitude":"-0.318988"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"ac3cacbda6c4ebe24c73050af611df77c2382dc03b08f76ea936ef6764a0895c","id":52733462,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.501150","street":{"id":951797,"name":"On or near Altenburg Avenue"},"longitude":"-0.318988"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-12"},"persistent_id":"32b522525c0be6d1aed7a8b76d8bdb029ed308cf96ee83caec58ca738a8b297a","id":52731786,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.501768","street":{"id":951946,"name":"On or near South Ealing Road"},"longitude":"-0.306920"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-11"},"persistent_id":"c030230df943d25c73e6d1bfb1401100be0db21fe216e2da35b6bb5e135c7c5c","id":52766748,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.501150","street":{"id":951797,"name":"On or near Altenburg Avenue"},"longitude":"-0.318988"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"432298b18b018cfcd808d9d84c8510abc6c503507a47b3fa7d69cc96bf821032","id":52764880,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.501522","street":{"id":923560,"name":"On or near Parking Area"},"longitude":"-0.306699"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-01"},"persistent_id":"23d0e58f182cd961e0b679929ce65d60b46d6e71f9333fde7dfe7f079e1e1409","id":52717823,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.497466","street":{"id":952034,"name":"On or near South Road"},"longitude":"-0.304198"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-11"},"persistent_id":"e7b72e45b16f1777b87f827764e9ed20709376fb332021289a39f6157d80b438","id":52690325,"location_subtype":"","month":"2016-10"},{"category":"other-theft","location_type":"Force","location":{"latitude":"51.497766","street":{"id":952018,"name":"On or near Little Ealing Lane"},"longitude":"-0.309374"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"4407ac3e57803368837183509cabd711c23dd499ff73691a4008f0b2bd1c59af","id":52771031,"location_subtype":"","month":"2016-10"},{"category":"public-order","location_type":"Force","location":{"latitude":"51.500284","street":{"id":951842,"name":"On or near Westlea Road"},"longitude":"-0.329466"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-03"},"persistent_id":"b60e32efc78e048afd354e81261a73ae7df9599a499dbd6e5051417860787232","id":52737423,"location_subtype":"","month":"2016-10"},{"category":"public-order","location_type":"Force","location":{"latitude":"51.497277","street":{"id":952026,"name":"On or near Chandos Avenue"},"longitude":"-0.307908"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"e9b61daa3d6b5719737fb5f3e02d1aa3b20d0098b874d09041ee94b45014e640","id":52772891,"location_subtype":"","month":"2016-10"},{"category":"public-order","location_type":"Force","location":{"latitude":"51.498204","street":{"id":951891,"name":"On or near Boston Road"},"longitude":"-0.326790"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-11"},"persistent_id":"87c97e4ae006cd6476de8ec71ab77bade8141ac8bb21d9cb82a555d273fb5f1d","id":52777780,"location_subtype":"","month":"2016-10"},{"category":"public-order","location_type":"Force","location":{"latitude":"51.499709","street":{"id":951950,"name":"On or near Northfield Avenue"},"longitude":"-0.315108"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"5a96307b57d3506bd29c5d055e1b410431599b39c6eedd2e608e265b1e58767d","id":52755850,"location_subtype":"","month":"2016-10"},{"category":"public-order","location_type":"Force","location":{"latitude":"51.499709","street":{"id":951950,"name":"On or near Northfield Avenue"},"longitude":"-0.315108"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-12"},"persistent_id":"acc559cb7f22f4037f45d1183fc6f0b19e1d124cf1d3a3d6d6c1e429e2ab5a13","id":52747147,"location_subtype":"","month":"2016-10"},{"category":"shoplifting","location_type":"Force","location":{"latitude":"51.499709","street":{"id":951950,"name":"On or near Northfield Avenue"},"longitude":"-0.315108"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-12"},"persistent_id":"c01e8f6a6fc6f90cc506f692c1dfcbe7123ea6915ae3a000b236963fccdfb05b","id":52723602,"location_subtype":"","month":"2016-10"},{"category":"shoplifting","location_type":"Force","location":{"latitude":"51.499709","street":{"id":951950,"name":"On or near Northfield Avenue"},"longitude":"-0.315108"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"acc559cb7f22f4037f45d1183fc6f0b19e1d124cf1d3a3d6d6c1e429e2ab5a13","id":52746198,"location_subtype":"","month":"2016-10"},{"category":"theft-from-the-person","location_type":"BTP","location":{"latitude":"51.499400","street":{"id":1488731,"name":"Northfields (lu Station)"},"longitude":"-0.314137"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"","id":66310036,"location_subtype":"LU STATION","month":"2016-10"},{"category":"theft-from-the-person","location_type":"Force","location":{"latitude":"51.498981","street":{"id":951949,"name":"On or near Northfield Avenue"},"longitude":"-0.314501"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"6e6fbc975f82f976ce5bcf414be896ff3f94347e3d7f5abc9e3a6f6b0c8abf27","id":52717659,"location_subtype":"","month":"2016-10"},{"category":"theft-from-the-person","location_type":"BTP","location":{"latitude":"51.499400","street":{"id":1488731,"name":"Northfields (lu Station)"},"longitude":"-0.314137"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"","id":66310035,"location_subtype":"LU STATION","month":"2016-10"},{"category":"theft-from-the-person","location_type":"BTP","location":{"latitude":"51.499400","street":{"id":1488731,"name":"Northfields (lu Station)"},"longitude":"-0.314137"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"","id":66310037,"location_subtype":"LU STATION","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.498036","street":{"id":952021,"name":"On or near Julien Road"},"longitude":"-0.311899"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"b7274e8934c1347cf23ab3a75d6befb92f085fbb90b8b7a040cad9901f82a481","id":52751588,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.494495","street":{"id":950851,"name":"On or near Windmill Road"},"longitude":"-0.313903"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"490313b1b7ddd3e26af660763f993e63c297dc0eee9dbbef4fe79e678b261e26","id":52763929,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.493688","street":{"id":950870,"name":"On or near Darwin Road"},"longitude":"-0.309092"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"ac03bcfd64d1d90857132dfb019c0e6b638891f7bf424183ac028989fb4a88b7","id":52765535,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.498204","street":{"id":951891,"name":"On or near Boston Road"},"longitude":"-0.326790"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"ea8f0f13c3108d6f857d957e6b885b9625d00fcf03a51fadd5de795ec66be9de","id":52711806,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.500284","street":{"id":951842,"name":"On or near Westlea Road"},"longitude":"-0.329466"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"3e1a89ec3115874ce73d810d4fdf5a5275e0067ab627142c014a8d23c0d4ad7f","id":52694699,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.494455","street":{"id":950908,"name":"On or near Sterling Place"},"longitude":"-0.301213"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"58d05bfcc4356beb3bcf9b7ae4651e6346215b61d5804ea801a6e2e3c667b8e7","id":52741027,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.501853","street":{"id":951790,"name":"On or near Erlesmere Gardens"},"longitude":"-0.325388"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"1f27141ca22c6d0b4a703856562e94dcf31ec764cb3ccfbe1e39fbdf6748eee2","id":52760803,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.493875","street":{"id":950854,"name":"On or near Windmill Road"},"longitude":"-0.313998"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"cf66eb9176e160219b60286b74d5963d706442b88e65a867379fe6a32d782b7d","id":52737169,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.495057","street":{"id":952020,"name":"On or near Junction Road"},"longitude":"-0.308610"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-12"},"persistent_id":"fac59200673ca91853fab9f029f2f7ce1b1ac461b736fbde04bc260ef0341dce","id":52776198,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.497112","street":{"id":951894,"name":"On or near Cawdor Crescent"},"longitude":"-0.324021"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"b9c34354636d69675d02639826519b9f759cc85b926c1560ceaab029382323c7","id":52751298,"location_subtype":"","month":"2016-10"},{"category":"vehicle-crime","location_type":"Force","location":{"latitude":"51.495057","street":{"id":952020,"name":"On or near Junction Road"},"longitude":"-0.308610"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"a2e46e94b018480fded74d380d9752dab010905bfe4a188d0888acea30dd012e","id":52750743,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.494352","street":{"id":950872,"name":"On or near Carlyle Road"},"longitude":"-0.309630"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-04"},"persistent_id":"bf39f4cd06dc442de1dac94a8d61599d98187114cca1f7180feddcce2f1a8bfa","id":52775250,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.499491","street":{"id":951787,"name":"On or near Jefferson Close"},"longitude":"-0.318070"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"59570427819c9b640facfa9e16c0fa853acc433f89b8c43d4ed6514a63cde39e","id":52726894,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.496651","street":{"id":952019,"name":"On or near Lawrence Road"},"longitude":"-0.307542"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-04"},"persistent_id":"a0eca39a7ece090a041ee63e233725afd24c1519b21b03583de1055d5a48f5f0","id":52690957,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.499709","street":{"id":951950,"name":"On or near Northfield Avenue"},"longitude":"-0.315108"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-12"},"persistent_id":"f1bea3aac97f6be3cf70d2698a73556e46882921e82df5edd917cf57faee0589","id":52776364,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"BTP","location":{"latitude":"51.499400","street":{"id":1488731,"name":"Northfields (lu Station)"},"longitude":"-0.314137"},"context":"","outcome_status":{"category":"Status update unavailable","date":"2017-02"},"persistent_id":"","id":66310033,"location_subtype":"LU STATION","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.494455","street":{"id":950908,"name":"On or near Sterling Place"},"longitude":"-0.301213"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-11"},"persistent_id":"25143ad896816b16e0d2712147a889614a8860f321ccc29dd447c3751d40b168","id":52756245,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.496651","street":{"id":952019,"name":"On or near Lawrence Road"},"longitude":"-0.307542"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-04"},"persistent_id":"bb8bf8f8e3aae316269c62d61cfc6b66666332929f8657d750e930152d6c65bd","id":52684422,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.503014","street":{"id":951805,"name":"On or near Salisbury Road"},"longitude":"-0.322320"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"5d45e2e98c0947ce600d44ebbac2e84fcbf5b8f162a9727a1aa599d013465a57","id":52681416,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.500879","street":{"id":951956,"name":"On or near Devonshire Road"},"longitude":"-0.313278"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-02"},"persistent_id":"d5df645df6974b4cdd69d2ab46a6836dbede36c667bd3428d7be1fba5d4f6d19","id":52720961,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.498105","street":{"id":951895,"name":"On or near Burnham Way"},"longitude":"-0.321146"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-05"},"persistent_id":"394fb19a69fad405d34f8f3d3310dfc874f1321efb78ad746a6f89e0955c881c","id":52718402,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.500879","street":{"id":951956,"name":"On or near Devonshire Road"},"longitude":"-0.313278"},"context":"","outcome_status":{"category":"Court case unable to proceed","date":"2016-11"},"persistent_id":"589706eb39932ed18ba1113979d5e198cdb540b3bb59b1eb72a6133247638927","id":52754922,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.493688","street":{"id":950870,"name":"On or near Darwin Road"},"longitude":"-0.309092"},"context":"","outcome_status":{"category":"Offender sent to prison","date":"2016-10"},"persistent_id":"ce97ad5f23272cec0df4fe22a4ec56503fce12a1afd3b5e1f5c582805096ea9b","id":52763201,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.500879","street":{"id":951956,"name":"On or near Devonshire Road"},"longitude":"-0.313278"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2017-04"},"persistent_id":"7d40b120eaa9d141fe5d27325a010741eb4966fcc5b5eaef202152a9ad4b90bc","id":52741687,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.494455","street":{"id":950908,"name":"On or near Sterling Place"},"longitude":"-0.301213"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-11"},"persistent_id":"4b3be7872898cc11bb007ebc72c355a35018e40cef300da8c5366a551061a0e4","id":52752121,"location_subtype":"","month":"2016-10"},{"category":"violent-crime","location_type":"Force","location":{"latitude":"51.498105","street":{"id":951895,"name":"On or near Burnham Way"},"longitude":"-0.321146"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2018-02"},"persistent_id":"19c932ab9a71926a270d1e07a99a7840ec57b99ee8494dc2807b0437d7560459","id":52695057,"location_subtype":"","month":"2016-10"},{"category":"other-crime","location_type":"Force","location":{"latitude":"51.494352","street":{"id":950872,"name":"On or near Carlyle Road"},"longitude":"-0.309630"},"context":"","outcome_status":{"category":"Offender given suspended prison sentence","date":"2018-02"},"persistent_id":"66e13271b8c76283594bb90703d07b0aed914db440c2092ee5b503dd203dcd5d","id":52743558,"location_subtype":"","month":"2016-10"},{"category":"other-crime","location_type":"Force","location":{"latitude":"51.499920","street":{"id":951846,"name":"On or near Cardiff Road"},"longitude":"-0.327303"},"context":"","outcome_status":{"category":"Investigation complete; no suspect identified","date":"2016-10"},"persistent_id":"793cb16ca9db89c4c5c54278d379ee3e934a7cc8c8f7f8a90c8e94805381d861","id":52740663,"location_subtype":"","month":"2016-10"}]
[ "http://2.bp.blogspot.com/-BxWy1tCoXPM/Wqtl6N159nI/AAAAAAAAE2g/atdJ8HunmcIsxBbXclkpgXLGBnTJinVGwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p079%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-nv8gIfphoHI/Wqtl62KuGpI/AAAAAAAAE2k/Vimb1bc4S4Ib_HKEI9X30QV8gpQQWu7KgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p080%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-VOq9HpcfJbU/Wqtl7fLKUPI/AAAAAAAAE2o/EDUXsHpSYZgGuJSng-My7g59220KXeiXgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p081%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-LL_rg_LosX8/Wqtl71cEl8I/AAAAAAAAE2s/h-kLh_xMzswHSzGk-zQB4t78VskqvroVwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p082%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-6XBzyz5JmYI/Wqtl8TlBbDI/AAAAAAAAE2w/7EwPAYGJ4SMuiL6NAkMJyEhPNOqWaU8mwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p083%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-xdbRCi7N97I/Wqtl8_6-8YI/AAAAAAAAE20/dHNNQ_lVBkksbaYlUZpvlrcsXjlfpfMFACHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p084%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-Jh-BUfA_D24/Wqtl9vPU0bI/AAAAAAAAE24/tmJ_mMwhja0wEuboH58rWnsFbJVaXMOVQCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p085%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-u8ZhwwVOjMk/Wqtl-Diog7I/AAAAAAAAE28/pXAsnPxb87k77r6D-mPzDMJmNIBfzkQ4QCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p086%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-TNbTdYbxsSo/Wqtl-XlAAFI/AAAAAAAAE3A/DsX5shFm5-0UvxLQVwXbxxcjVTXt47d8QCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p087%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-DMC_vO1TyO8/Wqtl-z-368I/AAAAAAAAE3E/tYvDbh65V-AzkrehVIwrGLlweaZIbykjACHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p088%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-qjQ6H2gFEYE/Wqtl_VH17-I/AAAAAAAAE3I/k0zvV45Tk70L61jWrO0JsQiPaD1o-FqQgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p089%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-tdsXxf376Y4/Wqtl_8QdHwI/AAAAAAAAE3M/-rCRyfs7t8oD2cp36ynSduN71GAhE-M7wCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p090%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-G5xxJhCNQJE/WqtmARcDwUI/AAAAAAAAE3Q/yaX7U-faCK47dM5l3PqEj1ubprZUBixcQCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p091%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-LN-TsGKB4Iw/WqtmA8PEQgI/AAAAAAAAE3U/Qzkx2WmAvx4mHSobbojlPf6s_JqUAf2NgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p092%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-3pZWoOY8dm8/WqtmBqadXpI/AAAAAAAAE3Y/4_Yro_wNIcQxm-aMuT4YWGysmqaKKIONACHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p093%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-0q65Lv_yK7c/WqtmCA7cKEI/AAAAAAAAE3c/x7ERauFJWdEs1hFmRWhCwcZFc09zOuVOgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p094%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-9CGp0M2J1SI/WqtmCRLpArI/AAAAAAAAE3g/rq9SZJklSQQYlmM2CGBGx8CG5t3IYUSLgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p095%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/--ssVcI9LC-U/WqtmDPFQi3I/AAAAAAAAE3k/tJPVQ3QfVC0Fvwsy3_f7QU_pC3Ma1HrBQCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p096%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-XKu0jEHi168/WqtmDl2ghHI/AAAAAAAAE3o/a-LGxSpyUXQD7jEE3S7JZeNWNT4WoyLQwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p097%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-UgoS7hSIIHQ/WqtmERXpJvI/AAAAAAAAE3s/H027NAaHn5QgpCDKMyoyB2OaeEjKIoRHwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p098%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-I95NLrsn5qQ/WqtmEzQLzPI/AAAAAAAAE3w/Nr-32tA47Z8o0tVXKVvF_CYUrZ-Vzw6CgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p099%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-ig8fs36ZDNI/WqtmFQEiwrI/AAAAAAAAE30/xkV43GzELVs2ZTOnmY1rWo5oZmmrjYOPgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p100%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-pCVuQugrM0Q/WqtmF0HmmPI/AAAAAAAAE34/EETssDYVQxEviS_CMeMlF9qgPaZ73Mu8ACHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p101%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-P9XdtZgvZ6w/WqtmGroKBAI/AAAAAAAAE38/99B-B8wEqs46KY5CuBE9FA3WUEerLHthgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p102%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-JDXiCG3lwfA/WqtmHF7yZqI/AAAAAAAAE4A/LjuyQ0Bcn3MC0VbJHK9OwMYbt4Xj_l61wCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p103%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-y2ArDv85pxs/WqtmHkDVxRI/AAAAAAAAE4E/6l9hGrk7eMoINgEsacjpwV8GUOqQLDBDwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p104%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-5gbPaJAvrHw/WqtmIDvlTdI/AAAAAAAAE4I/oDNWP1YH0IcUQp3F5kgxzJBfgd46gveWwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p105%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-Ud_NKnE2OsA/WqtmI04oztI/AAAAAAAAE4M/yV3rtf9C1cMRJurZIx38OB19hTaNLMxoACHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p106%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-da1tbWWnS3Y/WqtmJeSwGVI/AAAAAAAAE4Q/1oknIinc9AMKMO4a9lUlv8kEDJJyX2TPwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p107%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-xN120CWgVK4/WqtmJyifskI/AAAAAAAAE4U/imW4HPnXvI407OEffIJC6HdqDQqHTh6MgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p108%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-Ug0fwF3Yc_Y/WqtmKoaHNEI/AAAAAAAAE4Y/l18SgL8-LOIFhw8Z5x39xVVJL-kvYtZ0gCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p109%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-m_x5pa7Q8Mw/WqtmLBG9MbI/AAAAAAAAE4c/FnvjtuHkTwIcSQSE67HYlfDgnm_C_notgCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p110%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-WfbNr46gGUc/WqtmLnZr6RI/AAAAAAAAE4g/1CwocliJ-4ghDJiK_I7a7jpwFPvz_5DKQCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p111%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-ahVNpwLKFtI/WqtmMO8U7wI/AAAAAAAAE4k/1blUbv0EnxAeEq5c4BjFgZIZvWCUYoLTACHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p112%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-22qHJzO-ge0/WqtmM3Ks1FI/AAAAAAAAE4o/Uz9XWWQrw9wtwbJ__Q3UtBGM0zlE6X9QwCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p113%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-Tc8-NOnBpUk/WqtmNa3paII/AAAAAAAAE4s/j9HeEbFsHnMi-115JuXR4n9rcDDs6-eRQCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p114%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-KqV6ZKAv4tc/WqtmNkns65I/AAAAAAAAE4w/svuFGQ_UNaYlDA-NgznUkJeDurnC7IhUQCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p115%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg", "http://2.bp.blogspot.com/-hryYenRgnF0/WqtmOMYYdCI/AAAAAAAAE40/LRaeUWl6TYItGGauHKIlSWz3zuuACn7KQCHMYCw/s0/Aoba-kun's%20Confessions%20-%20c023%20(v06)%20-%20p116%20%5BDigital-HD%5D%20%5Bdanke-Empire%5D.jpg" ]
[{"ingredients": ["480g / 17oz de remolacha mixta como Candy, Bull's Blood y Golden, lavadas, hojas reservadas (ver abajo)", "2 cucharadas de aceite de oliva virgen extra", "2 cucharaditas de vinagre bals\u00e1mico envejecido", "30g / 1\u00bd oz chalote, pelado, finamente cortado", "4 pizca de sal marina", "2 pizcas de pimienta negra reci\u00e9n molida", "100g / 3\u00bd oz de crema", "1 cucharadita de r\u00e1bano picante fresco finamente rallado", "2 cucharadas de eneldo fresco picado", "2 pizcas de sal marina", "120g / 4\u00bdoz de salm\u00f3n ahumado en caliente, como bradon rost, carne toscamente copos", "2 cucharadas de eneldo fresco picado", "1 peque\u00f1o pu\u00f1ado de hojas de remolacha fresca u otras hojas de beb\u00e9"], "method": ["Para la ensalada de remolacha, traiga una olla grande de agua con una tapa herm\u00e9tica al hervor, coloque un inserto de vapor en la parte superior. Agregue la remolacha, cubra la sart\u00e9n y deje hervir durante 35-40 minutos o hasta que est\u00e9 tierna. (La remolacha se cuece cuando un cuchillo insertado en el centro no encuentra resistencia).", "Retire la remolacha y d\u00e9jela enfriar un poco antes de pelarla (es posible que desee usar guantes cuando pele la remolacha para evitar que las manos se manchen). Cortar la remolacha en trozos del tama\u00f1o de un bocado (aproximadamente 0,5 cm / \u00bd pulgada), luego colocar en un recipiente con aceite de oliva, vinagre bals\u00e1mico y chalota. Mezcle bien, luego condimente, al gusto, con sal y pimienta negra reci\u00e9n molida.", "Para la cr\u00e8me fra\u00eeche de r\u00e1bano picante, mezcle todos los ingredientes cr\u00e8me fra\u00eeche de r\u00e1bano picante juntos, pruebe y ajuste el aderezo, si es necesario.", "Para servir, divida la ensalada de remolacha entre 4 platos para servir, esparza el salm\u00f3n por encima y espolvoree un poco de eneldo picado. Arregle algunas hojas de remolacha frescas en el lado. Con una cuchara, mezcle la crema de r\u00e1bano picante en peque\u00f1os tazones y sirva al lado."], "url": "www_bbc_co_uk_food_recipes_brandonrostsmokedsal_93502", "title": "Salm\u00f3n ahumado caliente, ensalada de remolacha y cr\u00e8me fra\u00eeche con r\u00e1bano picante", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "30 minutos a 1 hora", "cookingMins": 60, "totalMins": 90}, "serves": "Para 4 personas", "image": "https://ichef.bbci.co.uk/food/ic/food_16x9_448/recipes/brandonrostsmokedsal_93502_16x9.jpg", "isVegetarian": false, "recommendations": 0}, {"ingredients": ["50g / 2oz de az\u00facar blanda y oscura", "50g / 2oz de sirope dorado", "50g / 2oz de mantequilla", "50g / 2oz de harina natural, m\u00e1s extra para quitar el polvo", "1 cucharadita de jengibre molido", "Crema doble de 300 ml / 10 fl oz, batida a picos firmes"], "method": ["Precaliente el horno a 180 \u00b0 C / 350 \u00b0 F / Gas 4 y alinee una bandeja para hornear con papel para hornear.", "Derrita el az\u00facar, el sirope dorado y la mantequilla en una cacerola. Cuando los gr\u00e1nulos de az\u00facar se hayan disuelto, retire la sart\u00e9n del fuego.", "Agregue la harina y el jengibre molido y mezcle bien para formar una pasta espesa.", "Coloque una pel\u00edcula adhesiva sobre una superficie de trabajo y termine la pasta. Haga rodar la mezcla en forma de bola, luego cubra la pel\u00edcula adhesiva y d\u00e9jela enfriar en la nevera hasta que frag\u00fce (aproximadamente 30 minutos).", "Retire la masa de brandy fr\u00eda del refrigerador y g\u00edrela en bolas del tama\u00f1o de una nuez con las manos; debe obtener al menos cuatro de esta mezcla.", "Polvore una superficie de trabajo con harina. Ruede cada bola de masa en un disco de aproximadamente 2 mm / 1/16 pulg. De grosor, luego coloque en la bandeja de hornear.", "Hornee el brandy en el horno durante 6-8 minutos, o hasta que est\u00e9 crujiente y dorado. Retire del horno y deje enfriar por aproximadamente un minuto.", "Con cuidado, levante cada brondy de la bandeja y gire el extremo de una cuchara de madera, dej\u00e1ndolo enfriar por un minuto antes de quitarlo. Si es posible, es mejor moldear las brochetas de brandy alrededor de varias cucharas al mismo tiempo mientras todav\u00eda est\u00e9n calientes.", "Para servir, coloque la crema en una bolsa de pl\u00e1stico con una boquilla en forma de estrella. Pipe la crema en las brochetas de brandy y apilar en un plato. Servir inmediatamente."], "url": "www_bbc_co_uk_food_recipes_brandy_snaps_17321", "title": "Brochetas hechas en casa", "time": {"preparation": "30 minutos a 1 hora", "preparationMins": 60, "cooking": "10 a 30 minutos", "cookingMins": 30, "totalMins": 90}, "serves": "Para 4 personas", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["300g / 10\u00bdoz de az\u00facar glas", "50g / 1\u00beoz de mantequilla", "Crema doble 25ml / 1fl oz", "Brandy 25ml / 1fl oz"], "method": ["Mida el az\u00facar glas en un taz\u00f3n, luego derrita la mantequilla por unos segundos en el microondas o en una sart\u00e9n peque\u00f1a a fuego lento, teniendo cuidado de no quemarla.", "Vierta la mantequilla derretida con la crema y el brandy en el az\u00facar y mezcle hasta que quede suave.", "\u00daselo para cubrir un pastel mientras est\u00e1 caliente, luego d\u00e9jelo reposar antes de cortar el pastel."], "url": "www_bbc_co_uk_food_recipes_brandy_butter_frosting_23164", "title": "Glaseado de mantequilla de brandy", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "no se requiere cocinar", "cookingMins": 0, "totalMins": 30}, "serves": "Hace suficiente para una torta redonda de 18cm / 7in", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["55 g / 2 oz de mantequilla", "Az\u00facar demerara 55 g / 2 oz", "Jarabe de oro de 55g / 2oz", "50g / 1\u00beoz de harina natural", "\u00bd cucharadita de jengibre molido", "\u00bd cucharadita de jugo de lim\u00f3n"], "method": ["Precalienta el horno a 180 \u00b0 C / 350 \u00b0 F / Gas 4. Pasa dos bandejas para hornear con pergamino para hornear, luego enjabona un mango grueso de una cuchara de madera y col\u00f3calo en una rejilla para enfriar.", "Mida la mantequilla, el az\u00facar y el jarabe en una sart\u00e9n peque\u00f1a de base pesada. La forma m\u00e1s f\u00e1cil es medir la mantequilla, luego el az\u00facar en la balanza (en la sart\u00e9n si tiene balanzas digitales), luego medir el jarabe en la parte superior para obtener hasta 165g / 6oz de peso total.", "Calienta suavemente hasta que la mantequilla se haya derretido y el az\u00facar se haya disuelto. Esto llevar\u00e1 unos 15 minutos a fuego lento. No deje que la mezcla hierva, ya que puede cristalizar. Para comprobar cu\u00e1ndo se ha disuelto el az\u00facar, revuelva ocasionalmente, tirando de la cuchara por el fondo de la sart\u00e9n hasta que ya no pueda o\u00edr los gr\u00e1nulos arenosos raspados y la mayor\u00eda de ellos hayan desaparecido.", "Deje que la mezcla se enfr\u00ede un poco, unos 2-3 minutos, luego tamice con la harina y el jengibre. Vierta el jugo de lim\u00f3n y mezcle bien para mezclar bien. Ponga cuatro cucharaditas de la mezcla en cada una de las bandejas preparadas para hacer c\u00edrculos limpios, a unos 10 cm de separaci\u00f3n.", "Hornee en el horno precalentado durante aproximadamente 10-15 minutos, o hasta que la mezcla est\u00e9 bien extendida, se ve de encaje y tiene un color dorado oscuro. Una vez horneado, debe trabajar r\u00e1pido para dar forma a las brock snaps, por lo que es m\u00e1s f\u00e1cil hornear una bandeja a la vez. Retire cada bandeja del horno y d\u00e9jela reposar durante un minuto aproximadamente, luego levante del pergamino para hornear con una rebanada de pescado. La mezcla debe ser lo suficientemente firme como para eliminarla, pero lo suficientemente flexible para darle forma. Revise soltando alrededor y debajo de los bordes con un peque\u00f1o cuchillo de paleta.", "Haga rodar r\u00e1pidamente un c\u00edrculo de la mezcla caliente alrededor del mango de la cuchara de madera, con la uni\u00f3n debajo. Presione ligeramente la junta para sellar, luego deslice el brandy de la cuchara y d\u00e9jela endurecer sobre la rejilla, una vez m\u00e1s con la uni\u00f3n debajo. Si alguno de los c\u00edrculos de la hoja se endurece demasiado para trabajar, vuelva a colocarlos en el horno durante unos segundos para que se suavicen nuevamente. Repita hasta que se haya usado toda la mezcla. Si la mezcla en la sart\u00e9n se vuelve demasiado firme para dejar caer cucharadas ordenadas, coloca una cucharadita de t\u00e9 en una peque\u00f1a bola lisa en tus manos, si\u00e9ntala en la bandeja de hornear y apl\u00e1stala ligeramente con los dedos. Cuando est\u00e9 fr\u00edo, guarde los brondy snaps en una lata herm\u00e9tica o en un recipiente; se mantendr\u00e1n durante al menos una semana."], "url": "www_bbc_co_uk_food_recipes_brandy_snaps_47363", "title": "Brandy Snaps", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "30 minutos a 1 hora", "cookingMins": 60, "totalMins": 90}, "serves": "Hace 16 brandy snaps", "image": "https://ichef.bbci.co.uk/food/ic/food_16x9_448/recipes/brandy_snaps_47363_16x9.jpg", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["70 g / 2\u00bd oz de mantequilla, m\u00e1s extra para engrasar", "70 g / 2\u00bd oz de az\u00facar en polvo", "3 cucharadas de jarabe de oro", "Harina normal de 70 g / 2\u00bd oz", "1 cucharadita de jengibre molido", "2 cucharaditas de brandy", "\u00bd lim\u00f3n, solo ralladura", "Crema doble de 300 ml / \u00bd pinta", "4 bolas de tallo de jengibre en alm\u00edbar, escurrido y finamente picado", "100g / 3\u00bdoz de chocolate negro liso de buena calidad, roto en cuadrados"], "method": ["Precaliente el horno a 180 \u00b0 C / 350 \u00b0 F / Gas 4. Coloque dos bandejas para hornear con papel antigrasa.", "Derrita la mantequilla con el az\u00facar y el jarabe, revolviendo a fuego lento hasta que el az\u00facar se disuelva. Retire la sart\u00e9n del fuego y agregue la harina, el jengibre, el brandy y la ralladura de lim\u00f3n.", "Coloque cuatro cucharadas soperas de la mezcla en una de las bandejas para hornear, dejando suficiente espacio para que la mezcla se extienda. Hornee en el centro del horno durante 10-12 minutos o hasta que est\u00e9 burbujeante y dorado. Mientras se cocinan los brandy, engrase dos cucharas de madera con mantequilla y envuelva una banda el\u00e1stica alrededor de ellas para unirlas. Coloque cuatro cucharadas m\u00e1s peque\u00f1as de la mezcla de brandy en la segunda bandeja para hornear.", "Saque los brandy del horno y coloque la segunda bandeja para hornear por la misma cantidad de tiempo. Deje que el brandy encaje en seco durante 30-60 segundos, luego levante cuidadosamente uno con una esp\u00e1tula y enrolle las cucharas, superponi\u00e9ndolas un poco. Sostenga por alrededor de 30 segundos hasta que la galleta se ponga en forma de tubo, luego deslice suavemente las cucharas y col\u00f3quelas en una rejilla para que se enfr\u00eden. Repite el m\u00e9todo con los brocks de brandy restantes. Si las galletas se vuelven demasiado dif\u00edciles de rodar en cualquier etapa, simplemente regrese al horno por unos segundos para suavizarlas. Contin\u00fae horneando y haciendo rodar las colaciones de brandy hasta que se use toda la mezcla.", "Para preparar el relleno, batir la crema hasta que se formen picos suaves. Agregue el jengibre picado y la cuchara en una bolsa grande con una boquilla simple. Pase la crema de jengibre por cada extremo de las brochetas de brandy y col\u00f3quelas bastante juntas sobre una rejilla colocada sobre una tabla.", "Derrita el chocolate en un recipiente resistente al calor sobre una fuente de agua hirviendo a fuego lento, teniendo cuidado de que el fondo del recipiente no toque el agua. Retire del fuego y, con una cuchara de postre, roc\u00ede chocolate derretido sobre los brondy broches. Coloque en el refrigerador por 15 minutos o hasta que el chocolate se ponga. Con cuidado, transfiera los brondy snaps a un plato de servir cuando est\u00e9 listo para servir."], "url": "www_bbc_co_uk_food_recipes_brandy_snaps_with_ginger_51104", "title": "Brandy se rompe con crema de jengibre y chocolate", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "30 minutos a 1 hora", "cookingMins": 60, "totalMins": 90}, "serves": "Sirve 12", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["50g / 2oz de az\u00facar en polvo de oro", "75g / 3oz de almendra molida", "Harina normal 150 g / 5oz, tamizada", "110 g / 4 oz de mantequilla, en cubitos", "1 huevo grande de gallinas camperas", "1 s\u00e9mola de cbs tbsp", "750 g / 1 libra de zarzamoras de 10 oz", "250 g / 9 oz de dulce de leche o caramelo enlatado", "Harina normal de 75g / 3oz, tamizada", "50 g / 2 oz de avena mediana", "75g / 3oz de az\u00facar granulada dorada", "75g / 3oz de mantequilla, cortada en cubitos", "450 g / 1 libra de zarzamoras / moras", "buena babosa de Drambuie", "az\u00facar al gusto"], "method": ["Haga los pasteles de la manera habitual: ya sea a mano o en un procesador de alimentos procesando el az\u00facar, las almendras, la harina y la mantequilla juntas, y luego agregue el huevo.", "Una vez amalgamado, combine en sus manos, envu\u00e9lvalo en film transparente y rel\u00e1jese bien. (La masa es suave). Luego, exti\u00e9ndala para que quepa en una lata de flan con fondo de 23 cm / 9 pulg. Con fondo de mantequilla. Pise la base y vuelva a enfriar, durante al menos 3 horas, preferiblemente durante la noche.", "Espolvorea la s\u00e9mola sobre la masa y luego esp\u00e1rzala sobre las zarzas. Caliente el dulce de leche o el caramelo y espolvoree las bayas.", "Haga la cobertura de crumble mezclando la harina, la avena y el az\u00facar y frote la mantequilla. Espolvorea sobre las bayas y presiona muy ligeramente. Hornee a 200C / 400F / Gas 6 por 15 minutos y luego reduzca a 180C / 350F / Gas 4 por 25 minutos hasta que est\u00e9n doradas. Deja hasta que apenas se caliente antes de decantar cuidadosamente a un plato.", "Cueza las zarzas en el Drambuie, agregando az\u00facar al gusto. Excreta muy brevemente, solo 3-5 minutos, por lo que las bayas a\u00fan est\u00e1n firmes. Sirva caliente, no caliente, con la tarta y un poco de crema espesa."], "url": "www_bbc_co_uk_food_recipes_brambleandbutterscot_67688", "title": "Tarta de crumble de zarzamora y caramelo", "time": {"preparation": "durante la noche", "preparationMins": 0, "cooking": "30 minutos a 1 hora", "cookingMins": 60, "totalMins": 60}, "serves": "Para 6", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["125g / 4oz de mantequilla sin sal ablandada", "125g / 4oz de az\u00facar glas\u00e9", "2 cucharadas de agua hirviendo", "3 cucharadas de brandy"], "method": ["Crema la mantequilla y el az\u00facar glas.", "Batir el agua hirviendo y el brandy hasta que quede suave.", "Enfr\u00ede hasta que sea necesario y s\u00edrvelo con pasteles de carne picada o budines de Navidad."], "url": "www_bbc_co_uk_food_recipes_brandybutter_2535", "title": "Mantequilla de brandy", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "no se requiere cocinar", "cookingMins": 0, "totalMins": 30}, "serves": "Para 6", "image": "https://ichef.bbci.co.uk/food/ic/food_16x9_448/recipes/brandybutter_2535_16x9.jpg", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["Mantequilla sin sal 110g / 4oz, ablandada", "85g / 3oz de az\u00facar mascabado ligero", "85g / 3oz de az\u00facar glas, tamizado", "3 cucharadas de brandy o co\u00f1ac"], "method": ["Pon la mantequilla en un taz\u00f3n. Batir bien con una cuchara de madera hasta que est\u00e9 suave o para usar r\u00e1pidamente un batidor de mano el\u00e9ctrico (y si usa un procesador de alimentos, entonces no es necesario tamizar el az\u00facar glas).", "Batir los az\u00facares hasta que est\u00e9n suaves, luego agregar el brandy. Si es demasiado generoso con el brandy, se cuajar\u00e1, as\u00ed que simplemente agregue m\u00e1s az\u00facar en polvo tamizado y volver\u00e1 a ser suave.", "Sirva con el pud\u00edn de Navidad o incluso como una descarada adici\u00f3n a un pastel de carne picada."], "url": "www_bbc_co_uk_food_recipes_brandybutter_65615", "title": "Mantequilla de brandy", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "no se requiere cocinar", "cookingMins": 0, "totalMins": 30}, "serves": "Hace aprox. 110 g / 4 oz", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["55 g / 2 oz de mantequilla", "Harina normal de 55g / 2oz", "570ml / 1 litro de leche", "4 cucharadas de aguardiente o ron oscuro", "Az\u00facar en polvo de 55 g / 2 oz"], "method": ["Derrita la mantequilla y agregue la harina. Cocine por 2 minutos y luego agregue la leche. Llevar a ebullici\u00f3n, revolviendo todo el tiempo, y cocine a fuego lento durante 10 minutos.", "Agregue el brandy (o ron) y el az\u00facar y sirva con pud\u00edn de Navidad."], "url": "www_bbc_co_uk_food_recipes_brandysauce_2534", "title": "Salsa de brandy (o ron)", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "10 a 30 minutos", "cookingMins": 30, "totalMins": 60}, "serves": "Para 6", "image": "https://ichef.bbci.co.uk/food/ic/food_16x9_448/recipes/brandysauce_2534_16x9.jpg", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["8 compraron cestas de brandy", "200g / 8oz de chocolate blanco continental", "Crema doble 200ml / 7floz", "200 m / 7 fl oz de crema fresca con mucha grasa", "Frambuesas o fresas frescas de 200g / 8oz y otras frutas suaves mezcladas"], "method": ["Derrita el chocolate blanco con la crema doble en un taz\u00f3n sobre agua caliente (no hirviendo) hasta que el chocolate se derrita (no permita que se caliente demasiado o se volver\u00e1 granulado y no se endurecer\u00e1 cuando est\u00e9 fr\u00edo).", "Dejar de lado para enfriar.", "Mezcle con la cr\u00e8me fra\u00eeche hasta que quede suave.", "Vierta en los estuches de brandy.", "Cubra con las frutas para servir."], "url": "www_bbc_co_uk_food_recipes_brandysnapbasketswit_70818", "title": "Cestas de broche con chocolate blanco", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "menos de 10 minutos", "cookingMins": 10, "totalMins": 40}, "serves": "Sirve 8", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["8 cestas de broche de brandy", "Crema doble 450ml / 16fl oz", "ralladura de 1 naranja", "2 cucharadas de licor de naranja, como Grand Marnier"], "method": ["Batir la crema doble, agregar la ralladura de naranja y Grand Marnier y la cuchara en las cestas."], "url": "www_bbc_co_uk_food_recipes_brandysnapbasketswit_70819", "title": "Cestas de broche con crema de naranja", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "no se requiere cocinar", "cookingMins": 0, "totalMins": 30}, "serves": "Sirve 8", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["100g / 4oz de mantequilla sin sal", "100 g / 4 oz de az\u00facar en polvo", "100g / 4 oz de jarabe de oro", "Harina de 100g / 4oz, tamizada", "\u00bd cucharadita de jengibre molido", "1 cucharada de jugo de lima", "una lima, solo c\u00e1scara", "Crema doble 250ml / 9fl oz", "pizca de chile en polvo", "2 frutas de la pasi\u00f3n, cortadas a la mitad y pulpa sacadas", "2 cucharadas de az\u00facar glas"], "method": ["Precalentar el horno a 180C / 350F / Gas 4.", "En una sart\u00e9n, derrita la mantequilla con el az\u00facar impalpable y el sirope dorado.", "Retire del fuego y doble suavemente la harina y el jengibre con el jugo de lim\u00f3n y la ralladura.", "Deje que se enfr\u00ede completamente.", "Coloque grandes cucharadas de la mezcla en una bandeja para hornear de base pesada. Aseg\u00farese de mantener la mezcla bien espaciada, ya que se extender\u00e1 durante la cocci\u00f3n.", "Cocine durante unos cinco minutos hasta que los brandy est\u00e9n dorados y lacy. Retire del horno y deje enfriar durante unos minutos en la bandeja, luego retire con cuidado con una esp\u00e1tula. Levante cada uno suavemente sobre una cuchara de madera, luego ruede alrededor del mango para formar un tubo.", "Dejar enfriar sobre una rejilla.", "Mientras tanto, bate la crema en un bol hasta que hayas logrado los picos suaves, luego agrega el chile en polvo, la pulpa de la fruta de la pasi\u00f3n y el az\u00facar glas.", "Coja en una manga pastelera y d\u00e9jela en la nevera hasta que est\u00e9 listo para servir.", "Para servir, vierta cada broche de presi\u00f3n con la crema de chile y maracuy\u00e1 y luego coloque tres en cada plato de servir.", "Servir inmediatamente."], "url": "www_bbc_co_uk_food_recipes_brandysnapswithchill_74819", "title": "Brandy se rompe con crema de chile y maracuy\u00e1", "time": {"preparation": "30 minutos a 1 hora", "preparationMins": 60, "cooking": "menos de 10 minutos", "cookingMins": 10, "totalMins": 70}, "serves": "Para 4 personas", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["300 ml / 10 fl oz de leche", "1 vaina de vainilla", "2 yemas de huevo de gallinas camperas", "Az\u00facar en polvo de 65 g / 2\u00bc oz", "40 g / 1\u00bd oz de harina de ma\u00edz", "1 cucharada de licor de naranja (como Grand Marnier), melocot\u00f3n dorado eau de vie gold kirsch", "algunas gotas de extracto de almendra", "50g / 1\u00beoz de harina natural", "1 cucharadita de polvo de hornear", "50 g / 1\u00beoz de almendras molidas", "pizca de sal", "4 huevos grandes de gallinas camperas", "75 g / 2\u00bd oz de az\u00facar en polvo", "algunas gotas de extracto de almendra", "1 cucharada de licor de naranja, como Grand Marnier u otro aguardiente", "2 cucharadas de az\u00facar en polvo, para quitar el polvo", "4 cucharadas de mermelada de cereza o albaricoque", "2 cucharadas de az\u00facar glas", "3 cucharadas de almendras en copos, ligeramente tostadas"], "method": ["Para la cr\u00e8me p\u00e2tissi\u00e8re, vierta la leche en una cacerola y agregue la vaina de vainilla. Llevar a ebullici\u00f3n, luego retirar del fuego y dejar en infusi\u00f3n hasta que vuelva a la temperatura ambiente.", "Coloque las yemas de huevo y el az\u00facar en un taz\u00f3n y bata hasta que est\u00e9n bien combinados y empiecen a ponerse p\u00e1lidos. Batir en la harina de ma\u00edz.", "Vuelva a calentar la leche, luego transfiera a una jarra, descartando la vaina de vainilla. Enjuaga la olla. Vierta la leche en la mezcla de huevo y az\u00facar desde una altura, batiendo constantemente, luego transfiera de vuelta a la cacerola.", "Revuelva a fuego bajo a medio hasta que espese. Transfiera a un taz\u00f3n y cubra con una pel\u00edcula adhesiva, asegur\u00e1ndose de que la pel\u00edcula adhesiva se asiente sobre la superficie de la crema pastelera para evitar que forme una capa. Cuando se haya enfriado, transfi\u00e9ralo a la nevera para enfriarlo.", "Precaliente el horno a 180 \u00b0 C / Fan 160 \u00b0 C / Gas 4. Cubra una lata de rollo suizo de 30x20 cm / 12x8 in con papel para hornear.", "Tamiza la harina com\u00fan y el polvo de hornear en un bol con las almendras molidas. A\u00f1ade una pizca de sal.", "Batir los huevos y el az\u00facar junto con un batidor de mano el\u00e9ctrico o en una batidora de pie hasta que la mezcla est\u00e9 p\u00e1lida con una textura aireada tipo mousse, tambi\u00e9n debe dejar un rastro de cinta. Agregue el extracto de almendra.", "Agregue la mezcla de harina y almendras y doblar muy suavemente pero a fondo con una cuchara de metal.", "Vierta la mezcla en la lata de rollo suizo preparada y unte con un cuchillo para el paladar para asegurarse de que est\u00e9 bien. Hornee durante unos 10-12 minutos, o hasta que est\u00e9n ligeramente dorados y el\u00e1sticos para tocar.", "Retire del horno y col\u00f3quelo en una rejilla para enfriar. Despegue el pergamino para hornear y deje enfriar.", "Para ensamblar, transfiera la esponja a una toalla de t\u00e9 ligeramente humedecida. Extienda la mermelada y luego cubra con la crema pastelera. Separe uniformemente con un cuchillo para el paladar, dejando un borde ancho (al menos de 5 cm) en la parte superior (de lo contrario, el relleno se derramar\u00e1) y uno m\u00e1s angosto (2 cm) en cada lado.", "Con cuidado, enrolle desde abajo, tirando del rollo hacia arriba y hacia arriba para tratar de detener el llenado, hasta que tenga una vuelta. No te preocupes si se agrieta un poco.", "Espolvorear con az\u00facar glas y las almendras tostadas. Servir."], "url": "www_bbc_co_uk_food_recipes_bras_de_gitan_63262", "title": "Bras de gitan", "time": {"preparation": "1-2 horas", "preparationMins": 120, "cooking": "10 a 30 minutos", "cookingMins": 30, "totalMins": 150}, "serves": "Hace alrededor de 8 rebanadas", "image": "https://ichef.bbci.co.uk/food/ic/food_16x9_448/recipes/bras_de_gitan_63262_16x9.jpg", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["3 naranjas", "300 ml / \u00bd litro de leche", "Crema doble de 300 ml / \u00bd pinta", "1 vaina de vainilla, dividida", "15 vainas de cardamomo verde, aplastadas con una mano de mortero", "90 g / 3\u00bd oz de mantequilla, suavizada", "15 rebanadas de pan blanco, preferiblemente ligeramente rancio", "8 huevos de gallinas camperas", "175g / 6oz de az\u00facar en polvo", "55 g / 2 oz de pistachos sin c\u00e1scara, picados", "85 g / 3\u00bc oz de sultanas doradas", "4 cucharadas de mermelada de naranja de Sevilla, tirada para quitar la c\u00e1scara", "az\u00facar en polvo", "crema fresca (opcional)"], "method": ["Retire la ralladura de las naranjas y coloque el resto de las naranjas a un lado. Vierta la leche y la crema en una sart\u00e9n, agregue la ralladura de naranja, la vaina de vainilla y los cardamomos triturados y deje que hierva. Apague el fuego y deje en infusi\u00f3n durante una hora.", "Precaliente el horno a 180 \u00b0 C / 350 \u00b0 F / Gas 4 y coloque una lata de asar grande dentro para calentar. La lata debe ser lo suficientemente grande como para contener una fuente para hornear de 30 x 22 x 5 cm / 12 x 9 x 2 pulgadas con espacio restante alrededor del borde.", "Unte con mantequilla el pan y c\u00f3rtelo en tri\u00e1ngulos. Segmenta las naranjas con un cuchillo afilado y descarta la c\u00e1scara. Retire la piel exterior transl\u00facida de cada segmento y des\u00e9chela. Corta cada segmento por la mitad. Batir los huevos y el az\u00facar juntos en un taz\u00f3n. Vierta la leche infundida a trav\u00e9s de un colador fino sobre la mezcla de huevo.", "Coloca una capa de pan, untada con mantequilla, en la fuente para hornear, luego agrega una capa de pedazos de pistacho, pasas y segmentos de naranja. Repita las capas, terminando con el pan y haciendo que la capa final se superponga perfectamente. Vierta la mezcla de leche y huevo en la parte superior. Poner un hervidor de agua a hervir.", "Coloque el plato en la lata de asar en el horno. Cuidadosamente vierta agua hirviendo en la lata de asar para que llegue a la mitad de los lados del plato, teniendo cuidado de no dejar que nada de agua entre en el pudin. Hornee durante 30-40 minutos, o hasta que est\u00e9n casi listos.", "Caliente la mermelada colada en una sart\u00e9n peque\u00f1a sobre fuego suave hasta que est\u00e9 l\u00edquida, y use para cepillar la parte superior del bud\u00edn de pan y mantequilla. Para servir, saque cada porci\u00f3n y espolvoree con az\u00facar glas, m\u00e1s una cucharada de crema fresca si lo desea."], "url": "www_bbc_co_uk_food_recipes_bread_and_butter_pudding_07166", "title": "Bud\u00edn de pan y mantequilla con naranja y cardamomo", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "1 a 2 horas", "cookingMins": 120, "totalMins": 150}, "serves": "Sirve 6-8", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["300 g / 10\u00bd oz de az\u00facar en polvo", "Crema doble 600ml / 20fl oz", "75 g / 2\u00bd oz pasas", "75g / 2\u00bdoz sultanas", "75 g / 2\u00bd oz de grosella", "75 g / 2\u00bd oz de c\u00e1scara mixta seca, picada", "150 g / 5\u00bd oz de mantequilla", "1 panecillo blanco suave pan de molde, en rodajas", "5 huevos de gallinas camperas", "50 g / 1 oz de az\u00facar en polvo", "300 ml / 10 fl oz de leche", "1 vaina de vainilla, dividida", "300 ml / 10 fl oz doble crema", "100ml / 3\u00bdfl oz de mermelada de albaricoque"], "method": ["Precalentar el horno a 160C / 140C Fan / Gas 3.", "Para hacer la crema de caramelo, caliente el az\u00facar en una sart\u00e9n, revolviendo cada cierto tiempo, hasta que tenga un caramelo oscuro. Vierta 300ml / 10fl oz de crema doble. Batir la crema doble restante hasta que se cae del batidor en cintas, y luego doblar en la mezcla de crema de caramelo. Tamizar en un recipiente limpio, cubrir y dejar reposar durante la noche.", "Para hacer el pudin de pan y mantequilla, esparza parte de la fruta seca en el fondo de una fuente para horno poco profunda. Derretir la mantequilla a fuego medio. Cepille generosamente las rebanadas de pan con la mantequilla derretida y coloque una capa encima de la fruta seca. Contin\u00faa con la capa as\u00ed hasta que la fruta y el pan se hayan agotado, terminando con una capa de pan.", "Mezcle los huevos y el az\u00facar en un taz\u00f3n grande y resistente al calor. Traiga la leche y la vainilla a fuego lento y vi\u00e9rtala sobre la mezcla de huevo. Vierta la crema y mezcle, luego cuele a trav\u00e9s de un colador fino, descartando la vaina de vainilla. Vierta la mezcla sobre el pan, empuj\u00e1ndolo hacia abajo para absorber todo el l\u00edquido.", "Hornee durante 40-50 minutos, hasta que se haya fraguado. Una vez que est\u00e9 fr\u00edo, caliente suavemente el atasco en una cacerola a fuego lento. Esmalte la parte superior del pud\u00edn con la mermelada de albaricoque caliente.", "Para servir, corta el pudin de pan y mantequilla en pociones. Transfiera a los tazones para servir y agregue una cucharada de crema de caramelo al costado."], "url": "www_bbc_co_uk_food_recipes_bread_and_butter_pudding_95777", "title": "Pud\u00edn de pan y mantequilla con crema de caramelo", "time": {"preparation": "durante la noche", "preparationMins": 0, "cooking": "1 a 2 horas", "cookingMins": 120, "totalMins": 120}, "serves": "Sirve 4-6", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["25g / 1oz de mantequilla, ablandada, m\u00e1s extra para engrasar", "2 rebanadas de pan blanco de un d\u00eda", "2 mitades de pera en lata, escurridas, picadas, m\u00e1s extra para servir", "4 cucharaditas de gotas de chocolate con leche", "1 huevo de gallinas camperas", "125ml / 4\u00bd fl oz de leche", "25 g / 1 oz de az\u00facar en polvo", "yogur natural, para servir"], "method": ["Precaliente el horno a 200C / 400F / Gas 6. Engrase un plato a prueba de horno de 400ml / 14fl con mantequilla. Coloque el plato engrasado en una bandeja para hornear.", "Unte con mantequilla un lado de cada pedazo de pan, luego corte cada pieza en cuatro tri\u00e1ngulos. Coloque una capa de cuatro tri\u00e1ngulos en el fondo del plato.", "Espolvorea m\u00e1s de la mitad de las gotas de pera y chocolate picadas.", "Repite el proceso con las gotas restantes de pan, pera y chocolate.", "Batir el huevo y el az\u00facar juntos hasta que est\u00e9n p\u00e1lidos y bien combinados, luego batir en la leche. Vierta la mezcla en el plato para cubrir las capas de pan y frutas. Presione cualquier pan no cubierto por la mezcla de huevo en el l\u00edquido para remojar, usando un tenedor.", "Hornee el pud\u00edn en el horno durante 25-30 minutos, o hasta que la crema se haya puesto y est\u00e9 dorada en la parte superior.", "Sirva con yogurt natural y piezas extra de pera, para adornar."], "url": "www_bbc_co_uk_food_recipes_bread_and_butter_60669", "title": "Pan y mantequilla sorpresa", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "10 a 30 minutos", "cookingMins": 30, "totalMins": 60}, "serves": "Porciones 2", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["75 g / 2\u00bd oz pasas", "100ml / 3\u00bdfl oz de t\u00e9 fr\u00edo", "3 manzanas o 3 peras o una mezcla de ambos", "exprimir jugo de lim\u00f3n", "400ml / 14fl oz de leche entera", "125g / 4\u00bd oz de mantequilla sin sal, m\u00e1s extra para engrasar", "3 huevos", "100 g / 3\u00bd oz de az\u00facar morena suave", "2 cucharaditas de canela", "1 cucharadita de nuez moscada, reci\u00e9n rallado", "1 cucharadita de extracto de vainilla", "\u00bd pan de molde grande, puede ser un poco rancio (o brioche)", "1 cucharada de cristales de az\u00facar moreno"], "method": ["Primero ponga las pasas en un taz\u00f3n peque\u00f1o, agregue el t\u00e9 fr\u00edo y d\u00e9jelo en remojo.", "Pele, base y corte las manzanas o las peras y mant\u00e9ngalas frescas en un taz\u00f3n de agua con un chorrito de jugo de lim\u00f3n.", "Engrase una fuente para horno y precaliente el horno a 180 \u00b0 C / 350 \u00b0 F / Gas 4.", "Suavemente caliente la leche en una cacerola, luego agregue la mantequilla y permita que se derrita. Coloque la leche y la mantequilla a un lado para enfriar a tibio.", "Coloque los huevos, el az\u00facar, la canela, la nuez moscada y la vainilla en un bol y bata con un batidor de mano el\u00e9ctrico hasta que est\u00e9n bien combinados. Batir en la leche mantecosa.", "Rompa el pan en trozos, manteniendo las cortezas encendidas o apagadas dependiendo de cu\u00e1n elegante sea, y p\u00f3ngalos en capas en la fuente para hornear engrasada. Cuele las pasas, descarte el t\u00e9, y esp\u00e1rcelas sobre el pan, luego cubra con la fruta rebanada. Vierta la mezcla y espolvoree cristales de az\u00facar moreno.", "Hornee en el horno precalentado durante aproximadamente 30 minutos hasta que el pud\u00edn se haya endurecido y tenga una costra dorada en la parte superior.", "Sirva con helado o natillas, o pruebe un poco de crema agria para variar."], "url": "www_bbc_co_uk_food_recipes_bread_pudding_zemlovka_35608", "title": "Pud\u00edn de pan (Zemlovka)", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "10 a 30 minutos", "cookingMins": 30, "totalMins": 60}, "serves": "Para 4 personas", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["Harina de pan fuerte 250 g / 9 oz, m\u00e1s extra para amasar", "7 g de levadura seca de acci\u00f3n r\u00e1pida", "1 cucharadita de sal", "2 cucharadas de aceite de oliva", "\u00bd zampone (trot\u00f3n de cerdo deshuesado y precocido), hervido durante 20 minutos y picado (disponible en algunas tiendas de delicatessen italianas)", "\u00bc col de col rizada, rebanada y blanqueada", "2 salchichas de hinojo, cocidas y en rodajas", "2 salchichas ahumadas, cocidas y en rodajas", "150g / 5\u00bd oz de patatas nuevas, cocidas y en rodajas", "100-150 g / 3\u00bd-5\u00bd oz crema de crema agria", "100-150 g / 3\u00bd-5\u00bd oz queso beaufort o queso reblochon"], "method": ["Para la masa de pan, coloque la harina en un taz\u00f3n grande y agregue la levadura y la sal y mezcle. Agregue lentamente 150-200 ml de agua hasta que se una como una masa. Amasar durante al menos 5 minutos hasta que tenga una masa suave. Coloque en un taz\u00f3n grande ligeramente enharinado, cubra y deje probar durante aproximadamente una hora o hasta que duplique su tama\u00f1o.", "Precalentar el horno a 200C / 180C Fan / Gas 6.", "Calentar una sart\u00e9n mediana y agregar el aceite, fre\u00edr el trot\u00f3n con la col durante 2-3 minutos.", "Elimine el aire de la masa y exti\u00e9ndalo formando un c\u00edrculo sobre una superficie enharinada.", "Coloque todos los ingredientes de relleno en la mitad del c\u00edrculo de masa enrollado, m\u00e9zclelos y luego doble la otra mitad para hacer un semic\u00edrculo. Engarce los bordes hasta que queden bien sellados y col\u00f3quelos en una bandeja para hornear forrada con papel de hornear.", "Hornee en el horno por 15-20 minutos o hasta que est\u00e9n doradas. Cuando toca la parte inferior, debe sonar hueco.", "Para servir, coloque el pan cocido en un plato para servir y desgarre."], "url": "www_bbc_co_uk_food_recipes_bread_stuffed_with_53425", "title": "Pan relleno de salchicha y zampone", "time": {"preparation": "1-2 horas", "preparationMins": 120, "cooking": "30 minutos a 1 hora", "cookingMins": 60, "totalMins": 180}, "serves": "Porciones 2", "image": "https://food.files.bbci.co.uk/kandl-food/1911/images/bbc_placeholder.png", "isVegetarian": false, "recommendations": 0}, {"ingredients": ["3 huevos de gallinas camperas", "3 cucharadas de az\u00facar en polvo", "2 tazas de leche y crema mezcladas juntas, mitad y mitad", "\u00bd cucharadita de extracto de vainilla", "1 pan blanco, croissants, brioche o panettone", "Mantequilla 50g / 20z", "grandes pasas, empapadas en Marsala", "crema doble o crema pastelera, para servir"], "method": ["Precalentar el horno a 180C / 350F / Gas 4.", "Mezcle los huevos, el az\u00facar, la leche y el extracto de vainilla en un taz\u00f3n grande.", "Corta el pan que prefieras, tueste y p\u00f3ngalo a la mantequilla y acom\u00f3delo en rodajas superpuestas en el fondo de un plato resistente al horno, dejando algunos bordes sobresalientes en la parte superior para que queden crujientes. Esparza las pasas remojadas sobre la parte superior y luego vierta la mezcla de huevo.", "Hornee durante 30 minutos en el horno precalentado y sirva caliente con crema o crema pastelera."], "url": "www_bbc_co_uk_food_recipes_breadandbutterpuddin_88983", "title": "Pudin de pan y mantequilla", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "30 minutos a 1 hora", "cookingMins": 60, "totalMins": 90}, "serves": "Sirve 8-10", "image": "https://ichef.bbci.co.uk/food/ic/food_16x9_448/recipes/breadandbutterpuddin_88983_16x9.jpg", "isVegetarian": true, "recommendations": 0}, {"ingredients": ["25g / 1oz de mantequilla, m\u00e1s extra para engrasar", "8 rebanadas finas de pan", "50g / 2oz sultanas", "2 cucharaditas de canela en polvo", "350ml / 12fl oz de leche entera", "Crema doble 50ml / 2fl oz", "2 huevos de gallinas camperas", "25g / 1 oz de az\u00facar granulada", "nuez moscada rallada, al gusto"], "method": ["Engrase un plato de 1 litro / 2 pinta de pastel con mantequilla.", "Corta las cortezas del pan. Extienda cada porci\u00f3n con un lado con mantequilla, luego c\u00f3rtela en tri\u00e1ngulos.", "Coloque una capa de pan con la mantequilla hacia arriba en el fondo del plato y luego agregue una capa de sultanas. Espolvorea con un poco de canela, luego repite las capas de pan y sultanas, espolvoreando con canela, hasta que hayas agotado todo el pan. Termine con una capa de pan, luego reserve.", "Suavemente caliente la leche y la crema en una sart\u00e9n a fuego lento hasta el punto de escaldar. No lo dejes hervir", "Agriete los huevos en un bol, agregue tres cuartos del az\u00facar y bata ligeramente hasta que est\u00e9n p\u00e1lidos.", "Agregue la mezcla caliente de leche y crema y revuelva bien, luego cuele la crema pastelera en un taz\u00f3n.", "Verter la crema sobre las capas de pan preparado y espolvorear con nuez moscada y el az\u00facar restante y dejar reposar durante 30 minutos.", "Precalentar el horno a 180C / 355F / Gas 4.", "Coloque el plato en el horno y hornee durante 30-40 minutos, o hasta que la crema se haya endurecido y la parte superior est\u00e9 dorada."], "url": "www_bbc_co_uk_food_recipes_breadandbutterpuddin_85936", "title": "Pudin de pan y mantequilla", "time": {"preparation": "menos de 30 minutos", "preparationMins": 30, "cooking": "30 minutos a 1 hora", "cookingMins": 60, "totalMins": 90}, "serves": "Para 4 personas", "image": "https://ichef.bbci.co.uk/food/ic/food_16x9_448/recipes/breadandbutterpuddin_85936_16x9.jpg", "isVegetarian": true, "recommendations": 0}]
{ "first_traded_price": 4754.0, "highest_price": 4797.0, "isin": "IRO1CHML0001", "last_traded_price": 4742.0, "lowest_price": 4740.0, "trade_volume": 525753.0, "unix_time": 1282435200 }
{ "ChQuility":{ "phpbb_intq":{ "ChForIpBan":"1", "ChForLimitWords":"1", "ChForLinkBan":"6", "ChForMoronBan":"6", "ChForYoutubeBan":"6", "ChForSameWord":"1", "ChForLimitCaps":"1", "ChForLimitLines":"1", "ChForSameLatter":"1", "ChForLimitSpecial":"1", "ChForLimitBlank":"1", "ChForBanCurl":"6" }, "phpbb_intm":{ "ChForCensorMin":"1" } } }
{ "first_traded_price": 33864.0, "highest_price": 33864.0, "isin": "IRO1NPRS0001", "last_traded_price": 33863.0, "lowest_price": 33863.0, "trade_volume": 34420.0, "unix_time": 1391558400 }
{"word": "see...off", "accent": "/si \u0251f/", "mean_cn": "phr. \u4e3a\u67d0\u4eba\u9001\u884c", "mean_en": "to go to a station, an airport, etc. to say goodbye to somebody who is starting a journey", "sentence": "His friends came to the airport to see him off.", "sentence_trans": "\u4ed6\u7684\u670b\u53cb\u4eec\u6765\u673a\u573a\u4e3a\u4ed6\u9001\u884c\u3002", "sentence_phrase": "", "word_etyma": "", "cloze_data": {}}
{"uuid": "f4c5d240-7a51-4f60-b070-66cbaa42ed6d", "children": ["9f7814b4-a30c-446e-93c3-ced2ee4a9257"], "befores": [{"name": "pyfixture", "status": "passed", "start": 1611040781545, "stop": 1611040781545}], "start": 1611040781545, "stop": 1611040781570}
{"author":"rosaseoane61","questions":[{"type":"quiz","question":"¿ Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Viola en ocho","correct":false},{"answer":"Organistrum","correct":true},{"answer":"Organillo","correct":false},{"answer":"Órgano ibérico","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/b9fe79bc-a777-462a-a27d-197760ed9f11","imageMetadata":{"id":"b9fe79bc-a777-462a-a27d-197760ed9f11","contentType":"image/jpeg","width":347,"height":145,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿ Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Laúd","correct":false},{"answer":"Fídula en ocho","correct":false},{"answer":"Fídula oval","correct":true},{"answer":"Rabel","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/266a1e88-dd9f-4536-8319-da52f66b5bcb","imageMetadata":{"id":"266a1e88-dd9f-4536-8319-da52f66b5bcb","contentType":"image/jpeg","width":281,"height":179,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Viola en ocho","correct":false},{"answer":"Guitarra","correct":false},{"answer":"Viola oval","correct":false},{"answer":"Laúd","correct":true}],"layout":"CLASSIC","image":"https://media.kahoot.it/699997e8-3025-4397-bd58-7f85f6ed4846","imageMetadata":{"id":"699997e8-3025-4397-bd58-7f85f6ed4846","contentType":"image/jpeg","width":344,"height":147,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Rabel","correct":true},{"answer":"Viola oval","correct":false},{"answer":"Viola en ocho","correct":false},{"answer":"Laúd","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/52ddda2b-abf7-4d46-a5ad-981f63fbe413","imageMetadata":{"id":"52ddda2b-abf7-4d46-a5ad-981f63fbe413","contentType":"image/jpeg","width":208,"height":243,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿ Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Rabel","correct":false},{"answer":"Fídula oval","correct":false},{"answer":"Viola oval","correct":false},{"answer":"viola en ocho","correct":true}],"layout":"CLASSIC","image":"https://media.kahoot.it/5951aac9-b5b2-41d9-897a-a38ecfb62a48","imageMetadata":{"id":"5951aac9-b5b2-41d9-897a-a38ecfb62a48","contentType":"image/jpeg","width":225,"height":225,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿ Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Fídula en ocho","correct":false},{"answer":"Rota","correct":true},{"answer":"Rabel","correct":false},{"answer":"Salterio","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/3b2f8a88-6ef2-464c-8793-831a26191572","imageMetadata":{"id":"3b2f8a88-6ef2-464c-8793-831a26191572","contentType":"image/jpeg","width":262,"height":192,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Son unas tejoletas","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":true},{"answer":"False","correct":false}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/edcda014-2c2a-465d-9770-9e59f28a8f3d","imageMetadata":{"id":"edcda014-2c2a-465d-9770-9e59f28a8f3d","contentType":"image/jpeg","width":259,"height":194,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Chirimía","correct":true},{"answer":"Oboe","correct":false},{"answer":"Clarinete","correct":false},{"answer":"Cuchufleta","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/0699787e-008b-4d15-bf38-0d76c4a2605e","imageMetadata":{"id":"0699787e-008b-4d15-bf38-0d76c4a2605e","contentType":"image/jpeg","width":224,"height":225,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Es un arpa gótica","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":false},{"answer":"False","correct":true}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/e5b9e48a-a4c8-4891-8718-cc61cd45502f","imageMetadata":{"id":"e5b9e48a-a4c8-4891-8718-cc61cd45502f","contentType":"image/jpeg","width":225,"height":225,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Es un arpa gótica","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":true},{"answer":"False","correct":false}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/46ed39b2-2b9b-471e-95eb-c3efe7b3b974","imageMetadata":{"id":"46ed39b2-2b9b-471e-95eb-c3efe7b3b974","contentType":"image/jpeg","width":170,"height":297,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Es el Pórtico del Paraíso ( Catedral de Orense)","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":true},{"answer":"False","correct":false}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/0ec3e059-223a-4328-804f-737ac74cb2b2","imageMetadata":{"id":"0ec3e059-223a-4328-804f-737ac74cb2b2","contentType":"image/jpeg","width":305,"height":165,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Es el pórtico de.......","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"El Paraíso ( Orense)","correct":false},{"answer":"De la Gloria ( Santiago de Compostela)","correct":true},{"answer":"De la Iglesia de Portomarín ( Lugo)","correct":false},{"answer":"del IES San Paio ( Tui)","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/1e52ed6e-67f5-4508-acd1-0427b2271492","imageMetadata":{"id":"1e52ed6e-67f5-4508-acd1-0427b2271492","contentType":"image/jpeg","width":300,"height":168,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Es un instrumento de percusión llamado....","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Redoma","correct":true},{"answer":"Sekere","correct":false},{"answer":"Saquito","correct":false},{"answer":"Bramadera","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/e420d210-3a5a-49fd-a7b5-f0fbcb99d73c","imageMetadata":{"id":"e420d210-3a5a-49fd-a7b5-f0fbcb99d73c","contentType":"image/jpeg","width":184,"height":274,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿Cómo se llama este instrumento de viento?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Salpinx","correct":false},{"answer":"Chirimía","correct":false},{"answer":"Tibia","correct":false},{"answer":"Añafil","correct":true}],"layout":"CLASSIC","image":"https://media.kahoot.it/016e9bbe-bda7-451e-ae70-0a6a8e21702c","imageMetadata":{"id":"016e9bbe-bda7-451e-ae70-0a6a8e21702c","contentType":"image/jpeg","width":194,"height":259,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Este instrumento de percusión se llama....","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"bongós","correct":false},{"answer":"Darbuka","correct":true},{"answer":"Yembé","correct":false},{"answer":"Conga","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/a362570c-4932-4df3-a62e-910bbfdc356e","imageMetadata":{"id":"a362570c-4932-4df3-a62e-910bbfdc356e","contentType":"image/jpeg","width":194,"height":259,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Es un salterio","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":true},{"answer":"False","correct":false}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/3ab97bc5-cd8d-4764-a426-aea8b50c61c6","imageMetadata":{"id":"3ab97bc5-cd8d-4764-a426-aea8b50c61c6","contentType":"image/jpeg","width":225,"height":225,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Arpa gótica","correct":false},{"answer":"Rota","correct":false},{"answer":"Salterio","correct":true},{"answer":"Laúd","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/a6db5067-eafd-4048-b9f2-a5d64c41b1e8","imageMetadata":{"id":"a6db5067-eafd-4048-b9f2-a5d64c41b1e8","contentType":"image/jpeg","width":219,"height":230,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"El Laúd y el Rabel son instrumentos de procedencia árabe","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":true},{"answer":"False","correct":false}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/d4fcfb48-bbce-45c0-a4fe-88b30ddc2207","imageMetadata":{"id":"d4fcfb48-bbce-45c0-a4fe-88b30ddc2207","contentType":"image/jpeg","width":252,"height":200,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿ Qué instrumento toca?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Pandereta ","correct":false},{"answer":"Redoma","correct":false},{"answer":"Darbuka","correct":false},{"answer":"Pandero","correct":true}],"layout":"CLASSIC","image":"https://media.kahoot.it/6d226167-415f-40b1-8bf5-7dbb9027fc23","imageMetadata":{"id":"6d226167-415f-40b1-8bf5-7dbb9027fc23","contentType":"image/jpeg","width":259,"height":194,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"el Añafil y la chirimía son instrumentos de viento","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":true},{"answer":"False","correct":false}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/239b0697-dc24-4fc8-9d28-9918891a72fd","imageMetadata":{"id":"239b0697-dc24-4fc8-9d28-9918891a72fd","contentType":"image/jpeg","width":259,"height":194,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"Es una.......","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Trompetilla","correct":false},{"answer":"Cornamusa","correct":true},{"answer":"Gaita asturiana","correct":false},{"answer":"Chirimía","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/20a69aca-b530-40a4-bacb-883880923b95","imageMetadata":{"id":"20a69aca-b530-40a4-bacb-883880923b95","contentType":"image/jpeg","width":211,"height":238,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"El de la derecha está tocando unas....","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Castañuelas","correct":false},{"answer":"Tejoletas","correct":true},{"answer":"Castañetas","correct":false},{"answer":"Ladrilletas","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/21137d84-f6e0-44ca-88d5-ea890434ed4b","imageMetadata":{"id":"21137d84-f6e0-44ca-88d5-ea890434ed4b","contentType":"image/jpeg","width":239,"height":211,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"En la Iglesia de Portomarín (Lugo)hay un pórtico con instrumentos medievales.","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"True","correct":true},{"answer":"False","correct":false}],"layout":"TRUE_FALSE","image":"https://media.kahoot.it/9980764a-3472-4f5b-b0d3-5bafe413445c","imageMetadata":{"id":"9980764a-3472-4f5b-b0d3-5bafe413445c","contentType":"image/jpeg","width":177,"height":285,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0},{"type":"quiz","question":"¿ Qué instrumento es?","time":10000,"points":true,"pointsMultiplier":1,"choices":[{"answer":"Organillo","correct":false},{"answer":"Piano portativo","correct":false},{"answer":"Órgano portativo","correct":true},{"answer":"Órgano ibérico","correct":false}],"layout":"CLASSIC","image":"https://media.kahoot.it/ff6ff719-7546-45ce-be4b-3c35fde4265d","imageMetadata":{"id":"ff6ff719-7546-45ce-be4b-3c35fde4265d","contentType":"image/jpeg","width":171,"height":294,"resources":""},"resources":"","video":{"startTime":0,"endTime":0,"service":"youtube","fullUrl":""},"questionFormat":0}],"answerMap":[4,4,4,4,4,4,2,4,2,2,2,4,4,4,4,2,4,2,4,2,4,4,2,4],"uuid":"fe985c7c-3101-4352-b51c-c40d49269c32"}
[{"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 13.2388476}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 7.2759632}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.988991199999999}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 11.670264999999999}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 12.300892399999999}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.298065599999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.253558199999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.265262599999999}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 10.9783912}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 7.3945154}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.291783799999999}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.305443600000001}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.246982399999999}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.284846999999999}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 7.0377038}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.044514599999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.068693399999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.1029442}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 7.2773558}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 8.4827272}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.0479518}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.093879599999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.8017832}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.8751168}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.0233568}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 7.0969942}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 8.5862564}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.8588796}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.894495399999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.4381866}, {"MWG": 64, "NWG": 16, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 10.8122232}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.367191799999999}, {"MWG": 64, "NWG": 16, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 10.4016618}, {"MWG": 64, "NWG": 16, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 10.424299600000001}, {"MWG": 64, "NWG": 16, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 10.862594799999998}, {"MWG": 64, "NWG": 16, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 9.483559}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.3865996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.2075404}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 7.5754094}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 8.909644}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.142028799999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.406837400000001}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.4283494}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.5417136}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.0053706}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.5342768}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.547017599999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.9560047999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 6.0274198}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.8146091999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.064514}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.2407266}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.4400199999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6160843999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.0509129999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.0180526}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.1524552}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.9992356}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.8235264}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.9934278}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.9912647999999993}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.8251261999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.985931}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.56835}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.9566581999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.1470346}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.032483000000001}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.006143}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.0255196}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.9067903999999998}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.417471}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.9496061999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7513776}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7206506}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8406247999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6636119999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.3082526000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.168663}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.010585600000001}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.973486}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.8816614}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.9536952}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.20852}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.5091477999999996}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.467222799999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.5125556}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.5170018}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6342188}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.3079263999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.9137552}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.5062737999999998}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 6.439432599999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.825900399999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 7.1546558000000005}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 6.3731198}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.896361799999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 7.1539443999999985}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.133110199999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.925873999999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.539787799999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 6.167305799999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.856183}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.3287868000000005}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.9592342}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.897962399999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.2357468}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.3363717999999998}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.3062084}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.06161}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 2.9339592}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.0439792}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.2276907999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.054142799999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.042497999999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.660264}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.2299134}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.0639226}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.0468536}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6684416}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.2268631999999995}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 7.258096}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.232493}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.064871200000001}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 7.2002571999999985}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.063181999999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.2316616}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 7.2521406}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 6.2910728}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.924925999999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 6.2386859999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.0652566}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6700716}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.5358469999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.2283428}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.360583999999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.530158}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.4797248000000005}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.5100662}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.7263126}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.1047834000000005}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.760002200000001}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.75052}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6931534}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.9871185999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.0564540000000004}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.7191104000000004}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.7001171999999998}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.633774199999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6355813999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6092101999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6170919999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6451523999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.6520561999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.7221615999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6197291999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6442338}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.4878136}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 6.0702958}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.474895}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.7902807999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.5410896000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.1169578000000002}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.9327172}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8976934}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6623081999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.673153}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.9133976000000006}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6816274}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6661897999999993}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.0184066}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6879386}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.0745566}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.6327408000000005}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7183692}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.691263199999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.6341035999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.907296199999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.9253386}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8049495999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.9789997999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.6504894}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.1125744}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8112609999999996}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7210358}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.9227034}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.6342478}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8086237999999994}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.633096199999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.0852846}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.710369}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7033464}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6878497999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4494126}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 3.6271962}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.2089924}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.2291708}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.6829668}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.6954372}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.9590901999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8138984000000002}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.606310199999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.111391199999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8403285999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.337117}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.8284746}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.9168074}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.7673485999999996}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 7.5811876}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.8080609999999995}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 9.656393999999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7717934}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.602485799999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 6.4726782}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.6110196}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.458422199999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 10.518910000000002}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3197196}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3078676000000002}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2690513999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.782345600000001}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4231898000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3342686}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2748887999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.8563328}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4149819999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4448492}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4189822}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4304193999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.5592827999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.0036504}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4491458}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.206149999999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4310713999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.311423}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.0060803999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.997576}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.8180444}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3114526}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3085194}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3358688}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.1789762}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3731139999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2686368000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.2593046}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.8443606}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.8516496}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.9263148}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.6419836000000005}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.647821}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.2577619999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9803012000000004}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2672142}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3782102000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9641235999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.938078}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.97882}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.8250968}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4370865999999998}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.8456901999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.8530678000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3653804000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.7878512}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9985837999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2945632}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.07186}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.0297548}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9161807999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.6186029999999993}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 6.4766786}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 6.4813898}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 6.313888199999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2735251999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.0786749999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3418542}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2788295999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2905336}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9642714}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9603302}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.039918}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.029992}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.2363412}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.122798999999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.3285218}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.2363116}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.165850000000001}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.683701599999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2374652}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.982172}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.6157604}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3203123999999997}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 7.7827942000000006}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.8920936}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.949519199999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.637452}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.2718704}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.7787288000000006}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.9613119999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.167243000000001}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.8579612}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.4236676}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 8.3877612}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 16.301403999999998}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 15.669650200000001}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 7.8222917999999995}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 10.3230816}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 8.736631399999998}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.024129199999999}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 16.700675799999996}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 15.0426084}, {"MWG": 16, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 8.5739596}, {"MWG": 32, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 7.7528668}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.3740048}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.5200815999999997}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 6.792362799999999}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.2320468}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.3534116}, {"MWG": 64, "NWG": 32, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.3400186}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4473979999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.1482513999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.9397393999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2625029999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.13124}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.6531226000000006}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.095121799999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.0054896}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.5803799999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 7.8586778}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 7.837166000000001}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.6531526}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.756061}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 7.821906199999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.5139499999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3346240000000003}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.820032}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.1696116}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.9889854}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.8482399999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.604114}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.4569981999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.7850378}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.3521057999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.74237}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.7406536}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.520763}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.0944702}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.1252834}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.8338693999999998}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.3298534}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.103242799999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.2056734}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.7293323999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.4009094}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.4032484}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.2244278}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.6540985999999998}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.2679845999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 32, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.3470391999999998}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.8399712}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.883706}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.2966077999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.4243154000000002}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.7277919999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.5048214}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.0956237999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.2749474}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.1650777999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.8480898}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2834813999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.873368799999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.8860782}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.8706408000000003}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2736145999999997}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.2502063999999997}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.4250284}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.0302606}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.0803975999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.6292146}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.0926328}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.0196232}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.008186}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.889932399999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6874645999999998}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.2535587999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.251604799999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.166563}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.8823508}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 6.251753}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.0589724}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.547019799999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.992126399999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.7760026}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.226413}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7028723999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.8264019999999994}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 5.2775594}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 2, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.207392199999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.115596600000001}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 5.323427199999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.612412399999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.1441606}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.4007593999999997}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 1, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.560294399999999}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.239363599999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.8748166}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.9056027999999996}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.9464044}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.6192274}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 5.2002825999999995}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.4441998}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.0836233999999996}, {"MWG": 32, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 32, "MDIMA": 8, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 4.8499904}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.1841897999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.9932518000000004}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.0252509999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.5925874}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.9923904}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.4649094}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.165878}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.4357827999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.227539}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.2291094}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.9667306}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 3.0556226}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 1, "PRECISION": 32, "time": 2.8778986}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 4.149108999999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6873166}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 1, "SB": 0, "PRECISION": 32, "time": 5.3366131999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 32, "KWI": 2, "VWM": 4, "VWN": 1, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3875737999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.1784134}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.687198}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9262556}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6863686}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.6823977999999995}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 2.9354706}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.663879}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 8, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 2, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.0553261999999997}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.9469116}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.944867199999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 4, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.178976199999999}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.3265642}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.0063192}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 32, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7709932000000004}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7607706}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 3.1958346}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 16, "NDIMC": 8, "MDIMA": 16, "NDIMB": 8, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.7272881999999994}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 3.9868814}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 32, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 0, "PRECISION": 32, "time": 4.0545576}, {"MWG": 64, "NWG": 64, "KWG": 32, "MDIMC": 8, "NDIMC": 16, "MDIMA": 16, "NDIMB": 16, "KWI": 2, "VWM": 2, "VWN": 4, "STRM": 0, "STRN": 0, "SA": 0, "SB": 1, "PRECISION": 32, "time": 4.013222999999999}]
[ "http://2.bp.blogspot.com/14IT5f7P60RHwA37T-jn5rbC3BVhOaFrS8k7kvsXJmh9l1xIvSNaYjNcAUGxYL5etT3M4zDwj5iz4PNEg98ZrlfPT8yQdZWfA67TY_JsRlnmZ7k-Df1-MEguoDaniDlCOLHfNA=s0?title=000_1489246122.png", "http://2.bp.blogspot.com/MZSYxPb4EVIG3uK2-gazzbwU-6G9Wpbp8jAYCDJZFhMjqP2fzu3ZniocTthLuf3MfUUwiUoVXblHUbDsUZrwWPJg8Eu58EsxqHiPQ88BYyLF-FB8pUmT-mSBELALekjnopuR4Q=s0?title=001_1489246122.png", "http://2.bp.blogspot.com/HYXcUGzeUngSGXpL68fG7Ukei2J-rrDrfmTdB-dku_N0WI2nK9lKL0fyu1xzjHVf5UnIRMxHLEKRu6hK4pQ2g3UZ-xMdVcEBEigwUvO4fsHemcED9XM5P0WvmH2FsSrGk5udbQ=s0?title=002_1489246122.png", "http://2.bp.blogspot.com/gbIFK65BZpjVxTe96y9oMs7fvz1aoNx2YlU5IaSqZwKzVV6HBNR71Z9OjvzRWUotIModMErGxIpfVu7fZK4R4IPwJrVarEQqmTFqtZhZ_8EFbolBNUKo0I1QDuvY0ZdnBNioSA=s0?title=003_1489246122.png", "http://2.bp.blogspot.com/D1U6jJSSN3xIARvtt9CcqQv9XErJFRkU71fza5_QPseuUcyTDIgBReN5eT5jFptw-q61ryCUugRLH3pRuOeFu1dantu07CaCCkAAV5E-cET7G4YZNLyBESkh52jGLjwFrrkbxA=s0?title=004_1489246122.png", "http://2.bp.blogspot.com/cR5GUYCIa5yckjo-96wseS4G3cF5QOoVA6B0GdDNKg96444NiKsfLT3qmY9QrC-Y56OZyDSZIHNklAmeR-6HcbMzbQyfJ4jPFmoeJWN-sv6lURXgFT3u6cuOm84M7SRcsMFkrw=s0?title=005_1489246122.png", "http://2.bp.blogspot.com/k_uwtcr8Pe6PWDOdPzLjKy3Z3Wbc_qzKx84xnUlaYe13LIJyYcNFx6raUnrwbMlQDJVbMNnJ9kME-pQd-st2ODsBguky5eN2Oscbar_NgKbxxpaSAJHsEIt7p6alS4Re1oPFww=s0?title=006_1489246122.png", "http://2.bp.blogspot.com/SPQXTxTslW47n0OfRiMI-2KuNos9_a91UcV5lPNSSIrf16faZw38qbZckVW_duVRZjPe7Gm6ujMbJgU-KRimVm50Qdx1oP8DFKAy7Zj1GarVH1T4fTcBVJYm7we3n8RKYTKuLg=s0?title=007_1489246122.png", "http://2.bp.blogspot.com/8QJWyPtwZN9ZnG35gLsBhpQEJ43ucmXf7PafWiCIEsYzyYCOWgObnVCjOnK7R09eVuwdGOH2HtcsyKxf2pcKqyCFbOgRympzOOEbzqS3yltrEvDzXKDsc6_EmbwUng4AZGx2rw=s0?title=008_1489246122.png", "http://2.bp.blogspot.com/WuoJn6-lcM674CBrzemO2Brsl5gnwmLRWdcp-fxPLd7tNtu5PSPjoDP_BONlVeGlUKP5zsN2JVe4ktR1upXdXAQDLFsURiamLLdYhYPGwhK87Byfh-KWRk31h0ymzgAJ5jC8pA=s0?title=009_1489246122.png", "http://2.bp.blogspot.com/vtnH7kzFindH-SV54UCTWGPxDNNxTG8CbmSFWoKkjiqNyMcCDWuUdwS0GFf1E849IpoInJ7F2BTYfH_QZzQMpdL41vWxQAoA83thI_TB_D1pmHMgn9E_zs8w1ppsFJoIHiKmZw=s0?title=010_1489246122.png", "http://2.bp.blogspot.com/_bd-9yxvBTlD31vkD-Y6jfRKPYTAZ_km6cvSKujQEyG1tBVxQUg9JSa49uiWkBZLwMD6IzFoaexjIeBCzfD3ZEoXEuBb4e9s5esROUeg-FV-36hcngyKa5Gt_TzmljU5XiP_tA=s0?title=011_1489246122.png", "http://2.bp.blogspot.com/u3mJp18nG1XBYlYH2yYqGYiRSsu5keUpaxObs-0tGCF-KBl7usbHmVuWks0rFBfHbvRKKi31z_Sb-YoUmd3QRC183d80HTXeXZGZScbw6WeXcetZkTYICebU4B9qQzNdtDiepA=s0?title=012_1489246122.png", "http://2.bp.blogspot.com/4E97b4zX91oWJ7wA4SNmU2qQD3WeV4ow714SetoBdTdJp-mT20qlGjd1bGr-Uuv9o699EnJPZOo0EggEZrMQSBV7n3wfd28EarcKhs6nCwmcdGDsocHuj5Aiif69HAIDsR2jmA=s0?title=013_1489246122.png", "http://2.bp.blogspot.com/dTEb8et4i2EqQHliHyv6zOFNsekMnkUpnYU-7T7CeK9NiXUK545IhFugZ4tqPlEeT4x9C2iy50R-385XC6yL_kjUfRbHRNfj-aUkhvTX0dr8jlcWM4z8mJbi3z0D-WlXIuSsDg=s0?title=014_1489246122.png", "http://2.bp.blogspot.com/GKW-KoMv-MSCIv33ll209TQWOZR6RDP03fi-xra0tD5vPI4_P5iajjpnQCVBDWlqY2NO8YwPhXYeD29X4YI4_hEMzBeJpOT7mbi-hJ4ssUaGlxnOBvJt9yuUWOVIhtLLP-cndA=s0?title=015_1489246122.png", "http://2.bp.blogspot.com/ptMJFFzxcQQQ6d3wealG2UM__FsifnnZ0UbD9fgJvyvUK6gGS4mB89xbvS3so_jS-aUQXgatwsuBUIToIuz88EKH_BofG0TqWIXu3Y8DoupHnQJLpB0Zdch0SCfH8h895kBKDA=s0?title=016_1489246122.png", "http://2.bp.blogspot.com/7vUkn1vcJdo18sosB0gBUFfwj-yfVKzWFaK5sq2NTjr9mdNzbR5GZ_Ac9yVtltbxRE7HqLVJHAoW3DSVQkCfFz-zyuDWTCvMIPKUins8tV2beU2_hDwaayj8gB-6Ikd-IAXh0A=s0?title=017_1489246122.png", "http://2.bp.blogspot.com/oQdh77kz0U5XTmWGZbcsbdnb5DKH-qmkJCyW_prKqiZR2xtFrQ3ZAhFzbeob2cvlPB-xNOt4BtIo7xqQOeSrUvJMJWodW-ben32qv99K59Vx1lOPbuDZTRFPLUpPNJiJRO7vUQ=s0?title=018_1489246122.png", "http://2.bp.blogspot.com/1tCBVVzL3FiIRYc9q4IVO9DYZ5brV9_6KpS6W1TnHzfVpYuujBRrOFLWLOZ2EQq-C1gKckelGxiy77zAdVTVvPTUgdKCIF6Rg20EPk8ZABW5cyFRVb07ptO8enAWt5YQjIifOA=s0?title=019_1489246122.png", "http://2.bp.blogspot.com/ztzkAQA9vopo-tHVyDS8LAMd8rZy9dNGGRGSWn9LzUIWTRC1Y7YMcViLnA7OQgSHqfNcX2hv6joo28SaMtzLoX9TpM0Tg-aO8_l1ht92zQ7UZZk82qi_LQ8NrREf8ZW4ESRiug=s0?title=020_1489246122.png", "http://2.bp.blogspot.com/Z0nZwJbiJyoTpvXwd3q4B_wGJv3GShGvjAl_aqB8N-fh4embSqZo4p0rFUfWnnHvXGTS9o4T2beMnImqd5UGIuyMf5w7I0kNJw79QMd4GbdL6TuElLoN7d55bhL4Y-jvUbheVw=s0?title=021_1489246122.png", "http://2.bp.blogspot.com/kfEqx_zeSIQxyvQ2bfyPsVKLzxGxSObZW5xH3O8chACObGRGrLbuuUI5e7fZ7emTbNdLos6XX1X_79A3kjbfVtCvdHlz6ULXvjgKj2e4VHGCnzIZgoBCBV2B7p-g8aDEfiyPyQ=s0?title=022_1489246122.png", "http://2.bp.blogspot.com/yMEOVwXf4LBU7lIpYLRdf-RzF3_Y0gvYp---HdzptF6nzaaQSHcGW0_YNFIDXA2lWwc0zi3gmP5p7pGfUvOPqmWO-pH0NnjyyhIkIHgVl7aFluVY6KmJoUMGSW13zLp-qwiZ-g=s0?title=023_1489246122.png", "http://2.bp.blogspot.com/29NY6OFDXhYH34BW_Pd1qWBysc5WOAZ0625iyzqEfzLj2n3rVSMsgGJEfJR1MxA_8U91HF5A-2-EoAntAcQUBZrq1hhzFNWaNsHHa8uzq3TcAdgAAT1kTILbKRnVCQ1y4VmjSA=s0?title=024_1489246122.png" ]
{"feedstocks": ["cartes"]}
{ "name": "personal_site", "version": "0.0.0", "main": "app.js", "author": "Colby Somerville", "license": "MIT", "dependencies": { "express": "^4.12.4", "gulp-autoprefixer": "^3.0.1", "morgan": "^1.6.0" }, "devDependencies": { "gulp": "^3.9.0", "gulp-less": "^3.0.3", "less": "^2.5.1", "normalize.less": "^1.0.0" } }
{ "id": 23397512, "type": "Feature", "properties": { "name":"Bright", "placetype":"locality", "woe:id":23397512, "woe:name":"Bright, Ontario, Canada", "woe:place_id":"6UGWSFybAp_eoGZg7A", "woe:placetype":"locality", "woe:placetype_id":7 }, "bbox": [-80.629356,43.22879,-80.617119,43.235699], "geometry": {"alpha":0.00015,"bbox":[-80.629356384277,43.228790283203,-80.617118835449,43.235698699951],"coordinates":[[[[-80.626389,43.234642],[-80.62558,43.235371],[-80.623726,43.235535],[-80.621452,43.235699],[-80.618874,43.235229],[-80.617119,43.234665],[-80.62114,43.22879],[-80.623985,43.230064],[-80.629356,43.231876],[-80.626389,43.234642]]]],"created":1292528447,"edges":10,"is_donuthole":0,"link":{"href":"http://farm6.static.flickr.com/5250/shapefiles/23397512_20101216_f5cf84e395.tar.gz"},"points":19,"type":"MultiPolygon"} }
[ "http://2.bp.blogspot.com/-0obCaMTBj1w/UWkcLUYiNdI/AAAAAAAAOwE/FYlPpIIzaPw/s0/%25255BMondaijiZ%25255D-ch02_00.jpg", "http://2.bp.blogspot.com/-XVTgO8ODneM/UWkcSCA_AqI/AAAAAAAAOwk/8Dux_-O-pzM/s0/%25255BMondaijiZ%25255D-ch02_01.jpg", "http://2.bp.blogspot.com/-GcuSJkmaH1w/UWkcVKg3EcI/AAAAAAAAOw0/jZkGYq37JMs/s0/%25255BMondaijiZ%25255D-ch02_02.png", "http://2.bp.blogspot.com/-jxjIbnGD6cE/UWkcaBnRkEI/AAAAAAAAOxE/GxXlKNSYthk/s0/%25255BMondaijiZ%25255D-ch02_03-04.png", "http://2.bp.blogspot.com/-70bcOMdIf80/UWkcdMbr3_I/AAAAAAAAOxM/dq-e0eDkdRk/s0/%25255BMondaijiZ%25255D-ch02_05.png", "http://2.bp.blogspot.com/-71mJ1BH_5oc/UWkcfwHnxjI/AAAAAAAAOxY/FMjCSBPlVLk/s0/%25255BMondaijiZ%25255D-ch02_06.png", "http://2.bp.blogspot.com/-gN_QGSiQ-B0/UWkcjTNH2iI/AAAAAAAAOxk/zCJo5IhPXMo/s0/%25255BMondaijiZ%25255D-ch02_07.png", "http://2.bp.blogspot.com/-q7i2Zjp4HZk/UWkcleK85dI/AAAAAAAAOx0/J-nAIcHKyUE/s0/%25255BMondaijiZ%25255D-ch02_08.png", "http://2.bp.blogspot.com/-LOdQP9QnyTo/UWkco2xZJPI/AAAAAAAAOyE/L5YJCWDCNgs/s0/%25255BMondaijiZ%25255D-ch02_09.png", "http://2.bp.blogspot.com/-XV1-48-cSeY/UWkcsJAwGKI/AAAAAAAAOyM/MOxT3kPicz8/s0/%25255BMondaijiZ%25255D-ch02_10.png", "http://2.bp.blogspot.com/-KFEOq3TWkPI/UWkcuO8wOII/AAAAAAAAOyc/GJLz_5gbaqk/s0/%25255BMondaijiZ%25255D-ch02_11.png", "http://2.bp.blogspot.com/-7Ffqiw8B9o4/UWkcxoGUy2I/AAAAAAAAOyk/M7vwp76c__E/s0/%25255BMondaijiZ%25255D-ch02_12.png", "http://2.bp.blogspot.com/-FeI2_4xZ1rM/UWkczohQr6I/AAAAAAAAOy0/gCwsS0zjBjE/s0/%25255BMondaijiZ%25255D-ch02_13.png", "http://2.bp.blogspot.com/-otgUc1-Pxns/UWkc3esogPI/AAAAAAAAOzE/5A3tYmCAXCk/s0/%25255BMondaijiZ%25255D-ch02_14.png", "http://2.bp.blogspot.com/-RiUR4w1dHJQ/UWkc7vopoeI/AAAAAAAAOzU/VaDwG4dS-Eo/s0/%25255BMondaijiZ%25255D-ch02_15.png", "http://2.bp.blogspot.com/-hU_r27jVQKw/UWkc-eIMgQI/AAAAAAAAOzk/r20ObPjxiMI/s0/%25255BMondaijiZ%25255D-ch02_16.png", "http://2.bp.blogspot.com/-KJH0HttePho/UWkdBAwbvMI/AAAAAAAAOz0/SNfjVF5Lnk4/s0/%25255BMondaijiZ%25255D-ch02_17.png", "http://2.bp.blogspot.com/-q-OZcxBlX3g/UWkdD5NEaAI/AAAAAAAAO0E/Kkp57XA9Hxc/s0/%25255BMondaijiZ%25255D-ch02_18.png", "http://2.bp.blogspot.com/-vo-sz9L9jSc/UWkdJFlrO-I/AAAAAAAAO0M/Gjifuxz0aug/s0/%25255BMondaijiZ%25255D-ch02_19.png", "http://2.bp.blogspot.com/-P4yJsd6r4Zk/UWkdL_WLvMI/AAAAAAAAO0k/vLgbrES4JMg/s0/%25255BMondaijiZ%25255D-ch02_20.png", "http://2.bp.blogspot.com/-KXtMJ0KKLFs/UWkdSdgErqI/AAAAAAAAO00/oZwdhStprHk/s0/%25255BMondaijiZ%25255D-ch02_21-22.png", "http://2.bp.blogspot.com/-zfJsYcYZ6-Q/UWkdUTvjNCI/AAAAAAAAO1M/4QHf2kUMuUg/s0/%25255BMondaijiZ%25255D-ch02_23.png", "http://2.bp.blogspot.com/-10U4D78qMgc/UWkdW421tCI/AAAAAAAAO1U/y1SZcqwQZYI/s0/%25255BMondaijiZ%25255D-ch02_24.png", "http://2.bp.blogspot.com/-OMtlY7_UljY/UWkdYrU3j3I/AAAAAAAAO1c/BPalJOEQ6Vg/s0/%25255BMondaijiZ%25255D-ch02_25.png", "http://2.bp.blogspot.com/-L26hcjvvtdM/UWkdZjtIZaI/AAAAAAAAO1k/DTRJOFBPETQ/s0/%25255BMondaijiZ%25255D-ch02_26.png", "http://2.bp.blogspot.com/-utcEekY99P8/UWkdbbrvBgI/AAAAAAAAO1s/3yRP7T1NKBU/s0/%25255BMondaijiZ%25255D-ch02_27.png", "http://2.bp.blogspot.com/-QUiXFa4lqSA/UWkddHiuIDI/AAAAAAAAO10/1yGQxrWuoV4/s0/%25255BMondaijiZ%25255D-ch02_28.png", "http://2.bp.blogspot.com/-ndYjR7JgxL0/UWkde325JNI/AAAAAAAAO18/e3wciRROo0Y/s0/%25255BMondaijiZ%25255D-ch02_29.png", "http://2.bp.blogspot.com/-_6WAEiPTKEs/UWkdgTodFnI/AAAAAAAAO2E/1b_bf_BhV90/s0/%25255BMondaijiZ%25255D-ch02_30.png", "http://2.bp.blogspot.com/-3_ga67yIXgI/UWkdh9eeJYI/AAAAAAAAO2M/6XBU3jUhQvE/s0/%25255BMondaijiZ%25255D-ch02_31.png", "http://2.bp.blogspot.com/-CF5zdeZxJB8/UWkdjJXIy5I/AAAAAAAAO2U/Xsv5JY09yv8/s0/%25255BMondaijiZ%25255D-ch02_32.png", "http://2.bp.blogspot.com/-GETkyZSbnG0/UWkdkl-pnXI/AAAAAAAAO2c/MfaQYLqYiIQ/s0/%25255BMondaijiZ%25255D-ch02_33.png" ]
{ "add": { "doc": { "id": "b7a85564b83eb479fd4d72e0003576cfd80361f942fbbc243087097c26c4bc7a", "url": "https://upload.wikimedia.org/wikipedia/commons/thumb/d/df/Flag_of_Osaka_City.svg/150px-Flag_of_Osaka_City.svg.png", "previous": " ", "after": " Osaka saka is a city in the Kansai region of Japan s main island of Honsh the designated city under the Local Autonomy Law the capital city of Osaka Prefecture and also the biggest part of Keihanshi Area which is represented by three major cities of Japan Kyoto Osaka and Kobe Located at the mouth of the Yodo River on Osaka Bay Osaka is the third largest city by population after Tokyo and Yokohama ", "color": "indigo|0.50915 gold|0.45532 golden|0.026932 rod|0.026932 dark|0.0059589 golden|0.0059589 rod|0.0059589 ", "after_weights": " Osaka|1 saka|0.98649 is|0.97297 a|0.95946 city|0.94595 in|0.93243 the|0.91892 Kansai|0.90541 region|0.89189 of|0.87838 Japan|0.86486 s|0.85135 main|0.83784 island|0.82432 of|0.81081 Honsh|0.7973 the|0.78378 designated|0.77027 city|0.75676 under|0.74324 the|0.72973 Local|0.71622 Autonomy|0.7027 Law|0.68919 the|0.67568 capital|0.66216 city|0.64865 of|0.63514 Osaka|0.62162 Prefecture|0.60811 and|0.59459 also|0.58108 the|0.56757 biggest|0.55405 part|0.54054 of|0.52703 Keihanshi|0.51351 Area|0.5 which|0.48649 is|0.47297 represented|0.45946 by|0.44595 three|0.43243 major|0.41892 cities|0.40541 of|0.39189 Japan|0.37838 Kyoto|0.36486 Osaka|0.35135 and|0.33784 Kobe|0.32432 Located|0.31081 at|0.2973 the|0.28378 mouth|0.27027 of|0.25676 the|0.24324 Yodo|0.22973 River|0.21622 on|0.2027 Osaka|0.18919 Bay|0.17568 Osaka|0.16216 is|0.14865 the|0.13514 third|0.12162 largest|0.10811 city|0.094595 by|0.081081 population|0.067568 after|0.054054 Tokyo|0.040541 and|0.027027 Yokohama|0.013514 |0", "previous_weights": " " } } }
["abe3f9124fc4614a7dae432eb40ac3fb397b836a","2f713ed48491e58550ab014699603081e8ac8b65","7dce0effeeda546b6ca91921918403942a764667","d92ac54e5ebfecbf794c24db54fb2179f9e74798","bbc4ca9e2d1310bc18ffd5ebb3f8cab5741f2f16","ec744d264f12d0bd959059e1d47d56736218def7","3d620de54d989f6b927a3b54368d0007ea69e08a","d582f9bfe67c990c5d6d9178e5fef7017d78474f","56770ead331c86f5db3e89948c711b57e5dce863","003f176ce0962bb2b44fea52f247091cbf8a6b09","395d6be47cb038f75ce96a59cb5bf4ec15b10203","1258347e614b82ab48ab00350fc9bdc8041073c5","45caee953cc3f41a7a5eb353b080a1f1dcec2f03","78ae852a0126441e2c7e615ab2fee68e8a1a0e44","b1345cfa011e7ac29b51a31d4482f4abad6a5406","938e0a57f33e493196e85f37b6ac2ae561f11f47","b9e4280d6c7147396aae0bf784b58ca60fded3c9","213225427c0d5c1ae4e5478ec16ed84656076f5d","e63a7e32ea5456732b9504c03ca36126f4b4df6d","244c73af6e4061a1a7338c0c8145043a4c76a7d9","fa2001d5f2e6b0e37df4d7f92c3fc9fb31cfb738","570a93cabdbf785647706a380d0f8fee2541ce3d","211eaada7fec159d90991e8556fdc91273fe47a7","66877bc47730c07551a7b738c1d175f0343fd3b3","10b5eef9c0c971aaf39f499073b13447659a2d63","ff2f0518f58ff684612764773150dea61486b28c","f29c7c0e7c820fc980a6961e6bdd82acefec4e89","df6379bd06432ea16b544d683a6d1167f0e0632d","8601eca562a1f402279f0db0e12299e1a6e76c7a","d9fb23fa78078c52a5e54fb461cc913d32c7d431","36536abe1753861bd4f6ab724eacd07ba6850aaf","2575789db92302b1296bc76dfe56472cabb26543","0c93ab7cad2449c18e9339c38eb5259012c70744","aa3f17efaf90fbdacb365f21518276c085dba089","efa8592759da8ba232491068e0ad7d7c5d7dab09","43b3988b4655734869eb593638e4fa30902c4aec","2c0573b18db3c442d07a91b8660bad17948b69e2","627ce83d48eef165670707e3edc67dea720c0d78","4bf029f6f5873f3c3bebc9324b394e87b8bb765e","7b9b59adbae47193b26c210f73dbb757f9e5c2b2","9ed45e466f83b4351c13ec06abffa75912029ae9","eca31812846620edaa4f9c691bfada0b1a11b42d","c4cc290a9814481c51fa65b8488539e08c7ef90b","59d8b74e2df601bde9f3fa15d73f19498412dafc","95e0dc181fd3122da23afe630bd60ee97b7c98d8","8653f9ffc56f091b5aa2a669167ded5633452d61","faeee68752d4ee8c41898a24d41fc5ebe517136a","4d425ba6fb55857e420b020f7d3bb80a9b4f1e82","4e8e6e4f59d124c1e15c012fa725082d8d160083","ce93f11089e66f851307995a57a67726ea3fd269","9731592af717913df22cf7e63f077ba233f394c3","2d70e7f2a05c38497052c6d37054499f00b4857a","79cd45cce575661b379f57f65e835c3f324f2e18","435a8a597f2d1ed33aaa0096b30aa1f27977007e","de9d3dac411045fb11a3fad16b1f7a9dbd506b80","8ab82cba587b3aeb7cc65dcb4b99e46fa6a141c6","a26ddcab77c2ea513aff3a858d8bf5a2835815c1","a54249416036f5eb3a19040990a08e09f7cb4b0a","7a4e5065329ffacf2676a49aefce97747e587952","e787caca2468c7bd823be327941256eeaedc06a8","8c9a7562b8265922197b0ff07c3f75e678d104a5","3b3ec0c2299f2a9666811b0936216c844daaaf20","7ce9956235591133cacc33321b0bb147c2f9819f","7d33a21aff0635919ec8c600c939fbbbe695c69f","a4b2e8ff87120d33f2569feca9888d0db9249f7d","b535754572a36c8cc4ba8311640d54d05c0acc42","65174a557bb00bcf2d091cfeeb1d1724bcbffb75","d2557d11d04fb5bf055a4dec9c0b0849bf09551c","4643eabe6a44c8961fb291c8cf110712041d32e4","f29f2124c2e3cbea347b9a0374a131560b30e064","dbde33aa2482dcd966dd2a8d46c16ff279a68115","245fec9c206681872320b244674f1dac83206814","6eb671cedf80f0341c3bd903391d4266ba10d85d","5b4679dcb6b7f77f4fa9c8a604234309b5d1bcb3","12c7a5ea2ceb91c39573a247a7d1bc3b1fe58d2b","35f7cdc0a77e2c991a3ba44bcf6ec4cbd888b387","17defdc56c1db9f1ccf7c6c797bc7546d4fb3f5c","7ad52ec84b4bda3a5536507e10b585fea3a6ab47","94db9a93047705f6e26301dd58a2b122a0589955","e962ce85729cf0a5bdf310a7cb637d23eb280dc2","68430454df9786e4fa81ba678913363d494c549e","0925d03a69bf2d398984df9a39a29ef81a134c4a","08b115dd391890e0fbcf6098ac517b83de1f94d5"]
{"title":"C2C Radio Program! Commercial Free! Jul 28th thru Aug 7th!","uid":5052109,"size":615620374,"categoryP":"audio","categoryS":"sound_clips","magnet":"?xt=urn:btih:c9ede39c18e31a437fc2fcce5118fc0493e56832&amp;dn=C2C+Radio+Program%21+Commercial+Free%21+Jul+28th+thru+Aug+7th%21&amp;tr=udp%3A%2F%2Ftracker.openbittorrent.com%3A80&amp;tr=udp%3A%2F%2Fopen.demonii.com%3A1337&amp;tr=udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969&amp;tr=udp%3A%2F%2Fexodus.desync.com%3A6969","seeders":0,"leechers":0,"uploader":"Stokeman","files":44,"time":1250215674,"description":"Download, SEED, and Enjoy!","torrent":{"xt":"urn:btih:c9ede39c18e31a437fc2fcce5118fc0493e56832","amp;dn":"C2C+Radio+Program%21+Commercial+Free%21+Jul+28th+thru+Aug+7th%21","amp;tr":["udp%3A%2F%2Ftracker.openbittorrent.com%3A80","udp%3A%2F%2Fopen.demonii.com%3A1337","udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969","udp%3A%2F%2Fexodus.desync.com%3A6969"],"infoHash":"c9ede39c18e31a437fc2fcce5118fc0493e56832","infoHashBuffer":{"type":"Buffer","data":[201,237,227,156,24,227,26,67,127,194,252,206,81,24,252,4,147,229,104,50]},"announce":[],"urlList":[]}}
{"artist": "Panda Bear", "timestamp": "2011-09-07 20:16:48.896285", "similars": [], "tags": [], "track_id": "TRBMOXT128F935243F", "title": "Track 3"}
["bc01f173f21da95c3175cbfa6bc663ad85e2722d"]
"\n一阵风吹来\n草绿\n草动\n空气中听人语\n猫\n小心地\n走\n跟着黄昏\n去了"
{"title":"Asian Mature - Sayoko Shintani Chunk","uid":8564821,"size":642286363,"categoryP":"porn","categoryS":"movie_clips","magnet":"?xt=urn:btih:2280e5ce5494696356d4209f01c889fc7155bce3&amp;dn=Asian+Mature+-+Sayoko+Shintani+Chunk&amp;tr=udp%3A%2F%2Ftracker.openbittorrent.com%3A80&amp;tr=udp%3A%2F%2Fopen.demonii.com%3A1337&amp;tr=udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969&amp;tr=udp%3A%2F%2Fexodus.desync.com%3A6969","seeders":0,"leechers":1,"uploader":"irealu69","files":-1,"time":1370976037,"description":"Asian Mature - Sayoko Shintani Chunk\n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~\n\nScreenshots:\n~~~~~~~~~~~~\n &lt;a href=&quot;\nhttp://picturescream.com/x/clean/4M5&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://picturescream.com/x/clean/4M5&lt;/a&gt;\n &lt;a href=&quot;\nhttp://picturescream.com/x/clean/4MX&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://picturescream.com/x/clean/4MX&lt;/a&gt;\n &lt;a href=&quot;\nhttp://picturescream.com/x/clean/4MZ&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://picturescream.com/x/clean/4MZ&lt;/a&gt;\n &lt;a href=&quot;\nhttp://picturescream.com/x/clean/4M3&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://picturescream.com/x/clean/4M3&lt;/a&gt;\n &lt;a href=&quot;\nhttp://picturescream.com/x/clean/4MV&quot; rel=&quot;nofollow&quot; target=&quot;_NEW&quot;&gt;\nhttp://picturescream.com/x/clean/4MV&lt;/a&gt;\n\n\nVideos Info:\n~~~~~~~~~~~~\nSize: 612.53 MB\nDuration: 41:49\nResolution: 640x480","torrent":{"xt":"urn:btih:2280e5ce5494696356d4209f01c889fc7155bce3","amp;dn":"Asian+Mature+-+Sayoko+Shintani+Chunk","amp;tr":["udp%3A%2F%2Ftracker.openbittorrent.com%3A80","udp%3A%2F%2Fopen.demonii.com%3A1337","udp%3A%2F%2Ftracker.coppersurfer.tk%3A6969","udp%3A%2F%2Fexodus.desync.com%3A6969"],"infoHash":"2280e5ce5494696356d4209f01c889fc7155bce3","infoHashBuffer":{"type":"Buffer","data":[34,128,229,206,84,148,105,99,86,212,32,159,1,200,137,252,113,85,188,227]},"announce":[],"urlList":[]}}
{"first_name":"Henry","last_name":"Gomez","permalink":"henry-gomez","crunchbase_url":"http://www.crunchbase.com/person/henry-gomez","homepage_url":null,"birthplace":null,"twitter_username":null,"blog_url":null,"blog_feed_url":null,"affiliation_name":"eBay","born_year":null,"born_month":null,"born_day":null,"tag_list":null,"alias_list":null,"created_at":"Tue Jul 03 05:26:12 UTC 2007","updated_at":"Tue Feb 05 22:45:04 UTC 2008","overview":null,"image":null,"degrees":[],"relationships":[{"is_past":true,"title":"Board of Directors","firm":{"name":"eBay","permalink":"ebay","type_of_entity":"company","image":{"available_sizes":[[[150,62],"assets/images/resized/0000/3625/3625v1-max-150x150.png"],[[210,87],"assets/images/resized/0000/3625/3625v1-max-250x250.png"],[[210,87],"assets/images/resized/0000/3625/3625v1-max-450x450.png"]],"attribution":null}}},{"is_past":true,"title":"President","firm":{"name":"Skype","permalink":"skype","type_of_entity":"company","image":{"available_sizes":[[[150,66],"assets/images/resized/0000/1387/1387v12-max-150x150.jpg"],[[250,110],"assets/images/resized/0000/1387/1387v12-max-250x250.jpg"],[[315,139],"assets/images/resized/0000/1387/1387v12-max-450x450.jpg"]],"attribution":null}}}],"investments":[],"milestones":[],"video_embeds":[],"external_links":[],"web_presences":[]}
{ "name": "adgage-escada", "version": "0.9.3", "description": "Escada butterflies animation campaign for AdGage", "main": "server.js", "dependencies": { "body-parser": "^1.10.0", "express": "^4.10.6", "sprity": "^1.0.6" }, "devDependencies": { "del": "latest", "gulp": "latest", "gulp-concat": "latest", "gulp-csslint": "latest", "gulp-flatten": "latest", "gulp-ftp": "^1.0.3", "gulp-header": "^1.2.2", "gulp-if": "^1.2.5", "gulp-imagemin": "^2.2.1", "gulp-jade": "latest", "gulp-jshint": "latest", "gulp-livereload": "latest", "gulp-load-plugins": "latest", "gulp-minify-css": "^1.1.6", "gulp-nodemon": "latest", "gulp-plumber": "^1.0.1", "gulp-rename": "latest", "gulp-sass": "latest", "gulp-sourcemaps": "latest", "gulp-uglify": "latest", "gulp-util": "latest", "imagemin-pngquant": "^4.1.0", "jshint-stylish": "latest", "nodemon": "latest", "require-dir": "latest", "source-map": "latest", "vinyl-source-stream": "latest" }, "scripts": { "test": "echo \"Error: no test specified\" && exit 1" }, "author": "Santiago Rebella santiago_rebella@hotmail.com", "license": "ISC" }