hexsha stringlengths 40 40 | size int64 5 1.05M | ext stringclasses 588
values | lang stringclasses 305
values | max_stars_repo_path stringlengths 3 363 | max_stars_repo_name stringlengths 5 118 | max_stars_repo_head_hexsha stringlengths 40 40 | max_stars_repo_licenses listlengths 1 10 | max_stars_count float64 1 191k ⌀ | max_stars_repo_stars_event_min_datetime stringdate 2015-01-01 00:00:35 2022-03-31 23:43:49 ⌀ | max_stars_repo_stars_event_max_datetime stringdate 2015-01-01 12:37:38 2022-03-31 23:59:52 ⌀ | max_issues_repo_path stringlengths 3 363 | max_issues_repo_name stringlengths 5 118 | max_issues_repo_head_hexsha stringlengths 40 40 | max_issues_repo_licenses listlengths 1 10 | max_issues_count float64 1 134k ⌀ | max_issues_repo_issues_event_min_datetime stringlengths 24 24 ⌀ | max_issues_repo_issues_event_max_datetime stringlengths 24 24 ⌀ | max_forks_repo_path stringlengths 3 363 | max_forks_repo_name stringlengths 5 135 | max_forks_repo_head_hexsha stringlengths 40 40 | max_forks_repo_licenses listlengths 1 10 | max_forks_count float64 1 105k ⌀ | max_forks_repo_forks_event_min_datetime stringdate 2015-01-01 00:01:02 2022-03-31 23:27:27 ⌀ | max_forks_repo_forks_event_max_datetime stringdate 2015-01-03 08:55:07 2022-03-31 23:59:24 ⌀ | content stringlengths 5 1.05M | avg_line_length float64 1.13 1.04M | max_line_length int64 1 1.05M | alphanum_fraction float64 0 1 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
fbc3cb3fb90a6a1030e560d4690ae76481cdf117 | 40,347 | xml | XML | datasets/Inspec/train/954.xml | Priyansh2/Automatic-Keyword-Extraction-Data | ac50446a23ad66b9f8c8f2ddfd6f021aa44e17b6 | [
"Apache-2.0"
] | 1 | 2019-12-18T19:12:37.000Z | 2019-12-18T19:12:37.000Z | datasets/Inspec/train/954.xml | Priyansh2/Automatic-Keyword-Extraction-Data | ac50446a23ad66b9f8c8f2ddfd6f021aa44e17b6 | [
"Apache-2.0"
] | null | null | null | datasets/Inspec/train/954.xml | Priyansh2/Automatic-Keyword-Extraction-Data | ac50446a23ad66b9f8c8f2ddfd6f021aa44e17b6 | [
"Apache-2.0"
] | 1 | 2019-10-19T06:40:36.000Z | 2019-10-19T06:40:36.000Z | <?xml version="1.0" encoding="UTF-8"?>
<?xml-stylesheet href="CoreNLP-to-HTML.xsl" type="text/xsl"?>
<root>
<document>
<sentences>
<sentence id="1">
<tokens>
<token id="1">
<word>Caring</word>
<lemma>caring</lemma>
<CharacterOffsetBegin>0</CharacterOffsetBegin>
<CharacterOffsetEnd>6</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="2">
<word>for</word>
<lemma>for</lemma>
<CharacterOffsetBegin>7</CharacterOffsetBegin>
<CharacterOffsetEnd>10</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="3">
<word>your</word>
<lemma>you</lemma>
<CharacterOffsetBegin>11</CharacterOffsetBegin>
<CharacterOffsetEnd>15</CharacterOffsetEnd>
<POS>PRP$</POS>
</token>
<token id="4">
<word>new</word>
<lemma>new</lemma>
<CharacterOffsetBegin>16</CharacterOffsetBegin>
<CharacterOffsetEnd>19</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="5">
<word>lawyers</word>
<lemma>lawyer</lemma>
<CharacterOffsetBegin>20</CharacterOffsetBegin>
<CharacterOffsetEnd>27</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
</tokens>
</sentence>
<sentence id="2">
<tokens>
<token id="1">
<word>In</word>
<lemma>in</lemma>
<CharacterOffsetBegin>28</CharacterOffsetBegin>
<CharacterOffsetEnd>30</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="2">
<word>any</word>
<lemma>any</lemma>
<CharacterOffsetBegin>31</CharacterOffsetBegin>
<CharacterOffsetEnd>34</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="3">
<word>given</word>
<lemma>given</lemma>
<CharacterOffsetBegin>35</CharacterOffsetBegin>
<CharacterOffsetEnd>40</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="4">
<word>year</word>
<lemma>year</lemma>
<CharacterOffsetBegin>41</CharacterOffsetBegin>
<CharacterOffsetEnd>45</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="5">
<word>,</word>
<lemma>,</lemma>
<CharacterOffsetBegin>45</CharacterOffsetBegin>
<CharacterOffsetEnd>46</CharacterOffsetEnd>
<POS>,</POS>
</token>
<token id="6">
<word>a</word>
<lemma>a</lemma>
<CharacterOffsetBegin>47</CharacterOffsetBegin>
<CharacterOffsetEnd>48</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="7">
<word>striking</word>
<lemma>striking</lemma>
<CharacterOffsetBegin>49</CharacterOffsetBegin>
<CharacterOffsetEnd>57</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="8">
<word>number</word>
<lemma>number</lemma>
<CharacterOffsetBegin>58</CharacterOffsetBegin>
<CharacterOffsetEnd>64</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="9">
<word>of</word>
<lemma>of</lemma>
<CharacterOffsetBegin>65</CharacterOffsetBegin>
<CharacterOffsetEnd>67</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="10">
<word>lawyers</word>
<lemma>lawyer</lemma>
<CharacterOffsetBegin>68</CharacterOffsetBegin>
<CharacterOffsetEnd>75</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="11">
<word>are</word>
<lemma>be</lemma>
<CharacterOffsetBegin>76</CharacterOffsetBegin>
<CharacterOffsetEnd>79</CharacterOffsetEnd>
<POS>VBP</POS>
</token>
<token id="12">
<word>in</word>
<lemma>in</lemma>
<CharacterOffsetBegin>80</CharacterOffsetBegin>
<CharacterOffsetEnd>82</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="13">
<word>a</word>
<lemma>a</lemma>
<CharacterOffsetBegin>83</CharacterOffsetBegin>
<CharacterOffsetEnd>84</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="14">
<word>state</word>
<lemma>state</lemma>
<CharacterOffsetBegin>85</CharacterOffsetBegin>
<CharacterOffsetEnd>90</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="15">
<word>of</word>
<lemma>of</lemma>
<CharacterOffsetBegin>91</CharacterOffsetBegin>
<CharacterOffsetEnd>93</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="16">
<word>flux</word>
<lemma>flux</lemma>
<CharacterOffsetBegin>94</CharacterOffsetBegin>
<CharacterOffsetEnd>98</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="17">
<word>,</word>
<lemma>,</lemma>
<CharacterOffsetBegin>98</CharacterOffsetBegin>
<CharacterOffsetEnd>99</CharacterOffsetEnd>
<POS>,</POS>
</token>
<token id="18">
<word>from</word>
<lemma>from</lemma>
<CharacterOffsetBegin>100</CharacterOffsetBegin>
<CharacterOffsetEnd>104</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="19">
<word>newly</word>
<lemma>newly</lemma>
<CharacterOffsetBegin>105</CharacterOffsetBegin>
<CharacterOffsetEnd>110</CharacterOffsetEnd>
<POS>RB</POS>
</token>
<token id="20">
<word>minted</word>
<lemma>mint</lemma>
<CharacterOffsetBegin>111</CharacterOffsetBegin>
<CharacterOffsetEnd>117</CharacterOffsetEnd>
<POS>VBN</POS>
</token>
<token id="21">
<word>law</word>
<lemma>law</lemma>
<CharacterOffsetBegin>118</CharacterOffsetBegin>
<CharacterOffsetEnd>121</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="22">
<word>school</word>
<lemma>school</lemma>
<CharacterOffsetBegin>122</CharacterOffsetBegin>
<CharacterOffsetEnd>128</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="23">
<word>graduates</word>
<lemma>graduate</lemma>
<CharacterOffsetBegin>129</CharacterOffsetBegin>
<CharacterOffsetEnd>138</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="24">
<word>looking</word>
<lemma>look</lemma>
<CharacterOffsetBegin>139</CharacterOffsetBegin>
<CharacterOffsetEnd>146</CharacterOffsetEnd>
<POS>VBG</POS>
</token>
<token id="25">
<word>for</word>
<lemma>for</lemma>
<CharacterOffsetBegin>147</CharacterOffsetBegin>
<CharacterOffsetEnd>150</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="26">
<word>their</word>
<lemma>they</lemma>
<CharacterOffsetBegin>151</CharacterOffsetBegin>
<CharacterOffsetEnd>156</CharacterOffsetEnd>
<POS>PRP$</POS>
</token>
<token id="27">
<word>first</word>
<lemma>first</lemma>
<CharacterOffsetBegin>157</CharacterOffsetBegin>
<CharacterOffsetEnd>162</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="28">
<word>job</word>
<lemma>job</lemma>
<CharacterOffsetBegin>163</CharacterOffsetBegin>
<CharacterOffsetEnd>166</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="29">
<word>,</word>
<lemma>,</lemma>
<CharacterOffsetBegin>166</CharacterOffsetBegin>
<CharacterOffsetEnd>167</CharacterOffsetEnd>
<POS>,</POS>
</token>
<token id="30">
<word>to</word>
<lemma>to</lemma>
<CharacterOffsetBegin>168</CharacterOffsetBegin>
<CharacterOffsetEnd>170</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="31">
<word>senior</word>
<lemma>senior</lemma>
<CharacterOffsetBegin>171</CharacterOffsetBegin>
<CharacterOffsetEnd>177</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="32">
<word>litigators</word>
<lemma>litigator</lemma>
<CharacterOffsetBegin>178</CharacterOffsetBegin>
<CharacterOffsetEnd>188</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="33">
<word>migrating</word>
<lemma>migrate</lemma>
<CharacterOffsetBegin>189</CharacterOffsetBegin>
<CharacterOffsetEnd>198</CharacterOffsetEnd>
<POS>VBG</POS>
</token>
<token id="34">
<word>to</word>
<lemma>to</lemma>
<CharacterOffsetBegin>199</CharacterOffsetBegin>
<CharacterOffsetEnd>201</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="35">
<word>new</word>
<lemma>new</lemma>
<CharacterOffsetBegin>202</CharacterOffsetBegin>
<CharacterOffsetEnd>205</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="36">
<word>challenges</word>
<lemma>challenge</lemma>
<CharacterOffsetBegin>206</CharacterOffsetBegin>
<CharacterOffsetEnd>216</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="37">
<word>with</word>
<lemma>with</lemma>
<CharacterOffsetBegin>217</CharacterOffsetBegin>
<CharacterOffsetEnd>221</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="38">
<word>new</word>
<lemma>new</lemma>
<CharacterOffsetBegin>222</CharacterOffsetBegin>
<CharacterOffsetEnd>225</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="39">
<word>firms</word>
<lemma>firm</lemma>
<CharacterOffsetBegin>226</CharacterOffsetBegin>
<CharacterOffsetEnd>231</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="40">
<word>.</word>
<lemma>.</lemma>
<CharacterOffsetBegin>231</CharacterOffsetBegin>
<CharacterOffsetEnd>232</CharacterOffsetEnd>
<POS>.</POS>
</token>
</tokens>
</sentence>
<sentence id="3">
<tokens>
<token id="1">
<word>The</word>
<lemma>the</lemma>
<CharacterOffsetBegin>233</CharacterOffsetBegin>
<CharacterOffsetEnd>236</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="2">
<word>one</word>
<lemma>one</lemma>
<CharacterOffsetBegin>237</CharacterOffsetBegin>
<CharacterOffsetEnd>240</CharacterOffsetEnd>
<POS>CD</POS>
</token>
<token id="3">
<word>certainty</word>
<lemma>certainty</lemma>
<CharacterOffsetBegin>241</CharacterOffsetBegin>
<CharacterOffsetEnd>250</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="4">
<word>is</word>
<lemma>be</lemma>
<CharacterOffsetBegin>251</CharacterOffsetBegin>
<CharacterOffsetEnd>253</CharacterOffsetEnd>
<POS>VBZ</POS>
</token>
<token id="5">
<word>that</word>
<lemma>that</lemma>
<CharacterOffsetBegin>254</CharacterOffsetBegin>
<CharacterOffsetEnd>258</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="6">
<word>lawyers</word>
<lemma>lawyer</lemma>
<CharacterOffsetBegin>259</CharacterOffsetBegin>
<CharacterOffsetEnd>266</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="7">
<word>new</word>
<lemma>new</lemma>
<CharacterOffsetBegin>267</CharacterOffsetBegin>
<CharacterOffsetEnd>270</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="8">
<word>to</word>
<lemma>to</lemma>
<CharacterOffsetBegin>271</CharacterOffsetBegin>
<CharacterOffsetEnd>273</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="9">
<word>any</word>
<lemma>any</lemma>
<CharacterOffsetBegin>274</CharacterOffsetBegin>
<CharacterOffsetEnd>277</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="10">
<word>firm</word>
<lemma>firm</lemma>
<CharacterOffsetBegin>278</CharacterOffsetBegin>
<CharacterOffsetEnd>282</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="11">
<word>need</word>
<lemma>need</lemma>
<CharacterOffsetBegin>283</CharacterOffsetBegin>
<CharacterOffsetEnd>287</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="12">
<word>care</word>
<lemma>care</lemma>
<CharacterOffsetBegin>288</CharacterOffsetBegin>
<CharacterOffsetEnd>292</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="13">
<word>and</word>
<lemma>and</lemma>
<CharacterOffsetBegin>293</CharacterOffsetBegin>
<CharacterOffsetEnd>296</CharacterOffsetEnd>
<POS>CC</POS>
</token>
<token id="14">
<word>feeding</word>
<lemma>feeding</lemma>
<CharacterOffsetBegin>297</CharacterOffsetBegin>
<CharacterOffsetEnd>304</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="15">
<word>in</word>
<lemma>in</lemma>
<CharacterOffsetBegin>305</CharacterOffsetBegin>
<CharacterOffsetEnd>307</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="16">
<word>myriad</word>
<lemma>myriad</lemma>
<CharacterOffsetBegin>308</CharacterOffsetBegin>
<CharacterOffsetEnd>314</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="17">
<word>ways</word>
<lemma>way</lemma>
<CharacterOffsetBegin>315</CharacterOffsetBegin>
<CharacterOffsetEnd>319</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="18">
<word>.</word>
<lemma>.</lemma>
<CharacterOffsetBegin>319</CharacterOffsetBegin>
<CharacterOffsetEnd>320</CharacterOffsetEnd>
<POS>.</POS>
</token>
</tokens>
</sentence>
<sentence id="4">
<tokens>
<token id="1">
<word>All</word>
<lemma>all</lemma>
<CharacterOffsetBegin>321</CharacterOffsetBegin>
<CharacterOffsetEnd>324</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="2">
<word>of</word>
<lemma>of</lemma>
<CharacterOffsetBegin>325</CharacterOffsetBegin>
<CharacterOffsetEnd>327</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="3">
<word>them</word>
<lemma>they</lemma>
<CharacterOffsetBegin>328</CharacterOffsetBegin>
<CharacterOffsetEnd>332</CharacterOffsetEnd>
<POS>PRP</POS>
</token>
<token id="4">
<word>need</word>
<lemma>need</lemma>
<CharacterOffsetBegin>333</CharacterOffsetBegin>
<CharacterOffsetEnd>337</CharacterOffsetEnd>
<POS>VBP</POS>
</token>
<token id="5">
<word>to</word>
<lemma>to</lemma>
<CharacterOffsetBegin>338</CharacterOffsetBegin>
<CharacterOffsetEnd>340</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="6">
<word>know</word>
<lemma>know</lemma>
<CharacterOffsetBegin>341</CharacterOffsetBegin>
<CharacterOffsetEnd>345</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="7">
<word>and</word>
<lemma>and</lemma>
<CharacterOffsetBegin>346</CharacterOffsetBegin>
<CharacterOffsetEnd>349</CharacterOffsetEnd>
<POS>CC</POS>
</token>
<token id="8">
<word>understand</word>
<lemma>understand</lemma>
<CharacterOffsetBegin>350</CharacterOffsetBegin>
<CharacterOffsetEnd>360</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="9">
<word>three</word>
<lemma>three</lemma>
<CharacterOffsetBegin>361</CharacterOffsetBegin>
<CharacterOffsetEnd>366</CharacterOffsetEnd>
<POS>CD</POS>
</token>
<token id="10">
<word>things</word>
<lemma>thing</lemma>
<CharacterOffsetBegin>367</CharacterOffsetBegin>
<CharacterOffsetEnd>373</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="11">
<word>:</word>
<lemma>:</lemma>
<CharacterOffsetBegin>373</CharacterOffsetBegin>
<CharacterOffsetEnd>374</CharacterOffsetEnd>
<POS>:</POS>
</token>
<token id="12">
<word>-LRB-</word>
<lemma>-lrb-</lemma>
<CharacterOffsetBegin>375</CharacterOffsetBegin>
<CharacterOffsetEnd>376</CharacterOffsetEnd>
<POS>-LRB-</POS>
</token>
<token id="13">
<word>1</word>
<lemma>1</lemma>
<CharacterOffsetBegin>376</CharacterOffsetBegin>
<CharacterOffsetEnd>377</CharacterOffsetEnd>
<POS>LS</POS>
</token>
<token id="14">
<word>-RRB-</word>
<lemma>-rrb-</lemma>
<CharacterOffsetBegin>377</CharacterOffsetBegin>
<CharacterOffsetEnd>378</CharacterOffsetEnd>
<POS>-RRB-</POS>
</token>
<token id="15">
<word>the</word>
<lemma>the</lemma>
<CharacterOffsetBegin>379</CharacterOffsetBegin>
<CharacterOffsetEnd>382</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="16">
<word>firm</word>
<lemma>firm</lemma>
<CharacterOffsetBegin>383</CharacterOffsetBegin>
<CharacterOffsetEnd>387</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="17">
<word>'s</word>
<lemma>'s</lemma>
<CharacterOffsetBegin>387</CharacterOffsetBegin>
<CharacterOffsetEnd>389</CharacterOffsetEnd>
<POS>POS</POS>
</token>
<token id="18">
<word>culture</word>
<lemma>culture</lemma>
<CharacterOffsetBegin>390</CharacterOffsetBegin>
<CharacterOffsetEnd>397</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="19">
<word>;</word>
<lemma>;</lemma>
<CharacterOffsetBegin>397</CharacterOffsetBegin>
<CharacterOffsetEnd>398</CharacterOffsetEnd>
<POS>:</POS>
</token>
<token id="20">
<word>-LRB-</word>
<lemma>-lrb-</lemma>
<CharacterOffsetBegin>399</CharacterOffsetBegin>
<CharacterOffsetEnd>400</CharacterOffsetEnd>
<POS>-LRB-</POS>
</token>
<token id="21">
<word>2</word>
<lemma>2</lemma>
<CharacterOffsetBegin>400</CharacterOffsetBegin>
<CharacterOffsetEnd>401</CharacterOffsetEnd>
<POS>LS</POS>
</token>
<token id="22">
<word>-RRB-</word>
<lemma>-rrb-</lemma>
<CharacterOffsetBegin>401</CharacterOffsetBegin>
<CharacterOffsetEnd>402</CharacterOffsetEnd>
<POS>-RRB-</POS>
</token>
<token id="23">
<word>the</word>
<lemma>the</lemma>
<CharacterOffsetBegin>403</CharacterOffsetBegin>
<CharacterOffsetEnd>406</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="24">
<word>resources</word>
<lemma>resource</lemma>
<CharacterOffsetBegin>407</CharacterOffsetBegin>
<CharacterOffsetEnd>416</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="25">
<word>available</word>
<lemma>available</lemma>
<CharacterOffsetBegin>417</CharacterOffsetBegin>
<CharacterOffsetEnd>426</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="26">
<word>to</word>
<lemma>to</lemma>
<CharacterOffsetBegin>427</CharacterOffsetBegin>
<CharacterOffsetEnd>429</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="27">
<word>help</word>
<lemma>help</lemma>
<CharacterOffsetBegin>430</CharacterOffsetBegin>
<CharacterOffsetEnd>434</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="28">
<word>them</word>
<lemma>they</lemma>
<CharacterOffsetBegin>435</CharacterOffsetBegin>
<CharacterOffsetEnd>439</CharacterOffsetEnd>
<POS>PRP</POS>
</token>
<token id="29">
<word>develop</word>
<lemma>develop</lemma>
<CharacterOffsetBegin>440</CharacterOffsetBegin>
<CharacterOffsetEnd>447</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="30">
<word>their</word>
<lemma>they</lemma>
<CharacterOffsetBegin>448</CharacterOffsetBegin>
<CharacterOffsetEnd>453</CharacterOffsetEnd>
<POS>PRP$</POS>
</token>
<token id="31">
<word>practices</word>
<lemma>practice</lemma>
<CharacterOffsetBegin>454</CharacterOffsetBegin>
<CharacterOffsetEnd>463</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="32">
<word>;</word>
<lemma>;</lemma>
<CharacterOffsetBegin>463</CharacterOffsetBegin>
<CharacterOffsetEnd>464</CharacterOffsetEnd>
<POS>:</POS>
</token>
<token id="33">
<word>and</word>
<lemma>and</lemma>
<CharacterOffsetBegin>465</CharacterOffsetBegin>
<CharacterOffsetEnd>468</CharacterOffsetEnd>
<POS>CC</POS>
</token>
<token id="34">
<word>-LRB-</word>
<lemma>-lrb-</lemma>
<CharacterOffsetBegin>469</CharacterOffsetBegin>
<CharacterOffsetEnd>470</CharacterOffsetEnd>
<POS>-LRB-</POS>
</token>
<token id="35">
<word>3</word>
<lemma>3</lemma>
<CharacterOffsetBegin>470</CharacterOffsetBegin>
<CharacterOffsetEnd>471</CharacterOffsetEnd>
<POS>LS</POS>
</token>
<token id="36">
<word>-RRB-</word>
<lemma>-rrb-</lemma>
<CharacterOffsetBegin>471</CharacterOffsetBegin>
<CharacterOffsetEnd>472</CharacterOffsetEnd>
<POS>-RRB-</POS>
</token>
<token id="37">
<word>where</word>
<lemma>where</lemma>
<CharacterOffsetBegin>473</CharacterOffsetBegin>
<CharacterOffsetEnd>478</CharacterOffsetEnd>
<POS>WRB</POS>
</token>
<token id="38">
<word>to</word>
<lemma>to</lemma>
<CharacterOffsetBegin>479</CharacterOffsetBegin>
<CharacterOffsetEnd>481</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="39">
<word>get</word>
<lemma>get</lemma>
<CharacterOffsetBegin>482</CharacterOffsetBegin>
<CharacterOffsetEnd>485</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="40">
<word>help</word>
<lemma>help</lemma>
<CharacterOffsetBegin>486</CharacterOffsetBegin>
<CharacterOffsetEnd>490</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="41">
<word>and</word>
<lemma>and</lemma>
<CharacterOffsetBegin>491</CharacterOffsetBegin>
<CharacterOffsetEnd>494</CharacterOffsetEnd>
<POS>CC</POS>
</token>
<token id="42">
<word>guidance</word>
<lemma>guidance</lemma>
<CharacterOffsetBegin>495</CharacterOffsetBegin>
<CharacterOffsetEnd>503</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="43">
<word>for</word>
<lemma>for</lemma>
<CharacterOffsetBegin>504</CharacterOffsetBegin>
<CharacterOffsetEnd>507</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="44">
<word>research</word>
<lemma>research</lemma>
<CharacterOffsetBegin>508</CharacterOffsetBegin>
<CharacterOffsetEnd>516</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="45">
<word>and</word>
<lemma>and</lemma>
<CharacterOffsetBegin>517</CharacterOffsetBegin>
<CharacterOffsetEnd>520</CharacterOffsetEnd>
<POS>CC</POS>
</token>
<token id="46">
<word>practice</word>
<lemma>practice</lemma>
<CharacterOffsetBegin>521</CharacterOffsetBegin>
<CharacterOffsetEnd>529</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="47">
<word>purposes</word>
<lemma>purpose</lemma>
<CharacterOffsetBegin>530</CharacterOffsetBegin>
<CharacterOffsetEnd>538</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="48">
<word>.</word>
<lemma>.</lemma>
<CharacterOffsetBegin>538</CharacterOffsetBegin>
<CharacterOffsetEnd>539</CharacterOffsetEnd>
<POS>.</POS>
</token>
</tokens>
</sentence>
<sentence id="5">
<tokens>
<token id="1">
<word>Obtaining</word>
<lemma>obtain</lemma>
<CharacterOffsetBegin>540</CharacterOffsetBegin>
<CharacterOffsetEnd>549</CharacterOffsetEnd>
<POS>VBG</POS>
</token>
<token id="2">
<word>a</word>
<lemma>a</lemma>
<CharacterOffsetBegin>550</CharacterOffsetBegin>
<CharacterOffsetEnd>551</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="3">
<word>thorough</word>
<lemma>thorough</lemma>
<CharacterOffsetBegin>552</CharacterOffsetBegin>
<CharacterOffsetEnd>560</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="4">
<word>understanding</word>
<lemma>understanding</lemma>
<CharacterOffsetBegin>561</CharacterOffsetBegin>
<CharacterOffsetEnd>574</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="5">
<word>of</word>
<lemma>of</lemma>
<CharacterOffsetBegin>575</CharacterOffsetBegin>
<CharacterOffsetEnd>577</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="6">
<word>a</word>
<lemma>a</lemma>
<CharacterOffsetBegin>578</CharacterOffsetBegin>
<CharacterOffsetEnd>579</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="7">
<word>new</word>
<lemma>new</lemma>
<CharacterOffsetBegin>580</CharacterOffsetBegin>
<CharacterOffsetEnd>583</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="8">
<word>firm</word>
<lemma>firm</lemma>
<CharacterOffsetBegin>584</CharacterOffsetBegin>
<CharacterOffsetEnd>588</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="9">
<word>'s</word>
<lemma>'s</lemma>
<CharacterOffsetBegin>588</CharacterOffsetBegin>
<CharacterOffsetEnd>590</CharacterOffsetEnd>
<POS>POS</POS>
</token>
<token id="10">
<word>workings</word>
<lemma>workings</lemma>
<CharacterOffsetBegin>591</CharacterOffsetBegin>
<CharacterOffsetEnd>599</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="11">
<word>may</word>
<lemma>may</lemma>
<CharacterOffsetBegin>600</CharacterOffsetBegin>
<CharacterOffsetEnd>603</CharacterOffsetEnd>
<POS>MD</POS>
</token>
<token id="12">
<word>be</word>
<lemma>be</lemma>
<CharacterOffsetBegin>604</CharacterOffsetBegin>
<CharacterOffsetEnd>606</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="13">
<word>the</word>
<lemma>the</lemma>
<CharacterOffsetBegin>607</CharacterOffsetBegin>
<CharacterOffsetEnd>610</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="14">
<word>greatest</word>
<lemma>greatest</lemma>
<CharacterOffsetBegin>611</CharacterOffsetBegin>
<CharacterOffsetEnd>619</CharacterOffsetEnd>
<POS>JJS</POS>
</token>
<token id="15">
<word>research</word>
<lemma>research</lemma>
<CharacterOffsetBegin>620</CharacterOffsetBegin>
<CharacterOffsetEnd>628</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="16">
<word>project</word>
<lemma>project</lemma>
<CharacterOffsetBegin>629</CharacterOffsetBegin>
<CharacterOffsetEnd>636</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="17">
<word>lawyers</word>
<lemma>lawyer</lemma>
<CharacterOffsetBegin>637</CharacterOffsetBegin>
<CharacterOffsetEnd>644</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="18">
<word>face</word>
<lemma>face</lemma>
<CharacterOffsetBegin>645</CharacterOffsetBegin>
<CharacterOffsetEnd>649</CharacterOffsetEnd>
<POS>VBP</POS>
</token>
<token id="19">
<word>.</word>
<lemma>.</lemma>
<CharacterOffsetBegin>649</CharacterOffsetBegin>
<CharacterOffsetEnd>650</CharacterOffsetEnd>
<POS>.</POS>
</token>
</tokens>
</sentence>
<sentence id="6">
<tokens>
<token id="1">
<word>How</word>
<lemma>how</lemma>
<CharacterOffsetBegin>651</CharacterOffsetBegin>
<CharacterOffsetEnd>654</CharacterOffsetEnd>
<POS>WRB</POS>
</token>
<token id="2">
<word>can</word>
<lemma>can</lemma>
<CharacterOffsetBegin>655</CharacterOffsetBegin>
<CharacterOffsetEnd>658</CharacterOffsetEnd>
<POS>MD</POS>
</token>
<token id="3">
<word>a</word>
<lemma>a</lemma>
<CharacterOffsetBegin>659</CharacterOffsetBegin>
<CharacterOffsetEnd>660</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="4">
<word>firm</word>
<lemma>firm</lemma>
<CharacterOffsetBegin>661</CharacterOffsetBegin>
<CharacterOffsetEnd>665</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="5">
<word>help</word>
<lemma>help</lemma>
<CharacterOffsetBegin>666</CharacterOffsetBegin>
<CharacterOffsetEnd>670</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="6">
<word>its</word>
<lemma>its</lemma>
<CharacterOffsetBegin>671</CharacterOffsetBegin>
<CharacterOffsetEnd>674</CharacterOffsetEnd>
<POS>PRP$</POS>
</token>
<token id="7">
<word>new</word>
<lemma>new</lemma>
<CharacterOffsetBegin>675</CharacterOffsetBegin>
<CharacterOffsetEnd>678</CharacterOffsetEnd>
<POS>JJ</POS>
</token>
<token id="8">
<word>lawyers</word>
<lemma>lawyer</lemma>
<CharacterOffsetBegin>679</CharacterOffsetBegin>
<CharacterOffsetEnd>686</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="9">
<word>learn</word>
<lemma>learn</lemma>
<CharacterOffsetBegin>687</CharacterOffsetBegin>
<CharacterOffsetEnd>692</CharacterOffsetEnd>
<POS>VBP</POS>
</token>
<token id="10">
<word>what</word>
<lemma>what</lemma>
<CharacterOffsetBegin>693</CharacterOffsetBegin>
<CharacterOffsetEnd>697</CharacterOffsetEnd>
<POS>WP</POS>
</token>
<token id="11">
<word>they</word>
<lemma>they</lemma>
<CharacterOffsetBegin>698</CharacterOffsetBegin>
<CharacterOffsetEnd>702</CharacterOffsetEnd>
<POS>PRP</POS>
</token>
<token id="12">
<word>need</word>
<lemma>need</lemma>
<CharacterOffsetBegin>703</CharacterOffsetBegin>
<CharacterOffsetEnd>707</CharacterOffsetEnd>
<POS>VBP</POS>
</token>
<token id="13">
<word>to</word>
<lemma>to</lemma>
<CharacterOffsetBegin>708</CharacterOffsetBegin>
<CharacterOffsetEnd>710</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="14">
<word>know</word>
<lemma>know</lemma>
<CharacterOffsetBegin>711</CharacterOffsetBegin>
<CharacterOffsetEnd>715</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="15">
<word>?</word>
<lemma>?</lemma>
<CharacterOffsetBegin>715</CharacterOffsetBegin>
<CharacterOffsetEnd>716</CharacterOffsetEnd>
<POS>.</POS>
</token>
</tokens>
</sentence>
<sentence id="7">
<tokens>
<token id="1">
<word>To</word>
<lemma>to</lemma>
<CharacterOffsetBegin>717</CharacterOffsetBegin>
<CharacterOffsetEnd>719</CharacterOffsetEnd>
<POS>TO</POS>
</token>
<token id="2">
<word>offer</word>
<lemma>offer</lemma>
<CharacterOffsetBegin>720</CharacterOffsetBegin>
<CharacterOffsetEnd>725</CharacterOffsetEnd>
<POS>VB</POS>
</token>
<token id="3">
<word>an</word>
<lemma>a</lemma>
<CharacterOffsetBegin>726</CharacterOffsetBegin>
<CharacterOffsetEnd>728</CharacterOffsetEnd>
<POS>DT</POS>
</token>
<token id="4">
<word>example</word>
<lemma>example</lemma>
<CharacterOffsetBegin>729</CharacterOffsetBegin>
<CharacterOffsetEnd>736</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="5">
<word>,</word>
<lemma>,</lemma>
<CharacterOffsetBegin>736</CharacterOffsetBegin>
<CharacterOffsetEnd>737</CharacterOffsetEnd>
<POS>,</POS>
</token>
<token id="6">
<word>here</word>
<lemma>here</lemma>
<CharacterOffsetBegin>738</CharacterOffsetBegin>
<CharacterOffsetEnd>742</CharacterOffsetEnd>
<POS>RB</POS>
</token>
<token id="7">
<word>are</word>
<lemma>be</lemma>
<CharacterOffsetBegin>743</CharacterOffsetBegin>
<CharacterOffsetEnd>746</CharacterOffsetEnd>
<POS>VBP</POS>
</token>
<token id="8">
<word>programs</word>
<lemma>program</lemma>
<CharacterOffsetBegin>747</CharacterOffsetBegin>
<CharacterOffsetEnd>755</CharacterOffsetEnd>
<POS>NNS</POS>
</token>
<token id="9">
<word>in</word>
<lemma>in</lemma>
<CharacterOffsetBegin>756</CharacterOffsetBegin>
<CharacterOffsetEnd>758</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="10">
<word>place</word>
<lemma>place</lemma>
<CharacterOffsetBegin>759</CharacterOffsetBegin>
<CharacterOffsetEnd>764</CharacterOffsetEnd>
<POS>NN</POS>
</token>
<token id="11">
<word>at</word>
<lemma>at</lemma>
<CharacterOffsetBegin>765</CharacterOffsetBegin>
<CharacterOffsetEnd>767</CharacterOffsetEnd>
<POS>IN</POS>
</token>
<token id="12">
<word>my</word>
<lemma>my</lemma>
<CharacterOffsetBegin>768</CharacterOffsetBegin>
<CharacterOffsetEnd>770</CharacterOffsetEnd>
<POS>PRP$</POS>
</token>
<token id="13">
<word>firm</word>
<lemma>firm</lemma>
<CharacterOffsetBegin>771</CharacterOffsetBegin>
<CharacterOffsetEnd>775</CharacterOffsetEnd>
<POS>NN</POS>
</token>
</tokens>
</sentence>
</sentences>
</document>
</root>
| 35.299213 | 61 | 0.514536 |
4151b30a33ccceab2e5f6222d8869a4f8309b7e3 | 4,199 | xml | XML | xdocs/jk2/confighowto.xml | apache/tomcat-connectors | e719874b21a526cb3447c747b9901719cf46eafe | [
"Apache-2.0"
] | 15 | 2015-04-12T06:17:35.000Z | 2021-11-09T21:28:46.000Z | xdocs/jk2/confighowto.xml | apache/tomcat-connectors | e719874b21a526cb3447c747b9901719cf46eafe | [
"Apache-2.0"
] | null | null | null | xdocs/jk2/confighowto.xml | apache/tomcat-connectors | e719874b21a526cb3447c747b9901719cf46eafe | [
"Apache-2.0"
] | 30 | 2015-02-05T09:44:19.000Z | 2022-03-05T13:55:50.000Z | <?xml version="1.0"?>
<document>
<copyright>
Licensed to the Apache Software Foundation (ASF) under one or more
contributor license agreements. See the NOTICE file distributed with
this work for additional information regarding copyright ownership.
The ASF licenses this file to You under the Apache License, Version 2.0
(the "License"); you may not use this file except in compliance with
the License. You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
</copyright>
<properties>
<title>Quick Start JK2 Configuration Guide</title>
<author email="mturk@mappingsoft.com">Mladen Turk</author>
</properties>
<section name="Introduction">
<p>
This document describes the configuration files used by JK2 on the
Tomcat and Web Server side:
<ul>
<li>
<b>jk2.properties</b> is used on the Tomcat side. It's installation path in
the $TOMCAT_HOME/conf directory.
</li>
<li>
<b>workers2.properties</b> is used on the webserver side. For the Apache
servers the default path is in the ServerRoot/conf directory.
</li>
</ul>
Although JK2 has many things in common with mod_jk, the configuration is quite
different, and all the directives should be inside the workers2.properties.
This enables JK2 to have the same configuration file no mater what the web server
it's connected to.
</p>
</section>
<section name="Minimum Configuration">
<p>
Minimum configuration is the simplest one to make the JK2 working. The used
channel will be socket, and lot of options are used by default. Both the
Tomcat and web server are on the same computer.
</p>
<p>
jk2.properties:
<source>
# The default port is 8009 but you can use another one
# channelSocket.port=8019
</source>
That is all needed on the Tomcat side to configure the JK2.
</p>
<p>
workers2.properties:
<source>
# Define the communication channel
[channel.socket:localhost:8009]
info=Ajp13 forwarding over socket
tomcatId=localhost:8009
# Map the Tomcat examples webapp to the Web server uri space
[uri:/examples/*]
info=Map the whole webapp
</source>
</p>
<p>
Start the Tomcat and Web server and browse to the <a>http://localhost/examples/</a>
</p>
</section>
<section name="Minimum JNI Configuration">
<p>
Minimum JNI configuration is the simplest one to make the Tomcat working
from inside the web server as inprocess. The only comunication channel used
is JNI. The JK2 will register all the native calls by itself, so there is
no need to specify the native library on Java side.
</p>
<p>
jk2.properties:
<source>
# Add the apr and channelJni to the list of handlers
handler.list=apr,request,container,channelJni
# The native libraries will be registered by JK2
apr.jniModeSo=inprocess
</source>
</p>
<p>
workers2.properties:
<source>
# Define the comunication channel
[channel.jni:jni]
info=The jni channel, used if tomcat is started inprocess
# Define the parameters for the Java Virtual Machine
[vm:]
info=Parameters used to load a JVM in the server process
OPT=-Djava.class.path=${TOMCAT_HOME}/lib/tomcat-jni.jar;${TOMCAT_HOME}/lib/tomcat.jar
OPT=-Dtomcat.home=${TOMCAT_HOME}
OPT=-Dcatalina.home=${TOMCAT_HOME}
OPT=-Xmx128M
# JNI worker startup handler
[worker.jni:onStartup]
info=Command to be executed by the VM on startup. This one will start tomcat.
class=org/apache/jk/apr/TomcatStarter
ARG=start
stdout=${serverRoot}/logs/stdout.log
stderr=${serverRoot}/logs/stderr.log
# JNI worker shutdown handler
[worker.jni:onShutdown]
info=Command to be executed by the VM on shutdown. This one will stop tomcat.
class=org/apache/jk/apr/TomcatStarter
ARG=stop
# Map the Tomcat examples webapp to the Web server uri space
[uri:/examples/*]
info=Map the whole webapp
</source>
</p>
<p>
Start the Web server and browse to the <a>http://localhost/examples/</a>
</p>
</section>
</document> | 31.810606 | 85 | 0.74994 |
8f925edb0c4a10f382cc2a9d97b66a98cbc15b91 | 2,059 | xml | XML | MalmoEnv/missions/default_world.xml | chemgymrl/malmo | 207e2530ec94af46450ba6d0e62d691ade91e282 | [
"MIT"
] | 1 | 2022-02-17T07:58:06.000Z | 2022-02-17T07:58:06.000Z | MalmoEnv/missions/default_world.xml | chemgymrl/malmo | 207e2530ec94af46450ba6d0e62d691ade91e282 | [
"MIT"
] | null | null | null | MalmoEnv/missions/default_world.xml | chemgymrl/malmo | 207e2530ec94af46450ba6d0e62d691ade91e282 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8" ?>
<Mission xmlns="http://ProjectMalmo.microsoft.com" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance">
<About>
<Summary>Everyday Minecraft life: survival</Summary>
</About>
<ServerSection>
<ServerHandlers>
<FlatWorldGenerator generatorString="2;7,2x3,2;4;decoration"/>
<ServerQuitFromTimeUp timeLimitMs="300000" description="out_of_time"/>
<ServerQuitWhenAnyAgentFinishes />
</ServerHandlers>
</ServerSection>
<AgentSection mode="Survival">
<Name>Rover</Name>
<AgentStart>
<!-- <Placement x="-203.5" y="81.0" z="217.5"/> -->
<Inventory>
<InventoryBlock quantity="10" slot="0" type="diamond_axe" />
</Inventory>
</AgentStart>
<AgentHandlers>
<ContinuousMovementCommands/>
<ObservationFromFullStats/>
<VideoProducer want_depth="false">
<Width>480</Width>
<Height>320</Height>
</VideoProducer>
<ObservationFromGrid>
<Grid name="board">
<min x="-1" y="-1" z="-1"/>
<max x="3" y="3" z="3"/>
</Grid>
</ObservationFromGrid>
<RewardForTouchingBlockType>
<Block type="leaves" reward="1000" />
</RewardForTouchingBlockType>
<RewardForMissionEnd rewardForDeath="-10000">
<Reward description="found_goal" reward="10000" />
<Reward description="out_of_time" reward="-1000000" />
</RewardForMissionEnd>
<AgentQuitFromCollectingItem>
<Item type="log" description="found_goal"/>
</AgentQuitFromCollectingItem>
</AgentHandlers>
</AgentSection>
</Mission> | 42.895833 | 109 | 0.499757 |
cb1a0669f4c0c31ccaa1aba32bffae62a79dd536 | 2,030 | xml | XML | research/object_detection/tsod/train/DC20_2302_TarSpot_6photo_1_2020-08-27-10-51-26.jpg_06_02.xml | plantbiojordan/models_py_tsod | 88593ee920880d764fec8332177041dd52967cce | [
"Apache-2.0"
] | null | null | null | research/object_detection/tsod/train/DC20_2302_TarSpot_6photo_1_2020-08-27-10-51-26.jpg_06_02.xml | plantbiojordan/models_py_tsod | 88593ee920880d764fec8332177041dd52967cce | [
"Apache-2.0"
] | null | null | null | research/object_detection/tsod/train/DC20_2302_TarSpot_6photo_1_2020-08-27-10-51-26.jpg_06_02.xml | plantbiojordan/models_py_tsod | 88593ee920880d764fec8332177041dd52967cce | [
"Apache-2.0"
] | null | null | null | <annotation>
<folder>Mary_WorkingImages</folder>
<filename>DC20_2302_TarSpot_6photo_1_2020-08-27-10-51-26.jpg_06_02.jpg</filename>
<path>/Volumes/ThompsonLab/Personnel/Elyse/Student_Folders/Mary_WorkingImages/DC20_2302_TarSpot_6photo_1_2020-08-27-10-51-26.jpg_06_02.jpg</path>
<source>
<database>Unknown</database>
</source>
<size>
<width>360</width>
<height>213</height>
<depth>3</depth>
</size>
<segmented>0</segmented>
<object>
<name>tarspot</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>71</xmin>
<ymin>137</ymin>
<xmax>81</xmax>
<ymax>148</ymax>
</bndbox>
</object>
<object>
<name>tarspot</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>24</xmin>
<ymin>172</ymin>
<xmax>30</xmax>
<ymax>179</ymax>
</bndbox>
</object>
<object>
<name>tarspot</name>
<pose>Unspecified</pose>
<truncated>1</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>55</xmin>
<ymin>206</ymin>
<xmax>62</xmax>
<ymax>213</ymax>
</bndbox>
</object>
<object>
<name>tarspot</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>235</xmin>
<ymin>32</ymin>
<xmax>252</xmax>
<ymax>49</ymax>
</bndbox>
</object>
<object>
<name>tarspot</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>90</xmin>
<ymin>45</ymin>
<xmax>95</xmax>
<ymax>52</ymax>
</bndbox>
</object>
<object>
<name>tarspot</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>2</xmin>
<ymin>135</ymin>
<xmax>8</xmax>
<ymax>142</ymax>
</bndbox>
</object>
<object>
<name>tarspot</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>245</xmin>
<ymin>80</ymin>
<xmax>251</xmax>
<ymax>87</ymax>
</bndbox>
</object>
</annotation>
| 20.505051 | 146 | 0.644335 |
ba2a3d2e4e6f164d41308a479f4394685a337d03 | 13,820 | xml | XML | xml/System.Web.UI/TemplateParser.xml | Alalajiyh/dotnet-api-docs.zh-cn | 990d6164e676dbb9cb9fa3142f12707eda9056d8 | [
"CC-BY-4.0",
"MIT"
] | null | null | null | xml/System.Web.UI/TemplateParser.xml | Alalajiyh/dotnet-api-docs.zh-cn | 990d6164e676dbb9cb9fa3142f12707eda9056d8 | [
"CC-BY-4.0",
"MIT"
] | null | null | null | xml/System.Web.UI/TemplateParser.xml | Alalajiyh/dotnet-api-docs.zh-cn | 990d6164e676dbb9cb9fa3142f12707eda9056d8 | [
"CC-BY-4.0",
"MIT"
] | null | null | null | <Type Name="TemplateParser" FullName="System.Web.UI.TemplateParser">
<Metadata><Meta Name="ms.openlocfilehash" Value="8cec35930f6bada0a377b16bbb6d5c8a275a1d9f" /><Meta Name="ms.sourcegitcommit" Value="bac13a81377b1c4ebf3990e3287a6f1700f73751" /><Meta Name="ms.translationtype" Value="MT" /><Meta Name="ms.contentlocale" Value="zh-CN" /><Meta Name="ms.lasthandoff" Value="03/19/2019" /><Meta Name="ms.locfileid" Value="57955473" /></Metadata><TypeSignature Language="C#" Value="public abstract class TemplateParser : System.Web.UI.BaseParser" />
<TypeSignature Language="ILAsm" Value=".class public auto ansi abstract beforefieldinit TemplateParser extends System.Web.UI.BaseParser" />
<TypeSignature Language="DocId" Value="T:System.Web.UI.TemplateParser" />
<TypeSignature Language="VB.NET" Value="Public MustInherit Class TemplateParser
Inherits BaseParser" />
<TypeSignature Language="C++ CLI" Value="public ref class TemplateParser abstract : System::Web::UI::BaseParser" />
<TypeSignature Language="F#" Value="type TemplateParser = class
 inherit BaseParser" />
<AssemblyInfo>
<AssemblyName>System.Web</AssemblyName>
<AssemblyVersion>1.0.5000.0</AssemblyVersion>
<AssemblyVersion>2.0.0.0</AssemblyVersion>
<AssemblyVersion>4.0.0.0</AssemblyVersion>
</AssemblyInfo>
<Base>
<BaseTypeName>System.Web.UI.BaseParser</BaseTypeName>
</Base>
<Interfaces />
<Docs>
<summary>用作 ASP.NET 文件分析器的抽象基类。</summary>
<remarks>
<format type="text/markdown"><![CDATA[
## Remarks
<xref:System.Web.UI.TemplateParser>类提供的分析器类的常见功能。 因为<xref:System.Web.UI.TemplateParser>类是抽象的不直接创建此类的实例。
]]></format>
</remarks>
<forInternalUseOnly />
<altmember cref="T:System.Web.UI.BaseTemplateParser" />
</Docs>
<Members>
<Member MemberName="CompileIntoType">
<MemberSignature Language="C#" Value="protected abstract Type CompileIntoType ();" />
<MemberSignature Language="ILAsm" Value=".method familyhidebysig newslot virtual instance class System.Type CompileIntoType() cil managed" />
<MemberSignature Language="DocId" Value="M:System.Web.UI.TemplateParser.CompileIntoType" />
<MemberSignature Language="VB.NET" Value="Protected MustOverride Function CompileIntoType () As Type" />
<MemberSignature Language="C++ CLI" Value="protected:
 abstract Type ^ CompileIntoType();" />
<MemberSignature Language="F#" Value="abstract member CompileIntoType : unit -> Type" Usage="templateParser.CompileIntoType " />
<MemberType>Method</MemberType>
<AssemblyInfo>
<AssemblyName>System.Web</AssemblyName>
<AssemblyVersion>1.0.5000.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.Type</ReturnType>
</ReturnValue>
<Parameters />
<Docs>
<summary>此成员支持 .NET Framework 结构，不能在代码中直接使用。</summary>
<returns>To be added.</returns>
<remarks>To be added.</remarks>
</Docs>
</Member>
<Member MemberName="ParseFile">
<MemberSignature Language="C#" Value="protected void ParseFile (string physicalPath, string virtualPath);" />
<MemberSignature Language="ILAsm" Value=".method familyhidebysig instance void ParseFile(string physicalPath, string virtualPath) cil managed" />
<MemberSignature Language="DocId" Value="M:System.Web.UI.TemplateParser.ParseFile(System.String,System.String)" />
<MemberSignature Language="VB.NET" Value="Protected Sub ParseFile (physicalPath As String, virtualPath As String)" />
<MemberSignature Language="C++ CLI" Value="protected:
 void ParseFile(System::String ^ physicalPath, System::String ^ virtualPath);" />
<MemberSignature Language="F#" Value="member this.ParseFile : string * string -> unit" Usage="templateParser.ParseFile (physicalPath, virtualPath)" />
<MemberType>Method</MemberType>
<AssemblyInfo>
<AssemblyName>System.Web</AssemblyName>
<AssemblyVersion>2.0.0.0</AssemblyVersion>
<AssemblyVersion>4.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.Void</ReturnType>
</ReturnValue>
<Parameters>
<Parameter Name="physicalPath" Type="System.String" Index="0" FrameworkAlternate="netframework-2.0;netframework-3.0;netframework-3.5;netframework-4.0;netframework-4.5;netframework-4.5.1;netframework-4.5.2;netframework-4.6;netframework-4.6.1;netframework-4.6.2;netframework-4.7;netframework-4.7.1;netframework-4.7.2;netframework-4.8" />
<Parameter Name="virtualPath" Type="System.String" Index="1" FrameworkAlternate="netframework-2.0;netframework-3.0;netframework-3.5;netframework-4.0;netframework-4.5;netframework-4.5.1;netframework-4.5.2;netframework-4.6;netframework-4.6.1;netframework-4.6.2;netframework-4.7;netframework-4.7.1;netframework-4.7.2;netframework-4.8" />
</Parameters>
<Docs>
<param name="physicalPath">要分析的文件的物理路径。 <paramref name="physicalPath" /> 优先于 <paramref name="virtualPath" />。</param>
<param name="virtualPath">要分析的文件的虚拟路径。</param>
<summary>分析由文件的虚拟或物理路径指定的文件的内容。</summary>
<remarks>
<format type="text/markdown"><![CDATA[
## Remarks
如果指定的物理路径，则它用于通过虚拟路径用于查找文件分析。
如果要分析的文件的路径是一个循环引用;也就是说，它引用当前解析分析器时，相同文件<xref:System.Web.HttpException>引发异常。
]]></format>
</remarks>
<exception cref="T:System.Web.HttpException"><paramref name="physicalPath" /> 或 <paramref name="virtualPath" /> 引用当前被分析的文件。</exception>
<forInternalUseOnly />
<altmember cref="M:System.Web.UI.TemplateParser.ProcessError(System.String)" />
</Docs>
</Member>
<Member MemberName="ParseTemplate">
<MemberSignature Language="C#" Value="public static System.Web.UI.ITemplate ParseTemplate (string content, string virtualPath, bool ignoreFilter);" />
<MemberSignature Language="ILAsm" Value=".method public static hidebysig class System.Web.UI.ITemplate ParseTemplate(string content, string virtualPath, bool ignoreFilter) cil managed" />
<MemberSignature Language="DocId" Value="M:System.Web.UI.TemplateParser.ParseTemplate(System.String,System.String,System.Boolean)" />
<MemberSignature Language="VB.NET" Value="Public Shared Function ParseTemplate (content As String, virtualPath As String, ignoreFilter As Boolean) As ITemplate" />
<MemberSignature Language="C++ CLI" Value="public:
 static System::Web::UI::ITemplate ^ ParseTemplate(System::String ^ content, System::String ^ virtualPath, bool ignoreFilter);" />
<MemberSignature Language="F#" Value="static member ParseTemplate : string * string * bool -> System.Web.UI.ITemplate" Usage="System.Web.UI.TemplateParser.ParseTemplate (content, virtualPath, ignoreFilter)" />
<MemberType>Method</MemberType>
<AssemblyInfo>
<AssemblyName>System.Web</AssemblyName>
<AssemblyVersion>4.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.Web.UI.ITemplate</ReturnType>
</ReturnValue>
<Parameters>
<Parameter Name="content" Type="System.String" Index="0" FrameworkAlternate="netframework-4.5;netframework-4.5.1;netframework-4.5.2;netframework-4.6;netframework-4.6.1;netframework-4.6.2;netframework-4.7;netframework-4.7.1;netframework-4.7.2;netframework-4.8" />
<Parameter Name="virtualPath" Type="System.String" Index="1" FrameworkAlternate="netframework-4.5;netframework-4.5.1;netframework-4.5.2;netframework-4.6;netframework-4.6.1;netframework-4.6.2;netframework-4.7;netframework-4.7.1;netframework-4.7.2;netframework-4.8" />
<Parameter Name="ignoreFilter" Type="System.Boolean" Index="2" FrameworkAlternate="netframework-4.5;netframework-4.5.1;netframework-4.5.2;netframework-4.6;netframework-4.6.1;netframework-4.6.2;netframework-4.7;netframework-4.7.1;netframework-4.7.2;netframework-4.8" />
</Parameters>
<Docs>
<param name="content">内容。</param>
<param name="virtualPath">虚拟路径。</param>
<param name="ignoreFilter">如果忽略该筛选器，则为 <see langword="true" />；否则为 <see langword="false" />。</param>
<summary>分析模块。</summary>
<returns>返回模板。</returns>
<remarks>To be added.</remarks>
<forInternalUseOnly />
</Docs>
</Member>
<Member MemberName="ProcessError">
<MemberSignature Language="C#" Value="protected void ProcessError (string message);" />
<MemberSignature Language="ILAsm" Value=".method familyhidebysig instance void ProcessError(string message) cil managed" />
<MemberSignature Language="DocId" Value="M:System.Web.UI.TemplateParser.ProcessError(System.String)" />
<MemberSignature Language="VB.NET" Value="Protected Sub ProcessError (message As String)" />
<MemberSignature Language="C++ CLI" Value="protected:
 void ProcessError(System::String ^ message);" />
<MemberSignature Language="F#" Value="member this.ProcessError : string -> unit" Usage="templateParser.ProcessError message" />
<MemberType>Method</MemberType>
<AssemblyInfo>
<AssemblyName>System.Web</AssemblyName>
<AssemblyVersion>2.0.0.0</AssemblyVersion>
<AssemblyVersion>4.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.Void</ReturnType>
</ReturnValue>
<Parameters>
<Parameter Name="message" Type="System.String" Index="0" FrameworkAlternate="netframework-2.0;netframework-3.0;netframework-3.5;netframework-4.0;netframework-4.5;netframework-4.5.1;netframework-4.5.2;netframework-4.6;netframework-4.6.1;netframework-4.6.2;netframework-4.7;netframework-4.7.1;netframework-4.7.2;netframework-4.8" />
</Parameters>
<Docs>
<param name="message">用于创建新的 <see cref="T:System.Web.ParserError" /> 的错误消息文本。</param>
<summary>通过使用指定信息创建新的 <see cref="T:System.Web.ParserError" /> 对象并将其添加到 <see cref="T:System.Web.ParserErrorCollection" /> 集合来报告处理错误。</summary>
<remarks>To be added.</remarks>
<forInternalUseOnly />
<altmember cref="M:System.Web.UI.TemplateParser.ProcessException(System.Exception)" />
<altmember cref="T:System.Web.ParserError" />
<altmember cref="T:System.Web.ParserErrorCollection" />
</Docs>
</Member>
<Member MemberName="ProcessException">
<MemberSignature Language="C#" Value="protected void ProcessException (Exception ex);" />
<MemberSignature Language="ILAsm" Value=".method familyhidebysig instance void ProcessException(class System.Exception ex) cil managed" />
<MemberSignature Language="DocId" Value="M:System.Web.UI.TemplateParser.ProcessException(System.Exception)" />
<MemberSignature Language="VB.NET" Value="Protected Sub ProcessException (ex As Exception)" />
<MemberSignature Language="C++ CLI" Value="protected:
 void ProcessException(Exception ^ ex);" />
<MemberSignature Language="F#" Value="member this.ProcessException : Exception -> unit" Usage="templateParser.ProcessException ex" />
<MemberType>Method</MemberType>
<AssemblyInfo>
<AssemblyName>System.Web</AssemblyName>
<AssemblyVersion>2.0.0.0</AssemblyVersion>
<AssemblyVersion>4.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.Void</ReturnType>
</ReturnValue>
<Parameters>
<Parameter Name="ex" Type="System.Exception" Index="0" FrameworkAlternate="netframework-2.0;netframework-3.0;netframework-3.5;netframework-4.0;netframework-4.5;netframework-4.5.1;netframework-4.5.2;netframework-4.6;netframework-4.6.1;netframework-4.6.2;netframework-4.7;netframework-4.7.1;netframework-4.7.2;netframework-4.8" />
</Parameters>
<Docs>
<param name="ex">用于创建新的 <see cref="T:System.Exception" /> 的 <see cref="T:System.Web.ParserError" />。</param>
<summary>通过创建新的 <see cref="T:System.Web.ParserError" /> 对象作为指定的 <see cref="T:System.Exception" /> 异常并将其添加到 <see cref="T:System.Web.ParserErrorCollection" /> 集合来报告分析器异常。</summary>
<remarks>To be added.</remarks>
<exception cref="T:System.Web.HttpCompileException">要处理的 <see cref="T:System.Exception" /> 是编译器错误。</exception>
<forInternalUseOnly />
<altmember cref="M:System.Web.UI.TemplateParser.ProcessError(System.String)" />
<altmember cref="T:System.Web.HttpCompileException" />
<altmember cref="T:System.Web.ParserError" />
<altmember cref="T:System.Web.ParserErrorCollection" />
</Docs>
</Member>
<Member MemberName="Text">
<MemberSignature Language="C#" Value="public string Text { get; }" />
<MemberSignature Language="ILAsm" Value=".property instance string Text" />
<MemberSignature Language="DocId" Value="P:System.Web.UI.TemplateParser.Text" />
<MemberSignature Language="VB.NET" Value="Public ReadOnly Property Text As String" />
<MemberSignature Language="C++ CLI" Value="public:
 property System::String ^ Text { System::String ^ get(); };" />
<MemberSignature Language="F#" Value="member this.Text : string" Usage="System.Web.UI.TemplateParser.Text" />
<MemberType>Property</MemberType>
<AssemblyInfo>
<AssemblyName>System.Web</AssemblyName>
<AssemblyVersion>4.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.String</ReturnType>
</ReturnValue>
<Docs>
<summary>获取包含要解析的数据字符串。</summary>
<value>要解析的数据。</value>
<remarks>To be added.</remarks>
<forInternalUseOnly />
</Docs>
</Member>
</Members>
</Type> | 67.087379 | 478 | 0.69356 |
f2a884f290a4f92102777a657dc5ac46f7a5a20d | 833 | csproj | XML | src/libraries/Microsoft.XmlSerializer.Generator/tests/SerializableAssembly.csproj | pyracanda/runtime | 72bee25ab532a4d0636118ec2ed3eabf3fd55245 | [
"MIT"
] | 9,402 | 2019-11-25T23:26:24.000Z | 2022-03-31T23:19:41.000Z | src/libraries/Microsoft.XmlSerializer.Generator/tests/SerializableAssembly.csproj | pyracanda/runtime | 72bee25ab532a4d0636118ec2ed3eabf3fd55245 | [
"MIT"
] | 37,522 | 2019-11-25T23:30:32.000Z | 2022-03-31T23:58:30.000Z | src/libraries/Microsoft.XmlSerializer.Generator/tests/SerializableAssembly.csproj | pyracanda/runtime | 72bee25ab532a4d0636118ec2ed3eabf3fd55245 | [
"MIT"
] | 3,629 | 2019-11-25T23:29:16.000Z | 2022-03-31T21:52:28.000Z | <Project Sdk="Microsoft.NET.Sdk">
<PropertyGroup>
<!-- We need a separate assembly in order to run SGen during the test build because if we just run
SGen on the test assembly itself, everytime we move the shared framework assemblies to VNext.0.0
or to target a new TFM, since we use the SDK to invoke SGen and there is no recent SDK with
VNext.0.0 then SGen fails when it tries to load the types to serialize. -->
<TargetFrameworks>netstandard2.1</TargetFrameworks>
</PropertyGroup>
<ItemGroup>
<PackageReference Include="Microsoft.Build.Tasks.Core" Version="14.3.0">
<PrivateAssets>all</PrivateAssets>
</PackageReference>
</ItemGroup>
<ItemGroup>
<Compile Include="$(TestSourceFolder)..\..\System.Runtime.Serialization.Xml\tests\SerializationTypes.cs" />
</ItemGroup>
</Project>
| 39.666667 | 111 | 0.726291 |
0a5fe798d5e868dae49cbf9d8b18f3119537e36b | 13,034 | filters | XML | build/Tests/UnitTests/Foundation/Foundation.UnitTests.vcxproj.filters | crossmob/WinObjC | 7bec24671c4c18b81aaf85eff2887438f18a697c | [
"MIT"
] | 6,717 | 2015-08-06T18:04:37.000Z | 2019-05-04T12:38:51.000Z | build/Tests/UnitTests/Foundation/Foundation.UnitTests.vcxproj.filters | Michael-Young48/WinObjC | 7bec24671c4c18b81aaf85eff2887438f18a697c | [
"MIT"
] | 2,711 | 2015-08-06T18:41:09.000Z | 2019-04-29T12:14:23.000Z | build/Tests/UnitTests/Foundation/Foundation.UnitTests.vcxproj.filters | Michael-Young48/WinObjC | 7bec24671c4c18b81aaf85eff2887438f18a697c | [
"MIT"
] | 1,021 | 2015-08-06T18:08:56.000Z | 2019-04-14T06:50:57.000Z | <?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="4.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<ItemGroup>
<ClCompile Include="$(StarboardBasePath)\tests\unittests\EntryPoint.cpp" />
</ItemGroup>
<ItemGroup>
<ClInclude Include="$(StarboardBasePath)\tests\unittests\Foundation\RuntimeTestHelpers.h" />
</ItemGroup>
<ItemGroup>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSRangeTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSDictionaryTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSInvocationTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSRegularExpressionTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSSortDescriptorTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSLockTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSRecursiveLockTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ArchivalTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\CoreFoundationTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSArrayTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSAttributedStringTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSBundleTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSCachedURLResponseTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSCharacterSetTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSComparisonPredicateTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSCompoundPredicateTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSConditionTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSCountedSetTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSDataTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSDateComponentsTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSDateFormatterTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSExpressionTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSFileManagerTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSJSONSerializationTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSLocaleTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSMapTableTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSMutableURLRequestTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSNumberTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSObjectTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSObject_NSKeyValueArrayAdaptersTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSObject_CancelPreviousPerformRequests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSOperationTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSPointerArrayTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSPointerFunctionsTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSPredicateTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSProcessInfoTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSProgressTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSProxyTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSStringTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSTimeZoneTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLCacheTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLCredentialStorageTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLCredentialTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLProtectionSpaceTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLProtocolTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLRequestTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLSessionConfigurationTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSTimerTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSValueTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\RuntimeTestHelpers.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\RuntimeTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\CFStringTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSIndexSetTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSThreadTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\UnitTests\Foundation\NSRunLoopTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSArray.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSData.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSDictionary.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSNumber.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSSet.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSString.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSCharacterSet.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSBundle.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSDate.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSDateFormatter.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSURL.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSURLRequest.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSURLResponse.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestUtils.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSSetTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLComponentsTests.m" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSGenericsTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSErrorTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSLocale.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSNumberFormatter.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSLocale.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSFileHandleTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSPropertyList.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSCalendarTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSCalendar.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSMutableOrderedSetTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSKeyValueCodingTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSOrderedSetTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSPropertyListSerializationTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\TestUtils.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSNotificationTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSObject_KeyValueObservationTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSCacheTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSTimeZone.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\ReferenceFoundation\TestNSStream.mm">
<Filter>ReferenceFoundation</Filter>
</ClangCompile>
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSURLResponseTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSUndoManagerTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSDecimalNumberTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\UnitTests\Foundation\NSURLSessionTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\UnitTests\Foundation\NSIndexPathTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSNullTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSInvocationOperationTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\UnitTests\Foundation\NSObject_NSKeyValueValidation.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\UnitTests\Foundation\NSObject_NSKeyValueSetAdaptersTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\UnitTests\Foundation\NSObject_NSKeyValueOrderedSetAdaptersTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSUUIDTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSScannerTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\FoundationTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\NSNotificationQueueTests.mm" />
<ClangCompile Include="$(StarboardBasePath)\tests\unittests\Foundation\DispatchTests.mm" />
</ItemGroup>
<ItemGroup>
<Text Include="..\..\..\tests\unittests\Foundation\NSFileManagerUT.txt" />
<Text Include="..\..\..\tests\unittests\Foundation\NSFileHandleTestFile.txt" />
</ItemGroup>
<ItemGroup>
<Filter Include="ReferenceFoundation">
<UniqueIdentifier>{1beaf0a2-ff8a-415b-ac31-aeb41c89f25d}</UniqueIdentifier>
</Filter>
</ItemGroup>
</Project> | 78.518072 | 124 | 0.782799 |
0a6f403064f36709b3158ecfa904f59ca5e7eba9 | 2,788 | xml | XML | data/images/test/z = 12 m.xml | andreanapoletani/object_detection_demo | b99bc106766b6ea7f703e4fbc416e235e6387ed2 | [
"MIT"
] | null | null | null | data/images/test/z = 12 m.xml | andreanapoletani/object_detection_demo | b99bc106766b6ea7f703e4fbc416e235e6387ed2 | [
"MIT"
] | null | null | null | data/images/test/z = 12 m.xml | andreanapoletani/object_detection_demo | b99bc106766b6ea7f703e4fbc416e235e6387ed2 | [
"MIT"
] | null | null | null | <annotation>
<folder>cropped_images</folder>
<filename>z = 12 m.jpg</filename>
<path>C:\Users\andre\Desktop\cropped_images\z = 12 m.jpg</path>
<source>
<database>Unknown</database>
</source>
<size>
<width>720</width>
<height>720</height>
<depth>3</depth>
</size>
<segmented>0</segmented>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>1</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1</xmin>
<ymin>235</ymin>
<xmax>13</xmax>
<ymax>255</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>55</xmin>
<ymin>231</ymin>
<xmax>69</xmax>
<ymax>253</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>109</xmin>
<ymin>229</ymin>
<xmax>126</xmax>
<ymax>251</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>169</xmin>
<ymin>223</ymin>
<xmax>188</xmax>
<ymax>248</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>233</xmin>
<ymin>219</ymin>
<xmax>249</xmax>
<ymax>246</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>298</xmin>
<ymin>214</ymin>
<xmax>315</xmax>
<ymax>242</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>368</xmin>
<ymin>213</ymin>
<xmax>385</xmax>
<ymax>238</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>439</xmin>
<ymin>209</ymin>
<xmax>455</xmax>
<ymax>234</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>513</xmin>
<ymin>204</ymin>
<xmax>530</xmax>
<ymax>232</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>588</xmin>
<ymin>198</ymin>
<xmax>608</xmax>
<ymax>225</ymax>
</bndbox>
</object>
<object>
<name>cone</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>671</xmin>
<ymin>195</ymin>
<xmax>689</xmax>
<ymax>225</ymax>
</bndbox>
</object>
</annotation>
| 18.965986 | 64 | 0.616571 |
812ed5ee510377f980d25fb81ce7995e44860a97 | 433 | xml | XML | .idea/copyright/buahin.xml | SimiPrambos/buahin | 5c6a2cd40ac9e96dbfb61eefba9654b5f0fd6636 | [
"MIT"
] | null | null | null | .idea/copyright/buahin.xml | SimiPrambos/buahin | 5c6a2cd40ac9e96dbfb61eefba9654b5f0fd6636 | [
"MIT"
] | null | null | null | .idea/copyright/buahin.xml | SimiPrambos/buahin | 5c6a2cd40ac9e96dbfb61eefba9654b5f0fd6636 | [
"MIT"
] | null | null | null | <component name="CopyrightManager">
<copyright>
<option name="notice" value="Copyright (C) 2021 SimiPrambos <simi.prambos@gmail.com> - All Rights Reserved &#36;file.fileName &#36;project.name <https://github.com/SimiPrambos/buahin.git> UI Design by Afsar <https://www.figma.com/community/file/882645007956337261>" />
<option name="myName" value="buahin" />
</copyright>
</component> | 72.166667 | 311 | 0.720554 |
96e238f75bee282f2a7a937504600327084261fa | 156 | xml | XML | res/values/colors.xml | wangjia55/QuickReturnListView | 328f2f881418aa7ae3755c6ddd3519cac40b4a37 | [
"Apache-2.0"
] | 212 | 2015-01-01T18:29:14.000Z | 2021-09-15T22:16:21.000Z | res/values/colors.xml | ranjithstar256/QuickReturnListView | 328f2f881418aa7ae3755c6ddd3519cac40b4a37 | [
"Apache-2.0"
] | 3 | 2015-04-03T05:55:30.000Z | 2016-07-24T13:42:50.000Z | res/values/colors.xml | ranjithstar256/QuickReturnListView | 328f2f881418aa7ae3755c6ddd3519cac40b4a37 | [
"Apache-2.0"
] | 80 | 2015-01-05T02:50:40.000Z | 2022-03-02T10:15:00.000Z | <resources>
<color name="top_item">#a6c</color>
<color name="sticky_item">#f44</color>
<color name="sticky_item_text">#fff</color>
</resources>
| 26 | 47 | 0.666667 |
a8564e625cbb526f1a754716a93c3fd10dec9fc7 | 5,213 | csproj | XML | WarsawCityGameServer/WarsawCityGamesServer.DataAccess/WarsawCityGamesServer.DataAccess.csproj | Koteczeg/WarsawCityGame | 40769f8e92ae6c20de53814b6d7025ed5052762b | [
"MIT"
] | null | null | null | WarsawCityGameServer/WarsawCityGamesServer.DataAccess/WarsawCityGamesServer.DataAccess.csproj | Koteczeg/WarsawCityGame | 40769f8e92ae6c20de53814b6d7025ed5052762b | [
"MIT"
] | null | null | null | WarsawCityGameServer/WarsawCityGamesServer.DataAccess/WarsawCityGamesServer.DataAccess.csproj | Koteczeg/WarsawCityGame | 40769f8e92ae6c20de53814b6d7025ed5052762b | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="14.0" DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<Import Project="$(MSBuildExtensionsPath)\$(MSBuildToolsVersion)\Microsoft.Common.props" Condition="Exists('$(MSBuildExtensionsPath)\$(MSBuildToolsVersion)\Microsoft.Common.props')" />
<PropertyGroup>
<Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
<Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
<ProjectGuid>{76285842-CF7E-40CA-B32D-90789AE7137C}</ProjectGuid>
<OutputType>Library</OutputType>
<AppDesignerFolder>Properties</AppDesignerFolder>
<RootNamespace>WarsawCityGamesServer.DataAccess</RootNamespace>
<AssemblyName>WarsawCityGamesServer.DataAccess</AssemblyName>
<TargetFrameworkVersion>v4.5.2</TargetFrameworkVersion>
<FileAlignment>512</FileAlignment>
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
<DebugSymbols>true</DebugSymbols>
<DebugType>full</DebugType>
<Optimize>false</Optimize>
<OutputPath>bin\Debug\</OutputPath>
<DefineConstants>DEBUG;TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
<DebugType>pdbonly</DebugType>
<Optimize>true</Optimize>
<OutputPath>bin\Release\</OutputPath>
<DefineConstants>TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<ItemGroup>
<Reference Include="EntityFramework">
<HintPath>..\packages\EntityFramework.6.1.3\lib\net45\EntityFramework.dll</HintPath>
</Reference>
<Reference Include="Microsoft.AspNet.Identity.Core">
<HintPath>..\packages\Microsoft.AspNet.Identity.Core.2.2.1\lib\net45\Microsoft.AspNet.Identity.Core.dll</HintPath>
</Reference>
<Reference Include="Microsoft.AspNet.Identity.EntityFramework">
<HintPath>..\packages\Microsoft.AspNet.Identity.EntityFramework.2.2.1\lib\net45\Microsoft.AspNet.Identity.EntityFramework.dll</HintPath>
</Reference>
<Reference Include="System" />
<Reference Include="System.Core" />
<Reference Include="System.Web" />
<Reference Include="System.Web.Http">
<HintPath>..\packages\Microsoft.AspNet.WebApi.Core.5.2.3\lib\net45\System.Web.Http.dll</HintPath>
</Reference>
<Reference Include="System.Xml.Linq" />
<Reference Include="System.Data.DataSetExtensions" />
<Reference Include="Microsoft.CSharp" />
<Reference Include="System.Data" />
<Reference Include="System.Net.Http" />
<Reference Include="System.Xml" />
</ItemGroup>
<ItemGroup>
<Compile Include="DataAccessServices\Instances\AchievementsService.cs" />
<Compile Include="DataAccessServices\Instances\FriendshipsService.cs" />
<Compile Include="DataAccessServices\Instances\MissionHistoryService.cs" />
<Compile Include="DataAccessServices\Instances\MissionService.cs" />
<Compile Include="DataAccessServices\Instances\PlayerService.cs" />
<Compile Include="DataAccessServices\Instances\RankingService.cs" />
<Compile Include="DataAccessServices\Instances\UserProfileService.cs" />
<Compile Include="DataAccessServices\Interfaces\IAchievementsService.cs" />
<Compile Include="DataAccessServices\Interfaces\IFriendshipsService.cs" />
<Compile Include="DataAccessServices\Interfaces\IMissionHistoryService.cs" />
<Compile Include="DataAccessServices\Interfaces\IMissionService.cs" />
<Compile Include="DataAccessServices\Interfaces\IPlayerService.cs" />
<Compile Include="DataAccessServices\Interfaces\IRankingService.cs" />
<Compile Include="DataAccessServices\Interfaces\IUserProfileService.cs" />
<Compile Include="GenericRepository\GenericRepository.cs" />
<Compile Include="IUnitOfWork.cs" />
<Compile Include="Properties\AssemblyInfo.cs" />
<Compile Include="UnitOfWork.cs" />
</ItemGroup>
<ItemGroup>
<ProjectReference Include="..\WarsawCityGamesServer.Common\WarsawCityGamesServer.Common.csproj">
<Project>{E83ACFCD-1FCB-4D55-BC75-136ED3AEA983}</Project>
<Name>WarsawCityGamesServer.Common</Name>
</ProjectReference>
<ProjectReference Include="..\WarsawCityGamesServer.Entities\WarsawCityGamesServer.Entities.csproj">
<Project>{C45CA7DC-FE60-4C69-B6FA-6F8C96B3A560}</Project>
<Name>WarsawCityGamesServer.Entities</Name>
</ProjectReference>
<ProjectReference Include="..\WarsawCityGamesServer.Models\WarsawCityGamesServer.Models.csproj">
<Project>{5AFB1E01-6751-4CD0-ABC2-65AB63C59F61}</Project>
<Name>WarsawCityGamesServer.Models</Name>
</ProjectReference>
</ItemGroup>
<ItemGroup>
<None Include="app.config" />
</ItemGroup>
<Import Project="$(MSBuildToolsPath)\Microsoft.CSharp.targets" />
<!-- To modify your build process, add your task inside one of the targets below and uncomment it.
Other similar extension points exist, see Microsoft.Common.targets.
<Target Name="BeforeBuild">
</Target>
<Target Name="AfterBuild">
</Target>
-->
</Project> | 52.13 | 186 | 0.739497 |
af77480d4277f97db012aed4fc791f4b3d2758a9 | 6,475 | xml | XML | com.tk.orm/mappers/STATIONMapper.xml | chliam/DAM | 0533a123abd16a49822380494893eb9f86ab8cf3 | [
"Apache-2.0"
] | null | null | null | com.tk.orm/mappers/STATIONMapper.xml | chliam/DAM | 0533a123abd16a49822380494893eb9f86ab8cf3 | [
"Apache-2.0"
] | null | null | null | com.tk.orm/mappers/STATIONMapper.xml | chliam/DAM | 0533a123abd16a49822380494893eb9f86ab8cf3 | [
"Apache-2.0"
] | 2 | 2015-09-07T14:59:29.000Z | 2020-11-04T04:18:12.000Z | <?xml version="1.0" encoding="UTF-8" ?>
<sqlMap namespace="EntityModel" xmlns="http://ibatis.apache.org/mapping"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance">
<alias>
<!--类的别名-->
<typeAlias alias="station" type="com.tk.orm.model.station,com.tk.orm"/>
</alias>
<parameterMaps>
<parameterMap id="station_params">
<parameter property="sId" column="sId" type="int" dbType="int" ></parameter>
<parameter property="sName" column="sName" dbType="Varchar" ></parameter>
<parameter property="sStatus" column="sStatus" type="int" dbType="int" ></parameter>
<parameter property="sSn" column="sSn" type="int" dbType="int" ></parameter>
<parameter property="sComment" column="sComment" dbType="Varchar" ></parameter>
<parameter property="Sx" column="Sx" type="double" dbType="float" ></parameter>
<parameter property="Sy" column="Sy" type="double" dbType="float" ></parameter>
<parameter property="Sh" column="Sh" type="double" dbType="float" ></parameter>
<parameter property="sB" column="sB" type="double" dbType="float" ></parameter>
<parameter property="sL" column="sL" type="double" dbType="float" ></parameter>
<parameter property="sHeight" column="sHeight" type="double" dbType="float" ></parameter>
<parameter property="sCoorName" column="sCoorName" dbType="Varchar" ></parameter>
<parameter property="sSpeedName" column="sSpeedName" dbType="Varchar" ></parameter>
<parameter property="sStyle" column="sStyle" type="int" dbType="int" ></parameter>
<parameter property="s1x" column="s1x" type="double" dbType="float" ></parameter>
<parameter property="s1y" column="s1y" type="double" dbType="float" ></parameter>
<parameter property="s1h" column="s1h" type="double" dbType="float" ></parameter>
</parameterMap>
</parameterMaps>
<resultMaps>
<resultMap id="stationResult" class="station">
<result property="sId" column="sId"/>
<result property="sName" column="sName"/>
<result property="sStatus" column="sStatus"/>
<result property="sSn" column="sSn"/>
<result property="sComment" column="sComment"/>
<result property="Sx" column="Sx"/>
<result property="Sy" column="Sy"/>
<result property="Sh" column="Sh"/>
<result property="sB" column="sB"/>
<result property="sL" column="sL"/>
<result property="sHeight" column="sHeight"/>
<result property="sCoorName" column="sCoorName"/>
<result property="sSpeedName" column="sSpeedName"/>
<result property="sStyle" column="sStyle"/>
<result property="s1x" column="s1x"/>
<result property="s1y" column="s1y"/>
<result property="s1h" column="s1h"/>
</resultMap>
</resultMaps>
<statements>
<!--查询所有记录-->
<select id="SelectAllstation" resultMap="stationResult">
<![CDATA[SELECT
sId,
sName,
sStatus,
sSn,
sComment,
Sx,
Sy,
Sh,
sB,
sL,
sHeight,
sCoorName,
sSpeedName,
sStyle,
s1x,
s1y,
s1h
FROM station]]>
</select>
<!--查询单条记录-->
<select id="SelectstationById" parameterClass="int" resultMap="stationResult" extends="SelectAllstation">
<![CDATA[ where sId = #value# ]]>
</select>
<!--插入新记录-->
<insert id="Insertstation" parameterClass="station">
select 1;
<!--id自动生成的示例用法-->
<selectKey property="sId" type="post" resultClass="int">
<![CDATA[
INSERT into station(sName, sStatus, sSn, sComment, Sx, Sy, Sh, sB, sL, sHeight, sCoorName, sSpeedName, sStyle, s1x, s1y, s1h )
VALUES(#sName#, #sStatus#, #sSn#, #sComment#, #Sx#, #Sy#, #Sh#, #sB#, #sL#, #sHeight#, #sCoorName#, #sSpeedName#, #sStyle#, #s1x#, #s1y#, #s1h# )
SELECT SCOPE_IDENTITY() as sId
]]>
</selectKey>
</insert>
<!--更新单条记录-->
<update id="Updatestation" parameterClass="station">
<![CDATA[Update station
SET
sName=#sName#
,
sStatus=#sStatus#
,
sSn=#sSn#
,
sComment=#sComment#
,
Sx=#Sx#
,
Sy=#Sy#
,
Sh=#Sh#
,
sB=#sB#
,
sL=#sL#
,
sHeight=#sHeight#
,
sCoorName=#sCoorName#
,
sSpeedName=#sSpeedName#
,
sStyle=#sStyle#
,
s1x=#s1x#
,
s1y=#s1y#
,
s1h=#s1h#
Where sId=#sId#]]>
</update>
<!--根据主键删除单条记录-->
<delete id="DeletestationById" parameterClass="int">
<![CDATA[Delete From station Where sId=#value#]]>
</delete>
<select id="SelectstationQuery" parameterMap="station_params" resultMap="stationResult">
select
a.sId,
a.sName,
a.sStatus,
a.sSn,
a.sComment,
a.Sx,
a.Sy,
a.Sh,
a.sB,
a.sL,
a.sHeight,
a.sCoorName,
a.sSpeedName,
a.sStyle,
a.s1x,
a.s1y,
a.s1h,
from station a
<dynamic prepend="where">
<isPropertyAvailable prepend="" property="sId">
<isGreaterThan prepend="and" property="sId" compareValue="0">
a.sId = #sId#
</isGreaterThan>
</isPropertyAvailable>
</dynamic>
<!--order by-->
<dynamic>
order by
a.sId
</dynamic>
</select>
</statements>
</sqlMap>
| 33.900524 | 154 | 0.484942 |
fd844cfbe2c5662f7f407fc928c589fd31d376b3 | 63,138 | xml | XML | data/Phase_1_CPD/assessment/Final_Exam/Human_Data/Reverse Layer Order Subjects/S_BED_203/S_BED_203_Final-Exam-1_Task7.xml | mitre-icarus/ICArUS-Challenge-Problem-Software-and-Data | de881551af982d625f8f15fc329590893f1299ca | [
"Apache-2.0"
] | null | null | null | data/Phase_1_CPD/assessment/Final_Exam/Human_Data/Reverse Layer Order Subjects/S_BED_203/S_BED_203_Final-Exam-1_Task7.xml | mitre-icarus/ICArUS-Challenge-Problem-Software-and-Data | de881551af982d625f8f15fc329590893f1299ca | [
"Apache-2.0"
] | null | null | null | data/Phase_1_CPD/assessment/Final_Exam/Human_Data/Reverse Layer Order Subjects/S_BED_203/S_BED_203_Final-Exam-1_Task7.xml | mitre-icarus/ICArUS-Challenge-Problem-Software-and-Data | de881551af982d625f8f15fc329590893f1299ca | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8" standalone="yes"?>
<ns3:Task_7_Phase xmlns:ns2="IcarusCPD_Base" xmlns:ns3="IcarusCPD_1" xmlns:ns4="IcarusCPD_05" id="Task7" examId="Final-Exam-1" startTime="2012-10-15T15:27:33.066-04:00" endTime="2012-10-15T15:58:44.461-04:00" name="Mission 7">
<ConditionNum>0</ConditionNum>
<CountCondition>true</CountCondition>
<InstructionPages>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide39.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide40.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide41.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide42.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide43.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide44.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide45.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide46.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide47.PNG"/>
<InstructionsPage imageUrl="tutorials/images/Task_Tutorials/Slide48.PNG"/>
</InstructionPages>
<ShowInstructionsPage>true</ShowInstructionsPage>
<ShowScore>false</ShowScore>
<ResponseGenerator>
<HumanSubject>true</HumanSubject>
<ResponseGeneratorId>203</ResponseGeneratorId>
<SiteId>BED</SiteId>
</ResponseGenerator>
<ApplicationVersion>1.16</ApplicationVersion>
<RoadsFile featureVectorUrl_CSV="ROAD_1.csv"/>
<RegionsFile featureVectorUrl_CSV="SOCINT_1.csv"/>
<InitialResponsibleGroup>A</InitialResponsibleGroup>
<InitialCredits>10</InitialCredits>
<CorrectPredictionCredits>1</CorrectPredictionCredits>
<Trial trialNum="1">
<FeatureVectorFile featureVectorUrl_CSV="task7_1.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="A" attackLocationId="1"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="114317">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="1"/>
<NumCreditsAwarded>0.76</NumCreditsAwarded>
<NumCreditsRemaining>10.76</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>76.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="26988">
<GroupAttackProbability group="A" probability="85.0" rawProbability="85.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="5.0" rawProbability="5.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="33836">
<GroupAttackProbability locationId="1" probability="73.0" rawProbability="83.0" time_ms="4103"/>
<GroupAttackProbability locationId="2" probability="17.0" rawProbability="19.0" time_ms="1778"/>
<GroupAttackProbability locationId="3" probability="5.0" rawProbability="6.0" time_ms="780"/>
<GroupAttackProbability locationId="4" probability="5.0" rawProbability="6.0" time_ms="811"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="31902">
<TroopAllocationScore_s2>76.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="76.0" allocation_raw="81.0" time_ms="2745"/>
<TroopAllocation locationId="2" allocation="16.0" allocation_raw="17.0" time_ms="530"/>
<TroopAllocation locationId="3" allocation="4.0" allocation_raw="5.0" time_ms="577"/>
<TroopAllocation locationId="4" allocation="4.0" allocation_raw="5.0" time_ms="811"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="2">
<FeatureVectorFile featureVectorUrl_CSV="task7_2.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="A" attackLocationId="1"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="182598">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="1"/>
<NumCreditsAwarded>0.62</NumCreditsAwarded>
<NumCreditsRemaining>11.379999999999999</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>62.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="38516">
<GroupAttackProbability group="A" probability="87.0" rawProbability="92.0" time_ms="2434"/>
<GroupAttackProbability group="B" probability="8.0" rawProbability="8.0" time_ms="951"/>
<GroupAttackProbability group="C" probability="3.0" rawProbability="3.0" time_ms="1748"/>
<GroupAttackProbability group="D" probability="2.0" rawProbability="3.0" time_ms="1700"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="66237">
<GroupAttackProbability locationId="1" probability="70.0" rawProbability="86.0" time_ms="23416"/>
<GroupAttackProbability locationId="2" probability="16.0" rawProbability="19.0" time_ms="406"/>
<GroupAttackProbability locationId="3" probability="10.0" rawProbability="13.0" time_ms="3431"/>
<GroupAttackProbability locationId="4" probability="4.0" rawProbability="5.0" time_ms="2090"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="41200">
<TroopAllocationScore_s2>62.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="62.0" allocation_raw="70.0" time_ms="7098"/>
<TroopAllocation locationId="2" allocation="25.0" allocation_raw="28.0" time_ms="1310"/>
<TroopAllocation locationId="3" allocation="11.0" allocation_raw="12.0" time_ms="1420"/>
<TroopAllocation locationId="4" allocation="2.0" allocation_raw="3.0" time_ms="2169"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="3">
<FeatureVectorFile featureVectorUrl_CSV="task7_3.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>true</ResponsibleGroupShown>
<GroundTruth responsibleGroup="A" attackLocationId="1"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="180617">
<ResponseFeedback responseWellFormed="true">
<GroundTruth responsibleGroup="A" attackLocationId="1"/>
<NumCreditsAwarded>0.86</NumCreditsAwarded>
<NumCreditsRemaining>11.239999999999998</NumCreditsRemaining>
<NumCreditsUsed>1.0</NumCreditsUsed>
<TroopAllocationScore_s2>86.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="25740">
<GroupAttackProbability group="A" probability="87.0" rawProbability="87.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="8.0" rawProbability="8.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="3.0" rawProbability="3.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="2.0" rawProbability="2.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="61526">
<GroupAttackProbability locationId="1" probability="78.0" rawProbability="80.0" time_ms="12308"/>
<GroupAttackProbability locationId="2" probability="11.0" rawProbability="11.0" time_ms="7364"/>
<GroupAttackProbability locationId="3" probability="7.0" rawProbability="7.0" time_ms="4149"/>
<GroupAttackProbability locationId="4" probability="4.0" rawProbability="5.0" time_ms="1701"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="18533">
<TroopAllocationScore_s2>86.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="86.0" allocation_raw="92.0" time_ms="4478"/>
<TroopAllocation locationId="2" allocation="8.0" allocation_raw="8.0" time_ms="1997"/>
<TroopAllocation locationId="3" allocation="4.0" allocation_raw="4.0" time_ms="2528"/>
<TroopAllocation locationId="4" allocation="2.0" allocation_raw="3.0" time_ms="1263"/>
</TroopAllocationResponse>
<LayerPurchaseTime_ms>60621</LayerPurchaseTime_ms>
<INTLayerPurchase costCredits="1">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayerPurchase>
</TrialResponse>
</Trial>
<Trial trialNum="4">
<FeatureVectorFile featureVectorUrl_CSV="task7_4.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="A" attackLocationId="1"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="148700">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="1"/>
<NumCreditsAwarded>0.9</NumCreditsAwarded>
<NumCreditsRemaining>12.139999999999999</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>90.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="64881">
<GroupAttackProbability group="A" probability="91.0" rawProbability="85.0" time_ms="3401"/>
<GroupAttackProbability group="B" probability="4.0" rawProbability="4.0" time_ms="1872"/>
<GroupAttackProbability group="C" probability="3.0" rawProbability="3.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="2.0" rawProbability="2.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="21419">
<GroupAttackProbability locationId="1" probability="89.0" rawProbability="88.0" time_ms="2714"/>
<GroupAttackProbability locationId="2" probability="6.0" rawProbability="6.0" time_ms="1763"/>
<GroupAttackProbability locationId="3" probability="2.0" rawProbability="2.0" time_ms="874"/>
<GroupAttackProbability locationId="4" probability="3.0" rawProbability="3.0" time_ms="1934"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="21684">
<TroopAllocationScore_s2>90.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="90.0" allocation_raw="90.0" time_ms="2699"/>
<TroopAllocation locationId="2" allocation="5.0" allocation_raw="5.0" time_ms="3417"/>
<TroopAllocation locationId="3" allocation="3.0" allocation_raw="3.0" time_ms="1841"/>
<TroopAllocation locationId="4" allocation="2.0" allocation_raw="3.0" time_ms="1653"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="5">
<FeatureVectorFile featureVectorUrl_CSV="task7_5.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="C" attackLocationId="3"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="113287">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="3"/>
<NumCreditsAwarded>0.06</NumCreditsAwarded>
<NumCreditsRemaining>10.2</NumCreditsRemaining>
<NumCreditsUsed>2.0</NumCreditsUsed>
<TroopAllocationScore_s2>6.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="37643">
<GroupAttackProbability group="A" probability="85.0" rawProbability="85.0" time_ms="1638"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="593"/>
<GroupAttackProbability group="C" probability="5.0" rawProbability="5.0" time_ms="1357"/>
<GroupAttackProbability group="D" probability="5.0" rawProbability="5.0" time_ms="515"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="17862">
<GroupAttackProbability locationId="1" probability="84.0" rawProbability="88.0" time_ms="2372"/>
<GroupAttackProbability locationId="2" probability="6.0" rawProbability="6.0" time_ms="1607"/>
<GroupAttackProbability locationId="3" probability="5.0" rawProbability="6.0" time_ms="655"/>
<GroupAttackProbability locationId="4" probability="5.0" rawProbability="6.0" time_ms="889"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="16848">
<TroopAllocationScore_s2>6.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="82.0" allocation_raw="86.0" time_ms="3557"/>
<TroopAllocation locationId="2" allocation="7.0" allocation_raw="7.0" time_ms="1638"/>
<TroopAllocation locationId="3" allocation="6.0" allocation_raw="7.0" time_ms="2184"/>
<TroopAllocation locationId="4" allocation="5.0" allocation_raw="6.0" time_ms="1123"/>
</TroopAllocationResponse>
<LayerPurchaseTime_ms>19453</LayerPurchaseTime_ms>
<INTLayerPurchase costCredits="2">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</INTLayer>
</INTLayerPurchase>
</TrialResponse>
</Trial>
<Trial trialNum="6">
<FeatureVectorFile featureVectorUrl_CSV="task7_6.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="C" attackLocationId="1"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="127686">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="1"/>
<NumCreditsAwarded>0.06</NumCreditsAwarded>
<NumCreditsRemaining>8.26</NumCreditsRemaining>
<NumCreditsUsed>2.0</NumCreditsUsed>
<TroopAllocationScore_s2>6.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="14461">
<GroupAttackProbability group="A" probability="6.0" rawProbability="6.0" time_ms="2371"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="85.0" rawProbability="91.0" time_ms="5491"/>
<GroupAttackProbability group="D" probability="4.0" rawProbability="5.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="32557">
<GroupAttackProbability locationId="1" probability="3.0" rawProbability="3.0" time_ms="1779"/>
<GroupAttackProbability locationId="2" probability="6.0" rawProbability="6.0" time_ms="1030"/>
<GroupAttackProbability locationId="3" probability="83.0" rawProbability="91.0" time_ms="1452"/>
<GroupAttackProbability locationId="4" probability="8.0" rawProbability="9.0" time_ms="5459"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="18674">
<TroopAllocationScore_s2>6.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="6.0" allocation_raw="6.0" time_ms="1030"/>
<TroopAllocation locationId="2" allocation="4.0" allocation_raw="5.0" time_ms="1684"/>
<TroopAllocation locationId="3" allocation="82.0" allocation_raw="92.0" time_ms="3322"/>
<TroopAllocation locationId="4" allocation="8.0" allocation_raw="9.0" time_ms="3962"/>
</TroopAllocationResponse>
<LayerPurchaseTime_ms>30903</LayerPurchaseTime_ms>
<INTLayerPurchase costCredits="2">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</INTLayer>
</INTLayerPurchase>
</TrialResponse>
</Trial>
<Trial trialNum="7">
<FeatureVectorFile featureVectorUrl_CSV="task7_7.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>true</ResponsibleGroupShown>
<GroundTruth responsibleGroup="C" attackLocationId="3"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="132757">
<ResponseFeedback responseWellFormed="true">
<GroundTruth responsibleGroup="C" attackLocationId="3"/>
<NumCreditsAwarded>0.47</NumCreditsAwarded>
<NumCreditsRemaining>8.73</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>47.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="16194">
<GroupAttackProbability group="A" probability="6.0" rawProbability="6.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="85.0" rawProbability="85.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="4.0" rawProbability="4.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="82633">
<GroupAttackProbability locationId="1" probability="6.0" rawProbability="5.0" time_ms="1123"/>
<GroupAttackProbability locationId="2" probability="13.0" rawProbability="12.0" time_ms="717"/>
<GroupAttackProbability locationId="3" probability="49.0" rawProbability="46.0" time_ms="1373"/>
<GroupAttackProbability locationId="4" probability="32.0" rawProbability="31.0" time_ms="3666"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="14430">
<TroopAllocationScore_s2>47.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="10.0" allocation_raw="8.0" time_ms="1388"/>
<TroopAllocation locationId="2" allocation="20.0" allocation_raw="17.0" time_ms="624"/>
<TroopAllocation locationId="3" allocation="47.0" allocation_raw="42.0" time_ms="3635"/>
<TroopAllocation locationId="4" allocation="23.0" allocation_raw="21.0" time_ms="328"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="8">
<FeatureVectorFile featureVectorUrl_CSV="task7_8.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="C" attackLocationId="3"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="95316">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="3"/>
<NumCreditsAwarded>0.6</NumCreditsAwarded>
<NumCreditsRemaining>9.33</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>60.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="21278">
<GroupAttackProbability group="A" probability="6.0" rawProbability="6.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="85.0" rawProbability="85.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="4.0" rawProbability="4.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="31309">
<GroupAttackProbability locationId="1" probability="22.0" rawProbability="22.0" time_ms="874"/>
<GroupAttackProbability locationId="2" probability="13.0" rawProbability="13.0" time_ms="734"/>
<GroupAttackProbability locationId="3" probability="58.0" rawProbability="58.0" time_ms="1904"/>
<GroupAttackProbability locationId="4" probability="7.0" rawProbability="7.0" time_ms="1467"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="18159">
<TroopAllocationScore_s2>60.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="24.0" allocation_raw="25.0" time_ms="0"/>
<TroopAllocation locationId="2" allocation="10.0" allocation_raw="11.0" time_ms="390"/>
<TroopAllocation locationId="3" allocation="60.0" allocation_raw="65.0" time_ms="2246"/>
<TroopAllocation locationId="4" allocation="6.0" allocation_raw="7.0" time_ms="1701"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="9">
<FeatureVectorFile featureVectorUrl_CSV="task7_9.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="D" attackLocationId="4"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="93491">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="4"/>
<NumCreditsAwarded>0.23</NumCreditsAwarded>
<NumCreditsRemaining>7.5600000000000005</NumCreditsRemaining>
<NumCreditsUsed>2.0</NumCreditsUsed>
<TroopAllocationScore_s2>23.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="8439">
<GroupAttackProbability group="A" probability="6.0" rawProbability="6.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="85.0" rawProbability="85.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="4.0" rawProbability="4.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="34164">
<GroupAttackProbability locationId="1" probability="8.0" rawProbability="8.0" time_ms="795"/>
<GroupAttackProbability locationId="2" probability="18.0" rawProbability="19.0" time_ms="952"/>
<GroupAttackProbability locationId="3" probability="51.0" rawProbability="55.0" time_ms="1123"/>
<GroupAttackProbability locationId="4" probability="23.0" rawProbability="25.0" time_ms="1592"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="15085">
<TroopAllocationScore_s2>23.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="11.0" allocation_raw="11.0" time_ms="3495"/>
<TroopAllocation locationId="2" allocation="16.0" allocation_raw="17.0" time_ms="2153"/>
<TroopAllocation locationId="3" allocation="50.0" allocation_raw="53.0" time_ms="1373"/>
<TroopAllocation locationId="4" allocation="23.0" allocation_raw="25.0" time_ms="0"/>
</TroopAllocationResponse>
<LayerPurchaseTime_ms>16115</LayerPurchaseTime_ms>
<INTLayerPurchase costCredits="2">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</INTLayer>
</INTLayerPurchase>
</TrialResponse>
</Trial>
<Trial trialNum="10">
<FeatureVectorFile featureVectorUrl_CSV="task7_10.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="D" attackLocationId="4"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="117343">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="4"/>
<NumCreditsAwarded>0.85</NumCreditsAwarded>
<NumCreditsRemaining>8.41</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>85.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="19453">
<GroupAttackProbability group="A" probability="6.0" rawProbability="6.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="4.0" rawProbability="4.0" time_ms="4243"/>
<GroupAttackProbability group="D" probability="85.0" rawProbability="85.0" time_ms="4945"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="39998">
<GroupAttackProbability locationId="1" probability="3.0" rawProbability="3.0" time_ms="2402"/>
<GroupAttackProbability locationId="2" probability="3.0" rawProbability="3.0" time_ms="2028"/>
<GroupAttackProbability locationId="3" probability="14.0" rawProbability="16.0" time_ms="2746"/>
<GroupAttackProbability locationId="4" probability="80.0" rawProbability="88.0" time_ms="5677"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="28236">
<TroopAllocationScore_s2>85.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="0.0" allocation_raw="0.0" time_ms="514"/>
<TroopAllocation locationId="2" allocation="0.0" allocation_raw="0.0" time_ms="296"/>
<TroopAllocation locationId="3" allocation="15.0" allocation_raw="15.0" time_ms="5664"/>
<TroopAllocation locationId="4" allocation="85.0" allocation_raw="85.0" time_ms="3088"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="11">
<FeatureVectorFile featureVectorUrl_CSV="task7_11.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="D" attackLocationId="2"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="173613">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="2"/>
<NumCreditsAwarded>0.06</NumCreditsAwarded>
<NumCreditsRemaining>4.470000000000001</NumCreditsRemaining>
<NumCreditsUsed>4.0</NumCreditsUsed>
<TroopAllocationScore_s2>6.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="8862">
<GroupAttackProbability group="A" probability="6.0" rawProbability="6.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="4.0" rawProbability="4.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="85.0" rawProbability="85.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="31090">
<GroupAttackProbability locationId="1" probability="3.0" rawProbability="3.0" time_ms="1326"/>
<GroupAttackProbability locationId="2" probability="10.0" rawProbability="10.0" time_ms="1825"/>
<GroupAttackProbability locationId="3" probability="3.0" rawProbability="3.0" time_ms="2481"/>
<GroupAttackProbability locationId="4" probability="84.0" rawProbability="85.0" time_ms="3494"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="18892">
<TroopAllocationScore_s2>6.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="5.0" allocation_raw="5.0" time_ms="1466"/>
<TroopAllocation locationId="2" allocation="6.0" allocation_raw="6.0" time_ms="3791"/>
<TroopAllocation locationId="3" allocation="5.0" allocation_raw="5.0" time_ms="1201"/>
<TroopAllocation locationId="4" allocation="84.0" allocation_raw="85.0" time_ms="4119"/>
</TroopAllocationResponse>
<LayerPurchaseTime_ms>94427</LayerPurchaseTime_ms>
<INTLayerPurchase costCredits="2">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</INTLayer>
</INTLayerPurchase>
<INTLayerPurchase costCredits="1">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayerPurchase>
<INTLayerPurchase costCredits="1">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayerPurchase>
</TrialResponse>
</Trial>
<Trial trialNum="12">
<FeatureVectorFile featureVectorUrl_CSV="task7_12.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="D" attackLocationId="4"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="134441">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="4"/>
<NumCreditsAwarded>0.31</NumCreditsAwarded>
<NumCreditsRemaining>4.78</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>31.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="23415">
<GroupAttackProbability group="A" probability="13.0" rawProbability="16.0" time_ms="1311"/>
<GroupAttackProbability group="B" probability="4.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="54.0" rawProbability="68.0" time_ms="3354"/>
<GroupAttackProbability group="D" probability="29.0" rawProbability="38.0" time_ms="2122"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="34788">
<GroupAttackProbability locationId="1" probability="9.0" rawProbability="13.0" time_ms="874"/>
<GroupAttackProbability locationId="2" probability="17.0" rawProbability="25.0" time_ms="0"/>
<GroupAttackProbability locationId="3" probability="47.0" rawProbability="73.0" time_ms="1856"/>
<GroupAttackProbability locationId="4" probability="27.0" rawProbability="43.0" time_ms="1045"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="12870">
<TroopAllocationScore_s2>31.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="7.0" allocation_raw="7.0" time_ms="640"/>
<TroopAllocation locationId="2" allocation="15.0" allocation_raw="15.0" time_ms="421"/>
<TroopAllocation locationId="3" allocation="47.0" allocation_raw="50.0" time_ms="2356"/>
<TroopAllocation locationId="4" allocation="31.0" allocation_raw="33.0" time_ms="1482"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="13">
<FeatureVectorFile featureVectorUrl_CSV="task7_13.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>true</ResponsibleGroupShown>
<GroundTruth responsibleGroup="D" attackLocationId="4"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="72072">
<ResponseFeedback responseWellFormed="true">
<GroundTruth responsibleGroup="D" attackLocationId="4"/>
<NumCreditsAwarded>0.31</NumCreditsAwarded>
<NumCreditsRemaining>5.09</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>31.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="8830">
<GroupAttackProbability group="A" probability="12.0" rawProbability="13.0" time_ms="0"/>
<GroupAttackProbability group="B" probability="3.0" rawProbability="4.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="42.0" rawProbability="49.0" time_ms="406"/>
<GroupAttackProbability group="D" probability="43.0" rawProbability="50.0" time_ms="1311"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="21341">
<GroupAttackProbability locationId="1" probability="8.0" rawProbability="8.0" time_ms="1124"/>
<GroupAttackProbability locationId="2" probability="7.0" rawProbability="7.0" time_ms="952"/>
<GroupAttackProbability locationId="3" probability="49.0" rawProbability="50.0" time_ms="2574"/>
<GroupAttackProbability locationId="4" probability="36.0" rawProbability="38.0" time_ms="3915"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="12433">
<TroopAllocationScore_s2>31.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="14.0" allocation_raw="15.0" time_ms="2512"/>
<TroopAllocation locationId="2" allocation="13.0" allocation_raw="14.0" time_ms="1716"/>
<TroopAllocation locationId="3" allocation="42.0" allocation_raw="46.0" time_ms="406"/>
<TroopAllocation locationId="4" allocation="31.0" allocation_raw="34.0" time_ms="468"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
<Trial trialNum="14">
<FeatureVectorFile featureVectorUrl_CSV="task7_14.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="D" attackLocationId="4"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="104411">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="4"/>
<NumCreditsAwarded>0.8</NumCreditsAwarded>
<NumCreditsRemaining>3.8899999999999997</NumCreditsRemaining>
<NumCreditsUsed>2.0</NumCreditsUsed>
<TroopAllocationScore_s2>80.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="22604">
<GroupAttackProbability group="A" probability="6.0" rawProbability="5.0" time_ms="2949"/>
<GroupAttackProbability group="B" probability="3.0" rawProbability="3.0" time_ms="0"/>
<GroupAttackProbability group="C" probability="5.0" rawProbability="5.0" time_ms="2262"/>
<GroupAttackProbability group="D" probability="86.0" rawProbability="85.0" time_ms="2090"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="25132">
<GroupAttackProbability locationId="1" probability="4.0" rawProbability="4.0" time_ms="2762"/>
<GroupAttackProbability locationId="2" probability="16.0" rawProbability="16.0" time_ms="936"/>
<GroupAttackProbability locationId="3" probability="3.0" rawProbability="3.0" time_ms="3151"/>
<GroupAttackProbability locationId="4" probability="77.0" rawProbability="80.0" time_ms="1545"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="23681">
<TroopAllocationScore_s2>80.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="3.0" allocation_raw="3.0" time_ms="2059"/>
<TroopAllocation locationId="2" allocation="13.0" allocation_raw="13.0" time_ms="4883"/>
<TroopAllocation locationId="3" allocation="4.0" allocation_raw="4.0" time_ms="1888"/>
<TroopAllocation locationId="4" allocation="80.0" allocation_raw="81.0" time_ms="1670"/>
</TroopAllocationResponse>
<LayerPurchaseTime_ms>16770</LayerPurchaseTime_ms>
<INTLayerPurchase costCredits="2">
<INTLayer xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</INTLayer>
</INTLayerPurchase>
</TrialResponse>
</Trial>
<Trial trialNum="15">
<FeatureVectorFile featureVectorUrl_CSV="task7_15.csv"/>
<GroupProbe>
<Groups>A B C D</Groups>
</GroupProbe>
<LocationProbe>
<Locations>1 2 3 4</Locations>
</LocationProbe>
<TroopAllocationProbe>
<Locations>1 2 3 4</Locations>
</TroopAllocationProbe>
<ResponsibleGroupShown>false</ResponsibleGroupShown>
<GroundTruth responsibleGroup="D" attackLocationId="4"/>
<INTLayers>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:ImintLayer"/>
</INTLayer>
<INTLayer costCredits="1">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:MovintLayer"/>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>A</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>B</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>C</Group>
</LayerType>
</INTLayer>
<INTLayer costCredits="2">
<LayerType xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:type="ns3:SigintLayer">
<Group>D</Group>
</LayerType>
</INTLayer>
</INTLayers>
<TrialResponse trialTime_ms="80730">
<ResponseFeedback responseWellFormed="true">
<GroundTruth attackLocationId="4"/>
<NumCreditsAwarded>0.81</NumCreditsAwarded>
<NumCreditsRemaining>4.699999999999999</NumCreditsRemaining>
<NumCreditsUsed>0.0</NumCreditsUsed>
<TroopAllocationScore_s2>81.0</TroopAllocationScore_s2>
</ResponseFeedback>
<GroupResponse trialPartTime_ms="16068">
<GroupAttackProbability group="A" probability="5.0" rawProbability="5.0" time_ms="2028"/>
<GroupAttackProbability group="B" probability="5.0" rawProbability="5.0" time_ms="1077"/>
<GroupAttackProbability group="C" probability="5.0" rawProbability="5.0" time_ms="0"/>
<GroupAttackProbability group="D" probability="85.0" rawProbability="86.0" time_ms="0"/>
</GroupResponse>
<LocationResponse trialPartTime_ms="23775">
<GroupAttackProbability locationId="1" probability="3.0" rawProbability="3.0" time_ms="1778"/>
<GroupAttackProbability locationId="2" probability="6.0" rawProbability="6.0" time_ms="874"/>
<GroupAttackProbability locationId="3" probability="3.0" rawProbability="3.0" time_ms="1123"/>
<GroupAttackProbability locationId="4" probability="88.0" rawProbability="89.0" time_ms="3322"/>
</LocationResponse>
<TroopAllocationResponse trialPartTime_ms="27705">
<TroopAllocationScore_s2>81.0</TroopAllocationScore_s2>
<TroopAllocation locationId="1" allocation="5.0" allocation_raw="5.0" time_ms="1139"/>
<TroopAllocation locationId="2" allocation="7.0" allocation_raw="8.0" time_ms="1591"/>
<TroopAllocation locationId="3" allocation="7.0" allocation_raw="8.0" time_ms="874"/>
<TroopAllocation locationId="4" allocation="81.0" allocation_raw="90.0" time_ms="764"/>
</TroopAllocationResponse>
</TrialResponse>
</Trial>
</ns3:Task_7_Phase>
| 56.322926 | 226 | 0.595157 |
ac6b07c1030dbfb5dba3e15cbb7f3a9d9a42a206 | 138 | props | XML | remoting/host/installer/mac/do_signing.props | nagineni/chromium-crosswalk | 5725642f1c67d0f97e8613ec1c3e8107ab53fdf8 | [
"BSD-3-Clause-No-Nuclear-License-2014",
"BSD-3-Clause"
] | 231 | 2015-01-08T09:04:44.000Z | 2021-12-30T03:03:10.000Z | remoting/host/installer/mac/do_signing.props | j4ckfrost/android_external_chromium_org | a1a3dad8b08d1fcf6b6b36c267158ed63217c780 | [
"BSD-3-Clause-No-Nuclear-License-2014",
"BSD-3-Clause"
] | 1 | 2015-07-21T08:02:01.000Z | 2015-07-21T08:02:01.000Z | remoting/host/installer/mac/do_signing.props | j4ckfrost/android_external_chromium_org | a1a3dad8b08d1fcf6b6b36c267158ed63217c780 | [
"BSD-3-Clause-No-Nuclear-License-2014",
"BSD-3-Clause"
] | 268 | 2015-01-21T05:53:28.000Z | 2022-03-25T22:09:01.000Z | HOST_UNINSTALLER_NAME=@@HOST_UNINSTALLER_NAME@@
HOST_PKG=@@HOST_PKG@@
DMG_VOLUME_NAME=@@DMG_VOLUME_NAME@@
DMG_FILE_NAME=@@DMG_FILE_NAME@@
| 27.6 | 47 | 0.826087 |
d8564edebee68ea2b833ad651831ffd3a1757662 | 257 | sublime-snippet | XML | Snippets/variable.sublime-snippet | emanuelen5/VHDL-Mode | 10f581c52aac5536b9c27b02dfd4c65df135bc71 | [
"MIT"
] | null | null | null | Snippets/variable.sublime-snippet | emanuelen5/VHDL-Mode | 10f581c52aac5536b9c27b02dfd4c65df135bc71 | [
"MIT"
] | null | null | null | Snippets/variable.sublime-snippet | emanuelen5/VHDL-Mode | 10f581c52aac5536b9c27b02dfd4c65df135bc71 | [
"MIT"
] | null | null | null | <snippet>
<content><![CDATA[variable ${1:var_name} : ${2:type_name} ${3::= ${4:initial_value}};]]></content>
<tabTrigger>variable</tabTrigger>
<scope>meta.block.process.declaration.vhdl</scope>
<description>variable declaration</description>
</snippet>
| 36.714286 | 99 | 0.719844 |
7242e62bf4991b6294ee4320c24de0525b378017 | 4,228 | ui | XML | ui/quick_widget.ui | tappi287/simmon_gui | 86a58fc5d3e81aacf551c1f2bd1312fd1c2b0526 | [
"MIT"
] | 2 | 2021-03-06T12:10:30.000Z | 2021-04-06T07:20:56.000Z | ui/quick_widget.ui | tappi287/simmon_gui | 86a58fc5d3e81aacf551c1f2bd1312fd1c2b0526 | [
"MIT"
] | 2 | 2021-04-06T08:47:10.000Z | 2021-09-14T19:44:44.000Z | ui/quick_widget.ui | tappi287/simmon_gui | 86a58fc5d3e81aacf551c1f2bd1312fd1c2b0526 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<ui version="4.0">
<class>quickWidget</class>
<widget class="QWidget" name="quickWidget">
<property name="geometry">
<rect>
<x>0</x>
<y>0</y>
<width>541</width>
<height>443</height>
</rect>
</property>
<property name="windowTitle">
<string>Form</string>
</property>
<layout class="QVBoxLayout" name="verticalLayout_5">
<item>
<widget class="QSplitter" name="splitter">
<property name="orientation">
<enum>Qt::Vertical</enum>
</property>
<widget class="QWidget" name="widget" native="true">
<layout class="QVBoxLayout" name="verticalLayout">
<item>
<widget class="QPushButton" name="quickExpandBtn">
<property name="enabled">
<bool>true</bool>
</property>
<property name="styleSheet">
<string notr="true">background: rgba(100, 100, 100,0); border: 1px solid; border-radius: 3px; border-color: rgb(146, 146, 146); margin: 1px;</string>
</property>
<property name="text">
<string>Quick Start</string>
</property>
<property name="checkable">
<bool>false</bool>
</property>
<property name="checked">
<bool>false</bool>
</property>
</widget>
</item>
<item>
<widget class="QWidget" name="quickExpandWidget" native="true">
<property name="sizePolicy">
<sizepolicy hsizetype="Preferred" vsizetype="Expanding">
<horstretch>0</horstretch>
<verstretch>0</verstretch>
</sizepolicy>
</property>
<layout class="QVBoxLayout" name="verticalLayout_2">
<item>
<widget class="QTextBrowser" name="quickTextBrowser"/>
</item>
</layout>
</widget>
</item>
</layout>
</widget>
<widget class="QWidget" name="widget_2" native="true">
<layout class="QVBoxLayout" name="verticalLayout_4">
<item>
<layout class="QHBoxLayout" name="horizontalLayout">
<property name="topMargin">
<number>0</number>
</property>
<item>
<widget class="QLabel" name="label">
<property name="text">
<string><html><head/><body><p><span style=" font-weight:600;">Steam Library</span> - Display Steam Library of the local machine and apps SimMon knows about</p></body></html></string>
</property>
</widget>
</item>
<item alignment="Qt::AlignRight">
<widget class="QPushButton" name="steamExpandBtn">
<property name="text">
<string>Refresh</string>
</property>
<property name="icon">
<iconset resource="res.qrc">
<normaloff>:/main/call_split-24px.svg</normaloff>:/main/call_split-24px.svg</iconset>
</property>
<property name="checkable">
<bool>true</bool>
</property>
<property name="checked">
<bool>true</bool>
</property>
</widget>
</item>
</layout>
</item>
<item>
<widget class="QWidget" name="steamExpandWidget" native="true">
<property name="sizePolicy">
<sizepolicy hsizetype="Preferred" vsizetype="Expanding">
<horstretch>0</horstretch>
<verstretch>0</verstretch>
</sizepolicy>
</property>
<layout class="QVBoxLayout" name="verticalLayout_3">
<item>
<widget class="QTableWidget" name="steamTable">
<property name="alternatingRowColors">
<bool>true</bool>
</property>
<property name="showGrid">
<bool>false</bool>
</property>
<property name="sortingEnabled">
<bool>true</bool>
</property>
</widget>
</item>
</layout>
</widget>
</item>
</layout>
</widget>
</widget>
</item>
</layout>
</widget>
<resources>
<include location="res.qrc"/>
</resources>
<connections/>
</ui>
| 32.775194 | 258 | 0.547067 |
693e3169ad86655e225c0a95b2c50eba51197a64 | 80 | xml | XML | androidlikebutton/src/main/res/values/strings.xml | nairobi222/AndroidLikeButton | d6ffd3e0176664d3dfaa7897c4ee7c15a0eff08b | [
"Apache-2.0"
] | 99 | 2018-01-16T13:00:33.000Z | 2022-01-17T07:10:58.000Z | androidlikebutton/src/main/res/values/strings.xml | nairobi222/AndroidLikeButton | d6ffd3e0176664d3dfaa7897c4ee7c15a0eff08b | [
"Apache-2.0"
] | 2 | 2018-06-22T13:34:00.000Z | 2022-01-17T07:34:47.000Z | androidlikebutton/src/main/res/values/strings.xml | nairobi222/AndroidLikeButton | d6ffd3e0176664d3dfaa7897c4ee7c15a0eff08b | [
"Apache-2.0"
] | 19 | 2018-01-19T09:15:54.000Z | 2021-12-11T11:37:02.000Z | <resources>
<string name="app_name">AndroidLikeButton</string>
</resources>
| 20 | 54 | 0.7375 |
356b971a9daee628a84c38d4c45e868af1db2e24 | 1,567 | xml | XML | AndroidManifest.xml | machman5/search-based-launcher | 86abe372ad7bd82f635e519d292cee78683a0234 | [
"MIT-0"
] | 36 | 2015-08-17T18:18:18.000Z | 2021-09-23T19:12:04.000Z | AndroidManifest.xml | machman5/search-based-launcher | 86abe372ad7bd82f635e519d292cee78683a0234 | [
"MIT-0"
] | 61 | 2015-09-01T16:05:46.000Z | 2022-01-07T14:10:58.000Z | AndroidManifest.xml | machman5/search-based-launcher | 86abe372ad7bd82f635e519d292cee78683a0234 | [
"MIT-0"
] | 13 | 2015-09-15T06:54:16.000Z | 2020-10-14T23:00:14.000Z | <manifest xmlns:android="http://schemas.android.com/apk/res/android"
package="com.vackosar.searchbasedlauncher"
android:versionCode="59"
android:versionName="59" >
<uses-sdk android:minSdkVersion="7"/>
<uses-permission android:name="android.permission.ACCESS_WIFI_STATE" />
<uses-permission android:name="android.permission.CHANGE_WIFI_STATE" />
<uses-permission android:name="android.permission.BLUETOOTH" />
<uses-permission android:name="android.permission.BLUETOOTH_ADMIN" />
<supports-screens
android:largeScreens="true"
android:normalScreens="true"
android:smallScreens="true"
android:anyDensity="true" />
<application
android:allowBackup="false"
android:icon="@drawable/ic_launcher"
android:label="Search Based Launcher"
android:theme="@style/AppTheme"
android:persistent="true"
android:windowSoftInputMode="stateVisible|adjustResize" >
<activity
android:name=".boundary.MainActivity"
android:label="Search Based Launcher"
android:alwaysRetainTaskState="true"
android:launchMode="singleInstance" >
<intent-filter>
<action android:name="android.intent.action.MAIN" />
<category android:name="android.intent.category.HOME"/>
<category android:name="android.intent.category.DEFAULT" />
<category android:name="android.intent.category.LAUNCHER" />
</intent-filter>
</activity>
</application>
</manifest>
| 42.351351 | 76 | 0.666879 |
47aab846c2dba34d0ca948f2187faee48c9d06e4 | 2,918 | xml | XML | app/src/main/res/drawable/wi_night_alt_cloudy_gusts.xml | rorpage/purty-weather | c093616d527d5a8d10a49b281f8c33399b1f4910 | [
"MIT"
] | null | null | null | app/src/main/res/drawable/wi_night_alt_cloudy_gusts.xml | rorpage/purty-weather | c093616d527d5a8d10a49b281f8c33399b1f4910 | [
"MIT"
] | 16 | 2020-10-12T18:46:13.000Z | 2021-10-20T23:22:48.000Z | app/src/main/res/drawable/wi_night_alt_cloudy_gusts.xml | rorpage/purty-weather | c093616d527d5a8d10a49b281f8c33399b1f4910 | [
"MIT"
] | 4 | 2020-10-05T19:16:23.000Z | 2020-10-30T13:58:12.000Z | <vector xmlns:android="http://schemas.android.com/apk/res/android"
android:width="30dp"
android:height="30dp"
android:viewportWidth="30"
android:viewportHeight="30">
<path
android:fillColor="#FF000000"
android:pathData="M2.98,21.02c0,0.23 0.09,0.43 0.27,0.6c0.17,0.17 0.37,0.25 0.61,0.25H9.6c0.26,0 0.49,0.1 0.69,0.29c0.2,0.19 0.3,0.42 0.3,0.68c0,0.27 -0.1,0.5 -0.3,0.69s-0.43,0.29 -0.69,0.29c-0.26,0 -0.48,-0.1 -0.68,-0.3c-0.18,-0.16 -0.38,-0.24 -0.61,-0.24c-0.24,0 -0.44,0.08 -0.6,0.24c-0.16,0.16 -0.24,0.36 -0.24,0.6c0,0.22 0.08,0.42 0.24,0.6c0.52,0.53 1.16,0.79 1.89,0.79s1.37,-0.26 1.89,-0.78c0.52,-0.52 0.78,-1.15 0.78,-1.89c0,-0.74 -0.26,-1.37 -0.78,-1.89s-1.15,-0.79 -1.89,-0.79H3.86c-0.24,0 -0.44,0.09 -0.62,0.26C3.07,20.59 2.98,20.79 2.98,21.02zM2.98,18c0,0.22 0.09,0.41 0.27,0.58c0.17,0.16 0.38,0.24 0.61,0.24h10.85c0.74,0 1.37,-0.26 1.89,-0.78c0.52,-0.52 0.78,-1.15 0.78,-1.88c0,-0.74 -0.26,-1.36 -0.78,-1.88c-0.52,-0.52 -1.15,-0.77 -1.89,-0.77c-0.76,0 -1.39,0.25 -1.89,0.76c-0.15,0.16 -0.23,0.36 -0.23,0.61c0,0.25 0.08,0.45 0.23,0.6c0.15,0.15 0.35,0.23 0.59,0.23s0.44,-0.07 0.62,-0.23c0.19,-0.19 0.42,-0.28 0.68,-0.28c0.26,0 0.48,0.09 0.67,0.28c0.19,0.19 0.29,0.42 0.29,0.68c0,0.26 -0.1,0.49 -0.29,0.68c-0.19,0.19 -0.42,0.29 -0.67,0.29H3.86c-0.24,0 -0.44,0.09 -0.62,0.26C3.07,17.57 2.98,17.77 2.98,18zM5.5,15.65c0,0.09 0.05,0.13 0.16,0.13H7.1c0.08,0 0.15,-0.05 0.22,-0.15c0.22,-0.54 0.57,-0.99 1.05,-1.35c0.47,-0.35 1,-0.55 1.58,-0.6l0.52,-0.07c0.12,0 0.19,-0.06 0.19,-0.17l0.08,-0.52c0.11,-1.08 0.57,-1.99 1.38,-2.71c0.81,-0.73 1.77,-1.09 2.86,-1.09s2.05,0.36 2.85,1.09c0.81,0.72 1.27,1.63 1.38,2.72l0.07,0.58c0,0.12 0.06,0.18 0.19,0.18h1.62c0.91,0 1.68,0.32 2.32,0.95c0.64,0.63 0.96,1.39 0.96,2.28c0,0.89 -0.32,1.65 -0.96,2.29c-0.64,0.64 -1.41,0.96 -2.31,0.96h-6.91c-0.11,0 -0.17,0.06 -0.17,0.18v1.37c0,0.11 0.06,0.17 0.17,0.17h6.91c0.89,0 1.72,-0.22 2.48,-0.67s1.36,-1.05 1.8,-1.81s0.67,-1.59 0.67,-2.48c0,-0.88 -0.23,-1.71 -0.68,-2.48c0.73,-0.71 1.23,-1.57 1.51,-2.58L27,11.18c0.02,-0.02 0.03,-0.04 0.03,-0.07c0,-0.04 -0.05,-0.1 -0.14,-0.16l-0.6,-0.21c-0.84,-0.26 -1.48,-0.71 -1.92,-1.36c-0.44,-0.65 -0.66,-1.32 -0.66,-2.02c0,-0.24 0.03,-0.51 0.09,-0.79l0.13,-0.62c0.02,-0.1 -0.02,-0.18 -0.13,-0.22l-0.8,-0.24c-0.44,-0.11 -0.85,-0.16 -1.25,-0.16c-0.37,0 -0.74,0.04 -1.12,0.13c-0.38,0.09 -0.77,0.22 -1.18,0.41c-0.4,0.18 -0.8,0.45 -1.18,0.8c-0.38,0.35 -0.72,0.75 -1,1.22c-0.71,-0.3 -1.48,-0.45 -2.32,-0.45c-1.41,0 -2.66,0.44 -3.75,1.31s-1.77,1.99 -2.07,3.35c-0.86,0.2 -1.61,0.61 -2.27,1.23c-0.66,0.62 -1.11,1.35 -1.36,2.2v0.03C5.51,15.58 5.5,15.61 5.5,15.65zM18.73,8.76c0.31,-0.55 0.74,-0.97 1.29,-1.26c0.55,-0.29 1.12,-0.44 1.71,-0.44c0.14,0 0.24,0 0.31,0.01c-0.01,0.09 -0.02,0.21 -0.02,0.36c0,0.94 0.26,1.85 0.79,2.71c0.52,0.86 1.25,1.51 2.17,1.94c-0.16,0.38 -0.41,0.72 -0.75,1.03c-0.89,-0.76 -1.94,-1.14 -3.16,-1.14h-0.33C20.48,10.71 19.81,9.64 18.73,8.76z"/>
</vector>
| 291.8 | 2,681 | 0.598012 |
4f385f78fc74b187f3a737434493478cab2416cf | 2,392 | xml | XML | web/target/classes/com/ht/hbm_xml/TUser.hbm.xml | NDCFL/SaleHome | ac951da51e54f634e20ac76ef1a8122ab8780d8a | [
"MIT"
] | 13 | 2019-08-03T09:09:23.000Z | 2022-03-31T04:42:28.000Z | web/target/classes/com/ht/hbm_xml/TUser.hbm.xml | sKyanfIre/SaleHome | ac951da51e54f634e20ac76ef1a8122ab8780d8a | [
"MIT"
] | 3 | 2020-05-21T03:17:53.000Z | 2022-02-09T22:56:42.000Z | src/main/resources/com/ht/hbm_xml/TUser.hbm.xml | NDCFL/SaleHome | ac951da51e54f634e20ac76ef1a8122ab8780d8a | [
"MIT"
] | 11 | 2018-03-24T04:12:18.000Z | 2021-11-19T04:21:59.000Z | <?xml version="1.0" encoding="utf-8"?>
<!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN"
"http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd">
<!--
Mapping file autogenerated by MyEclipse Persistence Tools
-->
<hibernate-mapping>
<class name="com.ht.pojo.TUser" table="t_user" catalog="sshproject">
<id name="idString" type="java.lang.String">
<column name="id_string" length="36" />
<generator class="uuid" />
</id>
<property name="emailString" type="java.lang.String">
<column name="email_string" length="50" />
</property>
<property name="phoneString" type="java.lang.String">
<column name="phone_string" length="11" />
</property>
<property name="pwdString" type="java.lang.String">
<column name="pwd_string" length="50" />
</property>
<property name="qqString" type="java.lang.String">
<column name="qq_string" length="20" />
</property>
<property name="wechatString" type="java.lang.String">
<column name="wechat_string" length="50" />
</property>
<property name="genderString" type="java.lang.String">
<column name="gender_string" length="2" />
</property>
<property name="birthday" type="java.util.Date">
<column name="birthday" length="0" />
</property>
<property name="nicknameString" type="java.lang.String">
<column name="nickname_string" length="50" />
</property>
<property name="nameString" type="java.lang.String">
<column name="name_string" length="20" />
</property>
<property name="headiconString" type="java.lang.String">
<column name="headicon_string" length="500" />
</property>
<property name="statusInt" type="int">
<column name="status_int"/>
</property>
<property name="reasonString" type="java.lang.String">
<column name="reason_string" length="500" />
</property>
<property name="usertypeInt" type="int">
<column name="usertype_int"/>
</property>
<property name="createTime" type="java.util.Date">
<column name="create_time" length="0" />
</property>
</class>
</hibernate-mapping>
| 41.964912 | 79 | 0.588211 |
90a7126842f5cad1432b45c78d5ca62ceba5c9d3 | 1,061 | kml | XML | tabels-core/src/it/resources/projectSamples/FloraOfAsturias/kml/merge-filtered-three-times.2197.kml | weso/tablines | 9b9b11b09f49abc84110bcaaee19e70d323d5621 | [
"Apache-2.0"
] | null | null | null | tabels-core/src/it/resources/projectSamples/FloraOfAsturias/kml/merge-filtered-three-times.2197.kml | weso/tablines | 9b9b11b09f49abc84110bcaaee19e70d323d5621 | [
"Apache-2.0"
] | 2 | 2020-02-01T15:45:54.000Z | 2020-04-21T10:18:24.000Z | tabels-core/src/it/resources/projectSamples/FloraOfAsturias/kml/merge-filtered-three-times.2197.kml | weso/tablines | 9b9b11b09f49abc84110bcaaee19e70d323d5621 | [
"Apache-2.0"
] | 2 | 2020-01-30T13:24:47.000Z | 2021-07-14T11:40:31.000Z | <?xml version="1.0" encoding="UTF-8"?>
<kml:kml xmlns:kml="http://earth.google.com/kml/2.1">
<kml:Document id="featureCollection">
<kml:Placemark id="merge-filtered-three-times.2197">
<kml:MultiGeometry>
<kml:Polygon>
<kml:outerBoundaryIs>
<kml:LinearRing>
<kml:coordinates>-6.783216180481069,43.093985198204116 -6.783683218442621,43.094019254212256 -6.784202757557045,43.09417312208772 -6.7845157226498385,43.094401358434865 -6.784934908110888,43.09538690108921 -6.784935927058131,43.09561196318299 -6.784780502769501,43.095725157425726 -6.784417288878946,43.09572818464377 -6.783949027927499,43.095428558269795 -6.7833219392178385,43.09451742552981 -6.783164399482283,43.09413547592061 -6.783216180481069,43.093985198204116</kml:coordinates>
</kml:LinearRing>
</kml:outerBoundaryIs>
</kml:Polygon>
</kml:MultiGeometry>
</kml:Placemark>
</kml:Document>
</kml:kml>
| 62.411765 | 514 | 0.655042 |
7050477171d1fd17eb948202500bc1c96f8a71ed | 1,747 | xml | XML | p1/p1-t9/p1-t9-c63-s22.xml | morrissinger/MassGenLaws | 8d740ef0e0fb8334174fac7ff1ab97c579f54862 | [
"Unlicense"
] | 1 | 2020-11-25T20:33:55.000Z | 2020-11-25T20:33:55.000Z | p1/p1-t9/p1-t9-c63-s22.xml | morrissinger/MassGenLaws | 8d740ef0e0fb8334174fac7ff1ab97c579f54862 | [
"Unlicense"
] | null | null | null | p1/p1-t9/p1-t9-c63-s22.xml | morrissinger/MassGenLaws | 8d740ef0e0fb8334174fac7ff1ab97c579f54862 | [
"Unlicense"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<law>
<structure>
<unit label="part" identifier="1" order_by="1" level="1">Administration Of The Government</unit>
<unit label="title" identifier="9" order_by="9" level="2">Taxation</unit>
<unit label="chapter" identifier="63" order_by="63" level="3">Taxation Of Corporations</unit>
</structure>
<section_number>22</section_number>
<catch_line>Domestic Companies Other Than Life; Premiums Subject To Taxation; Rate</catch_line>
<order_by>22</order_by>
<text>
[Text of section effective for tax years beginning on or after January 1, 2009. See 2008, 173, Sec. 101.]
Every domestic insurance company coming within the scope of the definition of a domestic company in section 1 of chapter 175, except life insurance companies with respect to amounts received as consideration for annuity contracts and business taxable under section 20 and marine, or fire and marine, insurance companies with respect to business taxable under section 29A, shall annually pay an excise of 2.28 per cent upon the gross premiums for all policies written or renewed, all additional premiums charged, and all assessments made by such company on policyholders during the preceding calendar year, exclusive of reinsurance; but such premiums and assessments for policies written or renewed for insurance, exclusive of reinsurance, of property or interests in other states or countries where a tax is actually paid by such company, or its agents, shall not be so taxed. For purposes of calculating the credit under section 29E of this chapter, the term “surtax” is hereby defined as the portion of the excise imposed under this section equal to 0.28 per cent.
</text>
</law> | 116.466667 | 1,066 | 0.763022 |
cb11b4d52422ce2508764b1714744cfb550d785e | 2,939 | xml | XML | Publications/Arxiv/xml/20-1507.04331-..xml | d-torrance/Macaulay2-web-site | edb1d0b607c5aa00ffbcf403f2403961c6d6083a | [
"CC0-1.0"
] | 1 | 2018-11-27T08:01:17.000Z | 2018-11-27T08:01:17.000Z | Publications/Arxiv/xml/20-1507.04331-..xml | d-torrance/Macaulay2-web-site | edb1d0b607c5aa00ffbcf403f2403961c6d6083a | [
"CC0-1.0"
] | 19 | 2018-04-17T19:52:43.000Z | 2021-02-07T01:08:10.000Z | Publications/Arxiv/xml/20-1507.04331-..xml | d-torrance/Macaulay2-web-site | edb1d0b607c5aa00ffbcf403f2403961c6d6083a | [
"CC0-1.0"
] | 5 | 2018-01-08T16:48:01.000Z | 2021-09-10T21:19:02.000Z | <?xml version="1.0" encoding="UTF-8"?>
<feed xmlns="http://www.w3.org/2005/Atom">
<link href="http://arxiv.org/api/query?search_query%3D%26id_list%3D1507.04331%26start%3D0%26max_results%3D10" rel="self" type="application/atom+xml"/>
<title type="html">ArXiv Query: search_query=&id_list=1507.04331&start=0&max_results=10</title>
<id>http://arxiv.org/api/p4385lZIughb3nK+NSFcQil7TUU</id>
<updated>2015-08-24T00:00:00-04:00</updated>
<opensearch:totalResults xmlns:opensearch="http://a9.com/-/spec/opensearch/1.1/">1</opensearch:totalResults>
<opensearch:startIndex xmlns:opensearch="http://a9.com/-/spec/opensearch/1.1/">0</opensearch:startIndex>
<opensearch:itemsPerPage xmlns:opensearch="http://a9.com/-/spec/opensearch/1.1/">10</opensearch:itemsPerPage>
<entry>
<id>http://arxiv.org/abs/1507.04331v1</id>
<updated>2015-07-15T19:12:52Z</updated>
<published>2015-07-15T19:12:52Z</published>
<title>Numerical algebraic geometry for model selection</title>
<summary> Researchers working with mathematical models are often confronted by the
related problems of parameter estimation, model validation, and model
selection. These are all optimization problems, well-known to be challenging
due to non-linearity, non-convexity and multiple local optima. Furthermore, the
challenges are compounded when only partial data is available. Here, we
consider polynomial models (e.g., mass-action chemical reaction networks at
steady state) and describe a framework for their analysis based on optimization
using numerical algebraic geometry. Specifically, we use probability-one
polynomial homotopy continuation methods to compute all critical points of the
objective function, then filter to recover the global optima. Our approach
exploits the geometric structures relating models and data, and we demonstrate
its utility on examples from cell signaling, synthetic biology, and
epidemiology.
</summary>
<author>
<name>Elizabeth Gross</name>
</author>
<author>
<name>Brent Davis</name>
</author>
<author>
<name>Kenneth L. Ho</name>
</author>
<author>
<name>Daniel J. Bates</name>
</author>
<author>
<name>Heather A. Harrington</name>
</author>
<link href="http://arxiv.org/abs/1507.04331v1" rel="alternate" type="text/html"/>
<link title="pdf" href="http://arxiv.org/pdf/1507.04331v1" rel="related" type="application/pdf"/>
<arxiv:primary_category xmlns:arxiv="http://arxiv.org/schemas/atom" term="q-bio.QM" scheme="http://arxiv.org/schemas/atom"/>
<category term="q-bio.QM" scheme="http://arxiv.org/schemas/atom"/>
<category term="math.AG" scheme="http://arxiv.org/schemas/atom"/>
<category term="math.NA" scheme="http://arxiv.org/schemas/atom"/>
<category term="q-bio.MN" scheme="http://arxiv.org/schemas/atom"/>
<category term="stat.ME" scheme="http://arxiv.org/schemas/atom"/>
</entry>
</feed>
| 54.425926 | 152 | 0.73018 |
760b13bb27f31735bfbd329fb51d37181ed25eb5 | 331 | xml | XML | viral2019/PMC7393812/sections/2_back/2_ref-list/34_ref.xml | petermr/openvirusdev | a3b04ad67a262c85bb7fe1f5c7eec9b8532673a9 | [
"Apache-2.0"
] | null | null | null | viral2019/PMC7393812/sections/2_back/2_ref-list/34_ref.xml | petermr/openvirusdev | a3b04ad67a262c85bb7fe1f5c7eec9b8532673a9 | [
"Apache-2.0"
] | 1 | 2020-11-14T03:41:20.000Z | 2021-03-22T10:04:35.000Z | viral2019/PMC7393812/sections/2_back/2_ref-list/34_ref.xml | petermr/openvirusdev | a3b04ad67a262c85bb7fe1f5c7eec9b8532673a9 | [
"Apache-2.0"
] | 1 | 2020-11-22T16:24:37.000Z | 2020-11-22T16:24:37.000Z | <?xml version="1.0" encoding="UTF-8"?>
<ref id="CR34">
<mixed-citation publication-type="other">Eliezer M, Hautefort C, Hamel AL, Verillaud B, Herman P, Houdart E, Eloit C (2020) Sudden and complete olfactory loss function as a possible symptom of COVID-19. JAMA Otolaryngol. 10.1001/jamaoto.2020.0832</mixed-citation>
</ref>
| 66.2 | 265 | 0.734139 |
2f83f7d5ace1514c6c072d2d36de5cf49e86e7c9 | 2,588 | xml | XML | src/main/res/layout-sw720dp-land/statcalc_main.xml | Epi-Info/Epi-Info-Android | 59312cfdea84cdacab65cb03066bd75b56bace5f | [
"Apache-2.0"
] | 1 | 2020-04-29T02:36:52.000Z | 2020-04-29T02:36:52.000Z | src/main/res/layout-sw720dp-land/statcalc_main.xml | Epi-Info/Epi-Info-Android | 59312cfdea84cdacab65cb03066bd75b56bace5f | [
"Apache-2.0"
] | 1 | 2019-03-31T18:43:34.000Z | 2020-02-26T02:05:21.000Z | src/main/res/layout-sw720dp-land/statcalc_main.xml | Epi-Info/Epi-Info-Android | 59312cfdea84cdacab65cb03066bd75b56bace5f | [
"Apache-2.0"
] | 2 | 2019-08-24T20:40:47.000Z | 2020-11-13T14:21:07.000Z | <?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:layout_height="fill_parent"
android:layout_width="fill_parent"
android:background="#FFFFFFFF"
android:orientation="horizontal">
<LinearLayout
android:orientation="vertical"
android:layout_width="500dp"
android:layout_height="fill_parent"
android:layout_margin="30dp"
android:gravity="center">
<ImageView
android:layout_height="145dp"
android:layout_width="398dp"
android:gravity="center"
android:src="@drawable/sc_rect"/>
</LinearLayout>
<LinearLayout
android:orientation="vertical"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
android:layout_marginTop="30dp"
android:gravity="center">
<Button
android:id="@+id/btnPS"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn1"/>
<Button
android:id="@+id/btnUCC"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn2"/>
<Button
android:id="@+id/btnCCS"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn3"/>
<Button
android:id="@+id/btn2x2"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn4"/>
<Button
android:id="@+id/btnMatchedPair"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn5"/>
<Button
android:id="@+id/btnChiSq"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn6"/>
<Button
android:id="@+id/btnPoisson"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn7"/>
<Button
android:id="@+id/btnBinomial"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn8"/>
<Button
android:id="@+id/btnOpenEpi"
android:layout_width="418dp"
android:layout_height="50dp"
android:layout_margin="10dp"
android:text="@string/statcalc_btn9"/>
</LinearLayout>
</LinearLayout> | 32.35 | 73 | 0.681994 |
a63e3ee6cc0e86aee5746b6d5686e1c9ed60e71b | 3,606 | xml | XML | xml/20107.xml | fbkarsdorp/meertens-song-collection | 77d7f39bdd5efb897e44954d43d3bc4fac9e1d8a | [
"MIT"
] | 1 | 2020-11-24T12:15:13.000Z | 2020-11-24T12:15:13.000Z | xml/20107.xml | fbkarsdorp/meertens-song-collection | 77d7f39bdd5efb897e44954d43d3bc4fac9e1d8a | [
"MIT"
] | null | null | null | xml/20107.xml | fbkarsdorp/meertens-song-collection | 77d7f39bdd5efb897e44954d43d3bc4fac9e1d8a | [
"MIT"
] | null | null | null | <?xml version='1.0' encoding='utf-8' standalone='yes'?>
<song>
<meta>
<id>20107</id>
<date>
<year-start>1654</year-start>
<year-end>1654</year-end>
</date>
<location>
<orginal-name>amsterdam</orginal-name>
<standard-name>Amsterdam, The Netherlands</standard-name>
<coordinates>
<lon>52.3745403</lon>
<lat>4.89797550561798</lat>
</coordinates>
</location>
<tags>
<tag standard-name="klaaglied" translation="lamentation">klaaglied</tag>
</tags>
<melody>Het daagt in de oosten</melody>
<categories>
<category translation="emotions">emoties</category>
</categories>
</meta>
<text>
<lg type="song">
<lg id="s1" type="stanza">
<l id="s1:l1" met="3" type="-+">STort nu (mijn ooghjes <rhyme label="a" type="f">teeder</rhyme>)</l>
<l id="s1:l2" met="3" type="-+">In ’t laeuw gestremt <rhyme label="b" type="m">robijn</rhyme>,</l>
<l id="s1:l3" met="3" type="-+">U bracke parelen <rhyme label="a" type="f" corresp="#s1:l1">neder</rhyme></l>
<l id="s1:l4" met="3" type="-+">En menght u saem om <rhyme label="b" type="m" corresp="#s1:l2">myn</rhyme>,</l>
<l id="s1:l5" met="3" type="-+">In dees beeck te doen <rhyme label="c" type="f">sincken</rhyme></l>
<l id="s1:l6" met="2" type="+-">En <rhyme label="c" type="f" corresp="#s1:l5">verdrincken</rhyme>.</l>
</lg>
<lg id="s2" type="stanza">
<l id="s2:l1" met="3" type="-+">Want nu dat ick moet <rhyme label="a" type="f">derr’ven</rhyme></l>
<l id="s2:l2" met="3" type="-+">Mijn lief Helranos <rhyme label="b" type="m">licht</rhyme>,</l>
<l id="s2:l3" met="3" type="-+">Wensch ick niet dan om ’t <rhyme label="a" type="f" corresp="#s2:l1">sterr’ven</rhyme>,</l>
<l id="s2:l4" met="3" type="-+">Kom Atrop met u <rhyme label="b" type="m" corresp="#s2:l2">schicht</rhyme>,</l>
<l id="s2:l5" met="3" type="-+">Wilt Cleo met u <rhyme label="c" type="f">banden</rhyme></l>
<l id="s2:l6" met="2" type="+-">Meê aen <rhyme label="c" type="f" corresp="#s2:l5">randen</rhyme>.</l>
</lg>
<lg id="s3" type="stanza">
<l id="s3:l1" met="3" type="-+">Wat reên, ha! wreede <rhyme label="a" type="f">Stiris</rhyme>,</l>
<l id="s3:l2" met="3" type="-+">Verdoofde ghy mijn <rhyme label="b" type="m">Zon</rhyme>?</l>
<l id="s3:l3" met="3" type="-+">U wreetheydt my te dier <rhyme label="a" type="f" corresp="#s3:l1">is</rhyme>,</l>
<l id="s3:l4" met="3" type="-+">Verrader dat ick <rhyme label="b" type="m" corresp="#s3:l2">kon</rhyme></l>
<l id="s3:l5" met="3" type="-+">Met tanden u <rhyme label="c" type="f">verscheuren</rhyme>,</l>
<l id="s3:l6" met="2" type="+-">’t Sou <rhyme label="c" type="f" corresp="#s3:l5">gebeuren</rhyme>.</l>
</lg>
<lg id="s4" type="stanza">
<l id="s4:l1" met="3" type="-+">Geen rust sal ick <rhyme label="a" type="f">aenvaerden</rhyme>,</l>
<l id="s4:l2" met="3" type="-+">Dat sweer ick by de <rhyme label="b" type="m">Goon</rhyme>,</l>
<l id="s4:l3" met="3" type="-+">Voor dat ick (o mijn <rhyme label="a" type="f" corresp="#s4:l1">waerde</rhyme>)</l>
<l id="s4:l4" met="3" type="-+">U Moorder (wreedt) doen <rhyme label="b" type="m" corresp="#s4:l2">doon</rhyme>,</l>
<l id="s4:l5" met="3" type="-+">Dan volgh ick op u <rhyme label="c" type="f">schreden</rhyme>,</l>
<l id="s4:l6" met="2" type="+-">Naer <rhyme label="c" type="f" corresp="#s4:l5">beneden</rhyme>.</l>
</lg>
</lg>
</text>
</song>
| 58.16129 | 131 | 0.555186 |
b605ec1ba926691f89ba7e4b54daf18f2419b6b4 | 3,050 | xml | XML | Polit/app/src/main/res/billStuff/Polit Bills Folder/Biils/BILLS-114-1-hr/BILLS-114hr3348ih.xml | MGaston504/Polit | 3401c15bdde342c7e64d0b72387b2172998941d0 | [
"MIT"
] | 2 | 2016-11-05T20:56:35.000Z | 2016-11-06T16:01:33.000Z | Polit/app/src/main/res/billStuff/Polit Bills Folder/Biils/BILLS-114-1-hr/BILLS-114hr3348ih.xml | MGaston504/Polit | 3401c15bdde342c7e64d0b72387b2172998941d0 | [
"MIT"
] | null | null | null | Polit/app/src/main/res/billStuff/Polit Bills Folder/Biils/BILLS-114-1-hr/BILLS-114hr3348ih.xml | MGaston504/Polit | 3401c15bdde342c7e64d0b72387b2172998941d0 | [
"MIT"
] | null | null | null | <?xml version="1.0"?>
<?xml-stylesheet type="text/xsl" href="billres.xsl"?>
<!DOCTYPE bill PUBLIC "-//US Congress//DTDs/bill.dtd//EN" "bill.dtd">
<bill bill-stage="Introduced-in-House" dms-id="H2E63A72CBF2A4F7DA29A898A3B143D68" public-private="public" bill-type="olc">
<metadata xmlns:dc="http://purl.org/dc/elements/1.1/">
<dublinCore>
<dc:title>114 HR 3348 IH: Providing Rewards for Outstanding Tips to Expose Crimes in Technology Act of 2015</dc:title>
<dc:publisher>U.S. House of Representatives</dc:publisher>
<dc:date>2015-07-29</dc:date>
<dc:format>text/xml</dc:format>
<dc:language>EN</dc:language>
<dc:rights>Pursuant to Title 17 Section 105 of the United States Code, this file is not subject to copyright protection and is in the public domain.</dc:rights>
</dublinCore>
</metadata>
<form>
<distribution-code display="yes">I</distribution-code>
<congress>114th CONGRESS</congress>
<session>1st Session</session>
<legis-num>H. R. 3348</legis-num>
<current-chamber>IN THE HOUSE OF REPRESENTATIVES</current-chamber>
<action>
<action-date date="20150729">July 29, 2015</action-date>
<action-desc><sponsor name-id="G000553">Mr. Al Green of Texas</sponsor> (for himself, <cosponsor name-id="P000592">Mr. Poe of Texas</cosponsor>, and <cosponsor name-id="D000614">Mr. Duffy</cosponsor>) introduced the following bill; which was referred to the <committee-name committee-id="HJU00">Committee on the Judiciary</committee-name></action-desc>
</action>
<legis-type>A BILL</legis-type>
<official-title>To direct the Attorney General to create a special reward program for individuals providing information leading to the apprehension and conviction of persons committing offenses under section 1030 of title 18, United States Code, and for other purposes.</official-title>
</form>
<legis-body id="H6F3A557AD07F4538BAE02A37F96F2A11" style="OLC">
<section id="H6F0DFE025B624C9E93773CA3C1BE1D3C" section-type="section-one"><enum>1.</enum><header>Short title</header><text display-inline="no-display-inline">This Act may be cited as the <quote><short-title>Providing Rewards for Outstanding Tips to Expose Crimes in Technology Act of 2015</short-title></quote> or <quote><short-title>PROTECT Act of 2015</short-title></quote>.</text></section> <section id="H1F9B39229308476EAB61DFA95CC51D63"><enum>2.</enum><header>Cybercrime reward program</header> <subsection id="H7F5C65A0B03444D9B1B21EB6C39F8BFD"><enum>(a)</enum><header>In general</header><text display-inline="yes-display-inline">The Attorney General shall establish and publicize a special reward program for individuals providing information leading to the apprehension and conviction of persons committing offenses under section 1030 of title 18, United States Code.</text></subsection>
<subsection id="HD66160BE4A80432D863F0F3CF2DB1E5D"><enum>(b)</enum><header>Authorization of appropriations</header><text>There are authorized to be appropriated $1,000,000 for each of fiscal years 2016 through 2020 to carry out this section.</text> </subsection></section> </legis-body> </bill>
| 95.3125 | 897 | 0.773443 |
b0e6a1fe7df7d401db5a27cae50c721914bc66a3 | 2,912 | xml | XML | demospringintegration/src/test/resources/message/TestMessage-context.xml | DoctusHartwald/artaudCode | cabd1b5bdf9a7e740560cb0e44c8dc62f86d30e5 | [
"Apache-2.0"
] | null | null | null | demospringintegration/src/test/resources/message/TestMessage-context.xml | DoctusHartwald/artaudCode | cabd1b5bdf9a7e740560cb0e44c8dc62f86d30e5 | [
"Apache-2.0"
] | null | null | null | demospringintegration/src/test/resources/message/TestMessage-context.xml | DoctusHartwald/artaudCode | cabd1b5bdf9a7e740560cb0e44c8dc62f86d30e5 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<beans xmlns="http://www.springframework.org/schema/beans"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:context="http://www.springframework.org/schema/context"
xmlns:int="http://www.springframework.org/schema/integration"
xmlns:int-file="http://www.springframework.org/schema/integration/file"
xmlns:util="http://www.springframework.org/schema/util" xmlns:p="http://www.springframework.org/schema/p"
xmlns:int-ext="http://www.springframework.org/schema/integration/integration-service-extender"
xmlns:int-stream="http://www.springframework.org/schema/integration/stream"
xmlns:int-xml="http://www.springframework.org/schema/integration/xml"
xsi:schemaLocation="http://www.springframework.org/schema/integration/xml http://www.springframework.org/schema/integration/xml/spring-integration-xml-2.0.xsd
http://www.springframework.org/schema/integration http://www.springframework.org/schema/integration/spring-integration-2.0.xsd
http://www.springframework.org/schema/integration/file http://www.springframework.org/schema/integration/file/spring-integration-file-2.0.xsd
http://www.springframework.org/schema/integration/stream http://www.springframework.org/schema/integration/stream/spring-integration-stream-1.0.xsd
http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd
http://www.springframework.org/schema/util http://www.springframework.org/schema/util/spring-util-3.0.xsd
http://www.springframework.org/schema/integration/integration-service-extender http://www.springframework.org/schema/integration/integration-service-extender/spring-integration-service-extender-1.0.xsd
http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-3.0.xsd">
<!--
welcomeProcessor (gateway) -> input (direct channel) ->
service-activator (on welcome calling decorateMessage) -> output
(channel with queue) output2 stream
-->
<!--
input message decorate the message send it to console
-->
<int:channel id="input" />
<int:transformer input-channel="input" output-channel="console"
method="decorateMessage">
<bean id="welcome" class="message.MessageWelcome" />
</int:transformer>
<int-stream:stdout-channel-adapter
id="console" />
<!--
receive message.IMessageExchanger un flux entree de
default-request-channel
-->
<int:gateway id="diningProcessor" service-interface="message.IMessageExchanger"
default-request-channel="inputExterieur" />
<int:channel id="inputExterieur">
<int:queue capacity="10" />
</int:channel>
<!--
<int:service-activator input-channel="input" output-channel="output"
ref="welcome" method="decorateMessage" >
-->
<!-- <pooler> scan the input channel pooler /> -->
<!-- </int:service-activator>-->
</beans> | 44.8 | 203 | 0.748283 |
b0481fbfd6ab7b43bc52cbfb40eab23a24b39a3b | 597 | csproj | XML | DAL/DAL.csproj | sharons74/koobeca | d396007766ccbab60540b30c1e526fdefe3f9a68 | [
"Apache-2.0"
] | null | null | null | DAL/DAL.csproj | sharons74/koobeca | d396007766ccbab60540b30c1e526fdefe3f9a68 | [
"Apache-2.0"
] | null | null | null | DAL/DAL.csproj | sharons74/koobeca | d396007766ccbab60540b30c1e526fdefe3f9a68 | [
"Apache-2.0"
] | null | null | null | <Project Sdk="Microsoft.NET.Sdk">
<PropertyGroup>
<TargetFramework>netstandard2.0</TargetFramework>
<AssemblyName>KoobecaFeedController.DAL</AssemblyName>
<RootNamespace>KoobecaFeedController.DAL</RootNamespace>
</PropertyGroup>
<ItemGroup>
<PackageReference Include="Microsoft.NETCore.Runtime.CoreCLR" Version="2.0.8" />
<PackageReference Include="MySql.Data" Version="8.0.13" />
<PackageReference Include="Newtonsoft.Json" Version="12.0.1" />
<PackageReference Include="System.Configuration.ConfigurationManager" Version="4.5.0" />
</ItemGroup>
</Project>
| 35.117647 | 92 | 0.742044 |
a23c00b65891c1787dedadd165a9429616214f50 | 1,751 | xml | XML | ui/src/main/res/drawable/ic_surah_badge.xml | Rarj/al-quran | 2fae0e76de6e1479eff996b61641638acadd4623 | [
"Apache-2.0"
] | null | null | null | ui/src/main/res/drawable/ic_surah_badge.xml | Rarj/al-quran | 2fae0e76de6e1479eff996b61641638acadd4623 | [
"Apache-2.0"
] | null | null | null | ui/src/main/res/drawable/ic_surah_badge.xml | Rarj/al-quran | 2fae0e76de6e1479eff996b61641638acadd4623 | [
"Apache-2.0"
] | null | null | null | <vector android:height="48dp" android:viewportHeight="512"
android:viewportWidth="512" android:width="48dp" xmlns:android="http://schemas.android.com/apk/res/android">
<path android:fillColor="#EDC472" android:pathData="M256,512l-74.98,-74.98H74.98V330.98L0,256l74.98,-74.98V74.98h106.04L256,0l74.98,74.98h106.04v106.04L512,256l-74.98,74.98v106.04H330.98L256,512z"/>
<path android:fillColor="#E8BA64" android:pathData="M437.02,181.02l0,-106.04l-106.04,0l-74.98,-74.98l0,512l74.98,-74.98l106.04,0l0,-106.04l74.98,-74.98z"/>
<path android:fillColor="#FFDE91" android:pathData="M104.99,407.01l88.46,0l62.55,62.551l62.55,-62.551l88.46,0l0,-88.46l62.551,-62.55l-62.551,-62.55l0,-88.46l-88.46,0l-62.55,-62.551l-62.55,62.551l-88.46,0l0,88.46l-62.551,62.55l62.551,62.55z"/>
<path android:fillColor="#FAD17F" android:pathData="M407.01,193.45l0,-88.46l-88.46,0l-62.55,-62.551l0,427.122l62.55,-62.551l88.46,0l0,-88.46l62.551,-62.55z"/>
<path android:fillColor="#FFAC5A" android:pathData="M256,427.12L205.88,377h-70.881v-70.88L84.88,256L135,205.88v-70.881h70.881L256,84.88L306.12,135h70.881v70.881L427.12,256L377,306.12v70.881h-70.88L256,427.12z"/>
<path android:fillColor="#FC9942" android:pathData="M377.001,205.88l0,-70.881l-70.881,0l-50.12,-50.119l0,342.24l50.12,-50.119l70.881,0l0,-70.881l50.119,-50.12z"/>
<path android:fillColor="#FFCF94" android:pathData="M165.009,346.991l53.301,0l37.69,37.69l37.69,-37.69l53.301,0l0,-53.301l37.69,-37.69l-37.69,-37.69l0,-53.301l-53.301,0l-37.69,-37.69l-37.69,37.69l-53.301,0l0,53.301l-37.69,37.69l37.69,37.69z"/>
<path android:fillColor="#FFC170" android:pathData="M346.991,218.31l0,-53.301l-53.301,0l-37.69,-37.69l0,257.362l37.69,-37.69l53.301,0l0,-53.301l37.69,-37.69z"/>
</vector>
| 145.916667 | 247 | 0.728155 |
0e7100e954e0f87d45f858af399b562b5b213a13 | 203 | xml | XML | src/chrome/content/rules/Metaboli.co.uk.xml | yymmk/https-everywhere | 066797362ff07b9b13b68b0aa78eaad5e7e7b27b | [
"MIT"
] | null | null | null | src/chrome/content/rules/Metaboli.co.uk.xml | yymmk/https-everywhere | 066797362ff07b9b13b68b0aa78eaad5e7e7b27b | [
"MIT"
] | null | null | null | src/chrome/content/rules/Metaboli.co.uk.xml | yymmk/https-everywhere | 066797362ff07b9b13b68b0aa78eaad5e7e7b27b | [
"MIT"
] | null | null | null | <ruleset name="Metaboli.co.uk">
<target host="metaboli.co.uk" />
<target host="www.metaboli.co.uk" />
<rule from="^http://(www\.)?metaboli\.co\.uk/" to="https://www.metaboli.co.uk/" />
</ruleset>
| 29 | 84 | 0.62069 |
0ee3a49f4c056febd22b79c2d19234f6251040f0 | 7,230 | xml | XML | Recursos/XmlExtraido/GP05_PapaYMamas/object/object_MakingAMess.xml | velocist/TS4CheatsInfo | b59ea7e5f4bd01d3b3bd7603843d525a9c179867 | [
"Apache-2.0"
] | null | null | null | Recursos/XmlExtraido/GP05_PapaYMamas/object/object_MakingAMess.xml | velocist/TS4CheatsInfo | b59ea7e5f4bd01d3b3bd7603843d525a9c179867 | [
"Apache-2.0"
] | null | null | null | Recursos/XmlExtraido/GP05_PapaYMamas/object/object_MakingAMess.xml | velocist/TS4CheatsInfo | b59ea7e5f4bd01d3b3bd7603843d525a9c179867 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<I c="GameObject" i="object" m="objects.game_object" n="object_MakingAMess" s="162781">
<U n="_components">
<V n="canvas" t="enabled">
<V n="enabled" t="canvas_component">
<U n="canvas_component">
<L n="canvas_types">
<E>Normal</E>
</L>
</U>
</V>
</V>
<V t="enabled" n="focus">
<U n="enabled">
<V n="_focus_score" t="globally">
<U n="globally">
<E n="base">LOW</E>
</U>
</V>
</U>
</V>
<V n="state" t="enabled">
<U n="enabled">
<L n="states">
<U>
<L n="client_states">
<U>
<T n="key">162803<!--CommodityBasedObjectStateValue: makeAMess_VariantA_1--></T>
</U>
<U>
<T n="key">162805<!--CommodityBasedObjectStateValue: makeAMess_VariantA_2--></T>
</U>
<U>
<T n="key">162806<!--CommodityBasedObjectStateValue: makeAMess_VariantA_3--></T>
</U>
<U>
<T n="key">162808<!--CommodityBasedObjectStateValue: makeAMess_VariantA_0--></T>
</U>
</L>
<V n="default_value" t="reference">
<T n="reference">162808<!--CommodityBasedObjectStateValue: makeAMess_VariantA_0--></T>
</V>
</U>
<U>
<L n="client_states">
<U>
<T n="key">163010<!--CommodityBasedObjectStateValue: makeAMess_VariantB_0--></T>
</U>
<U>
<T n="key">163011<!--CommodityBasedObjectStateValue: makeAMess_VariantB_1--></T>
</U>
<U>
<T n="key">163012<!--CommodityBasedObjectStateValue: makeAMess_VariantB_2--></T>
</U>
<U>
<T n="key">163013<!--CommodityBasedObjectStateValue: makeAMess_VariantB_3--></T>
</U>
</L>
<V n="default_value" t="reference">
<T n="reference">163010<!--CommodityBasedObjectStateValue: makeAMess_VariantB_0--></T>
</V>
</U>
<U>
<L n="client_states">
<U>
<T n="key">163014<!--CommodityBasedObjectStateValue: makeAMess_VariantC_0--></T>
</U>
<U>
<T n="key">163015<!--CommodityBasedObjectStateValue: makeAMess_VariantC_1--></T>
</U>
<U>
<T n="key">163016<!--CommodityBasedObjectStateValue: makeAMess_VariantC_2--></T>
</U>
<U>
<T n="key">163017<!--CommodityBasedObjectStateValue: makeAMess_VariantC_3--></T>
</U>
</L>
<V n="default_value" t="reference">
<T n="reference">163014<!--CommodityBasedObjectStateValue: makeAMess_VariantC_0--></T>
</V>
</U>
<U>
<L n="client_states">
<U>
<T n="key">165008<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantD_0--></T>
</U>
<U>
<T n="key">165009<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantD_1--></T>
</U>
<U>
<T n="key">165010<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantD_2--></T>
</U>
<U>
<T n="key">165011<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantD_3--></T>
</U>
</L>
<V n="default_value" t="reference">
<T n="reference">165008<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantD_0--></T>
</V>
</U>
<U>
<L n="client_states">
<U>
<T n="key">165128<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantE_0--></T>
</U>
<U>
<T n="key">165129<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantE_1--></T>
</U>
<U>
<T n="key">165130<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantE_2--></T>
</U>
<U>
<T n="key">165131<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantE_3--></T>
</U>
</L>
<V n="default_value" t="reference">
<T n="reference">165128<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantE_0--></T>
</V>
</U>
<U>
<L n="client_states">
<U>
<T n="key">165132<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantF_0--></T>
</U>
<U>
<T n="key">165133<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantF_1--></T>
</U>
<U>
<T n="key">165134<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantF_2--></T>
</U>
<U>
<T n="key">165135<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantF_3--></T>
</U>
</L>
<V n="default_value" t="reference">
<T n="reference">165132<!--CommodityBasedObjectStateValue: makeAMess_FlourVariantF_0--></T>
</V>
</U>
<U>
<L n="client_states">
<U>
<T n="key">167173<!--ObjectStateValue: makeAMess_Transient--></T>
</U>
<U>
<T n="key">167174<!--ObjectStateValue: makeAMess_NonTransient--></T>
</U>
</L>
<V n="default_value" t="reference">
<T n="reference">167173<!--ObjectStateValue: makeAMess_Transient--></T>
</V>
</U>
</L>
</U>
</V>
</U>
<L n="_super_affordances">
<T>13328<!--ImmediateSuperInteraction: debug_Reset--></T>
<T>13326<!--ImmediateSuperInteraction: debug_ObjectDestroy--></T>
<T>103888<!--ImmediateSuperInteraction: cheat_set_as_head--></T>
<T>163326<!--SuperInteraction: superInteraction_MakeAMess_VariantA_Continue--></T>
<T>13983<!--StandSuperInteraction: sim-stand--></T>
<T>163332<!--SuperInteraction: superInteraction_MakeAMess_VariantB_Continue--></T>
<T>163334<!--SuperInteraction: superInteraction_MakeAMess_VariantC_Continue--></T>
<T>163254<!--SuperInteraction: superInteraction_MakeAMess_Cleanup--></T>
<T>165016<!--SuperInteraction: superInteraction_MakeAMess_FlourVariantD_Continue--></T>
<T>174342<!--SuperInteraction: dog_Misbehavior_TrashPilePlay--></T>
<T>162966<!--SuperInteraction: pet_Misbehavior_TrashPilePlay--></T>
</L>
<U n="recycling_data">
<L n="recycling_values">
<U>
<E n="Bucks Type">RecycleBitsBucks</E>
<T n="Value">0.5</T>
</U>
<U>
<E n="Bucks Type">RecyclePiecesBucks</E>
<T n="Value">0.5</T>
</U>
</L>
</U>
<V n="supported_posture_types" t="literal">
<L n="literal">
<U>
<T n="posture_type">15537<!--MobilePosture: posture_Stand--></T>
</U>
</L>
</V>
</I> | 38.457447 | 105 | 0.501798 |
3cfaab31608ba788ca55101fbf0c3785f528a1d3 | 785 | xml | XML | ethics_statement_project/stem_cell_2018/PMC6442956/sections/2_back/2_ref-list/27_ref.xml | petermr/dictionary | 4b5e4c79adacf8ba0973c16c2f702cc1110624b8 | [
"Apache-2.0"
] | 7 | 2021-01-30T17:42:00.000Z | 2022-01-09T08:08:48.000Z | ethics_statement_project/stem_cell_2018/PMC6442956/sections/2_back/2_ref-list/27_ref.xml | petermr/dictionary | 4b5e4c79adacf8ba0973c16c2f702cc1110624b8 | [
"Apache-2.0"
] | 25 | 2020-11-16T15:36:41.000Z | 2021-06-01T05:15:31.000Z | ethics_statement_project/stem_cell_2018/PMC6442956/sections/2_back/2_ref-list/27_ref.xml | petermr/dictionary | 4b5e4c79adacf8ba0973c16c2f702cc1110624b8 | [
"Apache-2.0"
] | 2 | 2020-11-16T08:51:25.000Z | 2021-03-02T18:07:05.000Z | <?xml version="1.0" encoding="UTF-8"?>
<ref id="b27-1040835">
<label>27.</label>
<mixed-citation publication-type="journal">
<person-group person-group-type="author">
<name>
<surname>Newell</surname>
<given-names>LF</given-names>
</name>
<name>
<surname>Flowers</surname>
<given-names>ME</given-names>
</name>
<name>
<surname>Gooley</surname>
<given-names>TA</given-names>
</name>
<etal/>
</person-group>
<article-title>Characteristics of chronic GVHD after cord blood transplantation</article-title>.
<source>Bone Marrow Transplant</source>.
<year>2013</year>;
<volume>48</volume>(
<issue>10</issue>):
<fpage>1285</fpage>–
<lpage>1290</lpage>.
<pub-id pub-id-type="pmid">23584444</pub-id>
</mixed-citation>
</ref>
| 26.166667 | 99 | 0.649682 |
a74fcdb79cea005bf7d5c2bff9543da4010a0d14 | 4,013 | xml | XML | Languages/Russian/DefInjected/ThingDef/RangedSpacer.xml | emipa606/CyberneticWarfare | 07948a20ff45a5ec493167833b0dd37b04a6e1a5 | [
"MIT"
] | null | null | null | Languages/Russian/DefInjected/ThingDef/RangedSpacer.xml | emipa606/CyberneticWarfare | 07948a20ff45a5ec493167833b0dd37b04a6e1a5 | [
"MIT"
] | null | null | null | Languages/Russian/DefInjected/ThingDef/RangedSpacer.xml | emipa606/CyberneticWarfare | 07948a20ff45a5ec493167833b0dd37b04a6e1a5 | [
"MIT"
] | 1 | 2020-08-04T11:26:10.000Z | 2020-08-04T11:26:10.000Z | <?xml version="1.0" encoding="utf-8"?>
<LanguageData>
<!-- Disruptor -->
<Bullet_DisruptorOrb.label>электронная сфера</Bullet_DisruptorOrb.label>
<Bullet_UltraEMP.label>ультра ЭМИ</Bullet_UltraEMP.label>
<Bullet_StunningForce.label>оглушающая Сила</Bullet_StunningForce.label>
<Bullet_NonLethalCharge.label>не смертельный заряд</Bullet_NonLethalCharge.label>
<CW_Disruptor.label>Разрушитель</CW_Disruptor.label>
<CW_Disruptor.description>Тяжелый пистолет с генератором создающим электронные сферы, разрушающие одиночные цели. Регулируемая система питания изначально была разработана для нелетального действия и оглушения любого гуманоида одним выстрелом. Стандартное надзорное оборудование на Планетах-тюрьмах.\n\nЭта обновленная версия имеет доступ к четырем различным режимам огня.</CW_Disruptor.description>
<CW_Disruptor.tools.0.label>рукоятка</CW_Disruptor.tools.0.label>
<CW_Disruptor.tools.1.label>ствол</CW_Disruptor.tools.1.label>
<CW_Disruptor.verbs.0.label>Электронная Сфера</CW_Disruptor.verbs.0.label>
<CW_Disruptor.verbs.1.label>Ультра ЭМИ</CW_Disruptor.verbs.1.label>
<CW_Disruptor.verbs.2.label>Оглушающая Сила</CW_Disruptor.verbs.2.label>
<CW_Disruptor.verbs.3.label>Не смертельный заряд</CW_Disruptor.verbs.3.label>
<!-- Napalm Blaster -->
<Bullet_NapalmFlame.label>море пламени</Bullet_NapalmFlame.label>
<Bullet_NapalmBlast.label>концентрированный напалм</Bullet_NapalmBlast.label>
<Bullet_NapalmWave.label>концентрированный напалм</Bullet_NapalmWave.label>
<CW_NapalmBlaster.label>напалмовый бластер</CW_NapalmBlaster.label>
<CW_NapalmBlaster.description>Тяжелый огнемет с напалмом. Это механическое зажигательное устройство было разработано, чтобы созданния длинного, управляемого потока жидкого огня.\n\nУровень нагрева может быть удобно отрегулирован встроенным контроллером пиромантии.</CW_NapalmBlaster.description>
<CW_NapalmBlaster.tools.0.label>приклад</CW_NapalmBlaster.tools.0.label>
<CW_NapalmBlaster.tools.1.label>ствол</CW_NapalmBlaster.tools.1.label>
<CW_NapalmBlaster.verbs.0.label>Фаренгейт</CW_NapalmBlaster.verbs.0.label>
<CW_NapalmBlaster.verbs.1.label>Адский</CW_NapalmBlaster.verbs.1.label>
<CW_NapalmBlaster.verbs.2.label>Пекло</CW_NapalmBlaster.verbs.2.label>
<!-- Dual Eraser -->
<Bullet_DualEraser.label>двойная пуля</Bullet_DualEraser.label>
<CW_DualEraser.label>двойной стиратель</CW_DualEraser.label>
<CW_DualEraser.description>Пара скорострельных пистолетов-пулеметов с огромными магазинами для двойного оружия. Огромная огневая мощь, такая как мульти выстрел, достигается за счет низкой точности. Можно найти на Урбанистических мирах с повышенной криминальной активностью, где присутствуют узкие переулки. Может быть установлен на кибернетику для более быстрой перезагрузки близких целей.\n\nСделано для Акимбо.</CW_DualEraser.description>
<CW_DualEraser.tools.0.label>рукоятка</CW_DualEraser.tools.0.label>
<CW_DualEraser.tools.1.label>Ствол</CW_DualEraser.tools.1.label>
<CW_DualEraser.verbs.0.label>Мульти Выстрел</CW_DualEraser.verbs.0.label>
<CW_DualEraser.verbs.1.label>Быстрый огонь</CW_DualEraser.verbs.1.label>
<!-- Accelerator -->
<Bullet_Accelerator.label>сингулярность</Bullet_Accelerator.label>
<CW_Accelerator.label>акселератор</CW_Accelerator.label>
<CW_Accelerator.description>Тяжелая система кибернетического оружия. Внутренние катушки этого монструма включаются и выключаются в точно синхронизированной последовательности, что приводит к быстрому ускорению гибридных снарядов вдоль ствола с помощью магнитных сил. Меняет местами боеприпасы при переключении.</CW_Accelerator.description>
<CW_Accelerator.tools.0.label>приклад</CW_Accelerator.tools.0.label>
<CW_Accelerator.tools.1.label>ствол</CW_Accelerator.tools.1.label>
<CW_Accelerator.verbs.0.label>Сингулярность</CW_Accelerator.verbs.0.label>
<CW_Accelerator.verbs.1.label>Заряженный</CW_Accelerator.verbs.1.label>
<CW_Accelerator.verbs.2.label>Двойная Выдача</CW_Accelerator.verbs.2.label>
</LanguageData> | 91.204545 | 442 | 0.822826 |
cf92637fd13c9008bea36cb1dc136428286e6586 | 44,213 | xml | XML | ecco_all/ecco_unfinished/XML/ECCO_unedited.xml/K108900.000.xml | Text-Creation-Partnership/ECCO-TCP | 4a3c025535ead1532d7ce4b80a6cfe8cedb5a1de | [
"CC0-1.0"
] | 2 | 2018-01-18T17:51:02.000Z | 2021-11-05T03:16:22.000Z | ecco_all/ecco_unfinished/XML/ECCO_unedited.xml/K108900.000.xml | Text-Creation-Partnership/ECCO-TCP | 4a3c025535ead1532d7ce4b80a6cfe8cedb5a1de | [
"CC0-1.0"
] | null | null | null | ecco_all/ecco_unfinished/XML/ECCO_unedited.xml/K108900.000.xml | Text-Creation-Partnership/ECCO-TCP | 4a3c025535ead1532d7ce4b80a6cfe8cedb5a1de | [
"CC0-1.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<?xml-stylesheet TYPE="text/css" href="http://www.lib.umich.edu/tcp/docs/code/pfs.css"?>
<!DOCTYPE ETS SYSTEM "http://www.lib.umich.edu/tcp/docs/code/eebo2prf.xml.dtd">
<ETS>
<TEMPHEAD>
<REVDESCR>
<CHANGE><DATE>yyyy-mm-dd</DATE><RESPSTMT><NAME>[name of reviewer]</NAME><RESP>MURP</RESP></RESPSTMT><ITEM>Proofed text and corrected markup.</ITEM></CHANGE>
</REVDESCR>
</TEMPHEAD>
<EEBO>
<IDG S="marc" R="OX" ID="K108900.000">
<STC T="C">T138044</STC>
<BIBNO T="docno">CW3310375715</BIBNO>
<VID SET="ECLL">0058600600</VID>
</IDG>
<TEXT LANG="eng">
<FRONT>
<DIV1>
<P><PB REF="1"/>
THE VILLAGE LAWYER: A FARCE, IN TWO ACTS, AS PERFORMED AT THE THEATRES ROYAL IN LONDON AND DUBLIN, With universal Applause.</P>
<P>DUBLIN: PRINTED BY T. M'DONNEL, No. 50, ESSEX-STREET.</P>
<P>M,DCC,XCII.</P>
</DIV1>
<DIV1>
<PB REF="2"/>
<HEAD>Dramatis Personae. LONDON.</HEAD>
<P><TABLE>
<ROW>
<CELL COLS="2">MEN.</CELL>
</ROW>
<ROW>
<CELL><HI>Scout,</HI></CELL>
<CELL>Mr. Bannister, jun.</CELL>
</ROW>
<ROW>
<CELL><HI>Snarl,</HI></CELL>
<CELL>Mr. Bannister.</CELL>
</ROW>
<ROW>
<CELL><HI>Sheepface,</HI></CELL>
<CELL>Mr. Parsons.</CELL>
</ROW>
<ROW>
<CELL><HI>Justice Mittimus,</HI></CELL>
<CELL>Mr. Usher.</CELL>
</ROW>
<ROW>
<CELL><HI>Charles,</HI></CELL>
<CELL>Mr. Farley:</CELL>
</ROW>
<ROW>
<CELL COLS="2">WOMEN.</CELL>
</ROW>
<ROW>
<CELL>Mrs. <HI>Scout,</HI></CELL>
<CELL>Mrs. Webb.</CELL>
</ROW>
<ROW>
<CELL><HI>Kate,</HI></CELL>
<CELL>Miss Fontenelle.</CELL>
</ROW>
</TABLE></P>
</DIV1>
<DIV1>
<PB REF="3"/>
<HEAD>Dramatis Personae. DUBLIN.</HEAD>
<P><TABLE>
<ROW>
<CELL COLS="2">MEN.</CELL>
</ROW>
<ROW>
<CELL><HI>Scout,</HI></CELL>
<CELL>Mr. Duffy.</CELL>
</ROW>
<ROW>
<CELL><HI>Snarl,</HI></CELL>
<CELL>Mr. Mitchell.</CELL>
</ROW>
<ROW>
<CELL><HI>Sheepface,</HI></CELL>
<CELL>Mr. Barret.</CELL>
</ROW>
<ROW>
<CELL><HI>Charles,</HI></CELL>
<CELL>Mr. O'Reilly.</CELL>
</ROW>
<ROW>
<CELL COLS="2">WOMEN.</CELL>
</ROW>
<ROW>
<CELL><HI>Mrs. Scout,</HI></CELL>
<CELL>Mrs. Marshall.</CELL>
</ROW>
<ROW>
<CELL><HI>Kate,</HI></CELL>
<CELL>Mrs. Hitchcock.</CELL>
</ROW>
</TABLE></P>
</DIV1>
</FRONT>
<BODY>
<DIV1>
<PB REF="4"/>
<HEAD>THE VILLAGE LAWYER.</HEAD>
<DIV2 N="1">
<HEAD>ACT I.</HEAD>
<DIV3 N="1">
<HEAD>SCENE I.</HEAD>
<STAGE><HI>A Room in</HI> Scout<HI>'s House.</HI></STAGE>
<STAGE><HI>(Without.)</HI> Mrs. Scout.</STAGE>
<P>I Tell you it shall be—</P>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Na! na! but my Dear, now!</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>It does not signify talking—I must and will have it so.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>But think, my Dear, how ridiculous—</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>I don't care—I'm resolv'd—I'll no longer be the laughing Stock of the whole Country; do you imagine I'll—</P>
<STAGE><HI>Enter</HI> Mr. Scout. Mrs. Scout <HI>following.</HI></STAGE>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Nay! but my dear sweet Love, that inde∣fatigable
<PB N="6" REF="5"/>
Tongue of yours, would out-talk any Law∣yer in the Kingdom; I can talk sometimes pretty well myself, but I stand no chance with you—why, you would out-din the whole Bar itself, that tho' a Lawyer—</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<STAGE>(Sneering.)</STAGE>
<P>A Lawyer! No one to see you in this Trim, would imagine you had ever carried a Cause in any Body's Suit but your own—had you a grain of Spirit left, you might—</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Spirit! Nay, nay, Wife, don't complain of my want of Spirit; Was it not my Spirit that drove me from the Capital, and make me bury my Talents in Obscurity? Have not I attended all the Harangues of the Courts with only a little Whizzing on one side, and a Deafness on the other? And have not I con∣vinced you I had too much Spirit on a certain Oc∣casion?—</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Very fine indeed,—And so you make a Merit of your Blunders.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Blunders, indeed!—I think I made a Blun∣der in coming here—Not a single Job have I got since I have been down; not a broken Head, nor a Quarrel for one to get a Penny by—there has not been a Bastard born since we have been here! And, Damn me, if I don't think the very Cattle keep out of the Pound on purpose to spite me. Now, if one could put on the Appearance of Business, the Rea∣lity will follow of Course, and perhaps something may turn out.—</P>
</SP>
<SP>
<PB N="7" REF="6"/>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Yes, and in the mean Time, your poor Wife may starve, and your Daughter lose the Opportunity of settling herself handsomely with one of the young Men that pay their Addresses to her; which the Shabbiness of your Appearance has fright∣ened away.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Why, to be sure, I am Shabby enough of all Conscience, and cannot with any Propriety make my Appearance in Public.—Let me see—I have it—I'll go and purchase a Suit of Clothes directly.</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Purchase a Suit of Clothes without a Shilling in your Pocket?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>O, my Dear, that's nothing at all: most of the fashionable Suits in London are purchas∣ed that way. Let me see—what Colour shall I chuse? shall it be a Brown—a Grey—a Bat's-wing—or—</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Oh! never mind the Colour, so you can only find somebody Fool enough to let you have the Cloth.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>O, I'll warrant you. Let me see now—There's Neighbour Snarl now, that lives over the Way, he keeps a large Assortment of Colours, I'll hum him out of a Suit.</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Mr. Snarl!—take care what you do there, Husband; his Son, Charles, is in Love with our Harriot, and would have married her before now, but for fear of his Father's Anger—I would not for the World disappoint the Girl's hopes.</P>
</SP>
<SP>
<PB N="8" REF="7"/>
<SPEAKER>Scout.</SPEAKER>
<P>Well! well! step in and bring my Gown and Band—it will, at least, make me have a better Appearance, <STAGE><HI>[Exit</HI> Mrs. Scout.</STAGE> by hiding these damned Rags of mine.—Come, Wife, make haste—take care you don't break the China Bason on the Window.—Come, what a long Time you are.</P>
<STAGE><HI>Enter</HI> Mrs. Scout.</STAGE>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Why, I brought it as soon as I could.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Come—help me on with it—take Care what you are about. See what a large Hole here is. You sit all Day with your Hands before you—and I think you might have mended it.</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>I'll mend it when you come back,</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>There—there—now I shall do very well! and let me tell you, Wife, I am not the only one that make use of a Gown to hide Things that are not fit to be seen.</P>
<STAGE>[Exit.</STAGE>
</SP>
</DIV3>
<DIV3 N="2">
<PB N="9" REF="8"/>
<HEAD>SCENE II.</HEAD>
<STAGE>Snarl<HI>'s Shop</HI></STAGE>
<STAGE><HI>Enter</HI> Snarl, <HI>and</HI> Charles <HI>following.</HI></STAGE>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Charles, have you been looking out for another Shepherd, as I told you?</P>
</SP>
<SP>
<SPEAKER>Charles.</SPEAKER>
<P>No, Sir, I think you have got a very good one.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>No such Thing—I tell you that Sheep∣face is a Rogue—Here he has lived with me only a Fortnight, and there are missing Fourteen of my best Weathers.</P>
</SP>
<SP>
<SPEAKER>Charles.</SPEAKER>
<P>Consider, Sir, what Havock such a Dis∣order makes in a little Time.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Yes, Yes,—I have considered—and I know pretty well by this Time. I have long suspected him—and last Night I caught him in the very Fact, killing one of my fattest Weathers; and am de∣termined to have him up before Justice Mittimus this Day—but reach me my Book, and let me look over the Account of my Flock, perhaps there may be more Missing.</P>
</SP>
<SP>
<SPEAKER>Charles.</SPEAKER>
<P>There it is, Sir.</P>
<STAGE>(gives an Account Book.)</STAGE>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<STAGE>(Sits down.)</STAGE>
<P>And if Neighbour Gripe call, tell him I want to talk with him about this Rascal, Sheepface.—Let me see—Twelve times Ten</P>
<PB N="10" REF="9"/>
<STAGE><HI>Enter</HI> Sheepface <HI>behind.</HI></STAGE>
</SP>
<SP>
<SPEAKER>Charles.</SPEAKER>
<P>Sheepface—my Father has discovered all—do the best you can, beware saying too much.</P>
<STAGE><HI>[Exit</HI> Charles.</STAGE>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Save you, good Master Snarl.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>What! you Rascal! are you here? how dare you appear before me after the Trick you play'd me.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Only to tell you, I've been with Neigh∣bour Gripe, the Constable, who has been speaking to me about Sheep-stealing, Justice Mittimus, your Honour, and a power of Things—so I said to my∣self, as how I would not make it a Secret any longer with your good Workship.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Why! Fellow! this affected Simplicity won't serve your Purpose.—Did not I catch you last Night killing one of my fattest Weathers.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Only to keep it from Dying, by my Feckins.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>To keep it from Dying!—</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Of the Rot, an please your sweet Wor∣ship—it's a Way I learnt of our Doctor in the Parish, he cures most of his Patients the same Way.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>the Doctor, ha! the Doctors have a Li∣sence to kill from the College, but you have none, I believe. Why! there was not such a Breed in all the Kingdom for Spanish Wool!</P>
</SP>
<SP>
<PB N="11" REF="10"/>
<SPEAKER>Sheepface.</SPEAKER>
<P>Please your Worship, satisfy yourself with the Blows you gave me, and make Matters up, if it be your Worship's good Will and Pleasure.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>But 'tis not my good Will and Pleasure—my good Will and Pleasure is to see you hanged, you Rascal.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Oh! no; don't hang me!—consider that would be the Death of me! besides, your Worship, I was only married Yesterday—leave me alone for a Week or two, and who knows, but by that Time, I may save your Worship the Trouble.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>No, no, the Gallows will be the best Way at first, and every bit as sure.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Heaven give you the Luck of it, good Master Snarl.—Since it must be so, I must go seek for a Lawyer, I find, or Might will prevail over Right.</P>
<STAGE><HI>[Exit</HI> Sheepface.</STAGE>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Six times Twelve is Seventy-two—that is Right—then Nine times Seven is—</P>
<STAGE><HI>Enter</HI> Scout.</STAGE>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Egad! I have nick'd it nicely!—this was very lucky to catch him alone.—That seems to be a pretty piece of Cloth, and will just suit me. Good Morning to you, Mr. Snarl.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>O! what Neighbour Gripe! walk in.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>No, it's I, your Neighbour Scout.</P>
</SP>
<SP>
<PB N="12" REF="11"/>
<SPEAKER>Snarl.</SPEAKER>
<P>I am my Neighbour Scout's most obedient—but I have no Business with him, at present, that I know of.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<STAGE>(Aside.)</STAGE>
<P>I'll make you tell a different Story presently, or I am much mistaken.—I call'd to settle a little Account.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>I have no Account to settle with any body.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>There is a small Ballance of fifty Pounds—</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>I know nothing at all about it; I don't owe any Man a Farthing in the World.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>I wish I could say as much for myself, <STAGE>(aside.)</STAGE> Why, Sir, looking over my Father's Ac∣counts, I see he stands indebted to you fifty Pounds; and I, asan honest Man, am come to pay it.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<STAGE>(Turning round, rises, and shakes him by the Hand.)</STAGE>
<P>How do you do, Neighbour Scout? How do you do? I'm glad to see you!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Very well, I thank you, Sir. How do you do?</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>I think you live in our Village here.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Yes, Sir, I do.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Pray be seated.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>By no Means, I fcar I disturb you?</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Oh! no, not at all, pray sit down—I in∣sist upon it.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Ah! Sir, if every body was of my Prin∣ciple, I should be a deal richer than I am; I cannot bear to be in any body's Debt.</P>
</SP>
<SP>
<PB N="13" REF="12"/>
<SPEAKER>Snarl.</SPEAKER>
<P>Why? egad! the Generality of People bear it very well.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Very true, Sir, very true; when would you like to receive this Money? for I am impatient to pay every body.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Why, when you please.—No Time like the Time present.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Very true; I have it told out at home; but as I only hold my Father's Effects in Trust for my Daughter Harriot, for Form sake, you know it will be proper to have some of the other Guardians present at the Time of Payment.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Very true, it is so indeed!—Well, as soon as you please.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>What do you think of Three o'Clock this Afternoon?</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>A very good Time.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>And, egad! it happens very lucky—I have got a very fine Goose sent me by a Client from Norfolk, and you shall come and dine with me.—Are you fond of Goose?</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Very. It's my favourite Dish.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>That's very lucky. Don't forget to come. I think you do a deal of business here; more than all the Rest of the Trade around the Country.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Pretty well; I can't complain.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>And Mrs. Scout will dress the Goose by a valuable Receipt left her by her Great Uncle Al∣derman Dumpling.—Do you like it with Sage and Onion?</P>
</SP>
<SP>
<PB N="14" REF="13"/>
<SPEAKER>Snarl.</SPEAKER>
<P>Very much, indeed!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>You shall have it so. Why, you have such an engaging Way with you, that People take more Pleasure in paying you Money, than in re∣ceiving it from other People.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Ah, Sir, you slatter me!</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Not at all.—Egad! now I recollect—I promised Mr. Scout should have my Custom; and I don't care if I take a Coat to begin with.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Pray, Sir, look over my Pattern's, here's a Variety of Colours.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>This seems to be a pretty Piece of Cloth.</P>
<STAGE>(Feeling the Cloth that lies on the Counter.)</STAGE>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Very fine, and good!—It's an Iron Grey.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Don't you remember our going to School together.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>What! along with old Iron Fist.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>The same. You was reckoned the pretti<GAP DESC="illegible" EXTENT="1 letter" DISP="•"/>st boy in the whole school.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Yes? my Mother said I always was a pretty boy.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>This Cloth seems very smooth and fine.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Right Spanish Wool I assure you!—Let, me send your Quantity to your House?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Stop! stop!—Pay as you go—pay as you go!—That is always my Maxim.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>And, egad, a very good Maxim 'tis!—I Wish all my Customers made Use of the same.</P>
</SP>
<SP>
<PB N="15" REF="14"/>
<SPEAKER>Scout.</SPEAKER>
<P>Don't you remember the tricks you used to play the Curate.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Yes, very well.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Ay, you was always full of mischsef—what is this Cloth a yard.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Why to any body else it should be Nine∣teen Shillings and Sixpence, but—</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Now you are going to favour me.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>No, I am not; only as you are a particular friend, I won't charge you but Nineteen—And luckily here is just your quantity cut off.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>That's lucky, I'll take it home with me.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>By no means; my Boy—</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Why would you take the poor Boy from his Work? I don't mind carrying it myself.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>But, let me measure it; perhaps there may be some Mistake?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>No mistake—dy'e think I doubt your word,</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>But the price!—</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Never mind that, I leave it entirely to you.—Well, good Morning—Don't forget the Goose:—You'll be sure to be there Time enough to dine, before you receive your Money. Good Morn∣ing—Don't forget.</P>
<STAGE>[Eit.</STAGE>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Demme but he's carried off my cloth.—But he'll pay: O yes, he'll pay; for he must be a very honest Man, or he never would have told me of the fifty Pounds, and invite me to dine off the Goose into the Bargain. I am sorry I cheated him in the
<PB N="16" REF="15"/>
Cloth—but no Matter; it is the Way I got all my Money.</P>
<STAGE>[Exit.</STAGE>
</SP>
</DIV3>
<DIV3 N="3">
<HEAD>SCENE III.</HEAD>
<STAGE><HI>Enter</HI> Sheepface <HI>and</HI> Kate.</STAGE>
<SP>
<SPEAKER>Kate.</SPEAKER>
<P>If you wants a Lawyer to get you fairly out of a Scrape, my Master's the Man for your Money, Sheepface.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>I remember he stood my Friend before, from being hanged at York!—and, would you be∣lieve it, only for mending the Complexion of a bald faced Horse; and I don't know how it was, I have such a treacherous Memory: but some how or other—I forgot to pay him.</P>
</SP>
<SP>
<SPEAKER>Kate.</SPEAKER>
<P>O never mind—he won't remember that; but be very careful not to tell him your Master's Name.—I know he would not be concerned against Mr. Snarl, for the World!</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>No, no—I'll only tell him 'tis my Master, and he'll think I mean the rich Farmer I lived with formerly.</P>
</SP>
<SP>
<SPEAKER>Kate.</SPEAKER>
<P>Well, well—that will do—but here he comes, I'll go in.</P>
<STAGE>[Exit Kate.</STAGE>
<PB N="17" REF="16"/>
<STAGE><HI>Enter</HI> Scout.</STAGE>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Egad I think I have made a good Morn∣ing's Work!—This cloth will enable me to make a genteel Appearance.—But who have we here? sure I should know that Face.—Hark ye, Sir!—Didn't I save you and your Brother from being hanged some Time ago, at York?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Yes.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>And by the same Rule, I think one of you forgot to pay me.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>That was Brother.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>One of you got off clear, and the other died soon after in Prison?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>That was not I!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>No, no—I see it was not.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>For all that I was sicker than my Brother;—but I am come to ask your Worship to stand my Friend against a—his Worship, my Master.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>What! the rich Farmer here, that lives in the Neighbourhood?</P>
</SP>
<SP>
<SPEAKER>Shep.</SPEAKER>
<P>Yes, yes—he lives in the Neighbourhood sure enough;—and if you will stand my Friend, you shall be paid to your Heart's Content.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Aye! Now you speak to the Purpose:—Come, you must tell me how it was.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Why you must know my Master gives me
<PB N="18" REF="17"/>
but small Wages—very small Wages indeed!—So I thought I might as well do a little Business on my own Account, and so make myself Amends without any Damage to him, with an honest Neighbour of mine—a little Bit of a Butcher by Trade.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Well! But what Business can you have to do with him?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Why, saving your Worship's Presence—I hinders the Sheep from dying of the Rot.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Ah!—How do you contrive that?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>I cuts their Throats before it comes to them.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>What!—I suppose then your Master thinks that you kill his Sheep for the sake of selling their Carcasses?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Yes, and I cannot beat it out of his Head for the Soul of me.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Well; then you must tell me all the parti∣culars about it.—Relate every Circumstance, and don't hide a single Item.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Why, then Sir, you must know—that last Night, as I was going down,—(Must I tell the Truth?)—</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Yes, yes—You must tell the Truth here, or we shall never be able to lie to the Purpose any where else.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Well then—Last Night after I was mar∣ried, having a little leisure Time upon my Hands, I goes down to our Penn, and as I was musing on I
<PB N="19" REF="18"/>
don't know what, out I takes my Knife, and hap∣pening by mere accident, saving your Worship's presence, to put it under the throat of one of the fattest Wethers; I don't know how it came about, but I had not been long there, before the Wether died, and all of a sudden, as a Body may say.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>What! and somebody was looking on all the while?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Yes, Master from behind the Hedge, and would have it, it died all along with me.—And so as you see—he laid such a Shower of Blows on me, that it kept the Bride out of Temper all Night—But I hope your Worship will stand my Friend, and not let me lose the Fruits of my honest Labour—all at once.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Why, there are two Ways of settling this Business—and one is, I think, to be done without putting you to any Expence.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Let's try that first by all Means.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>You have scraped up something in your Master's Service?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>I have been up late and early for it, Sir.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>I suppose you have taken Care to have your Savings all in hard Cash?</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Yes, Sir.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Well, then, when you go Home, take it and hide it in the safest Place you can find.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Yes, Sir, that I'll do.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>I'll take Care your Master shall pay all Costs <GAP DESC="illegible" EXTENT="2 letters" DISP="••"/>d Charges.</P>
</SP>
<SP>
<PB N="20" REF="19"/>
<SPEAKER>Scout.</SPEAKER>
<P>Aye, so he ought—he can afford it.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>It shall be nothing out of your Pocket.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>That's just as I would have it.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>He'll have all the Trouble and the Expence of bringing you to Trial, and after that have the Pleasure of seeing you hanged.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Let's take the other Way.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Well!—let me see—I suppose he'll take out a Warant against you, and have you taken before Justice Mittimus.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>So I understand.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>I think the Justice's Credulity is easily im∣posed on:—so when you are ordered before him, I'll attend, and to all the Questions that you are asked, answer nothing, but imitate the Voice of the Lambs, when they bleat afte the Ewes—You can speak that Dialect.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>It's my Mother Tongue.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>But if I bring you off clear, I expect to be very well paid for this.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>So you shall—I'll pay you to your Heart's Content.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Be sure you answer nothing but Baa!</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Baa!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Aye! that will do very well—Be sure stick to that.</P>
</SP>
<SP>
<SPEAKER>Sheep.</SPEAKER>
<P>Yes, your Worship—Never fear I—What Trouble a Body has to keep one's own in this World.</P>
<STAGE>[Exeunt severally.</STAGE>
</SP>
</DIV3>
<DIV3 N="4">
<PB N="21" REF="20"/>
<HEAD>SCENE IV.</HEAD>
<STAGE><HI>The Outside of</HI> Scout's <HI>House.</HI></STAGE>
<STAGE><HI>Enter</HI> Snarl.</STAGE>
<P>Aye, aye—that's my Neighbour Scout's House—he is just come Home to give orders about the Din∣ner, I warrant—Egad, I think I shall make a good Day's Work—What with the Fifty Pounds his Fa∣ther owed mine—which, by the bye, I know no∣thing at all about—and the money for the Cloth—and the Goose that is to be dress'd by a famous Re∣ceipt from Alderman Dumpling's.—Egad, I be∣lieve they are dressing it now—I'll in, and see what is going forward.</P>
<STAGE>[Exit.</STAGE>
</DIV3>
<DIV3 N="5">
<PB N="22" REF="21"/>
<HEAD>SCENE V.</HEAD>
<STAGE><HI>The Inside of</HI> Sout's <HI>House.</HI></STAGE>
<STAGE><HI>Enter</HI> Scout, Mrs. Scout <HI>following.</HI></STAGE>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Wife, wife—come along—I think I hear Snarl at the Door: come to your Place, and mind your Cue.</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Never fear me—I warrant I shall make an excellent Nurse.</P>
<STAGE><HI>Enter</HI> Snarl.</STAGE>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Where is my Friend Mr. Scout?—Is the Goose a Dressing?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Wife, Wife—Here comes the Doctor—he brings me the cooling Mixture—the cooling Mix∣ture!</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>The cooling Mixture!</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Oh, Sir! I hope you have brought something for my poor Husband; he has been con∣fined to his Room, and has not been out this Fort∣night.</P>
</SP>
<SP>
<PB N="23" REF="22"/>
<SPEAKER>Snarl.</SPEAKER>
<P>Not out of his Room this Fortnight!</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>No, Sir, This Day Fortnight, of all the good Days in the Year, he was seized with a Lunacy Fit, and has not been out of Doors, since.</P>
</SP>
<SP>
<SPEAKER>Mr. Snarl.</SPEAKER>
<P>Why, Woman! What are you talk∣ing about?—Why he came to my Shop this Morn∣ing, and by the same Token, bought four Yards of Iron Grey Cloth, and I am come for my Money.</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>This Morning!</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>This Morning! and invited me to dine with him To-day off a Goose, and to receive fifty Pounds which his Father owed mine.—I'll speak to him—How d'ye do, good Mr. Scout?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Oh! how d'ye do good Mr. Drench?</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Good Mr. Drench!</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>He takes you for the Doctor, Mr. Drench.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Wife, Wife—keep the Doctor frome me, and a Fig for the Disease.</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>For Heaven's Sake, Sir, if you can't relieve him, don't torment him.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Hold your Tongue Woman. I want my Cloth or my Money. Mr. Scout!—Mr. Scout!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>See! see! see!—there is three nice Butter∣slies, there they fly! there they fly! <STAGE>(Jumps after them)</STAGE> with b<GAP DESC="illegible" EXTENT="1 letter" DISP="•"/>t wings.—I've batch'd them—I have them—I have them—Tally-ho, Tally-ho!—Oh! oh! oh!</P>
<STAGE>(falls in the Chair).</STAGE>
</SP>
<SP>
<PB N="24" REF="23"/>
<SPEAKER>Snarl.</SPEAKER>
<P>Butterflies!—Damme if I can see any.—I wish to see my Cloth.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<STAGE>(Jumps on the Chair.)</STAGE>
<P>My Lord, and Gen∣tlemen of the Jury—My Client Sir Hugh Wither∣ington, charges the Defendant Mr. Mungummery,—that is moreover, nevertheless, as shall appear as—<STAGE>(spits at him)—(Jumps down and dances)</STAGE>—Dol! de rol de lol! Oh! oh! oh!—<STAGE>(Jumps cross-legg'd o<GAP DESC="illegible" EXTENT="1 letter" DISP="•"/> the <GAP DESC="illegible" EXTENT="1 word" DISP="〈◊〉"/>).</STAGE></P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>There now, he's fancying himself a Tay∣l<GAP DESC="illegible" EXTENT="2 letters" DISP="••"/>, and at Work upon my Cloth.</P>
</SP>
<SP>
<SPEAKER>Mrs. Scout.</SPEAKER>
<P>Do, pray Sir, leave him, and don't torment him.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>I won't leave him without my Money—See he is getting better.—I'll speak to him again.—How d'ye do neighbour Scout?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>How d'ye do Mr. Snarl?—I am glad to see you,—I hope you are very well? My dear here is Mr. Snarl come to see us!</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>There! there! there! he knows me—he knows me.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Oh Mr. Snarl, I beg a thousand pardons; I confess I have been very unkind; but I hope you'l excuse me for not coming to see you. I have never called on you since I come to live in this Part of the Country.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Never called on me! Oh, the Devil! I shall never get my Cloth again.—Why Man you called on me this Morning, and bought four Yards
<PB N="25" REF="24"/>
of Iron Grey Cloth, and I am come for my Money. Besides fifty Pounds your Father owed mine—Aye▪ you may shake your head; but dam'me If I go out of the House without it.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Say you so? then I'll try some thing else. <STAGE>(Aside.)</STAGE> Wife! Wife! Wife! get up—softly! softly! get up!—don't lie snoring there—there's Thieves in the House. No, no.—Second Thoughts, be still, while I fetch my Gun and shoot them. Cover yourself up close; I'll shoot them! shoot them! shoot them!</P>
<STAGE>[Exit.</STAGE>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Thieves in the House did he say? Egad▪ who knows but in his mad Tricks, he may shoot me for a Thief? I'll get out of his Way, and not stay with a Madman.</P>
<STAGE><HI>Enter</HI> Scout <HI>with a Birch Broom, and presents it at him. Boh!</HI></STAGE>
<STAGE>[Exit Snarl.</STAGE>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Victoria! Victoria!—Huzza.</P>
<STAGE>[Exeunt Mr. and Mrs. Scout.</STAGE>
</SP>
</DIV3>
<TRAILER>END OF THE FIRST ACT.</TRAILER>
</DIV2>
<DIV2 N="2">
<PB N="26" REF="25"/>
<HEAD>ACT II.</HEAD>
<DIV3 N="1">
<HEAD>SCENE I.</HEAD>
<STAGE>Justices Office.</STAGE>
<STAGE>Justice Mittimus <HI>discovered sitting,</HI> Clerks, &c.</STAGE>
<SP>
<SPEAKER>Justice.</SPEAKER>
<P>So the Court being assembled the Par∣ties may appear.</P>
<STAGE><HI>Enter</HI> Snarl, Scout, Sheepface, Constables, &c.</STAGE>
<P>Where's your Lawyer, neighbour Snarl?</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>I am my own Lawyer, I shall employ no∣body, that would cost more Money.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Why, how now you Rascal, have you im∣posed upon me? What's the meaning of all this? is that the Plaintiff?</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<STAGE>(Aside to Scout)</STAGE>
<P>Yes, that's his Honour, my good Master.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>O! the Devil! What shall I do? I must stay and brazen it out! If I sneak out of Court it will cause suspicion.</P>
<STAGE>(Aside.)</STAGE>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Come, neighbour Snarl, begin.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Well then, that Thief, there—</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>No abuse! no abuse!</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Well then, I say that Rascal my Shepherd—
<PB N="27" REF="26"/>
No—do my eyes deceive me, sure that is—yes—it must be he—if I had not left him very bad I could have sworn—yes, yes, 'tis him, and that other Ras∣cal came to my Shop and bought—No, No,—I don't mean so—that Rascal there has killed fourteen of my fattest Weathers. What answer do you make to that?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>I deny the fact.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>What is become of them then.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>They did die of the rot.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>'Tis him—his Voice too—</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>What proof have you got.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Why this Morning he came to my house—No, No, I mean I went down last night to the pens, having long suspected him—'tis he! 'tis he and he began a long Story about Fifty Pounds, No, No, I don't mean that, and there I caught him in the very fact.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>That remains to be proved.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Yes, I'll swear 'tis the very man.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Why this is the very man, but is it certain that your weathers died of the rot, what answer do you make to that?</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Why, I tell you, he came this very morning, and after talking some time, makes no more to do thancarries off four yards of it.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Four yards of your weathers.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>No, no, four yards of my Cloth, I mean that other Thief, that other there.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>What other! What other, neighbour Snarl?</P>
</SP>
<SP>
<PB N="28" REF="27"/>
<SPEAKER>Scout.</SPEAKER>
<P>Why he's mad, an please your Worship.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Truly I think so too, hark'ye neighbour Snarl, not all the Justices in the Country, no nor their Clerks neither, can make any thing of your evidence. Stick to your Weathers! stick to your Weathers! or I must release the prisoner; but howe∣ver I believe it will be the shortest way to examine him myself, come here my good fellow, hold up your head, don't be frightened, tell me your name.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa—</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>It's a lie! it's a lie! His name is Sheepface.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Well, well, Sheepface or Baa, no matter for the name, did Mr. Snarl give you in charge four score Sheep, Sheepface?</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa!</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>I say did Mr. Snarl catch you in the night killing one of his fattest Weathers.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>What does he mean by Baa?</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Please your Worship, the blows he gave this poor fellow on the head has so affected his senses, he can say nothing else; he is to be trepann'd as soon as the Court breaks up, and the Doctors say it is the whole Materia Medica, against a dose of Jalup, he never recovers.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>But the Act, and in that case provided, for∣bids all blows, particularly on the head.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>It was dark, and when I strike, I never mind where the blows fall.</P>
</SP>
<SP>
<PB N="29" REF="28"/>
<SPEAKER>Scout.</SPEAKER>
<P>A voluntary confession, a voluntary con∣fession!</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>A voluntary confession indeed, release the prisoner, I find no cause of complaint against him.</P>
<STAGE>[Rises.</STAGE>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>No cause of complaint against him! you are a pretty Justice indeed, one kills my Sheep, and the other pays me with Sir Hugh Witherington, and then you can see no cause of complaint against him.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Not I truly.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>A pretty day's work I have made indeed, a Suit of Law, and a Suit of Iron-grey Cloth both carried against me; but as for you Mr. Lawyer, we shall meet again.</P>
<STAGE><HI>[Exit</HI> Snarl.</STAGE>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>O fie, neighbour Snarl, you're to blame; very much to blame indeed!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Come, now it's all over, go and thank his Worship.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa, Baa, Baa!</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Enough, enough, my good fellow, take care you don't catch cold in your Head, go and get trepann'd, and take care of yourself, Sheepface.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa!</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Poor fellow! poor fellow!</P>
<STAGE><HI>[Exit</HI> Justice.</STAGE>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Bravo my Boy! you have acted your part admirably, and I think I did very well to bring you off so cleverly; and now I make no doubt but as
<PB N="30" REF="29"/>
you are a very honest Fellow, you'll pay me as gene∣rous as you promis'd.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Aye! very well, very well indeed—you did that very well just now, but there's no occasion to have it over any more—I'm talking about my fee you know Sheepface!—Yes, yes, I tell you it was very well done, but at this time you know my fee is the question.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa, Baa!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>How's this, am I laughed at, pay me di∣rectly you Rascal or I'll play the Devil with you! I'll teach you try to cheat a Lawyer that lives by cheat∣ing others, I'll—</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>What again! braved by a Mongril Cur, a bleating Bellweather! a—</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Out of my sight, or Ill break every bone in your Dog's skin, you Sheep-slealing Scoundrel, would you cheat one that has cheated hundreds? get home to your hiding place.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa!</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Away, and mind how you and your wife play the rest of your parts, and perhaps I may for∣give you if we succeed; if not I will make an exam∣ple of you, you Rascal!</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Baa, Baa!</P>
<STAGE><HI>[Exit</HI> Sheepface.</STAGE>
<PB N="31" REF="30"/>
<STAGE><HI>Enter</HI> Justice <HI>and</HI> Kate.</STAGE>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Poor fellow! Like to die you say,</P>
</SP>
<SP>
<SPEAKER>Kate.</SPEAKER>
<P>Yes your Worship—Oh dear!</P>
<STAGE>(crying.)</STAGE>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Well, well, comfort yourself, remember you was only married Yesterday.</P>
</SP>
<SP>
<SPEAKER>Kate.</SPEAKER>
<P>That's the very thing, Sir, if he had but lived a little longer I should not have cared so much about it, but to be cut off just in the Honey Moon is very hard, Oh! Oh! Oh! But I am not re∣vengeful, and your Worship knows how much I love my Master's Daughter Harriet; and Charles, Mr. Snarl's Son is in love with her, but his Father won't agree to the Match.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>O, I understand you, so you'll hush up matters, provided he'll agree to the Marriage; well, what say you neighbour Scout.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Why! why, I don't know what to say to it, as you all seem willing to settle the Business, I don't like to stand out, and so I agree to it. But I think your Worship, I had better go in and fill up the blanks of a Bond and make him sign it, or when all is over he'll retract from his word.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Well do so! Here he comes, go! go!</P>
<STAGE><HI>[Exit</HI> Scout <HI>and</HI> Kate,</STAGE>
<PB N="32" REF="31"/>
<STAGE><HI>Enter</HI> Snarl.</STAGE>
<P>So neighbour Snarl, I find that the blows that you gave the poor Fellow on the Head, has occasioned his Death.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Oh, the Devil!</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>But hark'ye neighbour, I've got a proposal to make, which perhaps may not be disagreeable to you; your Son Charles it seems is in love with Har∣riet, Lawyer Scout's Daughter—Now, I believe' Sheepface's wife would hush up matters, provided you'll consent to the match.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Consent! why I suppose I must, in order to save myself from further expence, a very pretty day's work I have made on't truly.</P>
<STAGE><HI>Enter</HI> Scout.</STAGE>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Here your Worship, I have filled up a Bond, in order that he may sign whatever is agreed to, how d'ye do neighbour Snarl—I always cut my Coat—</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>According to my Cloth.</P>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Come, come! sign, sign!</P>
<STAGE>[Signs the Bond.</STAGE>
<PB N="33" REF="32"/>
<STAGE>Constable without</STAGE>
<P>Bring him along neighbour Hobnail.</P>
<STAGE><HI>Enter</HI> Charles, Sheepface, Constable, &c.</STAGE>
</SP>
<SP>
<SPEAKER>Just.</SPEAKER>
<P>Hey dey! where did this fellow come from?</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>I come from necessity your Worship.</P>
</SP>
<SP>
<SPEAKER>Snarl.</SPEAKER>
<P>Hey dey! What the plague are you not dead?</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>No, your Worship could never beat such a thing into my Head.</P>
</SP>
<SP>
<SPEAKER>Charles.</SPEAKER>
<P>Dear Sir, don't be angry, Sheepface has done nothing but by my directions, and I hope you'll not only forgive him, but enable me by your future Generosity to provide for ourselves hencefor∣ward.</P>
</SP>
<SP>
<SPEAKER>Sheepface.</SPEAKER>
<P>Do take back one of your best Sheep.</P>
</SP>
<SP>
<SPEAKER>Scout.</SPEAKER>
<P>Well, as we have settled our own affairs thus far, we must now appeal to the Tribunal, and humbly ask their permission for the Village Lawyer, to continue in Practice.</P>
</SP>
</DIV3>
</DIV2>
<TRAILER>FINIS.</TRAILER>
</DIV1>
</BODY>
</TEXT>
</EEBO>
</ETS>
| 34.731343 | 455 | 0.667745 |
06e6a20b8d196b8f318fb4083da51174a71357de | 1,265 | xml | XML | songdata/christianlyricsnet/fallinginlove.xml | mightmay/songpptcreator | 511cc129008bbb15fe67e1c73f4464cf34c99f5c | [
"MIT"
] | null | null | null | songdata/christianlyricsnet/fallinginlove.xml | mightmay/songpptcreator | 511cc129008bbb15fe67e1c73f4464cf34c99f5c | [
"MIT"
] | null | null | null | songdata/christianlyricsnet/fallinginlove.xml | mightmay/songpptcreator | 511cc129008bbb15fe67e1c73f4464cf34c99f5c | [
"MIT"
] | null | null | null | <?xml version="1.0" ?>
<song>
<thainame>none</thainame>
<englishname>Falling in Love </englishname>
<mienthainame>none</mienthainame>
<order>segment1,segment2,segment3,segment4,segment5,segment6</order>
<english>
<segment1>Am I your enemy. If I speak truth? (Galatians 4:16). And the whispers in my ear. I sing from roofs (Matthew 10:26-28). No, Im your enemy. if I dont say enough. Oh that you could see. This truth is love</segment1>
<segment2>I will fail you in love. We will all fail in love. But that doesnt mean that Im your enemy. Comfort doesnt equal love. Sugar water isnt love. But the Truth will come and set us free (John 8:32, 36)</segment2>
<segment3>Would you tell me if you knew that I was dying?. Some sort of parasite that got into my brain. Would I tell you that I thought that you were lying?. Ignoring evidence, ignoring all the pain</segment3>
<segment4>Theres too much sugar. Too much water. Too much sugar. Too much water</segment4>
<segment5>Jesus, set our hearts on fire. And let it burn our flesh down to the ground. Jesus, set our hearts on fire. And burn our flesh to the ground</segment5>
<segment6>Am I your enemy?. Am I your enemy?. Im not your enemy?. Im not the enemy! </segment6>
</english>
</song>
| 79.0625 | 226 | 0.731225 |
eae8c2166266d43eb4259ac0d80d67ab10f34498 | 400 | xml | XML | app/src/main/res/values/colors.xml | AChep/literaryclock | 0e0c3f0cf23c8e2d427b3e104f9e3093282f0d42 | [
"Apache-2.0"
] | 2 | 2019-01-04T20:16:14.000Z | 2022-03-21T13:26:06.000Z | app/src/main/res/values/colors.xml | AChep/literaryclock | 0e0c3f0cf23c8e2d427b3e104f9e3093282f0d42 | [
"Apache-2.0"
] | 20 | 2021-02-07T14:21:11.000Z | 2022-03-22T09:10:14.000Z | app/src/main/res/values/colors.xml | AChep/literaryclock | 0e0c3f0cf23c8e2d427b3e104f9e3093282f0d42 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<resources>
<color name="colorPrimary">#404756</color>
<color name="colorPrimaryDark">#404756</color>
<color name="colorAccent">#f4ff81</color>
<color name="colorNavigationBarPreQ">#B3FFFFFF</color>
<color name="white_88">#88000000</color>
<color name="white_ff">#FF000000</color>
<color name="green">#4caf50</color>
</resources>
| 28.571429 | 58 | 0.675 |
43089f321acac3d37f1f9c3549f9e61bbade0046 | 1,246 | xml | XML | osgi/bundles/xml/jaxp/build.xml | knopflerfish/knopflerfish.org | 1d70bbf651a1c509486d2cb39294ea78bb1b45b1 | [
"BSD-3-Clause"
] | 31 | 2015-12-09T08:02:10.000Z | 2022-03-22T16:20:23.000Z | osgi/bundles/xml/jaxp/build.xml | knopflerfish/knopflerfish.org | 1d70bbf651a1c509486d2cb39294ea78bb1b45b1 | [
"BSD-3-Clause"
] | 55 | 2016-04-13T09:41:30.000Z | 2022-01-27T13:52:47.000Z | osgi/bundles/xml/jaxp/build.xml | knopflerfish/knopflerfish.org | 1d70bbf651a1c509486d2cb39294ea78bb1b45b1 | [
"BSD-3-Clause"
] | 11 | 2015-12-09T08:02:18.000Z | 2022-01-07T10:51:17.000Z | <?xml version="1.0" encoding="UTF-8"?>
<project name="jaxp" default="all">
<dirname property="proj.dir" file="${ant.file.jaxp}"/>
<property name="topdir" location="${proj.dir}/../../.."/>
<property name = "bundle.build.lib" value = "true"/>
<property name = "bundle.build.api" value = "false"/>
<property name = "bundle.build.impl" value = "false"/>
<property name = "bundle.build.all" value = "false"/>
<property name="bmfa.Bundle-Version" value="1.0.0.kf3"/>
<property name="bmfa.Bundle-Category" value="lib"/>
<property name="bmfa.Bundle-Description" value="The Sun JAXP XML parser"/>
<property name="bmfa.Bundle-Vendor" value="Sun/Knopflerfish"/>
<property name="bmfa.Bundle-Classpath" value="parser.jar,jaxp.jar"/>
<property name="bmfa.Bundle-Name" value="JAXP XML lib"/>
<property name="bmfa.Export-Package" value="com.sun.xml.parser ; version=1.0, com.sun.xml.tree ; version=1.0, com.sun.xml.util ; version=1.0, org.w3c.dom ; version=2.0, org.xml.sax ; version=2.0, org.xml.sax.helpers ; version=2.0, javax.xml.parsers ; version=2.0"/>
<path id="bundle.compile.path">
</path>
<import file="${topdir}/../ant/bundlebuild.xml"/>
</project>
| 41.533333 | 274 | 0.636437 |
5a0ffcead1271dc7ffd34a58f38e872adc275a01 | 3,810 | xml | XML | data/dump/blogs/4227399.female.27.indUnk.Aquarius.xml | ampehta/color-bert | 30a4cfa92c1a644a3fe785fec8ce95352d69ce28 | [
"MIT"
] | null | null | null | data/dump/blogs/4227399.female.27.indUnk.Aquarius.xml | ampehta/color-bert | 30a4cfa92c1a644a3fe785fec8ce95352d69ce28 | [
"MIT"
] | null | null | null | data/dump/blogs/4227399.female.27.indUnk.Aquarius.xml | ampehta/color-bert | 30a4cfa92c1a644a3fe785fec8ce95352d69ce28 | [
"MIT"
] | null | null | null | <Blog>
<date>18,August,2004</date>
<post>
I won. That is all.... I frickin' won. And I feel good.
</post>
<date>16,August,2004</date>
<post>
Wow. Weekend was chock-full of packing. Well....almost. Does all night Friday and most of yesterday add up to "chock-full"? Happily, I think I may very well be able to finish up getting the god-awful attic packed by the end of the week. There is just SO much up there ! And it surprising to see just how much stuff I used to have in my old apartment that I STILL haven't unpacked since I moved in with J. J has COMPLETELY deconstructed the computer room...and it's SCARY to go in there. For as long as we've been together I've NEVER seen the room like that. All of the desks are in pieces and there's only 1...YES ! ONE !....computer up and running. Now. We just need the dumbass sellers to get off of their butts and finish up their end of the deal so we can close ! Origianlly we were supposed to be moving on the 28th of this month (closing on the 27th) but at the rate we're going we'll be lucky to close by Christmas ! That being the case, this whole living out of boxes thing is going to be getting REALLY old REALLY quick ...even more than usual. We went to bed around midnight ... and I woke up considerably later than my usual 6:15....yet I'm STILL exhausted and have been toying with the idea of using a sick day. I could tell them I hurt my back while packing and that I want to take the day to lay low. However, that god-damned work ethic of mine won't allow for it. We have WAY too much going on these days for me to take a sick day...and "the man" has been so good about taking everything in stride. One can never really tell what will set him off....and I'd like to NOT find out that my taking a sick day is one of those things. sigh Don't want to go to work. Must pry self out of cozy robe, shove cat off lap, and go get ready to face yet another Monday in hell. Hopefully it will go quickly.
</post>
<date>15,August,2004</date>
<post>
Well. The date has been set. Tuesday night. 5:30 pm. And I'm already getting nervous. Why am I nervous here???? I shouldn't be ! I'm the one in the right here ! I'm the one who's addressing the issue. SHE'S in the wrong and this is to ensure that I point that out ! So why am I nervous???? Why do I doubt myself so much??? At her first response I thougt he was right about her being dumb. But as we went back and forth, via e-mail, I realized that one of two things happened. Either she's not as dumb as she likes to play like she is ... OR Someone's talked to her and explained that when you have a friend with a girlfriend...and that girlfriend is requesing a private audience with you that MAYBE it's not a good thing and it's got nothing to do with having a "girl's night out" with her. Now I just have to figure out how to begin the conversation when Tuesday at 5:30 gets here. That, and I need to ensure that I cover EVERYTHING. So, I guess that means it's time for me to put my little thinking cap on and start making a list...and then make sure I remember what's ON that list so when the time comes I don't leave ANYTHING out. Sigh
</post>
<date>13,August,2004</date>
<post>
Yeah. That would be me . . . . And welcome to my blog ! As this is my first entry, there isn't much to say yet . . . But oh ! I assure you that will change quickly enough ! I am in a crazy time in my life right now and am positive there will be PLENTY to post in the future . . . And so, I'll close with another "Welcome" and close up shop for now.
</post>
</Blog> | 92.926829 | 1,830 | 0.690814 |
c34b5544ccb1882c4acf364406ba72ca41fcd648 | 3,185 | xml | XML | app/src/main/res/layout/view_user_center_content.xml | melvin11112017/mobike | bbed2c972cbd60ff9b5b85c68da4060258c44a1b | [
"Apache-2.0"
] | 53 | 2017-05-20T00:03:21.000Z | 2021-08-11T17:36:18.000Z | app/src/main/res/layout/view_user_center_content.xml | melvin11112017/mobike | bbed2c972cbd60ff9b5b85c68da4060258c44a1b | [
"Apache-2.0"
] | 3 | 2017-09-11T03:43:27.000Z | 2019-10-19T08:11:56.000Z | app/src/main/res/layout/view_user_center_content.xml | melvin11112017/mobike | bbed2c972cbd60ff9b5b85c68da4060258c44a1b | [
"Apache-2.0"
] | 28 | 2017-05-19T15:25:40.000Z | 2021-09-24T08:25:36.000Z | <?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:app="http://schemas.android.com/apk/res-auto"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:orientation="vertical">
<TextView
android:id="@+id/id_tv_netfail"
android:layout_width="match_parent"
android:layout_height="50dp"
android:background="@color/red"
android:drawableStart="@drawable/network_unavailable_ic"
android:gravity="center"
android:paddingLeft="50dp"
android:text="网络无法连接，请检查网络连接"
android:textColor="@color/white"
android:visibility="gone"/>
<include layout="@layout/divider"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_money"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="我的钱包"
app:rightTvText="0.0元"
app:showRightTv="true"/>
<include layout="@layout/divider"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_youhui"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="我的优惠"
app:rightTvText=""
app:showRightTv="true"/>
<include layout="@layout/divider"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_stickers"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="我的贴纸"
/>
<include layout="@layout/divider"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_distance"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="我的行程"
/>
<include layout="@layout/divider_user_center"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_mymassege"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="我的消息"
/>
<include layout="@layout/divider"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_invent"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="邀请好友"
/>
<include layout="@layout/divider"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_guide"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="用户指南"
/>
<include layout="@layout/divider"/>
<com.yiwen.mobike.views.MySettingView
android:id="@+id/tv_my_setting"
android:layout_width="match_parent"
android:layout_height="wrap_content"
app:leftTvText="设置"
/>
<include layout="@layout/divider"/>
<View
android:layout_width="match_parent"
android:layout_height="match_parent"
android:background="@color/bg"/>
</LinearLayout> | 32.171717 | 73 | 0.623234 |
c3726cabf4f87695ce27955c8c2aa0f1c5262251 | 1,388 | xml | XML | arnaldo-root/pom.xml | STB1019/tools | 39f170559f316366e32d2e7635f3e3350aeb7308 | [
"Apache-2.0"
] | null | null | null | arnaldo-root/pom.xml | STB1019/tools | 39f170559f316366e32d2e7635f3e3350aeb7308 | [
"Apache-2.0"
] | null | null | null | arnaldo-root/pom.xml | STB1019/tools | 39f170559f316366e32d2e7635f3e3350aeb7308 | [
"Apache-2.0"
] | null | null | null | <project xmlns="http://maven.apache.org/POM/4.0.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd">
<modelVersion>4.0.0</modelVersion>
<groupId>it.unibs.ieeesb.arnaldoproject</groupId>
<artifactId>arnaldo-root</artifactId>
<version>${arnaldo.project.version}</version>
<packaging>pom</packaging>
<properties>
<arnaldo.project.version>0.2-SNAPSHOT</arnaldo.project.version>
<log4j2.version>2.8.2</log4j2.version>
<project.build.sourceEncoding>UTF-8</project.build.sourceEncoding>
<maven.compiler.source>1.8</maven.compiler.source>
<maven.compiler.target>1.8</maven.compiler.target>
</properties>
<modules>
<module>automatic-tester</module>
<module>common-interfaces</module>
<module>common-interface-impl-example</module>
</modules>
<dependencies>
<!-- https://mvnrepository.com/artifact/org.apache.logging.log4j/log4j-core -->
<dependency>
<groupId>org.apache.logging.log4j</groupId>
<artifactId>log4j-core</artifactId>
<version>${log4j2.version}</version>
</dependency>
<!-- https://mvnrepository.com/artifact/org.apache.logging.log4j/log4j-api -->
<dependency>
<groupId>org.apache.logging.log4j</groupId>
<artifactId>log4j-api</artifactId>
<version>${log4j2.version}</version>
</dependency>
</dependencies>
</project> | 34.7 | 104 | 0.733429 |
65642c1d3c6715a340d871227ef39339811737d7 | 8,061 | csproj | XML | Barings.Controls.WPF/Barings.Controls.WPF.csproj | Barings/Barings.Controls.WPF | 10e26de19e26a425b68b1e7708017b57f9c36e17 | [
"MIT"
] | null | null | null | Barings.Controls.WPF/Barings.Controls.WPF.csproj | Barings/Barings.Controls.WPF | 10e26de19e26a425b68b1e7708017b57f9c36e17 | [
"MIT"
] | 2 | 2017-02-08T05:31:23.000Z | 2017-02-08T05:36:27.000Z | Barings.Controls.WPF/Barings.Controls.WPF.csproj | Barings/Barings.Controls.WPF | 10e26de19e26a425b68b1e7708017b57f9c36e17 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="14.0" DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<Import Project="$(MSBuildExtensionsPath)\$(MSBuildToolsVersion)\Microsoft.Common.props" Condition="Exists('$(MSBuildExtensionsPath)\$(MSBuildToolsVersion)\Microsoft.Common.props')" />
<PropertyGroup>
<Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
<Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
<ProjectGuid>{777DAC02-C82E-4236-A9F0-67C7A104C009}</ProjectGuid>
<OutputType>Library</OutputType>
<AppDesignerFolder>Properties</AppDesignerFolder>
<RootNamespace>Barings.Controls.WPF</RootNamespace>
<AssemblyName>Barings.Controls.WPF</AssemblyName>
<TargetFrameworkVersion>v4.5</TargetFrameworkVersion>
<FileAlignment>512</FileAlignment>
<ProjectTypeGuids>{60dc8134-eba5-43b8-bcc9-bb4bc16c2548};{FAE04EC0-301F-11D3-BF4B-00C04F79EFBC}</ProjectTypeGuids>
<WarningLevel>4</WarningLevel>
<AutoGenerateBindingRedirects>true</AutoGenerateBindingRedirects>
<TargetFrameworkProfile />
<SccProjectName>SAK</SccProjectName>
<SccLocalPath>SAK</SccLocalPath>
<SccAuxPath>SAK</SccAuxPath>
<SccProvider>SAK</SccProvider>
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
<PlatformTarget>AnyCPU</PlatformTarget>
<DebugSymbols>true</DebugSymbols>
<DebugType>full</DebugType>
<Optimize>false</Optimize>
<OutputPath>bin\Debug\</OutputPath>
<DefineConstants>DEBUG;TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
<PlatformTarget>AnyCPU</PlatformTarget>
<DebugType>pdbonly</DebugType>
<Optimize>true</Optimize>
<OutputPath>bin\Release\</OutputPath>
<DefineConstants>TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<PropertyGroup>
<StartupObject />
</PropertyGroup>
<ItemGroup>
<Reference Include="FontAwesome.WPF, Version=4.7.0.37774, Culture=neutral, PublicKeyToken=0758b07a11a4f466, processorArchitecture=MSIL">
<HintPath>..\packages\FontAwesome.WPF.4.7.0.9\lib\net40\FontAwesome.WPF.dll</HintPath>
<Private>True</Private>
</Reference>
<Reference Include="ICSharpCode.AvalonEdit, Version=5.0.3.0, Culture=neutral, PublicKeyToken=9cc39be672370310, processorArchitecture=MSIL">
<HintPath>..\packages\AvalonEdit.5.0.3\lib\Net40\ICSharpCode.AvalonEdit.dll</HintPath>
</Reference>
<Reference Include="Newtonsoft.Json, Version=9.0.0.0, Culture=neutral, PublicKeyToken=30ad4fe6b2a6aeed, processorArchitecture=MSIL">
<HintPath>..\packages\Newtonsoft.Json.9.0.1\lib\net45\Newtonsoft.Json.dll</HintPath>
<Private>True</Private>
</Reference>
<Reference Include="System" />
<Reference Include="System.Data" />
<Reference Include="System.Linq.Dynamic, Version=1.0.6132.35681, Culture=neutral, processorArchitecture=MSIL">
<HintPath>..\packages\System.Linq.Dynamic.1.0.7\lib\net40\System.Linq.Dynamic.dll</HintPath>
<Private>True</Private>
</Reference>
<Reference Include="System.Xml" />
<Reference Include="Microsoft.CSharp" />
<Reference Include="System.Core" />
<Reference Include="System.Xml.Linq" />
<Reference Include="System.Xaml">
<RequiredTargetFramework>4.0</RequiredTargetFramework>
</Reference>
<Reference Include="WindowsBase" />
<Reference Include="PresentationCore" />
<Reference Include="PresentationFramework" />
<Reference Include="Xceed.Wpf.Toolkit, Version=3.0.0.0, Culture=neutral, PublicKeyToken=3e4669d2f30244f4, processorArchitecture=MSIL">
<HintPath>..\packages\Extended.Wpf.Toolkit.3.0\lib\net40\Xceed.Wpf.Toolkit.dll</HintPath>
<Private>True</Private>
</Reference>
</ItemGroup>
<ItemGroup>
<Compile Include="CodeEditors\CSharpEditor.xaml.cs">
<DependentUpon>CSharpEditor.xaml</DependentUpon>
</Compile>
<Compile Include="CodeEditors\Highlighting\AvalonEditExtensions.cs" />
<Compile Include="CodeEditors\Highlighting\HighlightMatchingCurlyBraces.cs" />
<Compile Include="CodeEditors\Highlighting\HighlightMatchingParentheses.cs" />
<Compile Include="CodeEditors\Highlighting\HighlightMatchingWords.cs" />
<Compile Include="CodeEditors\SqlEditor.xaml.cs">
<DependentUpon>SqlEditor.xaml</DependentUpon>
</Compile>
<Compile Include="CodeEditors\XmlEditor.xaml.cs">
<DependentUpon>XmlEditor.xaml</DependentUpon>
</Compile>
<Compile Include="Extensions\GenericExtensions.cs" />
<Compile Include="Extensions\StringExtensions.cs" />
<Compile Include="Extensions\TypeExtensions.cs" />
<Compile Include="NumericTextBox.cs" />
<Compile Include="Properties\AssemblyInfo.cs">
<SubType>Code</SubType>
</Compile>
<AppDesigner Include="Properties\" />
<Compile Include="QueryBuilder\Attributes\ValueOptionsAttribute.cs" />
<Compile Include="QueryBuilder\Enums\ExpressionType.cs" />
<Compile Include="QueryBuilder\Exceptions\InvalidQueryExpressionException.cs" />
<Compile Include="QueryBuilder\Models\Field.cs" />
<Compile Include="QueryBuilder\Interfaces\IExpression.cs" />
<Compile Include="QueryBuilder\Models\QueryExpressionData.cs" />
<Compile Include="QueryBuilder\Models\QueryExpressionGroupData.cs" />
<Compile Include="QueryBuilder\Models\Operation.cs" />
<Compile Include="QueryBuilder\Attributes\QueryTableAttribute.cs" />
<Compile Include="QueryBuilder\QueryBuilder.xaml.cs">
<DependentUpon>QueryBuilder.xaml</DependentUpon>
</Compile>
<Compile Include="QueryBuilder\QueryExpression.xaml.cs">
<DependentUpon>QueryExpression.xaml</DependentUpon>
</Compile>
<Compile Include="QueryBuilder\QueryExpressionGroup.xaml.cs">
<DependentUpon>QueryExpressionGroup.xaml</DependentUpon>
</Compile>
</ItemGroup>
<ItemGroup>
<Page Include="CodeEditors\CSharpEditor.xaml">
<SubType>Designer</SubType>
<Generator>MSBuild:Compile</Generator>
</Page>
<Page Include="CodeEditors\Resources\Icons.xaml">
<Generator>MSBuild:Compile</Generator>
<SubType>Designer</SubType>
</Page>
<Page Include="CodeEditors\Resources\Styles.xaml">
<Generator>MSBuild:Compile</Generator>
<SubType>Designer</SubType>
</Page>
<Page Include="CodeEditors\SqlEditor.xaml">
<SubType>Designer</SubType>
<Generator>MSBuild:Compile</Generator>
</Page>
<Page Include="CodeEditors\XmlEditor.xaml">
<SubType>Designer</SubType>
<Generator>MSBuild:Compile</Generator>
</Page>
<Page Include="QueryBuilder\QueryBuilder.xaml">
<Generator>MSBuild:Compile</Generator>
<SubType>Designer</SubType>
</Page>
<Page Include="QueryBuilder\QueryExpression.xaml">
<Generator>MSBuild:Compile</Generator>
<SubType>Designer</SubType>
</Page>
<Page Include="QueryBuilder\QueryExpressionGroup.xaml">
<Generator>MSBuild:Compile</Generator>
<SubType>Designer</SubType>
</Page>
</ItemGroup>
<ItemGroup>
<EmbeddedResource Include="CodeEditors\Resources\CSharp-Mode.xshd" />
<EmbeddedResource Include="CodeEditors\Resources\JavaScript-Mode.xshd" />
<EmbeddedResource Include="CodeEditors\Resources\SQL-Mode Dark.xshd" />
<EmbeddedResource Include="CodeEditors\Resources\SQL-Mode.xshd" />
<EmbeddedResource Include="CodeEditors\Resources\XML-Mode.xshd" />
<None Include="packages.config" />
</ItemGroup>
<Import Project="$(MSBuildToolsPath)\Microsoft.CSharp.targets" />
<!-- To modify your build process, add your task inside one of the targets below and uncomment it.
Other similar extension points exist, see Microsoft.Common.targets.
<Target Name="BeforeBuild">
</Target>
<Target Name="AfterBuild">
</Target>
-->
</Project> | 47.698225 | 186 | 0.726709 |
349e6858423c6e0927eca85bab30db343db49077 | 9,445 | xml | XML | docs/model/db-schema.xml | brazil-data-cube/sampledb | a0497043d1801909cc92262d36fb2a5932ee31d7 | [
"MIT"
] | 1 | 2020-02-25T19:59:53.000Z | 2020-02-25T19:59:53.000Z | docs/model/db-schema.xml | fabianazioti/sample-db | 1c65c6e281f8f900fc7ebd9ee37c99e704e316f0 | [
"MIT"
] | 45 | 2020-02-19T16:40:13.000Z | 2022-01-18T14:05:12.000Z | docs/model/db-schema.xml | fabianazioti/sample-db | 1c65c6e281f8f900fc7ebd9ee37c99e704e316f0 | [
"MIT"
] | 1 | 2020-02-19T16:01:14.000Z | 2020-02-19T16:01:14.000Z | <?xml version="1.0" encoding="UTF-8"?>
<mxfile host="app.diagrams.net" modified="2021-07-16T15:08:41.777Z" agent="5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/91.0.4472.114 Safari/537.36" etag="lzJH6pHnh5IV-E9aXg_x" version="14.8.6" type="google" pages="2"><diagram id="UlW0UkzZfYnhfvFQ5z1r" name="Page-1">7Z1bd5u4Fsc/Tdaa85AsLgbjx1ycTKdJ25NmetqnLGoUmzkY+YCcxv30RwKEcaW4YIyQgrK6Zoy4GOu/9UNsaW+d2JfLl5vEXy3uYACiE8sIXk7sqxML/40m+H+kZJOXmBOrKJknYVCUbQs+hz9BUWgUpeswAOnOgQjCCIWr3cIZjGMwQztlfpLAH7uHPcFo91tX/hwwBZ9nfsSW/icM0CIv9azxtvxPEM4X9JtNt/h9S58eXPySdOEH8EelyJ6e2JcJhCj/tHy5BBGpPVov+XnXr+wtbywBMapzQvTl1F3dpKP/3SUflqeju5/w35tTh94c2tBfDAJcAcUmTNACzmHsR9Nt6UUC13EAyGUNvLU95hbCFS40ceE/AKFNoaa/RhAXLdAyKvaClxB9JaefjZ1i81txNfL56qW6sSk2nmCMLmEEk+w2bSP7IwfFwTkRGhdP73+CBD7AOz/e5Huuw4h+KTm/uCPTxtts/RVVmsJ1MgP7Ks0qDNFP5gDtOdBy8gNJlVa+otDnBsAlQMkGH5CAyEfh867N+YXpzsvjylM/wRDftGUU7ezUHLln49Gk/BsX5lm0ulNrcma4drnbc3a/If/FxUW3JoSr1d9UDluRA9J9t2EYu99r75gk/pBfkm5V6mBblJltExM2+zVhS2UT7twyLXN0Npnstczd3XYt0+R8EX3UbEpjnOxeKm+uzKUOsMO76+X7+d+rv96dR8vnL9+mF+dP8anr9WKHMb7rr9TYyEZmhmcO3dxaYra1KbcqJgdjwLE4o2LmZtXGz5zfWvlxrNSkj6ffktYzBNmz7e0izjbdQw12smv63s51rZHdlfXufVQ9+9G6qJzUX64icLZK4DOI/Rgr9at94y7NinxE/vfMmlN8k1R6m5gC7pUhP4xBUpjQDEaRv0rD7PC8ZBFGwa2/gWtEL0S3Lp7CFxDc5104M2ssP27xxdKqnRU3Q3b7UTiP8ecZtjPyjRcJSPG93PopKo4ou2BGdrMJ/C+o4Nizvtuum31vFFXKAwd4waiJYT+DBIGXvXZY2hOt+BKIbmFgP7bdTWtcHLSodjVp4+BZ7455NLYFl7GFV6XHvx6FfnSP+95+PM+sYFdkUtVBAlcPtAmTgqwnAZIpNixUylmp9RgTCRehDIJkZwSe6LnfIUJwWWwkRX2UF83qwrnA/3DtXBJUOfh2L/G2ud3G/8jhCX4Yx9gM/DDTD2BD+QFSVEvp/Y3o9/pTfNQU2+5M6zGj9af3uKau37Pdqr2aZ69f/lbz1nJWm3f2cMS1+hRlzXcRBgGIW+jk1tapIgxtmGJ08RhdAh/5KUCP5LxzvOvdh4fpzfS+Z5kodfNjL9KVPwvj+W1+piuNji+7GlbbmymyvdmWZqsgttZ9kHantd1S66M3VhCE9HrmcZtiadfyItUevYrU/OepRtZ+5JOGpOwbiyZpNySd9E7Stm8kKpG0vjy9kZR9aZglwEcgePSJiyOn6MO7u+nnh/O7T0PiaH3xZOHoiBVTc7QbjppW3yAdsa+VbxakpWHLC1I6ZlGRY73CnVIwdI420E4ajrJ9lDflSTuGb9tgRRLa3uiwJzvKUbwJpq9Kpcc4WtgBf1rATlv1OG3VGXVmCG1dM0Pt9JQtqNUQB0/s7ho96/chYJYGyUfu9pSmLW+3x2FdN4q53qr6Ob3pt6frYwltYXrAWBRNeVqLpSnrLvi79x5udy+RjvxDxQ77Th/7S5Dz9Mv5/eWf55inxh+W4/xLdq72o5wsHHX1kIYojvKGNIRy1B3QkIYr/5CGyz7WUIiiwVO0gXTSULStj1tTtNWAhliMsh70t4tRr7Y+fWF0bDByBCCdJeEKhTAuxjOmXx+GRND6qslC0InuhwojqNM3QScD6ohO5O+ITtiOaDbk9EiGhXOAXp0/TAcE0AaiSQNQ3QUVBlCvd4AOqAs6kb8LWgahV/QAcTBgfqrXATUNdsxWA7QbgJapVnoDqGm0fd9QiKBb05YZoew7AQ2VyarlkRlgGppftImMslB1bDKqaqh2BNVR31AdW4zYb3mcvrRteak6Zucc4rtNS7/ocAeZGognDUt1B1UYS8e9s5Ttn173PYO0Lkork0wPbZ3yd1jHbH+1QOtjup6BNCX1rND00mOyVcF+qo5IFDc5v3e2sq7yIbFV/hjFMevepmxdJSAAA8frUQIVheLVY/3jGq8d4bX34CeP9fkMCK+lqcuLV4/105AWhqv8EX/BAgYDzkrUQD5p4KoDS4XBtfdYKI91Ag0JrvIHmnqs42YW+WkaPoUzH2XugU2KwHLIjFUv3NTT4abCGNt7nJTX1hmkMmHlDz71WPdNmD6u1t+jcJYj9eLjx9vp+YchIVW9yFOv7RxGjdS6SB31HjM1aesAUhmpk9p69RYBwLps8IV9MgErJ+pfnz8OCqf1JZMFp6ahp1oJ42nvEVSmwfrwBgPUranLS1TTYL1y6xQkA37tbyKbLFR1dCdVGFR7j6pyle2kHqCP/J1Sl+3Q6JTvTcWTBaRu2/6KBmldkDq9R1e5A1qFyK2vT28gZccMdcr3htrJwlHT4CRryPOJ787heFVGnVUcVZRuIv6pS8MC9sWxchdO9bqzB5334dDX0frzKGVZOrVcYHwgicW31i3v09U02ddGxZw8HaYWb6KgLMuqmKZ2pQtjau9Lppom+2r6lsOWt9YtM1PZN0idYLyZdtLQ1GnrVtU0VWfZVNNp++xUeWCyNHWJ0cpZkGzo+XKb6CYPVnXYhzCs9r+KqslZUkwRrh7SHuWP8zA5K4rp4cnG8smDUx3hIQ6nvPlzgnGqbIzHIe1R/qAOk7OkmB6kbKqePDRlxymi2Sw944ZCvvUVkN2ZB74//WJ3ZKzSB97TrJZlNHb7UGn3Jd3hEdfqbP1js/X0usE+YRvM95JmpJIze+9Nj1S6Crh+OJPw9EjlIQpK85xtPdNOM1WhkUrORL43PVLpKuAG4iygq0cqm2knD021D0gYTfsfqeSsv6sISo8wUukq4BLirKo7+JHKBrpJg1VOLnON1Y6wKsFIJScz+nC4Wtq6xFzlJDv312gBkxBtKsssDQ2tDaSTB606+kMcWvsfteQkRlfHAVDcn9GmiSoQDsLJdb6z5tLgsKpgAIir036Iwyov74dgrA4o8cfWtiVmKGfZSD23rrF80uCUszCkxmlHOK0dk96h3ANK/7G1bZlxqhOAtFdPGpp67AsfCOaAvl9hCi3gHMZ+NN2WXiRwHQcgKOp4e8wtzMQhreIfgNCmqER/jSAuWqBlVOwFLyH6SpsT/vyNfD5ziq2rl8quqw3diPEP/kovQDYqZ5HN7WnZFj2PqHntL8OIFNxDbCqQagzXyYzc4AKhVXpiOcR0HVyf5D/kgPRsDiG2TX8VpmczbGBkxyzNDr1+yq+JP/5y1YrlkO3KHD0j+8vuMDhPkszqpvfYrh/gnR9v8h3XIZEwu3XW8Kha9M5ff7IX2ET0wfbakXT9BKL6XpNNQOSj8Bns3EgHBsk+3ouUNHQF9xPLjUhjzpyLljtHZU292UmffSSoKTBU9AROOUMB5epgu6jqjlV6ftKBTyav/pPp9Tmfr8jdmdpsP+NNz/lUYDkik7MekZ7zeYiCe/p/Y7GK6llKwpjKUVs0U9nBWmUWfPulW73FcF29FJikxFmNKAtyGnKi9+OsRiSWqhM9ki6Mqpy5n4KpOmk7wKcsUyfyD6Fb9H206lAgzoBH4rPMqXp1/jAdElIbyCYLUi29IpE4pPLmfYplqqXukkQtmWopsB6RxVmPCMTBcInaRDR5iNo2ZEUTtdV0T9FEbftOoi5R6+cU6o+o7DsEXYJhwFStL5wsVDX1SsQCqcqZ7Sn63V/Z2Z5HiE9SYDFik7MacQTzjFE5VG+mH++mD/ff/qAfiMVbxsi23EHF2B9nmWLBXdi2eUw1bFvNBRXdhW0b+6swbLe2Li9sLYMdTR74OsVNZJMFq+akrfNNY7U+Vkd9Y9WcDGmK/aS+Qv31WdlujY5YaiyfPDjVKUvE4XTcP06VTVlySHtUIEXJhB3o0BFLTdWThaaW7TAKiYxYKqOUvtHGpSOWjhGxVLoXfhuxVM4IlCRkyeKs2brNTw90QvoOEtLT4VQ6EMDDksfBUsmqDqxAT1A60EVStp9WGel5cnf3FOKs8/qWo5MsBdZ5tTjrvCrmeOwwOqmJgnv6epZYRfX4jjCm1n2Edqg26ydRJyHdIRopMKJjss4MnZG+mXby0FRP+BRGU15GesE0VXa+5xEGy00Fpnya7EzBoWekb6KbNFil36ax2j1WuRnpxXLVauvnUZmrVn3FeuMq1WNnKn0AhgnUBoLJA1Sd50kcUHl56AUDta2Tp2+gGm3ap/xZn8pUcExWkvznDXl2ZwP5pMGrzT4fNV67wisvH71YvNrs01Qdr+oRCFuau8SEtTkTPnmL2w8ZtQ10lAa1ls6uJwy13Fz1gnuyyi4CekjXR/58elh/lqt6In1T+eTBqY6tF4dTTlyS6J6rsrH1h7RH+WPpLZt1feuJ9E3V656meDOBEFX23ST+anEHA0CO+D8=</diagram><diagram name="Copy of Page-1" id="SVVlx1P-7XNb7GUhA1pB">7Z1vc5u4FsY/TWb2vmjGgMH4Zf442d5NNp00e7d9laFGseli5AW5jfvprwTCxhGkuDbiEE6ms2sExsBz9DN+dHQ4sS4Wz9ext5zfUp+EJ+bAfz6xLk9M/jcc8/+JlnXWYriOm7XM4sCXbduGj8EPIhsHsnUV+CTZ2ZBRGrJguds4pVFEpmynzYtj+n13syca7n7q0psRpeHj1AvV1r8Dn82zVtccbdt/J8Fsnn+y4cgzXnj5xvJMkrnn0++FJmtyYl3ElLLs1eL5goTi6uXX5V/7x1d2ffd4cflw/Vdw7kdn4b/vsp1d7fOWzSnEJGLH3bUpT42t8+tFfH755CKN2ZzOaOSFk23reUxXkU/EXgd8abvNDaVL3mjwxq+EsbWMBW/FKG+as0Uo15LngH0Sbz8d2XLxs9ybeH35XFxYy4UnGrELGtI4PUxrkP6JjSL/TIQJb57c/yAxfaC3XrTO1lwFYf6h4v3yiAyLL2cnLs72RZz85CLL7RK6iqfkte1kGDEvnpHXdmhvQol3QkIXhMVr/r6YhB4Lvu0enSc7w2yz3eatH2jAj9scyJ77zhg6p6PhePM3kgEv+/E7c3w6cKzNatfe/YTs/OROt1HFL7W3Lmy2FBskrx3GYLD7udZOlPIX2S7zpcI12DalkbxHVFvtRrX51qP6+NFqGsPT8fjVaN1dbdUK15IPyr/Q1psAHe/uKuuwyq6OFZvDVmIz4gf9KQ9AsZCG5qmdL26jM11ab5YKYUgjUhKFg0LoG8W4P7V/Gvk6I3fk1uXxoJkQt9xdElqG86sxPN7tDe7Ofs2hpTWg5RfHNy9cyWuTeItlSE6XMf1GIi/isrwMeX4rtRQvmfclDfCEH2MeDZaIDn43yLwgIrGMqikNQ2+ZBOnmWcs8CP0bb01XLN9RvnT+FDwT/z67dTTS/vP9hu8sKYaePBix2guDWcRfT3mkiU88j0nCj+XGS5jcYnPrN0gPNqb/kAK1XfOL5Tjp54Zhod23iesPK2P9G4kZef6FaFdjcxNjpv2Cm44Muu/be19zJDeaF+977UF1RO+EzL7x4SjxURkO/PRZ4IX3/HeAF83SyNgVXlx+P6bLh7wTi4b0HoTEEx5sbCNxQYmIg4s3sZSVYmVInvL3fqGM0YVciOXl2Ow0vRT2Of/HL86FIJrND/eCLxvbZf5PbB7z7/GIh4YXpAISHjzfScKOqn7FrWIOlJpSW00pPVKU/vAHv05Xfxj7KZ7+EPS2ih8sZrHDp9+g/OI/hWmHnge+T6KjquSUq1SQJe+UWlRxFVV8j3kJYY/ibWd81fs/HybXk/uWRcopnG17niy9aRDNbrJ3OlBUfN5VsNjXDJ19bYxU1UPVul+gjSmdG2m/LPXReyrxg3x/RuP9sOIHZ1s0NYxKnGan0jWqtqIeFIoaJmJUD0bHrWPU6jVGs0gHxNGhIsc0Jh4j/qMnvI6MoQ/vbycfH85uP/SbolXigcGo6gEhRhvBqGG2ztFD/ZyOc7RCn9Y4qpouqyW/IyWI0dragcGoatX00kDb2+QeqMrp7YSqGyPHQORvw6RSPxwBOXZwlOcb7PRqt6RX28OmosM81MDBu6Of5h+8MgRSJnZjJDBVe0ggHAy8m79BKqTGgbhByjtbQZGOOXRF/ezW9HvlJsnU2sMO9XGQpnVpWqa1XpqqJtFfrd8La/25mUU7IJqqTk/kLUjG0/+d3V/8fsZ5OvjNtO3/QOdqO8qB4Sjm5ejiaNnYh16OqiZRryAKLCPHVH0eFrAQKVpfOjAUxTwcXRQtHfrQilHrUCOn4xgFlopjlaTikGQaB0sW0EiOfEw+PfScoPun4GglqKX6M0jQhghqt07QfifhZLEOiKCqv5KOQz2KAeQMoJdnD5N+A7RKNDAAxeQbbQB1Wwdov7NvLGDZN5ZqrJDIR3zWkAwMPlUzBvHZDD43NWHaw+ehdk3H8enCwudQNVTyyTTpRdnMpbl7f9lzilYoB4WiQ9WLQYo2RNFh2xQdqpZNz4blhxVZiK2BVPVV+GklGxsUx5RqiAeGpaorgyxtiKWj1lmqujdXbSeM1kVpIaf0iL1zCAytquMi0fqYrKYkScR17lA2acNsrVAPDFsPzYRBttbPxW+draq103O2joCxVbVjcrYuY+ITxGtNAaHg1VYNHcRrQ3htfa6TrXo+/cZrVeXQtvBqqz6N6GH8kj/yD5hTH2sV1ZEPDFxx5pM2uLY+9clWTaCewxXYTChbNW6moZckwVMw9VhqD6wTRhbI2DoqgmEszorSxtjWp0XZnZ0W1QxhgU2TslX7Jkgel6svYTDNkHp+d3czOfuz50gFPkXKxilSupA6bH2KlHOoAfTGkApsypSjWjZ8x55IusqI+t+Pd33HKfD5Uo5q6iBOG8Jp6/OlnM7Ol2oEp1nsA8KpatKsEhLjT/46ooEBKs6f0gbU1udPOf2eP+UAmz/lqA4MVoHfVzwwIMWZVLpAarc+k8o51NXpOEiBzaQaqb4LloHfUzsoHB2pJo2sJr6bvVGpItYUP25NcSfvXa/NYy19qKrbWIygC3Q09UcV8oN5rKpqAvWspvgImO8zUn2fjlk+emuKV+kH5cErI7SAdNG09cepjlQHqGeTl0fATKCRagJhTfG9lAPDUXSAdHG09eepjjprADUyNDkCZgi5qiGExXFrqwYFqC6W1dEF1PafrOoe6ul0+7bUBVZTx1VtFxyb3Fc8MCDFmjraQFqWNacXpIfaOR0HKbAKOq7quODY5J7ageGo6tWE02lyWjr18a0/9diZuuTL04uoEyOUHnGfpkeNi9e/XnO5X6u8U0Zgs7FnHrvoBB2PCRVFX6CMT7qqE9Sz8UkXmPkzVs0fHJ/8Bf2gfOuO0QbSRdPWxyfHqgvUs/HJMTAjaKwaQTg+uZdyYDiKLpAujrY+PjnurAnUyPjkGJgpNFZNIRyfrK0aGKBiOWVdQG1/fHJ8qKfzxogKrJjyWLVhvBWb0zhg68ftDStCtUo4KFA1Bqp9g1RtiKqtD1YaA9Xc6c4Pfnl8g6NqJjsAHLQaA9WU2Xm+EkK1UjM4VMXyydqoWlbnQzNVD7V6uu2hymiHhNCSesmYTrevfHBoioWSddG09nTzBtXubKXkI3VHYKWRjYHqxWBO3b7qwYHpWFGI+DOS/7riEJrTGY28cLJtPY/pKvKJL6/xdpsbmoojesVXwthaXkRvxShvmrNFKNeS54B9yrsTf/1ZvD615dLlc2HV5TpfiPgJf8p3IBYK7xKL27elS/n7hJpX3iIIRcM95aFCc43pKp6KA5wztkxOTFuErs2vp/iP2CA5nVHKY9NbBsnplAeYWDFN0k2vnrJ98pcv9lqIHLFcyM4bpH/pEfpncZxG3eSex/UDvfWidbbiKhASpoeeSSP02DPspKb5+VVtlyd3sPzLr2rDqmcnxCT0WPBt9/COH6SG6krJsjT5M9tPTCcUHTw1G01nxjZX782mgIIpUiN5JW8Z3pUMFmweGLbLtMagZmDS0vG0Nyrcleoc0Aq5G1Nbdch6lgQqAx7QTaKhOl6YBvorCr5yozjSqygmMGljaonaupna4WfDv7j/3mL4AL2ApTAZhuqBpfOgsP57Ld3gUBWzmLRRtSQvVDdVO5vG1ARTgSUxGYaaxZQ6BI/C3Myoenn2MOk7UvdPYdKL1Nx/QKQ2j9SyzFDNTDUP9XreElNNaNlLuRgFdUjkI1HriAaHqJi+pI+oJVmhuon6FvKXjkZUaMlMZkkyk3w2A1K1hnBwqIppTPqoWpIVqpuqnc1jamQKkwx/SGBVzZmQZkWlMqheT+5uJw/3n3/LX4iINwdDy3R6Pvm+Ukw4sD20ZDTCtjZsy5JGNcM23zPCthj+gGBrqa4NPr64tmxgsGqp9g5itSmsDtvHamefCX8chbJwh4RR1arBmU17ywcHp/gwMH04HbWP034/EV6GOyScqh4NTm3aVz04NHUVhXRObdpMZ/qcdy6c2qRvapNhScfnp3ObKpMENU1uslRralvXnmAhe12F7POB13zIoAxgbgnANlQ7fmgMD7Wx8H7wZT/bZx5TqdzNfV8NVU+sb/OYhtDyl4aqwdUxi1LzPKYqBV+5KzT1KorJTNqYWvcrtEG1VYOsOxXujtQjoWUwDVWXC4va76cdHJpiEpM2mpbVtddMU8xhKol+SGhVc5iwtH193eBgFdOVtGG1tLq9Xq7m1hNytRj+gLhqq9bMlPoEgfoTwcAA1VZ9HARqU0AtK2yvGaidTVRqpqp9Fv6QgFqSuJTWL8nOBfNAa8kHB6+YuKQPr2UV7jXjVXV9uuOqNkRYaLlMturVpIQNnoJsUtNjsk4YWSBqa+kIB7X4eHttqC0tf68ZtYc6QR0fvbKBPd9+kxaEKfeHyAcGpw6WitaH05IZTJpx6hzqA3Ucpw60QtGO6tRgyv2+6jVPU74YU8oK665jbzm/pT4RW/wf</diagram></mxfile> | 4,722.5 | 9,406 | 0.95585 |
2c15356e01113de93d6e7935987c70750f33b39e | 1,717 | xml | XML | simpledialogfragments/src/main/res/layout/simpledialogfragment_form_item_datetime.xml | mendhak/SimpleDialogFragments | 0f95f23547a14e328917e8c56789feda156015c7 | [
"Apache-2.0"
] | 117 | 2017-02-11T23:26:05.000Z | 2022-03-29T02:45:04.000Z | simpledialogfragments/src/main/res/layout/simpledialogfragment_form_item_datetime.xml | mendhak/SimpleDialogFragments | 0f95f23547a14e328917e8c56789feda156015c7 | [
"Apache-2.0"
] | 62 | 2017-02-15T16:42:00.000Z | 2022-02-23T18:17:49.000Z | simpledialogfragments/src/main/res/layout/simpledialogfragment_form_item_datetime.xml | mendhak/SimpleDialogFragments | 0f95f23547a14e328917e8c56789feda156015c7 | [
"Apache-2.0"
] | 20 | 2017-02-13T04:09:30.000Z | 2022-02-18T04:57:09.000Z | <?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:tools="http://schemas.android.com/tools"
android:layout_width="match_parent"
android:layout_height="wrap_content"
xmlns:app="http://schemas.android.com/apk/res-auto">
<com.google.android.material.textfield.TextInputLayout
android:id="@+id/dateLayout"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:saveEnabled="false"
android:layout_weight="1"
app:counterOverflowTextAppearance="@style/OverflowText">
<com.google.android.material.textfield.TextInputEditText
android:id="@+id/date"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:saveEnabled="false"
android:hint="@string/date"
android:inputType="date"/>
</com.google.android.material.textfield.TextInputLayout>
<com.google.android.material.textfield.TextInputLayout
android:id="@+id/timeLayout"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:saveEnabled="false"
android:layout_weight="1"
app:counterOverflowTextAppearance="@style/OverflowText">
<com.google.android.material.textfield.TextInputEditText
android:id="@+id/time"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:saveEnabled="false"
android:hint="@string/time"
android:inputType="date"/>
</com.google.android.material.textfield.TextInputLayout>
</LinearLayout> | 39.022727 | 72 | 0.676762 |
17abaf4888bd0290329e27ce10b19c279fe27b1f | 1,833 | xml | XML | testing/uniformDistrib.xml | gitter-badger/sbmlsolver | c92936832297ea1d2ad7f17223b68ada43c8f0b2 | [
"Apache-2.0"
] | 29 | 2015-05-21T21:06:06.000Z | 2021-12-06T15:33:30.000Z | testing/uniformDistrib.xml | gitter-badger/sbmlsolver | c92936832297ea1d2ad7f17223b68ada43c8f0b2 | [
"Apache-2.0"
] | 689 | 2015-01-27T21:45:59.000Z | 2022-03-30T23:47:28.000Z | testing/uniformDistrib.xml | gitter-badger/sbmlsolver | c92936832297ea1d2ad7f17223b68ada43c8f0b2 | [
"Apache-2.0"
] | 23 | 2015-06-25T22:57:21.000Z | 2021-11-06T02:03:28.000Z | <?xml version="1.0" encoding="UTF-8"?>
<sbml xmlns="http://www.sbml.org/sbml/level3/version1/core" level="3" version="1"
xmlns:distrib="http://www.sbml.org/sbml/level3/version1/distrib/version1"
distrib:required="true">
<model id="uniform_test" name="uniform distrib test">
<listOfParameters>
<parameter id="min" value="1" constant="true"/>
<parameter id="max" value="2" constant="true"/>
<parameter id="rand" constant="false"/>
</listOfParameters>
<listOfRules>
<assignmentRule variable="rand">
<math xmlns="http://www.w3.org/1998/Math/MathML">
<apply>
<ci> uniform </ci>
<ci> min </ci>
<ci> max </ci>
</apply>
</math>
</assignmentRule>
</listOfRules>
<listOfFunctionDefinitions>
<functionDefinition id="uniform">
<math xmlns="http://www.w3.org/1998/Math/MathML">
<lambda>
<bvar>
<ci>param1</ci>
</bvar>
<bvar>
<ci>param2</ci>
</bvar>
<cn>0</cn>
</lambda>
</math>
<distrib:drawFromDistribution>
<distrib:listOfDistribInputs>
<distrib:distribInput distrib:id="min" distrib:index="0"/>
<distrib:distribInput distrib:id="max" distrib:index="1"/>
</distrib:listOfDistribInputs>
<UncertML xmlns="http://www.uncertml.org/3.0">
<UniformDistribution definition="http://www.uncertml.org/distributions/uniform">
<minimum> <var varId="min"/> </minimum>
<maximum> <var varId="max"/> </maximum>
</UniformDistribution>
</UncertML>
</distrib:drawFromDistribution>
</functionDefinition>
</listOfFunctionDefinitions>
</model>
</sbml>
| 33.327273 | 92 | 0.561375 |
31aa47325281e749b875beea20c36f2328eed8a1 | 2,201 | xml | XML | app/src/main/res/values/strings.xml | delet-dis/Converta | 90cda1b6a705cf694d8d9a9c83a4b7f42edbcb5a | [
"MIT"
] | 1 | 2022-01-23T16:00:15.000Z | 2022-01-23T16:00:15.000Z | app/src/main/res/values/strings.xml | delet-dis/Converta | 90cda1b6a705cf694d8d9a9c83a4b7f42edbcb5a | [
"MIT"
] | null | null | null | app/src/main/res/values/strings.xml | delet-dis/Converta | 90cda1b6a705cf694d8d9a9c83a4b7f42edbcb5a | [
"MIT"
] | null | null | null | <resources>
<string name="appName" translatable="false">Converta</string>
<string name="onboardingBackgroundImageContentDescription">Gradient image</string>
<string name="helloText">Hello</string>
<string name="chooseCommunicationLanguageText">Choose your communication language</string>
<string name="chooseCommunicationLanguageButtonText">Go to speech synthesizer settings</string>
<string name="chooseApplicationModeText">I want the application to open in</string>
<string name="applicationModeTTSButtonText">Speaking mode</string>
<string name="applicationModeSTTButtonText">Listening mode</string>
<string name="finishButtonText">Finish</string>
<string name="STTTitle">Listening mode</string>
<string name="TTSTitle">Speaking mode</string>
<string name="phrasesCategoriesModeDisplayingText">Saved categories</string>
<string name="phrasesModeDisplayingText">Saved phrases</string>
<string name="addButtonContentDescription">Add icon</string>
<string name="phraseEditingMode">Phrase editing</string>
<string name="categoryEditingMode">Category editing</string>
<string name="phraseAddingMode">Phrase adding</string>
<string name="categoryAddingMode">Category adding</string>
<string name="editTextHint">Enter text</string>
<string name="discardButtonContentDescription">Discard</string>
<string name="submitButtonContentDescription">Submit</string>
<string name="deleteButtonContentDescription">Delete</string>
<string name="enterPhraseHint">Enter phrase…</string>
<string name="ttsErrorText">An error has occurred</string>
<string name="startSTTRecognition">Start recognition</string>
<string name="stopSTTRecognition">Stop recognition</string>
<string name="settings">Settings</string>
<string name="changeCommunicationLanguageSettingsAction">Change communication language</string>
<string name="changeApplicationOpenModeSettingsAction">Change application open mode</string>
<string name="listening">Listening</string>
<string name="databaseRecordEditingHint">Long press on a phrase or category allows you to edit it</string>
</resources> | 66.69697 | 111 | 0.761472 |
31bcd2b99f325df5097f9f401fc7a5eabf7a91c4 | 2,845 | xib | XML | TFPopupDemo/TFPopupDemo/Example/ExampleNotification.xib | shmxybfq/TFPopup | 67e88d38e569fe8e1fac6085aa4f0866ef1853e0 | [
"MIT"
] | 238 | 2019-03-01T09:18:21.000Z | 2022-03-27T15:24:01.000Z | TFPopupDemo/TFPopupDemo/Example/ExampleNotification.xib | Macsags/TFPopup | 67e88d38e569fe8e1fac6085aa4f0866ef1853e0 | [
"MIT"
] | 20 | 2019-03-13T10:01:26.000Z | 2022-03-18T07:59:46.000Z | TFPopupDemo/TFPopupDemo/Example/ExampleNotification.xib | Macsags/TFPopup | 67e88d38e569fe8e1fac6085aa4f0866ef1853e0 | [
"MIT"
] | 24 | 2019-03-08T08:08:51.000Z | 2022-01-11T09:46:41.000Z | <?xml version="1.0" encoding="UTF-8"?>
<document type="com.apple.InterfaceBuilder3.CocoaTouch.XIB" version="3.0" toolsVersion="14460.31" targetRuntime="iOS.CocoaTouch" propertyAccessControl="none" useAutolayout="YES" useTraitCollections="YES" colorMatched="YES">
<device id="retina4_7" orientation="portrait">
<adaptation id="fullscreen"/>
</device>
<dependencies>
<deployment identifier="iOS"/>
<plugIn identifier="com.apple.InterfaceBuilder.IBCocoaTouchPlugin" version="14460.20"/>
<capability name="documents saved in the Xcode 8 format" minToolsVersion="8.0"/>
</dependencies>
<objects>
<placeholder placeholderIdentifier="IBFilesOwner" id="-1" userLabel="File's Owner"/>
<placeholder placeholderIdentifier="IBFirstResponder" id="-2" customClass="UIResponder"/>
<view contentMode="scaleToFill" id="iN0-l3-epB" customClass="ExampleNotification">
<rect key="frame" x="0.0" y="0.0" width="396" height="78"/>
<autoresizingMask key="autoresizingMask" widthSizable="YES" heightSizable="YES"/>
<subviews>
<button opaque="NO" contentMode="scaleToFill" contentHorizontalAlignment="center" contentVerticalAlignment="center" lineBreakMode="middleTruncation" translatesAutoresizingMaskIntoConstraints="NO" id="RlC-oh-4ov">
<rect key="frame" x="0.0" y="0.0" width="396" height="78"/>
<color key="backgroundColor" white="0.0" alpha="0.0" colorSpace="custom" customColorSpace="genericGamma22GrayColorSpace"/>
<state key="normal" image="popup-3"/>
<state key="highlighted" image="popup-3"/>
<connections>
<action selector="sure:" destination="iN0-l3-epB" eventType="touchUpInside" id="tTM-rL-zDD"/>
</connections>
</button>
</subviews>
<color key="backgroundColor" white="0.0" alpha="0.0" colorSpace="custom" customColorSpace="genericGamma22GrayColorSpace"/>
<constraints>
<constraint firstAttribute="trailing" secondItem="RlC-oh-4ov" secondAttribute="trailing" id="7nx-eC-OkV"/>
<constraint firstItem="RlC-oh-4ov" firstAttribute="top" secondItem="iN0-l3-epB" secondAttribute="top" id="A9v-Gp-fDN"/>
<constraint firstAttribute="bottom" secondItem="RlC-oh-4ov" secondAttribute="bottom" id="ARE-q6-5Z7"/>
<constraint firstItem="RlC-oh-4ov" firstAttribute="leading" secondItem="iN0-l3-epB" secondAttribute="leading" id="YtX-zZ-kk9"/>
</constraints>
<freeformSimulatedSizeMetrics key="simulatedDestinationMetrics"/>
</view>
</objects>
<resources>
<image name="popup-3" width="598" height="117"/>
</resources>
</document>
| 67.738095 | 228 | 0.646046 |
18ba89748453eeac95488fc81a35f6e2f6ecfce6 | 1,047 | xml | XML | android/library/src/main/res/drawable/ic_fluent_person_arrow_left_20_filled.xml | johnarthur1/fluentui-system-icons | fd97ea6526d4c00ca9f1085582f27a10b1fce0e8 | [
"MIT"
] | null | null | null | android/library/src/main/res/drawable/ic_fluent_person_arrow_left_20_filled.xml | johnarthur1/fluentui-system-icons | fd97ea6526d4c00ca9f1085582f27a10b1fce0e8 | [
"MIT"
] | null | null | null | android/library/src/main/res/drawable/ic_fluent_person_arrow_left_20_filled.xml | johnarthur1/fluentui-system-icons | fd97ea6526d4c00ca9f1085582f27a10b1fce0e8 | [
"MIT"
] | null | null | null | <vector xmlns:android="http://schemas.android.com/apk/res/android" android:width="20dp" android:height="20dp" android:viewportWidth="20" android:viewportHeight="20">
<path android:pathData="M10 2C7.79 2 6 3.79 6 6s1.79 4 4 4 4-1.79 4-4-1.79-4-4-4zm-4.991 9C3.903 11 3 11.887 3 13c0 1.691 0.833 2.966 2.135 3.797C6.417 17.614 8.145 18 10 18c0.085 0 0.17 0 0.255-0.003C9.471 17.047 9 15.83 9 14.5s0.472-2.55 1.257-3.5H5.01z" android:fillColor="@color/fluent_default_icon_tint"/>
<path android:pathData="M19 14.5c0-2.485-2.015-4.5-4.5-4.5S10 12.015 10 14.5s2.015 4.5 4.5 4.5 4.5-2.015 4.5-4.5zm-6.853-0.354l2-2c0.195-0.195 0.511-0.195 0.707 0 0.195 0.196 0.195 0.512 0 0.708L13.707 14H16.5c0.276 0 0.5 0.224 0.5 0.5S16.776 15 16.5 15h-2.793l1.147 1.146c0.195 0.196 0.195 0.512 0 0.708-0.196 0.195-0.512 0.195-0.708 0l-2-2c-0.048-0.048-0.084-0.104-0.108-0.163C12.014 14.633 12 14.57 12 14.503v-0.006c0-0.067 0.014-0.13 0.038-0.188 0.024-0.058 0.06-0.113 0.106-0.16l0.003-0.003z" android:fillColor="@color/fluent_default_icon_tint"/>
</vector>
| 209.4 | 555 | 0.705826 |
b26578aadf932abb6cdf34a60530778a47a3fe67 | 10,865 | xaml | XML | WPFMap/MainWindow.xaml | NeverMorewd/WPFMap | 0fcc2591b69b6140c8bfdce886b5de6f34c5a536 | [
"Apache-2.0"
] | null | null | null | WPFMap/MainWindow.xaml | NeverMorewd/WPFMap | 0fcc2591b69b6140c8bfdce886b5de6f34c5a536 | [
"Apache-2.0"
] | null | null | null | WPFMap/MainWindow.xaml | NeverMorewd/WPFMap | 0fcc2591b69b6140c8bfdce886b5de6f34c5a536 | [
"Apache-2.0"
] | null | null | null | <nm:NMWindow x:Class="WPFMap.MainWindow"
xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"
xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"
xmlns:d="http://schemas.microsoft.com/expression/blend/2008"
xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"
xmlns:sys="clr-namespace:System;assembly=mscorlib"
xmlns:nm="clr-namespace:NM.Framework.UI"
xmlns:local="clr-namespace:WPFMap"
mc:Ignorable="d" UseLayoutRounding="True"
WindowStartupLocation="CenterScreen"
Title="nevermore-map" KeyUp="Window_KeyUp" >
<nm:NMWindow.Resources>
<Style x:Key="FocusVisual">
<Setter Property="Control.Template">
<Setter.Value>
<ControlTemplate>
<Rectangle Margin="2" SnapsToDevicePixels="true" Stroke="{DynamicResource {x:Static SystemColors.ControlTextBrushKey}}" StrokeThickness="1" StrokeDashArray="1 2"/>
</ControlTemplate>
</Setter.Value>
</Setter>
</Style>
<SolidColorBrush x:Key="OptionMark.Static.Background" Color="#FFFFFFFF"/>
<SolidColorBrush x:Key="OptionMark.Static.Border" Color="#FF707070"/>
<Style x:Key="OptionMarkFocusVisual">
<Setter Property="Control.Template">
<Setter.Value>
<ControlTemplate>
<Rectangle Margin="14,0,0,0" SnapsToDevicePixels="true" Stroke="{DynamicResource {x:Static SystemColors.ControlTextBrushKey}}" StrokeThickness="1" StrokeDashArray="1 2"/>
</ControlTemplate>
</Setter.Value>
</Setter>
</Style>
<SolidColorBrush x:Key="OptionMark.MouseOver.Background" Color="#FFF3F9FF"/>
<SolidColorBrush x:Key="OptionMark.MouseOver.Border" Color="#FF5593FF"/>
<SolidColorBrush x:Key="OptionMark.MouseOver.Glyph" Color="#FF212121"/>
<SolidColorBrush x:Key="OptionMark.Disabled.Background" Color="#FFE6E6E6"/>
<SolidColorBrush x:Key="OptionMark.Disabled.Border" Color="#FFBCBCBC"/>
<SolidColorBrush x:Key="OptionMark.Disabled.Glyph" Color="#FF707070"/>
<SolidColorBrush x:Key="OptionMark.Pressed.Background" Color="#FFD9ECFF"/>
<SolidColorBrush x:Key="OptionMark.Pressed.Border" Color="#FF3C77DD"/>
<SolidColorBrush x:Key="OptionMark.Pressed.Glyph" Color="#FF212121"/>
<SolidColorBrush x:Key="OptionMark.Static.Glyph" Color="#FF212121"/>
<Style x:Key="CheckBoxStyle1" TargetType="{x:Type CheckBox}">
<Setter Property="FocusVisualStyle" Value="{StaticResource FocusVisual}"/>
<Setter Property="Background" Value="{StaticResource OptionMark.Static.Background}"/>
<Setter Property="BorderBrush" Value="{StaticResource OptionMark.Static.Border}"/>
<Setter Property="Foreground" Value="{DynamicResource {x:Static SystemColors.ControlTextBrushKey}}"/>
<Setter Property="BorderThickness" Value="1"/>
<Setter Property="Template">
<Setter.Value>
<ControlTemplate TargetType="{x:Type CheckBox}">
<Grid x:Name="templateRoot" Background="Transparent" SnapsToDevicePixels="True">
<Border x:Name="checkBoxBorder" CornerRadius="10" BorderBrush="{TemplateBinding BorderBrush}" BorderThickness="{TemplateBinding BorderThickness}" Background="{TemplateBinding Background}" HorizontalAlignment="{TemplateBinding HorizontalContentAlignment}" Margin="1" VerticalAlignment="{TemplateBinding VerticalContentAlignment}">
<Grid x:Name="markGrid">
<Ellipse x:Name="excontent" Margin="5" Panel.ZIndex="9" Fill="Blue" Stroke="{TemplateBinding Foreground}"/>
<Ellipse x:Name="content" Width="{TemplateBinding Width}" Height="{TemplateBinding Height}" Fill="{TemplateBinding Background}" Stroke="{TemplateBinding Foreground}"/>
</Grid>
</Border>
</Grid>
<ControlTemplate.Triggers>
<Trigger Property="HasContent" Value="true">
<Setter Property="FocusVisualStyle" Value="{StaticResource OptionMarkFocusVisual}"/>
<Setter Property="Padding" Value="4,-1,0,0"/>
</Trigger>
<Trigger Property="IsMouseOver" Value="true">
<Setter Property="Background" TargetName="checkBoxBorder" Value="{StaticResource OptionMark.MouseOver.Background}"/>
<Setter Property="BorderBrush" TargetName="checkBoxBorder" Value="{StaticResource OptionMark.MouseOver.Border}"/>
<Setter Property="Fill" TargetName="content" Value="{StaticResource OptionMark.MouseOver.Glyph}"/>
<Setter Property="Fill" TargetName="content" Value="{StaticResource OptionMark.MouseOver.Glyph}"/>
</Trigger>
<Trigger Property="IsEnabled" Value="false">
<Setter Property="Background" TargetName="checkBoxBorder" Value="{StaticResource OptionMark.Disabled.Background}"/>
<Setter Property="BorderBrush" TargetName="checkBoxBorder" Value="{StaticResource OptionMark.Disabled.Border}"/>
<Setter Property="Fill" TargetName="content" Value="{StaticResource OptionMark.Disabled.Glyph}"/>
<Setter Property="Fill" TargetName="content" Value="{StaticResource OptionMark.Disabled.Glyph}"/>
</Trigger>
<Trigger Property="IsPressed" Value="true">
<Setter Property="Background" TargetName="checkBoxBorder" Value="{StaticResource OptionMark.Pressed.Background}"/>
<Setter Property="BorderBrush" TargetName="checkBoxBorder" Value="{StaticResource OptionMark.Pressed.Border}"/>
<Setter Property="Fill" TargetName="content" Value="{StaticResource OptionMark.Pressed.Glyph}"/>
<Setter Property="Fill" TargetName="content" Value="{StaticResource OptionMark.Pressed.Glyph}"/>
</Trigger>
<Trigger Property="IsChecked" Value="true">
<Setter Property="Opacity" TargetName="content" Value="1"/>
<Setter Property="Opacity" TargetName="content" Value="0"/>
</Trigger>
<Trigger Property="IsChecked" Value="{x:Null}">
<Setter Property="Opacity" TargetName="content" Value="0"/>
<Setter Property="Opacity" TargetName="content" Value="1"/>
</Trigger>
</ControlTemplate.Triggers>
</ControlTemplate>
</Setter.Value>
</Setter>
</Style>
</nm:NMWindow.Resources>
<nm:NMWindow.WindowTitleBar>
<nm:WindowTitleBar Background="Red">
<Button ToolTip="帮助" FontSize="21"
Foreground="#CCCCCC">
<Button.Template>
<ControlTemplate TargetType="{x:Type Button}">
<Border CornerRadius="5" Width="25" Height="25" Padding="0">
<Border.Background>
<SolidColorBrush x:Name="BackgroundColor" Color="#00000000"/>
</Border.Background>
<Viewbox Stretch="Uniform" Width="16.7" Height="16.7">
<Canvas Canvas.Left="0" Canvas.Top="0" Width="24" Height="24">
<Canvas.RenderTransform>
<TranslateTransform X="0" Y="0"/>
</Canvas.RenderTransform>
<Canvas.Resources/>
<Path Fill="{TemplateBinding Foreground}">
<Path.Data>
<PathGeometry Figures="M12 2C6.5 2 2 6.5 2 12s4.5 10 10 10s10-4.5 10-10S17.5 2 12 2z M12 4c4.4 0 8 3.6 8 8s-3.6 8-8 8s-8-3.6-8-8 S7.6 4 12 4z M12 6c-2.2 0-4 1.8-4 4h2c0-1.1 0.9-2 2-2s2 0.9 2 2c0 2-3 2.4-3 5h2c0-1.7 3-2.5 3-5C16 7.8 14.2 6 12 6z M11 16v2h2 v-2H11z" FillRule="NonZero"/>
</Path.Data>
</Path>
</Canvas>
</Viewbox>
</Border>
<ControlTemplate.Triggers>
<Trigger Property="IsMouseOver" Value="true">
<Trigger.EnterActions>
<BeginStoryboard>
<Storyboard Storyboard.TargetName="BackgroundColor" Storyboard.TargetProperty="Color">
<ColorAnimation
To="#30333C"
Duration="0:0:0.2" />
</Storyboard>
</BeginStoryboard>
</Trigger.EnterActions>
<Trigger.ExitActions>
<BeginStoryboard>
<Storyboard Storyboard.TargetName="BackgroundColor" Storyboard.TargetProperty="Color">
<ColorAnimation
To="#00000000"
Duration="0:0:0.2" />
</Storyboard>
</BeginStoryboard>
</Trigger.ExitActions>
</Trigger>
</ControlTemplate.Triggers>
</ControlTemplate>
</Button.Template>
</Button>
<Line X1="2" X2="2" Y1="3" Y2="23"
Margin="1,0,7,0"
StrokeThickness="1" Stroke="White" Opacity="0.2"/>
</nm:WindowTitleBar>
</nm:NMWindow.WindowTitleBar>
<Grid>
<Grid.Resources>
<sys:Int32 x:Key="test">1</sys:Int32>
</Grid.Resources>
<Control Template="{StaticResource ChinaMap2}"/>
</Grid>
</nm:NMWindow>
| 68.765823 | 357 | 0.522688 |
7e87d3b2b28c6096c21cd101da831e5a6d84cd92 | 407 | xml | XML | app/src/main/res/values/strings.xml | Ashmit-Aryan/Nasa-Apod-Photo-Viewer | aa22b7e02c89aa0b9584f82e05c3fa9059255694 | [
"MIT"
] | 1 | 2020-08-07T03:59:45.000Z | 2020-08-07T03:59:45.000Z | app/src/main/res/values/strings.xml | Ashmit-Aryan/Nasa-Apod-Photo-Viewer | aa22b7e02c89aa0b9584f82e05c3fa9059255694 | [
"MIT"
] | null | null | null | app/src/main/res/values/strings.xml | Ashmit-Aryan/Nasa-Apod-Photo-Viewer | aa22b7e02c89aa0b9584f82e05c3fa9059255694 | [
"MIT"
] | 1 | 2021-12-09T06:27:04.000Z | 2021-12-09T06:27:04.000Z | <resources>
<string name="app_name">Nasa Photo Viewer</string>
<string name="copyright">©Copyright To Nasa</string>
<string name="ApodFragment">Picture Of The day</string>
<string name="mars_rover_activity">Mars Rover Picture</string>
<string name="curiosity">Curiosity</string>
<string name="opportunity">Opportunity</string>
<string name="spirit">Spirit</string>
</resources> | 37 | 66 | 0.714988 |
f8df0b3c61ec010e9f11bc8ec42766a78d5e22c6 | 1,023 | nuspec | XML | Src/XmlDocInspections.Plugin/XmlDocInspections.nuspec | matkoch/XmlDocInspections | f6530bd549726629e10b07035a3735af91332e75 | [
"MIT"
] | 29 | 2015-03-04T14:14:19.000Z | 2021-09-16T15:13:38.000Z | Src/XmlDocInspections.Plugin/XmlDocInspections.nuspec | matkoch/XmlDocInspections | f6530bd549726629e10b07035a3735af91332e75 | [
"MIT"
] | 16 | 2015-11-27T08:36:02.000Z | 2021-12-09T19:35:57.000Z | Src/XmlDocInspections.Plugin/XmlDocInspections.nuspec | matkoch/XmlDocInspections | f6530bd549726629e10b07035a3735af91332e75 | [
"MIT"
] | 8 | 2015-02-27T00:46:54.000Z | 2020-11-20T18:52:15.000Z | <?xml version="1.0"?>
<package xmlns="http://schemas.microsoft.com/packaging/2010/07/nuspec.xsd">
<metadata>
<id>ReSharper.XmlDocInspections</id>
<version>$Version$</version>
<title>XML Doc Inspections</title>
<authors>ulrichb</authors>
<licenseUrl>https://github.com/ulrichb/XmlDocInspections/blob/master/LICENSE</licenseUrl>
<projectUrl>https://github.com/ulrichb/XmlDocInspections#readme</projectUrl>
<iconUrl>https://raw.githubusercontent.com/ulrichb/XmlDocInspections/master/Doc/Icons/Xml128.png</iconUrl>
<requireLicenseAcceptance>false</requireLicenseAcceptance>
<description>Configurable warnings for missing XML Doc comments</description>
<releaseNotes>$ReleaseNotes$</releaseNotes>
<tags>xml doc xmldoc inspection warning</tags>
<dependencies>
<dependency id="Wave" version="$DependencyVer$" />
</dependencies>
</metadata>
<files>
<file src="$BinDirInclude$\$Configuration$\XmlDocInspections.Plugin.*" target="dotFiles" />
</files>
</package>
| 44.478261 | 110 | 0.73607 |
0dd27bc4eedf7621e2429be583b69afcd56f284a | 1,090 | xml | XML | test/functionalModules.xml | danguilherme/kony-functional-modules | f7d12f2104e189bc766ae5bd3c3209eafde38397 | [
"MIT"
] | null | null | null | test/functionalModules.xml | danguilherme/kony-functional-modules | f7d12f2104e189bc766ae5bd3c3209eafde38397 | [
"MIT"
] | 2 | 2015-09-24T13:32:53.000Z | 2019-06-14T19:10:26.000Z | test/functionalModules.xml | danguilherme/kony-functional-modules | f7d12f2104e189bc766ae5bd3c3209eafde38397 | [
"MIT"
] | null | null | null | <!--/**
views : list of ids of forms, popups, templates (seg,datagrid, header, footer... etc) - Optional
jsModules : js modules required for this functional module, - Optional
dependentModules : Other functional modules required for this module. - Optional
Either forms or modules should be provided for a module.
**/-->
<functionalModules projectName="Marvel">
<functionalModule name="startup" loadOnStartUp="true">
<views>frmMain,frmwow</views>
<jsModules>vizActions_IDE,mod_mvc,frmMainView</jsModules>
<dependentModules>services</dependentModules>
</functionalModule>
<functionalModule name="services">
<jsModules>mod_http,mod_md5,marvelService</jsModules>
</functionalModule>
<functionalModule name="comics">
<views>tmplComics,frmComics</views>
<jsModules></jsModules>
</functionalModule>
<functionalModule name="characters">
<views>tmplCharacterItem,frmCharacters</views>
<jsModules>frmCharactersView,frmCharactersModel,frmCharactersController</jsModules>
</functionalModule>
</functionalModules>
| 37.586207 | 97 | 0.738532 |
abf0ed7cb7786d6607a62b1d6ed54f242b06aaaf | 27,880 | xml | XML | documentation/manual/pt-br/module_specs/Zend_View-Helpers.xml | ddgc/zf1 | cae3c90c175ddc9b55e7c6eb64cd60c48a249e50 | [
"BSD-3-Clause"
] | 2 | 2017-07-31T13:49:25.000Z | 2019-02-22T03:43:35.000Z | documentation/manual/pt-br/module_specs/Zend_View-Helpers.xml | ddgc/zf1 | cae3c90c175ddc9b55e7c6eb64cd60c48a249e50 | [
"BSD-3-Clause"
] | 2 | 2019-01-16T15:21:22.000Z | 2019-02-03T21:52:44.000Z | documentation/manual/pt-br/module_specs/Zend_View-Helpers.xml | ddgc/zf1 | cae3c90c175ddc9b55e7c6eb64cd60c48a249e50 | [
"BSD-3-Clause"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<!-- EN-Revision: 24249 -->
<!-- Reviewed: no -->
<sect1 id="zend.view.helpers" xmlns:xi="http://www.w3.org/2001/XInclude">
<title>Assistentes de Visualização</title>
<para>
Em seus scripts de visualização, frequentemente é necessário a execução de certas tarefas
complexas repetidas vezes: p. ex.: formatar uma data, gerar um elemento de formulário, ou
exibir links de acionamento. Você pode empregar classes assistentes para executar estas
tarefas para você.
</para>
<para>
A helper is simply a class. Let's say we want a helper named 'fooBar'.
By default, the class is prefixed with 'Zend_View_Helper_'
(you can specify a custom prefix when setting a helper path), and the
last segment of the class name is the helper name; this segment should
be TitleCapped; the full class name is then:
<classname>Zend_View_Helper_FooBar</classname>. This class should contain at the
minimum a single method, named after the helper, and camelCased:
<methodname>fooBar()</methodname>.
</para>
<note>
<title>Watch the Case</title>
<para>
Helper names are always camelCased, i.e., they never begin with an
uppercase character. The class name itself is MixedCased, but the
method that is actually executed is camelCased.
</para>
</note>
<note>
<title>Default Helper Path</title>
<para>
The default helper path always points to the Zend Framework view
helpers, i.e., 'Zend/View/Helper/'. Even if you call
<methodname>setHelperPath()</methodname> to overwrite the existing paths, this
path will be set to ensure the default helpers work.
</para>
</note>
<para>
Para usar um assistente em seu script de visualização, chame-o usando
<command>$this->helperName()</command>. Em segundo plano, <classname>Zend_View</classname>
irá carregar a classe <classname>Zend_View_Helper_HelperName</classname>, instanciá-la e
chamar seu método <methodname>helperName()</methodname>. O objeto criado é persistente
dentro do escopo da instância <classname>Zend_View</classname>, e será reutilizado por todas
as chamadas futuras a <command>$this->helperName()</command>.
</para>
<sect2 id="zend.view.helpers.initial">
<title>Assistentes Padrão</title>
<para>
<classname>Zend_View</classname> vem com um conjunto padrão de assistentes, a maioria
deles dedicados à geração de elementos de formulários e automaticamente escapar a saída
apropriada. Além disso, existem assistentes para criar <acronym>URL</acronym>s baseadas
em rotas e listas de <acronym>HTML</acronym>, bem como declarar variáveis. Os
assistentes atualmente embarcados incluem:
</para>
<itemizedlist>
<listitem>
<para>
<methodname>declareVars()</methodname>: Primarily for use when using
<methodname>strictVars()</methodname>, this helper can be used to declare
template variables that may or may not already be set in the
view object, as well as to set default values. Arrays passed as
arguments to the method will be used to set default values;
otherwise, if the variable does not exist, it is set to an empty string.
</para>
</listitem>
<listitem>
<para>
<methodname>fieldset($name, $content, $attribs)</methodname>: Creates an
<acronym>XHTML</acronym> fieldset. If <varname>$attribs</varname> contains a
'legend' key, that value will be used for the fieldset legend. The
fieldset will surround the <varname>$content</varname> as provided to
the helper.
</para>
</listitem>
<listitem>
<para>
<methodname>form($name, $attribs, $content)</methodname>: Generates an
<acronym>XHTML</acronym> form. All <varname>$attribs</varname> are escaped and
rendered as <acronym>XHTML</acronym> attributes of the form tag. If
<varname>$content</varname> is present and not a boolean
<constant>FALSE</constant>, then that content is rendered within the start and
close form tags; if <varname>$content</varname> is a boolean
<constant>FALSE</constant> (the default), only the opening form tag is
generated.
</para>
</listitem>
<listitem>
<para>
<methodname>formButton($name, $value, $attribs)</methodname>: Cria um elemento
<button />.
</para>
</listitem>
<listitem>
<para>
<methodname>formCheckbox($name, $value, $attribs, $options)</methodname>:
Cria um elemento <input type="checkbox" />.
</para>
<para>
By default, when no $value is provided and no $options are
present, '0' is assumed to be the unchecked value, and '1'
the checked value. If a $value is passed, but no $options
are present, the checked value is assumed to be the value
passed.
</para>
<para>
$options should be an array. If the array is indexed, the
first value is the checked value, and the second the
unchecked value; all other values are ignored. You may also
pass an associative array with the keys 'checked' and
'unChecked'.
</para>
<para>
If $options has been passed, if $value matches the checked
value, then the element will be marked as checked. You may
also mark the element as checked or unchecked by passing a
boolean value for the attribute 'checked'.
</para>
<para>
The above is probably best summed up with some examples:
</para>
<programlisting language="php"><![CDATA[
// '1' and '0' as checked/unchecked options; not checked
echo $this->formCheckbox('foo');
// '1' and '0' as checked/unchecked options; checked
echo $this->formCheckbox('foo', null, array('checked' => true));
// 'bar' and '0' as checked/unchecked options; not checked
echo $this->formCheckbox('foo', 'bar');
// 'bar' and '0' as checked/unchecked options; checked
echo $this->formCheckbox('foo', 'bar', array('checked' => true));
// 'bar' and 'baz' as checked/unchecked options; unchecked
echo $this->formCheckbox('foo', null, null, array('bar', 'baz'));
// 'bar' and 'baz' as checked/unchecked options; unchecked
echo $this->formCheckbox('foo', null, null, array(
'checked' => 'bar',
'unChecked' => 'baz'
));
// 'bar' and 'baz' as checked/unchecked options; checked
echo $this->formCheckbox('foo', 'bar', null, array('bar', 'baz'));
echo $this->formCheckbox('foo',
null,
array('checked' => true),
array('bar', 'baz'));
// 'bar' and 'baz' as checked/unchecked options; unchecked
echo $this->formCheckbox('foo', 'baz', null, array('bar', 'baz'));
echo $this->formCheckbox('foo',
null,
array('checked' => false),
array('bar', 'baz'));
]]></programlisting>
<para>
In all cases, the markup prepends a hidden element with the
unchecked value; this way, if the value is unchecked, you
will still get a valid value returned to your form.
</para>
</listitem>
<listitem>
<para>
<methodname>formErrors($errors, $options)</methodname>: Generates an
<acronym>XHTML</acronym> unordered list to show errors.
<varname>$errors</varname> should be a string or an array of strings;
<varname>$options</varname> should be any attributes you want
placed in the opening list tag.
</para>
<para>
You can specify alternate opening, closing, and separator
content when rendering the errors by calling several methods
on the helper:
</para>
<itemizedlist>
<listitem>
<para>
<methodname>setElementStart($string)</methodname>; default is
'<ul class="errors"%s"><li>', where %s
is replaced with the attributes as specified in
<varname>$options</varname>.
</para>
</listitem>
<listitem>
<para>
<methodname>setElementSeparator($string)</methodname>; default
is '</li><li>'.
</para>
</listitem>
<listitem>
<para>
<methodname>setElementEnd($string)</methodname>; default is
'</li></ul>'.
</para>
</listitem>
</itemizedlist>
</listitem>
<listitem>
<para>
<methodname>formFile($name, $attribs)</methodname>: Cria um elemento
<input type="file" />.
</para>
</listitem>
<listitem>
<para>
<methodname>formHidden($name, $value, $attribs)</methodname>: Cria um elemento
<input type="hidden" />.
</para>
</listitem>
<listitem>
<para>
<methodname>formLabel($name, $value, $attribs)</methodname>: Creates a
<label> element, setting the <property>for</property> attribute to
<varname>$name</varname>, and the actual label text to
<varname>$value</varname>. If <emphasis>disable</emphasis> is passed in
<property>attribs</property>, nothing will be returned.
</para>
</listitem>
<listitem>
<para>
<methodname>formMultiCheckbox($name, $value, $attribs, $options,
$listsep)</methodname>: Creates a list of checkboxes.
<varname>$options</varname> should be an associative array, and may be
arbitrarily deep. <varname>$value</varname> may be a single value or
an array of selected values that match the keys in the
<varname>$options</varname> array. <varname>$listsep</varname> is an
<acronym>HTML</acronym> break ("<br />") by default. By default, this
element is treated as an array; all checkboxes share the same name, and are
submitted as an array.
</para>
</listitem>
<listitem>
<para>
<methodname>formPassword($name, $value, $attribs)</methodname>: Cria um elemento
<input type="password" />.
</para>
</listitem>
<listitem>
<para>
<methodname>formRadio($name, $value, $attribs, $options)</methodname>: Cria uma
série de elementos <input type="radio" />, um para cada elemento em
$options. Na matriz $options, a chave e seu valor estão associados ao valor do
controle e seu rótulo, respectivamente. O conteúdo de $value será
pré-selecionado.
</para>
</listitem>
<listitem>
<para>
<methodname>formReset($name, $value, $attribs)</methodname>: Cria um elemento
<input type="reset" />.
</para>
</listitem>
<listitem>
<para>
<methodname>formSelect($name, $value, $attribs, $options)</methodname>: Cria um
bloco <select>...</select>, com um <option> para cada elemento
em $options. Na matriz $options, a chave e seu valor estão associados ao valor
do controle e seu rótulo. O conteúdo de $value será pré-selecionado.
</para>
</listitem>
<listitem>
<para>
<methodname>formSubmit($name, $value, $attribs)</methodname>: Cria um elemento
<input type="submit" />.
</para>
</listitem>
<listitem>
<para>
<methodname>formText($name, $value, $attribs)</methodname>: Cria um elemento
<input type="text" />.
</para>
</listitem>
<listitem>
<para>
<methodname>formTextarea($name, $value, $attribs)</methodname>: Cria um bloco
<textarea>...</textarea>.
</para>
</listitem>
<listitem>
<para>
<methodname>url($urlOptions, $name, $reset)</methodname>: Creates a
<acronym>URL</acronym> string based on a named route.
<varname>$urlOptions</varname> should be an associative array of key/value pairs
used by the particular route.
</para>
</listitem>
<listitem>
<para>
<methodname>htmlList($items, $ordered, $attribs, $escape)</methodname>:
generates unordered and ordered lists based on the <varname>$items</varname>
passed to it. If <varname>$items</varname> is a multidimensional
array, a nested list will be built. If the <varname>$escape</varname>
flag is <constant>TRUE</constant> (default), individual items will be escaped
using the view objects registered escaping mechanisms; pass a
<constant>FALSE</constant> value if you want to allow markup in your lists.
</para>
</listitem>
</itemizedlist>
<para>
Utilizar estes assistentes em seus scripts de visualização é muito fácil, aqui está um
exemplo. Note que tudo que você necessita fazer é chamá-los; eles carregam e instanciam
a sí próprios a medida que tornam-se necessários.
</para>
<programlisting language="php"><![CDATA[
// dentro do seu script de visualização,
// $this aponta para a instância de Zend_View.
//
// digamos que você já atribuiu uma série de valores a matriz
// $countries = array('us' => 'United States', 'il' =>
// 'Israel', 'de' => 'Germany').
?>
<form action="action.php" method="post">
<p><label>Your Email:
<?php echo $this->formText('email', 'you@example.com', array('size' => 32)) ?>
</label></p>
<p><label>Your Country:
<?php echo $this->formSelect('country', 'us', null, $this->countries) ?>
</label></p>
<p><label>Would you like to opt in?
<?php echo $this->formCheckbox('opt_in', 'yes', null, array('yes', 'no')) ?>
</label></p>
</form>
]]></programlisting>
<para>
A saída resultante do script de visualização deverá se parecer com isto:
</para>
<programlisting language="php"><![CDATA[
<form action="action.php" method="post">
<p><label>Your Email:
<input type="text" name="email" value="you@example.com" size="32" />
</label></p>
<p><label>Your Country:
<select name="country">
<option value="us" selected="selected">United States</option>
<option value="il">Israel</option>
<option value="de">Germany</option>
</select>
</label></p>
<p><label>Would you like to opt in?
<input type="hidden" name="opt_in" value="no" />
<input type="checkbox" name="opt_in" value="yes" checked="checked" />
</label></p>
</form>
]]></programlisting>
<xi:include href="Zend_View-Helpers-Action.xml" />
<xi:include href="Zend_View-Helpers-BaseUrl.xml" />
<xi:include href="Zend_View-Helpers-Currency.xml" />
<xi:include href="Zend_View-Helpers-Cycle.xml" />
<xi:include href="Zend_View-Helpers-Partial.xml" />
<xi:include href="Zend_View-Helpers-Placeholder.xml" />
<xi:include href="Zend_View-Helpers-Doctype.xml" />
<xi:include href="Zend_View-Helpers-Gravatar.xml" />
<xi:include href="Zend_View-Helpers-HeadLink.xml" />
<xi:include href="Zend_View-Helpers-HeadMeta.xml" />
<xi:include href="Zend_View-Helpers-HeadScript.xml" />
<xi:include href="Zend_View-Helpers-HeadStyle.xml" />
<xi:include href="Zend_View-Helpers-HeadTitle.xml" />
<xi:include href="Zend_View-Helpers-HtmlObject.xml" />
<xi:include href="Zend_View-Helpers-InlineScript.xml" />
<xi:include href="Zend_View-Helpers-Json.xml" />
<xi:include href="Zend_View-Helpers-Navigation.xml" />
<xi:include href="Zend_View-Helpers-TinySrc.xml" />
<xi:include href="Zend_View-Helpers-Translate.xml" />
<xi:include href="Zend_View-Helpers-UserAgent.xml" />
</sect2>
<sect2 id="zend.view.helpers.paths">
<title>Localizando os Assistentes</title>
<para>
Assim como os scripts de visualização, seu controlador pode especificar uma lista de
caminhos onde o <classname>Zend_View</classname> deve procurar pelas classes
assistentes. Por padrão, <classname>Zend_View</classname> procura pelas classes
assistentes em "Zend/View/Helper/*". Você pode instruir o
<classname>Zend_View</classname> a procurar em outros locais usando os métodos
<methodname>setHelperPath()</methodname> e <methodname>addHelperPath()</methodname>.
Além disso, você pode indicar um prefixo da classe a ser usado para os assistentes no
caminho fornecido, permitindo o uso de namespaces em suas classes assistentes. Por
padrão, se nenhum prefixo da classe for fornecido, 'Zend_View_Helper_' é assumido.
</para>
<programlisting language="php"><![CDATA[
$view = new Zend_View();
// Set path to /path/to/more/helpers, with prefix 'My_View_Helper'
$view->setHelperPath('/path/to/more/helpers', 'My_View_Helper');
]]></programlisting>
<para>
De fato, você pode "empilhar" caminhos usando o método
<methodname>addHelperPath()</methodname>. A medida que você adiciona caminhos à pilha,
<classname>Zend_View</classname> procurará no caminho mais recentemente adicionado.
Isto permite a você incrementar o conjunto original de assistentes (ou susbstituir) com
os seus próprios personalizados.
</para>
<programlisting language="php"><![CDATA[
$view = new Zend_View();
// Add /path/to/some/helpers with class prefix 'My_View_Helper'
$view->addHelperPath('/path/to/some/helpers', 'My_View_Helper');
// Add /other/path/to/helpers with class prefix 'Your_View_Helper'
$view->addHelperPath('/other/path/to/helpers', 'Your_View_Helper');
// now when you call $this->helperName(), Zend_View will look first for
// "/path/to/some/helpers/HelperName" using class name
// "Your_View_Helper_HelperName", then for
// "/other/path/to/helpers/HelperName.php" using class name
// "My_View_Helper_HelperName", and finally for
// "Zend/View/Helper/HelperName.php" using class name
// "Zend_View_Helper_HelperName".
]]></programlisting>
</sect2>
<sect2 id="zend.view.helpers.custom">
<title>Escrevendo Assistentes Personalizados</title>
<para>
Escrever assistentes personalizados é fácil; basta seguir estas regras:
</para>
<itemizedlist>
<listitem>
<para>
While not strictly necessary, we recommend either implementing
<classname>Zend_View_Helper_Interface</classname> or extending
<classname>Zend_View_Helper_Abstract</classname> when creating your
helpers. Introduced in 1.6.0, these simply define a
<methodname>setView()</methodname> method; however, in upcoming releases, we
plan to implement a strategy pattern that will simplify much of
the naming schema detailed below. Building off these now will
help you future-proof your code.
</para>
</listitem>
<listitem>
<para>
The class name must, at the very minimum, end with the helper
name itself, using MixedCaps. E.g., if you were writing a
helper called "specialPurpose", the class name would minimally
need to be "SpecialPurpose". You may, and should, give the class
name a prefix, and it is recommended that you use 'View_Helper'
as part of that prefix: "My_View_Helper_SpecialPurpose". (You
will need to pass in the prefix, with or without the trailing
underscore, to <methodname>addHelperPath()</methodname> or
<methodname>setHelperPath()</methodname>).
</para>
</listitem>
<listitem>
<para>
A classe deve ter um método público que coincida com o nome do assistente; este
é o método que será chamado quando o seu template chamar
"$this->specialPurpose()". Em nosso exemplo "specialPurpose", o método requerido
deverá ser declarado como "public function specialPurpose()".
</para>
</listitem>
<listitem>
<para>
Em geral, a classe não deve ecoar ou imprimir a saída gerada. Em lugar disso,
ela deve retornar os valores a serem impressos. Os valores retornados deverão
estar devidamente escapados.
</para>
</listitem>
<listitem>
<para>
A classe deve estar em um arquivo chamado após a classe assistente. Voltando ao
exemplo "specialPurpose", o arquivo recebeu o nome "SpecialPurpose.php".
</para>
</listitem>
</itemizedlist>
<para>
Localize o arquivo com a classe assistente em algum dos caminhos armazenados na pilha,
e o <classname>Zend_View</classname> automaticamente irá carregar, instanciar,
persistir, e executar o código para você.
</para>
<para>
Aqui está um exemplo do assistente <classname>SpecialPurpose</classname>:
</para>
<programlisting language="php"><![CDATA[
class My_View_Helper_SpecialPurpose extends Zend_View_Helper_Abstract
{
protected $_count = 0;
public function specialPurpose()
{
$this->_count++;
$output = "I have seen 'The Jerk' {$this->_count} time(s).";
return htmlspecialchars($output);
}
}
]]></programlisting>
<para>
Em um script de visualização, você pode chamar o assistente
<classname>SpecialPurpose</classname> quantas vezes desejar; ele será instanciado apenas
uma vez; e persistirá durante todo o tempo de vida da instância de
<classname>Zend_View</classname>.
</para>
<programlisting language="php"><![CDATA[
// remember, in a view script, $this refers to the Zend_View instance.
echo $this->specialPurpose();
echo $this->specialPurpose();
echo $this->specialPurpose();
]]></programlisting>
<para>
A saída deverá se parecer com isto:
</para>
<programlisting language="php"><![CDATA[
I have seen 'The Jerk' 1 time(s).
I have seen 'The Jerk' 2 time(s).
I have seen 'The Jerk' 3 time(s).
]]></programlisting>
<para>
Sometimes you will need access to the calling <classname>Zend_View</classname>
object -- for instance, if you need to use the registered encoding,
or want to render another view script as part of your helper. To get
access to the view object, your helper class should have a
<methodname>setView($view)</methodname> method, like the following:
</para>
<programlisting language="php"><![CDATA[
class My_View_Helper_ScriptPath
{
public $view;
public function setView(Zend_View_Interface $view)
{
$this->view = $view;
}
public function scriptPath($script)
{
return $this->view->getScriptPath($script);
}
}
]]></programlisting>
<para>
If your helper class has a <methodname>setView()</methodname> method, it will be
called when the helper class is first instantiated, and passed the
current view object. It is up to you to persist the object in your
class, as well as determine how it should be accessed.
</para>
<para>
If you are extending <classname>Zend_View_Helper_Abstract</classname>, you do
not need to define this method, as it is defined for you.
</para>
</sect2>
<sect2 id="zend.view.helpers.registering-concrete">
<title>Registering Concrete Helpers</title>
<para>
Sometimes it is convenient to instantiate a view helper, and then register it with the
view. As of version 1.10.0, this is now possible using the
<methodname>registerHelper()</methodname> method, which expects two arguments: the
helper object, and the name by which it will be registered.
</para>
<programlisting language="php"><![CDATA[
$helper = new My_Helper_Foo();
// ...do some configuration or dependency injection...
$view->registerHelper($helper, 'foo');
]]></programlisting>
<para>
If the helper has a <methodname>setView()</methodname> method, the view object will call
this and inject itself into the helper on registration.
</para>
<note>
<title>Helper name should match a method</title>
<para>
The second argument to <methodname>registerHelper()</methodname> is the name of the
helper. A corresponding method name should exist in the helper; otherwise,
<classname>Zend_View</classname> will call a non-existent method when invoking the
helper, raising a fatal <acronym>PHP</acronym> error.
</para>
</note>
</sect2>
</sect1>
<!--
vim:se ts=4 sw=4 et:
-->
| 43.49454 | 100 | 0.571915 |
4803c77dd54cf62c6eb15762830e07d16cc4cc37 | 979 | xml | XML | source/topic/topic-example.xml | wardweistra/fhir | 033536a5c08650ece7aa2f40840a00fc1915ec26 | [
"BSD-3-Clause"
] | null | null | null | source/topic/topic-example.xml | wardweistra/fhir | 033536a5c08650ece7aa2f40840a00fc1915ec26 | [
"BSD-3-Clause"
] | null | null | null | source/topic/topic-example.xml | wardweistra/fhir | 033536a5c08650ece7aa2f40840a00fc1915ec26 | [
"BSD-3-Clause"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<Topic xmlns="http://hl7.org/fhir">
<id value="example"/>
<url value="http://argonautproject.org/subscription-ig/Topic/admission" />
<version value="0.3" />
<title value="admission" />
<status value="draft"/>
<date value="2019-08-01" />
<description value="Admission Topic for testing framework and behavior" />
<resourceTrigger>
<description value="Beginning of a clinical encounter" />
<resourceType value="Encounter" />
<queryCriteria>
<current value="status:in-progress" />
<previous value="status:not=in-progress" />
<requireBoth value="true" />
</queryCriteria>
<fhirPathCriteria value="%previous.status!='in-progress' and %current.status='in-progress'"/>
</resourceTrigger>
<canFilterBy>
<name value="patient" />
<matchType value="=" />
<documentation value="Exact match to a patient resource (reference)" />
</canFilterBy>
<!-- insert contents here -->
</Topic>
| 36.259259 | 115 | 0.680286 |
3db69e865ee8420f79f90309882d9bb6cf49d643 | 1,987 | xsd | XML | pwiz_tools/Skyline/TestUtil/Schemas/AuditLog/Skyl_4.21.xsd | austinkeller/pwiz | aa8e575cb40fd5e97cc7d922e4d8da44c9277cca | [
"Apache-2.0"
] | null | null | null | pwiz_tools/Skyline/TestUtil/Schemas/AuditLog/Skyl_4.21.xsd | austinkeller/pwiz | aa8e575cb40fd5e97cc7d922e4d8da44c9277cca | [
"Apache-2.0"
] | null | null | null | pwiz_tools/Skyline/TestUtil/Schemas/AuditLog/Skyl_4.21.xsd | austinkeller/pwiz | aa8e575cb40fd5e97cc7d922e4d8da44c9277cca | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" version="0.9">
<xs:element name="audit_log_root" type="audit_log_root_type"/>
<xs:complexType name="audit_log_root_type">
<xs:sequence>
<xs:element name="document_hash" type="xs:string"/>
<xs:element name="root_hash" type="xs:string" minOccurs="0" />
<xs:element name="audit_log" type="audit_log_type"/>
</xs:sequence>
<xs:attribute name="format_version" type="xs:string" />
</xs:complexType>
<xs:complexType name="audit_log_type">
<xs:sequence>
<xs:element name="audit_log_entry" type="audit_log_entry_type" minOccurs="0" maxOccurs="unbounded"/>
</xs:sequence>
</xs:complexType>
<xs:complexType name="audit_log_entry_type">
<xs:sequence>
<xs:element name="reason" type="xs:string" minOccurs="0" maxOccurs="1" />
<xs:element name="extra_info" type="xs:string" minOccurs="0" maxOccurs="1" />
<xs:element name="undo_redo" type="message_type" minOccurs="1" maxOccurs="1"/>
<xs:element name="summary" type="message_type" minOccurs="1" maxOccurs="1"/>
<xs:element name="all_info" type="message_type" minOccurs="1" maxOccurs="unbounded"/>
<xs:element name="en_extra_info" type="xs:string" minOccurs="0" />
<xs:element name="hash" type="xs:string" minOccurs="0" />
</xs:sequence>
<xs:attribute name="format_version" type="xs:double" />
<xs:attribute name="time_stamp" type="xs:string" />
<xs:attribute name="user" type="xs:string" />
</xs:complexType>
<xs:complexType name="message_type">
<xs:sequence>
<xs:element name="type" type="xs:string"/>
<xs:element name="name" type="xs:string" minOccurs="0" maxOccurs="unbounded" />
<xs:element name="reason" type="xs:string" minOccurs="0"/>
<xs:element name="en_expanded" type="xs:string" minOccurs="0" />
</xs:sequence>
</xs:complexType>
</xs:schema>
| 45.159091 | 107 | 0.65073 |
5be5e7d66493f184fb1c324f4deffeed8389a388 | 2,117 | xml | XML | pom.xml | paremus/osgi.enroute | 7d534c287aa6e3ee9391f815d03ca4f81e480356 | [
"Apache-2.0"
] | 111 | 2015-07-09T22:32:00.000Z | 2022-03-23T13:20:02.000Z | pom.xml | paremus/osgi.enroute | 7d534c287aa6e3ee9391f815d03ca4f81e480356 | [
"Apache-2.0"
] | 119 | 2015-06-07T11:29:17.000Z | 2022-03-28T07:13:02.000Z | pom.xml | paremus/osgi.enroute | 7d534c287aa6e3ee9391f815d03ca4f81e480356 | [
"Apache-2.0"
] | 102 | 2015-03-09T09:12:40.000Z | 2022-03-10T14:04:36.000Z | <?xml version="1.0"?>
<project
xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd"
xmlns="http://maven.apache.org/POM/4.0.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance">
<modelVersion>4.0.0</modelVersion>
<groupId>org.osgi.enroute</groupId>
<artifactId>enroute-all</artifactId>
<name>OSGi enRoute All</name>
<packaging>pom</packaging>
<version>0.0.1-SNAPSHOT</version>
<description>
A top-level reactor for building all of the OSGi enRoute projects.
This project should not be released, and is provided for convenient
test builds both locally and in CI.
</description>
<url>http://enroute.osgi.org/</url>
<organization>
<name>OSGi Alliance</name>
<url>https://osgi.org/</url>
</organization>
<licenses>
<license>
<name>Apache License, Version 2.0</name>
<url>http://www.opensource.org/licenses/apache2.0.php</url>
<distribution>repo</distribution>
</license>
</licenses>
<scm>
<url>https://github.com/osgi/osgi.enroute</url>
<connection>scm:git:https://github.com/osgi/osgi.enroute.git</connection>
<developerConnection>scm:git:https://github.com/osgi/osgi.enroute.git</developerConnection>
</scm>
<issueManagement>
<system>GitHub</system>
<url>https://github.com/osgi/osgi.enroute/issues</url>
</issueManagement>
<mailingLists>
<mailingList>
<name>OSGi Developer Mail List</name>
<post>osgi-dev@mail.osgi.org</post>
<subscribe>https://mail.osgi.org/mailman/listinfo/osgi-dev</subscribe>
<archive>https://mail.osgi.org/pipermail/osgi-dev/</archive>
</mailingList>
</mailingLists>
<!-- Do not deploy this project -->
<properties>
<maven.deploy.skip>true</maven.deploy.skip>
</properties>
<modules>
<module>indexes</module>
<module>archetypes</module>
<module>examples</module>
</modules>
</project>
| 32.569231 | 102 | 0.623051 |
751ff4ca809cbfee5ede5bee8329abdc25ee9870 | 4,811 | xml | XML | Data/climate/1992_01_16_0500707.xml | parashar-lonewolf/ClimaChange_Claims | 2591a302b154bb059c4e83c19db0f352f22190f4 | [
"MIT"
] | 6 | 2021-04-09T15:27:38.000Z | 2022-03-10T16:12:47.000Z | Data/climate/1992_01_16_0500707.xml | parashar-lonewolf/ClimaChange_Claims | 2591a302b154bb059c4e83c19db0f352f22190f4 | [
"MIT"
] | null | null | null | Data/climate/1992_01_16_0500707.xml | parashar-lonewolf/ClimaChange_Claims | 2591a302b154bb059c4e83c19db0f352f22190f4 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE nitf SYSTEM "http://www.nitf.org/IPTC/NITF/3.3/specification/dtd/nitf-3-3.dtd">
<nitf change.date="June 10, 2005" change.time="19:30" version="-//IPTC//DTD NITF 3.3//EN">
<head>
<title>Protectionism Not Root of Wheat Loss</title>
<meta content="16" name="publication_day_of_month"/>
<meta content="1" name="publication_month"/>
<meta content="1992" name="publication_year"/>
<meta content="Thursday" name="publication_day_of_week"/>
<meta content="Editorial Desk" name="dsk"/>
<meta content="22" name="print_page_number"/>
<meta content="A" name="print_section"/>
<meta content="5" name="print_column"/>
<meta content="Opinion" name="online_sections"/>
<docdata>
<doc-id id-string="500707"/>
<doc.copyright holder="The New York Times" year="1992"/>
<identified-content>
<classifier class="indexing_service" type="descriptor">INTERNATIONAL TRADE AND WORLD MARKET</classifier>
<classifier class="indexing_service" type="descriptor">GRAIN</classifier>
<classifier class="indexing_service" type="descriptor">PROTECTIONISM (TRADE)</classifier>
<location class="indexing_service">UNITED STATES</location>
<org class="indexing_service">EUROPEAN COMMUNITY</org>
<classifier class="online_producer" type="types_of_material">Letter</classifier>
<classifier class="online_producer" type="taxonomic_classifier">Top/Opinion/Opinion/Letters</classifier>
<classifier class="online_producer" type="taxonomic_classifier">Top/Opinion</classifier>
<classifier class="online_producer" type="taxonomic_classifier">Top/Opinion/Opinion</classifier>
<classifier class="online_producer" type="taxonomic_classifier">Top/Features/Travel/Guides/Destinations/North America</classifier>
<classifier class="online_producer" type="taxonomic_classifier">Top/Features/Travel/Guides/Destinations/North America/United States</classifier>
<classifier class="online_producer" type="general_descriptor">Grain</classifier>
<classifier class="online_producer" type="general_descriptor">Protectionism (Trade)</classifier>
<classifier class="online_producer" type="general_descriptor">International Trade and World Market</classifier>
</identified-content>
</docdata>
<pubdata date.publication="19920116T000000" ex-ref="http://query.nytimes.com/gst/fullpage.html?res=9E0CEEDC103DF935A25752C0A964958260" item-length="254" name="The New York Times" unit-of-measure="word"/>
</head>
<body>
<body.head>
<hedline>
<hl1>Protectionism Not Root of Wheat Loss</hl1>
</hedline>
</body.head>
<body.content>
<block class="lead_paragraph">
<p>To the Editor:</p>
<p>On his recent trip President Bush told the Australians that a 30 percent loss in United States wheat production last year was related to trade barriers created by European farm subsidies. In fact, the sharp decline in our wheat production was due to drought and excessive temperatures in much of the country's grain belt.</p>
</block>
<block class="full_text">
<p>To the Editor:</p>
<p>On his recent trip President Bush told the Australians that a 30 percent loss in United States wheat production last year was related to trade barriers created by European farm subsidies. In fact, the sharp decline in our wheat production was due to drought and excessive temperatures in much of the country's grain belt.</p>
<p>Neither Mr. Bush nor Congress will bring this worrisome news to the American public. Along with six years of drought in California and broken records for high temperatures around the country, the consequences of weather changes in lost crops, dirt storms and hurricane-level wind damage point to the greenhouse effect's becoming a serious factor sooner than anticipated.</p>
<p>The President and Congress have failed to respond to scientists' urgings to stabilize our consumption of fossil fuel and begin to reduce it. The Energy Department has stymied significant progress on developing large-scale production of solar power, wind power, and so on. The promised huge tree-planting project to absorb carbon dioxide has been forgotten despite its potential for putting unemployed youth to work.</p>
<p>World food production fell 6 percent last year. Washington, by stalling world agreement on reducing fossil-fuel use, is playing Russian roulette with both our own and the rest of the world's food supply. To have our President misrepresent the facts on a foreign podium is a sign he has no plan to change this dangerous course. FREDERICK S. LIGHTFOOT Greenport, L.I., Jan. 2, 1992</p>
</block>
</body.content>
</body>
</nitf>
| 82.948276 | 430 | 0.738516 |
8c8895882da3f615cec3c432b20a5b6d5e3d22fb | 2,060 | xml | XML | android/app/src/main/AndroidManifest.xml | EdvaldoMartins/flutter_pub_dev | ad8d67f4220550772f490431a933f7f5b89d15a0 | [
"Apache-2.0"
] | 31 | 2020-08-02T14:29:14.000Z | 2022-02-19T13:00:30.000Z | android/app/src/main/AndroidManifest.xml | EdvaldoMartins/flutter_pub_dev | ad8d67f4220550772f490431a933f7f5b89d15a0 | [
"Apache-2.0"
] | null | null | null | android/app/src/main/AndroidManifest.xml | EdvaldoMartins/flutter_pub_dev | ad8d67f4220550772f490431a933f7f5b89d15a0 | [
"Apache-2.0"
] | 3 | 2021-02-24T14:17:34.000Z | 2021-07-31T15:45:09.000Z | <manifest xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:dist="http://schemas.android.com/apk/distribution"
xmlns:tools="http://schemas.android.com/tools"
package="nunioz.app.pub_dev"
android:targetSandboxVersion="2"
tools:targetApi="o">
<dist:module dist:instant="true" />
<uses-permission android:name="android.permission.INTERNET" />
<application
android:name="io.flutter.app.FlutterApplication"
android:icon="@drawable/pubicon"
android:label="pub.dev">
<activity
android:name=".MainActivity"
android:configChanges="orientation|keyboardHidden|keyboard|screenSize|smallestScreenSize|locale|layoutDirection|fontScale|screenLayout|density|uiMode"
android:hardwareAccelerated="true"
android:launchMode="singleTop"
android:theme="@style/LaunchTheme"
android:windowSoftInputMode="adjustResize">
<meta-data
android:name="default-url"
android:value="https://pub.dev" />
<intent-filter
android:autoVerify="true"
android:order="100">
<action android:name="android.intent.action.VIEW" />
<category android:name="android.intent.category.DEFAULT" />
<category android:name="android.intent.category.BROWSABLE" />
<data android:host="pub.dev" />
<data android:scheme="https" />
<data android:scheme="http" />
</intent-filter>
<intent-filter>
<action android:name="android.intent.action.MAIN" />
<category android:name="android.intent.category.LAUNCHER" />
</intent-filter>
</activity>
<!-- Don't delete the meta-data below.
This is used by the Flutter tool to generate GeneratedPluginRegistrant.java -->
<meta-data
android:name="flutterEmbedding"
android:value="2" />
</application>
</manifest>
| 40.392157 | 162 | 0.607282 |
13d04c47942f61aec545979ed7e78ed2ca53dd77 | 4,957 | xml | XML | 2016-xml/5K0Y-PSB0-004G-K09J-00000-00.xml | openva/va-decoded | 16c17864e5e400e835461b93ff96d9f922fc0aac | [
"MIT"
] | 5 | 2016-04-15T18:51:19.000Z | 2019-04-07T00:23:20.000Z | 2016-xml/5K0Y-PSB0-004G-K09J-00000-00.xml | openva/va-decoded | 16c17864e5e400e835461b93ff96d9f922fc0aac | [
"MIT"
] | 47 | 2015-10-30T01:39:35.000Z | 2017-12-11T14:05:31.000Z | 2016-xml/5K0Y-PSB0-004G-K09J-00000-00.xml | openva/va-decoded | 16c17864e5e400e835461b93ff96d9f922fc0aac | [
"MIT"
] | 5 | 2015-10-30T01:46:06.000Z | 2017-03-09T17:45:00.000Z | <?xml version="1.0" encoding="UTF-8"?><!--Transformation version 1.3--><legislativeDoc xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="http://www.lexisnexis.com/xmlschemas/content/public/legislativedoc/1/" schemaVersion="1.0"><legislativeDocHead><citations><citeForThisResource citeDefinition="#7159#349#000008# 01# 66.7#">Va. Code Ann. § 8.01-66.7</citeForThisResource></citations><legislativeBodyInfo><jurisdiction><jurisSystem normalizedLongName="Virginia" normalizedShortName="VA"/></jurisdiction></legislativeBodyInfo></legislativeDocHead><legislativeDocBody><statute><level levelType="section"><anchor id="_8.01-66.7"/><heading><desig>§ 8.01-66.7.</desig><title>Hearing and disposal of claim of unreasonableness</title></heading><bodyText><p>If the injured person questions the reasonableness of the charges made by a hospital, nurse, physician, or emergency medical services agency that provided emergency medical services or emergency medical services vehicle transportation claiming a lien pursuant to <citation type="statute" normalizedCite="VACODE 8.01-66.2"><content><span normalizedCite="Va. Code Ann. § 8.01-66.2">§ 8.01-66.2<locator><locatorKey><keyName name="citeReference"/><keyValue value="#7159#349#000008# 01# 66.2#"/></locatorKey></locator></span></content></citation>, the injured person or the hospital, physician, nurse, or emergency medical services agency that provided emergency medical services or emergency medical services vehicle transportation may file, in the court that would have jurisdiction of such claim if such claim were asserted against the injured person by such hospital, physician, nurse, or emergency medical services agency that provided emergency medical services or emergency medical services vehicle transportation, a petition setting forth the facts. The court shall hear and dispose of the matter in a summary way after five days' notice to the other party in interest.</p></bodyText><history><historyGroup groupType="history-citation"><historyItem><bodyText><p>Code 1950, § 32-145; 1979, c. 722; <citation normalizedCite="2003 VA CH 455"><content><span normalizedCite="2003 Va. Ch. 455">2003, c. 455<locator><locatorKey><keyName name="citeReference"/><keyValue value="#1834#131#2003#000455#"/></locatorKey></locator></span></content></citation>; <citation normalizedCite="2015 VA CH 502"><content><span normalizedCite="2015 Va. Ch. 502">2015, cc. 502<locator><locatorKey><keyName name="citeReference"/><keyValue value="#1834#131#2015#000502#"/></locatorKey></locator></span></content></citation>, <citation normalizedCite="2015 VA CH 503"><content><span normalizedCite="2015 Va. Ch. 503">503<locator><locatorKey><keyName name="citeReference"/><keyValue value="#1834#131#2015#000503#"/></locatorKey></locator></span></content></citation>.</p></bodyText></historyItem></historyGroup></history></level></statute></legislativeDocBody><metadata><dc:metadata xmlns:dc="http://purl.org/dc/elements/1.1/"><dc:identifier identifierScheme="PGUID">urn:contentItem:5K0Y-PSB0-004G-K09J-00000-00</dc:identifier><dc:source sourceScheme="productContentSetIdentifier">10816</dc:source><dc:date dateType="last-updated">2016-06-15</dc:date></dc:metadata><publicationInfo><publicationName>CODE OF VIRGINIA </publicationName><copyright>Copyright © 2016 by Matthew Bender & Company, Inc. a member of the LexisNexis Group. All rights reserved</copyright></publicationInfo><hierarchy><hierarchyLevel levelType="title"><heading><desig>TITLE 8.01.</desig><title>CIVIL REMEDIES AND PROCEDURE</title></heading><hierarchyLevel levelType="chapter"><heading><desig>CHAPTER 3.</desig><title>ACTIONS</title></heading><hierarchyLevel levelType="article"><heading><desig>ARTICLE 7.1.</desig><title>LIEN FOR HOSPITAL, MEDICAL AND NURSING SERVICES</title></heading></hierarchyLevel></hierarchyLevel></hierarchyLevel></hierarchy><classification classificationScheme="legal"><classificationItem><className>Contracts Law</className><classCode>Z3VpZD11cm46dG9waWM6QzY0RTZFMzE0RjkwNDdFQUI5M0U5N0ZFMjYyREMyQzU7cGFyZW50Z3VpZD0</classCode><classificationItem><className>Hospital Liens</className><classCode>Z3VpZD11cm46dG9waWM6NDJCNTE4NDg5QzA5NEYyOUFBQUIyOUQ4MzAyNzVEQ0M7cGFyZW50Z3VpZD11cm46dG9waWM6MTk1QjRFRkE3QjQzNEM5NEIwNkFDNEQ0ODM2MUJCRDU</classCode></classificationItem></classificationItem><classificationItem><className>Healthcare Law</className><classCode>Z3VpZD11cm46dG9waWM6NkUxMkVDQjJDOEY5NDVDQ0E5NTFEMTlDMjIwNzVERjc7cGFyZW50Z3VpZD0</classCode><classificationItem><className>General Overview</className><classCode>Z3VpZD11cm46dG9waWM6MzM1NkIwRTdBNzU3NEExOEJCNjU4NjNFNjEwRTVDMzQ7cGFyZW50Z3VpZD11cm46dG9waWM6OTJBNUJFODM1QjFDNDQzNThDMEEzQTFFMDc5ODc1OUE</classCode></classificationItem></classificationItem></classification><classificationGroup classificationScheme="indexing-terms"><classification classificationScheme="legal"/></classificationGroup></metadata></legislativeDoc> | 4,957 | 4,957 | 0.804519 |
2f649aa1d6477a6bdbe940a09b70caa857cc8d17 | 713 | xml | XML | app/src/main/res/values/styles.xml | Khalid-Syfullah/PlasmaPlus | 7900d17dcaca946bc32ba0db5771f359dd99cc0a | [
"Unlicense",
"MIT"
] | null | null | null | app/src/main/res/values/styles.xml | Khalid-Syfullah/PlasmaPlus | 7900d17dcaca946bc32ba0db5771f359dd99cc0a | [
"Unlicense",
"MIT"
] | null | null | null | app/src/main/res/values/styles.xml | Khalid-Syfullah/PlasmaPlus | 7900d17dcaca946bc32ba0db5771f359dd99cc0a | [
"Unlicense",
"MIT"
] | null | null | null | <resources>
<!-- Base application theme. -->
<style name="AppTheme" parent="Theme.AppCompat.Light.NoActionBar">
<!-- Customize your theme here. -->
<item name="colorPrimary">@color/colorPrimary</item>
<item name="colorPrimaryDark">@color/colorPrimaryDark</item>
<item name="colorAccent">@color/colorAccent</item>
</style>
<style name="Mystyle" parent="Widget.AppCompat.PopupMenu">
<item name="android:textColor">@android:color/white</item>
<item name="android:itemBackground">@android:color/holo_red_light</item>
<item name="android:divider">#FF0000</item>
<item name="android:dividerHeight">2dp</item>
</style>
</resources>
| 35.65 | 80 | 0.657784 |
b4bc48e70a2e070ad13f1a6a24261e54acf10140 | 566 | xml | XML | src/main/resources/mybatis/mybatis-config.xml | zyl19880411/koalas-web | a53616bde51ac848f9d0991a5502c2564f6bb0ab | [
"Apache-2.0"
] | 1 | 2020-12-14T08:41:13.000Z | 2020-12-14T08:41:13.000Z | src/main/resources/mybatis/mybatis-config.xml | zyl19880411/koalas-web | a53616bde51ac848f9d0991a5502c2564f6bb0ab | [
"Apache-2.0"
] | 5 | 2020-12-14T08:25:16.000Z | 2022-03-31T20:11:35.000Z | src/main/resources/mybatis/mybatis-config.xml | zyl19880411/koalas-web | a53616bde51ac848f9d0991a5502c2564f6bb0ab | [
"Apache-2.0"
] | 1 | 2021-02-16T10:55:56.000Z | 2021-02-16T10:55:56.000Z | <?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE configuration
PUBLIC "-//ibatis.apache.org//DTD Config 3.0//EN"
"http://ibatis.apache.org/dtd/ibatis-3-config.dtd">
<configuration>
<settings>
<setting name="callSettersOnNulls" value="true" />
<setting name="cacheEnabled" value="true"/>
</settings>
<plugins>
<plugin interceptor="com.github.miemiedev.mybatis.paginator.OffsetLimitInterceptor">
<property name="dialectClass" value="com.github.miemiedev.mybatis.paginator.dialect.MySQLDialect" />
</plugin>
</plugins>
</configuration>
| 35.375 | 103 | 0.712014 |
370db9413852bbe16dd81b45a9d3415658a47ace | 3,646 | xml | XML | assets/gothic_desk/gothic_desk_assets.xml | nicollassilva/bobba-assets | 2e76d491706c0e74c9ca2a86e2f83234cbb37e86 | [
"MIT"
] | 1 | 2020-03-18T17:06:18.000Z | 2020-03-18T17:06:18.000Z | assets/gothic_desk/gothic_desk_assets.xml | nicollassilva/bobba-assets | 2e76d491706c0e74c9ca2a86e2f83234cbb37e86 | [
"MIT"
] | 5 | 2021-01-05T16:32:00.000Z | 2022-02-10T20:07:30.000Z | assets/gothic_desk/gothic_desk_assets.xml | nicollassilva/bobba-assets | 2e76d491706c0e74c9ca2a86e2f83234cbb37e86 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="ISO-8859-1" ?>
<assets>
<asset name="gothic_desk_64_a_0_0" x="35" y="48"/>
<asset name="gothic_desk_64_b_0_0" x="59" y="31"/>
<asset name="gothic_desk_64_c_0_0" x="-28" y="33"/>
<asset name="gothic_desk_64_d_0_0" x="59" y="20"/>
<asset name="gothic_desk_64_c_0_1" x="35" y="67"/>
<asset name="gothic_desk_64_d_0_1" x="51" y="34"/>
<asset name="gothic_desk_64_c_0_2" x="29" y="60"/>
<asset name="gothic_desk_64_d_0_2" x="50" y="28"/>
<asset name="gothic_desk_64_c_0_3" x="26" y="67"/>
<asset name="gothic_desk_64_d_0_3" x="54" y="51"/>
<asset name="gothic_desk_64_c_0_4" x="51" y="51"/>
<asset name="gothic_desk_64_d_0_4" x="51" y="37"/>
<asset name="gothic_desk_32_a_0_0" x="18" y="24"/>
<asset name="gothic_desk_32_b_0_0" x="31" y="15"/>
<asset name="gothic_desk_32_c_0_0" x="-11" y="17"/>
<asset name="gothic_desk_32_d_0_0" x="31" y="9"/>
<asset name="gothic_desk_32_c_0_1" x="17" y="33"/>
<asset name="gothic_desk_32_d_0_1" x="27" y="17"/>
<asset name="gothic_desk_32_c_0_2" x="15" y="29"/>
<asset name="gothic_desk_32_d_0_2" x="26" y="14"/>
<asset name="gothic_desk_32_c_0_3" x="14" y="33"/>
<asset name="gothic_desk_32_d_0_3" x="28" y="25"/>
<asset name="gothic_desk_32_c_0_4" x="8" y="25"/>
<asset name="gothic_desk_32_d_0_4" x="27" y="18"/>
<asset name="gothic_desk_64_a_2_0" flipH="1" source="gothic_desk_64_a_0_0" x="35" y="48"/>
<asset name="gothic_desk_64_b_2_0" flipH="1" source="gothic_desk_64_b_0_0" x="59" y="31"/>
<asset name="gothic_desk_64_c_2_0" flipH="1" source="gothic_desk_64_c_0_0" x="-28" y="33"/>
<asset name="gothic_desk_64_d_2_0" flipH="1" source="gothic_desk_64_d_0_0" x="59" y="20"/>
<asset name="gothic_desk_64_c_2_1" flipH="1" source="gothic_desk_64_c_0_1" x="35" y="67"/>
<asset name="gothic_desk_64_d_2_1" flipH="1" source="gothic_desk_64_d_0_1" x="51" y="34"/>
<asset name="gothic_desk_64_c_2_2" flipH="1" source="gothic_desk_64_c_0_2" x="29" y="60"/>
<asset name="gothic_desk_64_d_2_2" flipH="1" source="gothic_desk_64_d_0_2" x="50" y="28"/>
<asset name="gothic_desk_64_c_2_3" flipH="1" source="gothic_desk_64_c_0_3" x="26" y="67"/>
<asset name="gothic_desk_64_d_2_3" flipH="1" source="gothic_desk_64_d_0_3" x="54" y="51"/>
<asset name="gothic_desk_64_c_2_4" flipH="1" source="gothic_desk_64_c_0_4" x="51" y="51"/>
<asset name="gothic_desk_64_d_2_4" flipH="1" source="gothic_desk_64_d_0_4" x="51" y="37"/>
<asset name="gothic_desk_32_a_2_0" flipH="1" source="gothic_desk_32_a_0_0" x="18" y="24"/>
<asset name="gothic_desk_32_b_2_0" flipH="1" source="gothic_desk_32_b_0_0" x="31" y="15"/>
<asset name="gothic_desk_32_c_2_0" flipH="1" source="gothic_desk_32_c_0_0" x="-11" y="17"/>
<asset name="gothic_desk_32_d_2_0" flipH="1" source="gothic_desk_32_d_0_0" x="31" y="9"/>
<asset name="gothic_desk_32_c_2_1" flipH="1" source="gothic_desk_32_c_0_1" x="17" y="33"/>
<asset name="gothic_desk_32_d_2_1" flipH="1" source="gothic_desk_32_d_0_1" x="27" y="17"/>
<asset name="gothic_desk_32_c_2_2" flipH="1" source="gothic_desk_32_c_0_2" x="15" y="29"/>
<asset name="gothic_desk_32_d_2_2" flipH="1" source="gothic_desk_32_d_0_2" x="26" y="14"/>
<asset name="gothic_desk_32_c_2_3" flipH="1" source="gothic_desk_32_c_0_3" x="14" y="33"/>
<asset name="gothic_desk_32_d_2_3" flipH="1" source="gothic_desk_32_d_0_3" x="28" y="25"/>
<asset name="gothic_desk_32_c_2_4" flipH="1" source="gothic_desk_32_c_0_4" x="8" y="25"/>
<asset name="gothic_desk_32_d_2_4" flipH="1" source="gothic_desk_32_d_0_4" x="27" y="18"/>
<asset name="gothic_desk_icon_a" source="gothic_desk_icon_a" x="15" y="14"/>
</assets> | 71.490196 | 93 | 0.696928 |
542e547feadfee7f47f62568e0f8a77913e3d857 | 13,916 | xml | XML | ddf/ddf_files/unverified/ushap.xml | ehazlett/ktranslate | 77e12ad79dec550b63742bf6c7ad53455b120002 | [
"Apache-2.0"
] | 31 | 2021-02-24T05:03:18.000Z | 2022-03-23T07:52:29.000Z | ddf/ddf_files/unverified/ushap.xml | ehazlett/ktranslate | 77e12ad79dec550b63742bf6c7ad53455b120002 | [
"Apache-2.0"
] | 125 | 2021-06-07T21:57:38.000Z | 2022-03-31T19:28:42.000Z | ddf/ddf_files/unverified/ushap.xml | ehazlett/ktranslate | 77e12ad79dec550b63742bf6c7ad53455b120002 | [
"Apache-2.0"
] | 16 | 2021-05-17T23:54:23.000Z | 2022-02-14T13:12:15.000Z | <?xml version="1.0"?>
<!-- DigiPower UPS -->
<APC_DDF xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="apc_ddf_1_6.xsd"
ddfid ="ushap" ddfname="USHAP" ddfversion="4" canremove="yes">
<schemaVersion>1.6</schemaVersion>
<!-- upsIdentName -->
<device deviceid="ushapdiscdata">
<oidMustExist ruleid="mib2objidtest" oid=".1.3.6.1.4.1.2468.1.2.1.1.1.1.0"/>
<!-- upsIdentAgentFirmwareVersion-->
<setProductData ruleid="appversiondata" field="appversion">
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.1.3.0</getOid>
</setProductData>
<!-- upsIdentModel -->
<suppressRule ruleid="stompmib2model" suppressid="core/mib2data/modeldata"/>
<setProductData ruleid="modeldata" field="model">
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.1.2.0</getOid>
</setProductData>
</device>
<device deviceid="ushap">
<oidMustExist ruleid="ushap" oid=".1.3.6.1.4.1.2468.1.2.1.1.1.1.0"/>
<!-- upsBattery Begin -->
<!-- upsBatteryStatus -->
<stateSensor ruleid="upsBatteryStatus">
<type>state</type>
<sensorId>UPS_BATTERY_STATUS</sensorId>
<value>
<mapValue mapid="value6-vm">
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.2.1.0</getOid>
</mapValue>
</value>
<label>Battery Status</label>
<enum>BatteryStatus-em</enum>
<sensorSet>Battery</sensorSet>
</stateSensor>
<valueMap ruleid="value6-vm">
<valueIn>1</valueIn><valueOut>0</valueOut>
<valueIn>2</valueIn><valueOut>1</valueOut>
<valueIn>3</valueIn><valueOut>2</valueOut>
<valueIn>4</valueIn><valueOut>3</valueOut>
<valueIn>5</valueIn><valueOut>4</valueOut>
<valueIn>6</valueIn><valueOut>5</valueOut>
</valueMap>
<enumMap ruleid="BatteryStatus-em">
<label>unknown</label>
<label>normal</label>
<label>low</label>
<label>depleted</label>
<label>discharging</label>
<label>failure</label>
</enumMap>
<!-- upsSecondsOnBattery -->
<numSensor ruleid="upsSecondsOnBattery">
<type>timeinsec</type>
<sensorId>SECONDS_ON_BATTERY</sensorId>
<value>
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.2.2.0</getOid>
</value>
<label>Seconds On Battery</label>
<sensorSet>Battery</sensorSet>
</numSensor>
<!-- upsEstimatedMinutesRemaining -->
<numSensor ruleid="upsEstimatedMinutesRemaining">
<type>mininmin</type>
<sensorId>ESTIMATED_MINUTES_REMAINING</sensorId>
<value>
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.2.3.0</getOid>
</value>
<label>Estimated Minutes Remaining</label>
<sensorSet>Battery</sensorSet>
</numSensor>
<!-- upsEstimatedChargeRemaining -->
<numSensor ruleid="upsEstimatedChargeRemaining">
<type>pctofcapacity</type>
<sensorId>ESTIMATED_CHARGE_REMAINING</sensorId>
<value>
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.2.4.0</getOid>
</value>
<label>Estimated Charge Remaining</label>
<sensorSet>Battery</sensorSet>
</numSensor>
<!-- upsBatteryVoltage -->
<numSensor ruleid="v4dupsBatteryVoltage">
<type>voltageDC</type>
<sensorId>BATTERY_VOLTAGE_</sensorId>
<value>
<mult>
<op><getOid>.1.3.6.1.4.1.2468.1.2.1.1.2.5.0</getOid></op>
<op>0.1</op>
</mult>
</value>
<label>Battery Voltage</label>
<sensorSet>Battery</sensorSet>
</numSensor>
<!--upsBatterymandatory -->
<numSensor ruleid="upsBatterymandatory">
<type>num/mandatory</type>
<sensorId>BATTERY_MANDATORY_</sensorId>
<value>
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.2.6.0</getOid>
</value>
<label>Battery Mandatory</label>
<sensorSet>Battery</sensorSet>
</numSensor>
<!-- upsBatteryTemperature -->
<numSensor ruleid="upsBatteryTemperature">
<type>temp</type>
<sensorId>BATTERY_TEMPERATURE</sensorId>
<value>
<mult>
<op><getOid>.1.3.6.1.4.1.2468.1.2.1.1.2.7.0</getOid></op>
<op>0.1</op>
</mult>
</value>
<label>Battery Temperature</label>
<sensorSet>Battery</sensorSet>
</numSensor>
<!-- upsInput Begin -->
<!-- upsInputFrequency -->
<numSensor ruleid="upsInputFrequency" index=".1.3.6.1.4.1.2468.1.2.1.1.3.3.1.1">
<type>frequency</type>
<sensorId>INPUT_FREQUENCY<rowIndex/></sensorId>
<value>
<mult>
<op><getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.3.3.1.2</getRowOid></op>
<op>0.1</op>
</mult>
</value>
<label>Input Frequency<rowIndex/></label>
<sensorSet>Input<rowIndex/></sensorSet>
</numSensor>
<!-- upsInputVoltage -->
<numSensor ruleid="upsInputVoltage" index=".1.3.6.1.4.1.2468.1.2.1.1.3.3.1.1">
<type>voltageDC</type>
<sensorId>INPUT_VOLTAGE_<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.3.3.1.3</getRowOid>
</value>
<label>Input Voltage<rowIndex/></label>
<sensorSet>Input<rowIndex/></sensorSet>
</numSensor>
<!-- upsInputCurrent -->
<numSensor ruleid="upsInputCurrent" index=".1.3.6.1.4.1.2468.1.2.1.1.3.3.1.1">
<type>amperage</type>
<sensorId>INPUT_CURRENT<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.3.3.1.4</getRowOid>
</value>
<label>Input Current<rowIndex/></label>
<sensorSet>Input<rowIndex/></sensorSet>
</numSensor>
<!-- upsInputTruePower -->
<numSensor ruleid="upsInputTruePower" index=".1.3.6.1.4.1.2468.1.2.1.1.3.3.1.1">
<type>powerW</type>
<sensorId>INPUT_TRUE_POWER<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.3.3.1.5</getRowOid>
</value>
<label>Input True Power<rowIndex/></label>
<sensorSet>Input<rowIndex/></sensorSet>
</numSensor>
<!-- upsInputVoltageMax -->
<numSensor ruleid="upsInputVoltageMax" index=".1.3.6.1.4.1.2468.1.2.1.1.3.3.1.1">
<type>voltageDC</type>
<sensorId>INPUT_VOLTAGE_MAX<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.3.3.1.6</getRowOid>
</value>
<label>Input Voltage Maximum<rowIndex/></label>
<sensorSet>Input<rowIndex/></sensorSet>
</numSensor>
<!-- upsInputVoltageMin -->
<numSensor ruleid="upsInputVoltageMin" index=".1.3.6.1.4.1.2468.1.2.1.1.3.3.1.1">
<type>voltageDC</type>
<sensorId>INPUT_VOLTAGE_MAX<rowIndex/></sensorId>
<value>
<mult>
<op><getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.3.3.1.7</getRowOid></op>
<op>0.1</op>
</mult>
</value>
<label>Input Voltage Minimum<rowIndex/></label>
<sensorSet>Input<rowIndex/></sensorSet>
</numSensor>
<!-- upsOutput Begin -->
<!-- upsOutputSource -->
<stateSensor ruleid="upsOutputSource">
<type>state</type>
<sensorId>UPS_OUTPUT_SOURCE</sensorId>
<value>
<mapValue mapid="value7-vm">
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.4.1.0</getOid>
</mapValue>
</value>
<label>Output Source</label>
<enum>OutputSource-em</enum>
<sensorSet>Output1</sensorSet>
</stateSensor>
<valueMap ruleid="value7-vm">
<valueIn>1</valueIn><valueOut>0</valueOut>
<valueIn>2</valueIn><valueOut>1</valueOut>
<valueIn>3</valueIn><valueOut>2</valueOut>
<valueIn>4</valueIn><valueOut>3</valueOut>
<valueIn>5</valueIn><valueOut>4</valueOut>
<valueIn>6</valueIn><valueOut>5</valueOut>
<valueIn>7</valueIn><valueOut>6</valueOut>
</valueMap>
<enumMap ruleid="OutputSource-em">
<label>other</label>
<label>none</label>
<label>normal</label>
<label>bypass</label>
<label>battery</label>
<label>booster</label>
<label>reducer</label>
</enumMap>
<!-- upsOutputFrequency -->
<numSensor ruleid="upsOutputFrequency">
<type>frequency</type>
<sensorId>OUTPUT_FREQUENCY</sensorId>
<value>
<mult>
<op><getOid>.1.3.6.1.4.1.2468.1.2.1.1.4.2.0</getOid></op>
<op>0.1</op>
</mult>
</value>
<label>Output Frequency</label>
<sensorSet>Output1</sensorSet>
</numSensor>
<!-- upsOutputVoltage -->
<numSensor ruleid="upsOutputVoltage" index=".1.3.6.1.4.1.2468.1.2.1.1.4.4.1.1">
<type>voltageDC</type>
<sensorId>INPUT_VOLTAGE_<rowIndex/></sensorId>
<value>
<mult>
<op><getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.4.4.1.2</getRowOid></op>
<op>0.1</op>
</mult>
</value>
<label>Output Voltage<rowIndex/></label>
<sensorSet>Output<rowIndex/></sensorSet>
</numSensor>
<!-- upsOutputCurrent -->
<numSensor ruleid="upsOutputCurrent" index=".1.3.6.1.4.1.2468.1.2.1.1.4.4.1.1">
<type>amperage</type>
<sensorId>OUTPUT_CURRENT<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.4.4.1.3</getRowOid>
</value>
<label>Output Current<rowIndex/></label>
<sensorSet>Output<rowIndex/></sensorSet>
</numSensor>
<!-- upsOutputPower -->
<numSensor ruleid="upsOutputPower" index=".1.3.6.1.4.1.2468.1.2.1.1.4.4.1.1">
<type>powerW</type>
<sensorId>OUTPUT_POWER<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.4.4.1.4</getRowOid>
</value>
<label>Output Power<rowIndex/></label>
<sensorSet>Output<rowIndex/></sensorSet>
</numSensor>
<!-- upsOutputPercentLoad -->
<numSensor ruleid="upsOutputPercentLoad" index=".1.3.6.1.4.1.2468.1.2.1.1.4.4.1.1">
<type>pctofcapacity</type>
<sensorId>OUTPUT_PERCENT_LOAD<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.4.4.1.5</getRowOid>
</value>
<label>Output Percent Load<rowIndex/></label>
<sensorSet>Output<rowIndex/></sensorSet>
</numSensor>
<!-- upsBypass Begin -->
<!-- upsBypassFrequency -->
<numSensor ruleid="upsBypassFrequency">
<type>frequency</type>
<sensorId>BYPASS_FREQUENCY</sensorId>
<value>
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.5.1.0</getOid>
</value>
<label>Bypass Frequency</label>
<sensorSet>Bypass1</sensorSet>
</numSensor>
<!-- upsBypassVoltage -->
<numSensor ruleid="upsInputVoltage" index=".1.3.6.1.4.1.2468.1.2.1.1.5.3.1.1">
<type>voltageDC</type>
<sensorId>BYPASS_VOLTAGE_<rowIndex/></sensorId>
<value>
<mult>
<op><getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.5.3.1.2</getRowOid></op>
<op>0.1</op>
</mult>
</value>
<label>Output Voltage<rowIndex/></label>
<sensorSet>Bypass<rowIndex/></sensorSet>
</numSensor>
<!-- upsBypassCurrent -->
<numSensor ruleid="upsBypassCurrent" index=".1.3.6.1.4.1.2468.1.2.1.1.5.3.1.1">
<type>amperage</type>
<sensorId>BYPASS_CURRENT<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.5.3.1.3</getRowOid>
</value>
<label>Bypass Current<rowIndex/></label>
<sensorSet>Bypass<rowIndex/></sensorSet>
</numSensor>
<!-- upsBypassPower -->
<numSensor ruleid="upsBypassPower" index=".1.3.6.1.4.1.2468.1.2.1.1.5.3.1.1">
<type>powerW</type>
<sensorId>UPS_BYPASS_POWER<rowIndex/></sensorId>
<value>
<getRowOid>.1.3.6.1.4.1.2468.1.2.1.1.5.3.1.4</getRowOid>
</value>
<label>Bypass Power<rowIndex/></label>
<sensorSet>Bypass<rowIndex/></sensorSet>
</numSensor>
<!-- emdStatus Begin -->
<!-- emdSatatusEmdType -->
<stateSensor ruleid="emdSatatusEmdType">
<type>state</type>
<sensorId>EMD_SATATUS_EMD_TYPE</sensorId>
<value>
<mapValue mapid="value4-vm">
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.11.1.0</getOid>
</mapValue>
</value>
<label>EMD Type</label>
<enum>EmdType-em</enum>
<sensorSet>EMD Satatus</sensorSet>
</stateSensor>
<valueMap ruleid="value4-vm">
<valueIn>1</valueIn><valueOut>0</valueOut>
<valueIn>2</valueIn><valueOut>1</valueOut>
<valueIn>3</valueIn><valueOut>2</valueOut>
<valueIn>4</valueIn><valueOut>3</valueOut>
</valueMap>
<enumMap ruleid="EmdType-em">
<label>unknown</label>
<label>disabled</label>
<label>eMD-HT</label>
<label>eMD-T</label>
</enumMap>
<!-- emdSatatusTemperature -->
<numSensor ruleid="emdSatatusTemperature">
<type>temp</type>
<sensorId>SATATUS_TEMPERATURE</sensorId>
<value>
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.11.2.0</getOid>
</value>
<label>EMD Satatus Temperature</label>
<sensorSet>EMD Satatus</sensorSet>
</numSensor>
<!-- emdSatatusHumidity -->
<numSensor ruleid="emdSatatusHumidity">
<type>humidity</type>
<sensorId>SATATUS_HUMIDITY</sensorId>
<value>
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.11.3.0</getOid>
</value>
<label>EMD Satatus Humidity</label>
<sensorSet>EMD Satatus</sensorSet>
</numSensor>
<!-- emdSatatusAlarm1 -->
<stateSensor ruleid="emdSatatusAlarm1">
<type>state</type>
<sensorId>EMD_SATATUS_ALARM_1</sensorId>
<value>
<mapValue mapid="value4-vm">
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.11.4.0</getOid>
</mapValue>
</value>
<label>Alarm 1 Status</label>
<enum>Alarm-em</enum>
<sensorSet>EMD Satatus</sensorSet>
</stateSensor>
<enumMap ruleid="Alarm-em">
<label>unknown</label>
<label>disabled</label>
<label>active</label>
<label>inactive</label>
</enumMap>
<!-- emdSatatusAlarm2 -->
<stateSensor ruleid="emdSatatusAlarm2">
<type>state</type>
<sensorId>EMD_SATATUS_ALARM_2</sensorId>
<value>
<mapValue mapid="value4-vm">
<getOid>.1.3.6.1.4.1.2468.1.2.1.1.11.5.0</getOid>
</mapValue>
</value>
<label>Alarm 2 Status</label>
<enum>Alarm-em</enum>
<sensorSet>EMD Satatus</sensorSet>
</stateSensor>
</device>
</APC_DDF> | 31.771689 | 110 | 0.605778 |
f844e743bdbd2f98e2722441bf77236d7672ca89 | 296 | xml | XML | pan14/03-random-obfuscation/suspicious-document00062-source-document01564.xml | wiraindrak/Plagiarsm-Detection | 4d8d6bdbc676bf2fd718a654ccfa11478984614c | [
"MIT"
] | null | null | null | pan14/03-random-obfuscation/suspicious-document00062-source-document01564.xml | wiraindrak/Plagiarsm-Detection | 4d8d6bdbc676bf2fd718a654ccfa11478984614c | [
"MIT"
] | null | null | null | pan14/03-random-obfuscation/suspicious-document00062-source-document01564.xml | wiraindrak/Plagiarsm-Detection | 4d8d6bdbc676bf2fd718a654ccfa11478984614c | [
"MIT"
] | null | null | null | <document reference="suspicious-document00062.txt">
<feature name="plagiarism" obfuscation="random" obfuscation_degree="0.48102887396895816" source_length="460" source_offset="492" source_reference="source-document01564.txt" this_length="286" this_offset="11459" type="artificial" />
</document>
| 74 | 231 | 0.807432 |
f977f5b3628d933759b738284b33a4151ba0e02a | 958 | xml | XML | app/src/main/res/layouts/shopcart/layout/wgshopcart_list_item1.xml | mumabinggan/WeygoPhone | 15b6eb23160b010dc399fe54c923c48c6a0b737d | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layouts/shopcart/layout/wgshopcart_list_item1.xml | mumabinggan/WeygoPhone | 15b6eb23160b010dc399fe54c923c48c6a0b737d | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layouts/shopcart/layout/wgshopcart_list_item1.xml | mumabinggan/WeygoPhone | 15b6eb23160b010dc399fe54c923c48c6a0b737d | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<com.weygo.weygophone.common.SwipeItemLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:layout_width="match_parent"
android:layout_height="@dimen/x106">
<com.weygo.weygophone.pages.shopcart.widget.WGShopCartItemView
android:id="@+id/itemView"
android:layout_width="match_parent"
android:layout_height="wrap_content">
</com.weygo.weygophone.pages.shopcart.widget.WGShopCartItemView>
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="match_parent">
<Button
android:id="@+id/delete"
android:text="删除"
android:textColor="#ffffff"
android:textSize="16sp"
android:background="#ff0000"
android:layout_width="100dp"
android:layout_height="match_parent" />
</LinearLayout>
</com.weygo.weygophone.common.SwipeItemLayout> | 34.214286 | 103 | 0.67119 |
f506dc2b9260e37a6c1a4d3658c8715ed986e277 | 34,192 | storyboard | XML | TheMovieManager-v2/TheMovieManager/Base.lproj/Main.storyboard | qclin/iOS-networking | c5a98ebc9c21ab9fe843d747f9fc567bdbb6f5f7 | [
"MIT"
] | null | null | null | TheMovieManager-v2/TheMovieManager/Base.lproj/Main.storyboard | qclin/iOS-networking | c5a98ebc9c21ab9fe843d747f9fc567bdbb6f5f7 | [
"MIT"
] | null | null | null | TheMovieManager-v2/TheMovieManager/Base.lproj/Main.storyboard | qclin/iOS-networking | c5a98ebc9c21ab9fe843d747f9fc567bdbb6f5f7 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8" standalone="no"?>
<document type="com.apple.InterfaceBuilder3.CocoaTouch.Storyboard.XIB" version="3.0" toolsVersion="11762" systemVersion="15G31" targetRuntime="iOS.CocoaTouch" propertyAccessControl="none" useAutolayout="YES" useTraitCollections="YES" colorMatched="YES" initialViewController="72f-zb-tFC">
<device id="retina4_7" orientation="portrait">
<adaptation id="fullscreen"/>
</device>
<dependencies>
<deployment identifier="iOS"/>
<plugIn identifier="com.apple.InterfaceBuilder.IBCocoaTouchPlugin" version="11757"/>
<capability name="Constraints to layout margins" minToolsVersion="6.0"/>
<capability name="documents saved in the Xcode 8 format" minToolsVersion="8.0"/>
</dependencies>
<scenes>
<!--Manager Navigation-->
<scene sceneID="2cX-Pa-55d">
<objects>
<navigationController storyboardIdentifier="ManagerNavigationController" id="kU7-ZA-CTN" userLabel="Manager Navigation" sceneMemberID="viewController">
<navigationBar key="navigationBar" contentMode="scaleToFill" id="tOf-JB-2gq">
<rect key="frame" x="0.0" y="0.0" width="320" height="44"/>
<autoresizingMask key="autoresizingMask"/>
</navigationBar>
<connections>
<segue destination="AoF-9E-uwa" kind="relationship" relationship="rootViewController" id="r1j-3f-mJR"/>
</connections>
</navigationController>
<placeholder placeholderIdentifier="IBFirstResponder" id="hG4-GV-CP7" userLabel="First Responder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="940" y="475"/>
</scene>
<!--Web Auth-->
<scene sceneID="tHu-Pb-CGD">
<objects>
<viewController storyboardIdentifier="TMDBAuthViewController" id="jwh-DV-AeZ" userLabel="Web Auth" customClass="TMDBAuthViewController" customModule="TheMovieManager" customModuleProvider="target" sceneMemberID="viewController">
<layoutGuides>
<viewControllerLayoutGuide type="top" id="UZw-Z9-T03"/>
<viewControllerLayoutGuide type="bottom" id="kux-EN-rnt"/>
</layoutGuides>
<view key="view" contentMode="scaleToFill" id="nQA-q2-QHt">
<rect key="frame" x="0.0" y="0.0" width="375" height="667"/>
<autoresizingMask key="autoresizingMask" widthSizable="YES" heightSizable="YES"/>
<subviews>
<webView contentMode="scaleToFill" translatesAutoresizingMaskIntoConstraints="NO" id="t9i-xb-ieq">
<rect key="frame" x="0.0" y="0.0" width="375" height="667"/>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
</webView>
</subviews>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<constraints>
<constraint firstItem="t9i-xb-ieq" firstAttribute="top" secondItem="nQA-q2-QHt" secondAttribute="top" id="1se-bx-p7d"/>
<constraint firstAttribute="trailing" secondItem="t9i-xb-ieq" secondAttribute="trailing" id="6bl-XL-24h"/>
<constraint firstItem="t9i-xb-ieq" firstAttribute="leading" secondItem="nQA-q2-QHt" secondAttribute="leading" id="MPS-J6-bWd"/>
<constraint firstItem="t9i-xb-ieq" firstAttribute="bottom" secondItem="kux-EN-rnt" secondAttribute="top" id="k5P-U6-Rh2"/>
</constraints>
</view>
<connections>
<outlet property="webView" destination="t9i-xb-ieq" id="gYI-it-Aij"/>
</connections>
</viewController>
<placeholder placeholderIdentifier="IBFirstResponder" id="1YL-Bg-nbJ" userLabel="First Responder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="251" y="1221"/>
</scene>
<!--Movie Detail-->
<scene sceneID="Geg-H8-Vtp">
<objects>
<viewController storyboardIdentifier="MovieDetailViewController" id="ZVa-CJ-SjC" userLabel="Movie Detail" customClass="MovieDetailViewController" customModule="TheMovieManager" customModuleProvider="target" sceneMemberID="viewController">
<layoutGuides>
<viewControllerLayoutGuide type="top" id="pqN-bU-5MP"/>
<viewControllerLayoutGuide type="bottom" id="n2O-so-rG9"/>
</layoutGuides>
<view key="view" contentMode="scaleToFill" id="dA2-ru-aaG">
<rect key="frame" x="0.0" y="0.0" width="375" height="667"/>
<autoresizingMask key="autoresizingMask" widthSizable="YES" heightSizable="YES"/>
<subviews>
<imageView userInteractionEnabled="NO" contentMode="scaleAspectFit" horizontalHuggingPriority="251" verticalHuggingPriority="251" translatesAutoresizingMaskIntoConstraints="NO" id="d3z-LX-ckt">
<rect key="frame" x="0.0" y="20" width="375" height="603"/>
<constraints>
<constraint firstAttribute="height" constant="556" id="6pv-j8-krM"/>
</constraints>
<variation key="default">
<mask key="constraints">
<exclude reference="6pv-j8-krM"/>
</mask>
</variation>
</imageView>
<toolbar opaque="NO" clearsContextBeforeDrawing="NO" contentMode="scaleToFill" translatesAutoresizingMaskIntoConstraints="NO" id="6VR-33-08e">
<rect key="frame" x="0.0" y="623" width="375" height="44"/>
<constraints>
<constraint firstAttribute="height" constant="44" id="rKr-OC-Snd"/>
</constraints>
<items>
<barButtonItem image="Favorite" style="plain" id="afS-qH-AhS" userLabel="Toggle Favorite">
<color key="tintColor" red="0.0" green="0.0" blue="0.0" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<connections>
<action selector="toggleFavorite:" destination="ZVa-CJ-SjC" id="wce-NO-HW8"/>
</connections>
</barButtonItem>
<barButtonItem image="List" style="plain" id="0UD-zu-Qep" userLabel="Toggle Watchlist">
<color key="tintColor" red="0.0" green="0.0" blue="0.0" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<connections>
<action selector="toggleWatchlist:" destination="ZVa-CJ-SjC" id="O2h-Gg-dZy"/>
</connections>
</barButtonItem>
</items>
</toolbar>
<activityIndicatorView opaque="NO" contentMode="scaleToFill" horizontalHuggingPriority="750" verticalHuggingPriority="750" style="gray" translatesAutoresizingMaskIntoConstraints="NO" id="2Vf-UK-Evl">
<rect key="frame" x="177.5" y="311.5" width="20" height="20"/>
</activityIndicatorView>
<textField opaque="NO" clipsSubviews="YES" contentMode="scaleToFill" contentHorizontalAlignment="left" contentVerticalAlignment="center" borderStyle="roundedRect" textAlignment="natural" minimumFontSize="17" translatesAutoresizingMaskIntoConstraints="NO" id="H12-vu-U0V">
<rect key="frame" x="314" y="577" width="25" height="30"/>
<nil key="textColor"/>
<fontDescription key="fontDescription" type="system" pointSize="14"/>
<textInputTraits key="textInputTraits"/>
</textField>
</subviews>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<constraints>
<constraint firstItem="6VR-33-08e" firstAttribute="top" secondItem="H12-vu-U0V" secondAttribute="bottom" constant="16" id="0gh-59-zvX"/>
<constraint firstItem="6VR-33-08e" firstAttribute="bottom" secondItem="n2O-so-rG9" secondAttribute="top" id="2gX-U1-fHt"/>
<constraint firstItem="d3z-LX-ckt" firstAttribute="top" secondItem="pqN-bU-5MP" secondAttribute="bottom" id="3d5-Tp-BLk"/>
<constraint firstAttribute="centerX" secondItem="6VR-33-08e" secondAttribute="centerX" id="5w8-VI-tVy"/>
<constraint firstAttribute="centerX" secondItem="d3z-LX-ckt" secondAttribute="centerX" id="7kY-LS-s5E"/>
<constraint firstAttribute="trailingMargin" secondItem="6VR-33-08e" secondAttribute="trailing" constant="-16" id="8iJ-7z-mdy"/>
<constraint firstItem="6VR-33-08e" firstAttribute="top" secondItem="d3z-LX-ckt" secondAttribute="bottom" id="Ih0-t0-c8P"/>
<constraint firstAttribute="centerX" secondItem="2Vf-UK-Evl" secondAttribute="centerX" id="R8G-vS-hQR"/>
<constraint firstItem="6VR-33-08e" firstAttribute="leading" secondItem="dA2-ru-aaG" secondAttribute="leadingMargin" constant="-16" id="cbT-Gm-dO8"/>
<constraint firstAttribute="trailingMargin" secondItem="d3z-LX-ckt" secondAttribute="trailing" constant="-16" id="dSi-ZH-6Ib"/>
<constraint firstItem="d3z-LX-ckt" firstAttribute="leading" secondItem="dA2-ru-aaG" secondAttribute="leadingMargin" constant="-16" id="gWp-Q7-W2T"/>
<constraint firstAttribute="trailingMargin" secondItem="H12-vu-U0V" secondAttribute="trailing" constant="20" id="rO5-s0-uLG"/>
<constraint firstItem="2Vf-UK-Evl" firstAttribute="centerY" secondItem="d3z-LX-ckt" secondAttribute="centerY" id="uBJ-NE-1kV"/>
</constraints>
</view>
<connections>
<outlet property="activityIndicator" destination="2Vf-UK-Evl" id="5Ks-Kd-CTn"/>
<outlet property="posterImageView" destination="d3z-LX-ckt" id="aP6-0S-L51"/>
<outlet property="ratingTextField" destination="H12-vu-U0V" id="Vg7-sS-YA0"/>
<outlet property="toggleFavoriteButton" destination="afS-qH-AhS" id="lgk-gb-0Bx"/>
<outlet property="toggleWatchlistButton" destination="0UD-zu-Qep" id="Pgt-we-P8h"/>
</connections>
</viewController>
<placeholder placeholderIdentifier="IBFirstResponder" id="jK8-pb-hVD" userLabel="First Responder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="1643" y="1221"/>
</scene>
<!--Watchlist-->
<scene sceneID="tKN-ki-6Gu">
<objects>
<viewController automaticallyAdjustsScrollViewInsets="NO" id="Tb6-sk-v10" userLabel="Watchlist" customClass="WatchlistViewController" customModule="TheMovieManager" customModuleProvider="target" sceneMemberID="viewController">
<layoutGuides>
<viewControllerLayoutGuide type="top" id="qNB-dz-lSk"/>
<viewControllerLayoutGuide type="bottom" id="frY-Ma-0oY"/>
</layoutGuides>
<view key="view" contentMode="scaleToFill" id="LWu-V5-2xV">
<rect key="frame" x="0.0" y="0.0" width="375" height="667"/>
<autoresizingMask key="autoresizingMask" widthSizable="YES" heightSizable="YES"/>
<subviews>
<tableView clipsSubviews="YES" contentMode="scaleToFill" alwaysBounceVertical="YES" dataMode="prototypes" style="plain" separatorStyle="default" rowHeight="44" sectionHeaderHeight="1" sectionFooterHeight="1" translatesAutoresizingMaskIntoConstraints="NO" id="nlH-w1-wIP">
<rect key="frame" x="0.0" y="64" width="375" height="554"/>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<prototypes>
<tableViewCell contentMode="scaleToFill" selectionStyle="default" indentationLevel="1" indentationWidth="0.0" reuseIdentifier="WatchlistTableViewCell" id="8bL-ip-8xb">
<rect key="frame" x="0.0" y="1" width="1000" height="44"/>
<autoresizingMask key="autoresizingMask"/>
<tableViewCellContentView key="contentView" opaque="NO" clipsSubviews="YES" multipleTouchEnabled="YES" contentMode="center" tableViewCell="8bL-ip-8xb" id="Tw3-hP-hF3">
<rect key="frame" x="0.0" y="0.0" width="1000" height="44"/>
<autoresizingMask key="autoresizingMask"/>
</tableViewCellContentView>
</tableViewCell>
</prototypes>
<connections>
<outlet property="dataSource" destination="Tb6-sk-v10" id="gfv-Rq-1In"/>
<outlet property="delegate" destination="Tb6-sk-v10" id="b9i-i6-oNN"/>
</connections>
</tableView>
</subviews>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<constraints>
<constraint firstItem="nlH-w1-wIP" firstAttribute="leading" secondItem="LWu-V5-2xV" secondAttribute="leading" id="BEO-Oy-SgE"/>
<constraint firstAttribute="trailing" secondItem="nlH-w1-wIP" secondAttribute="trailing" id="UBx-ZT-AzB"/>
<constraint firstItem="nlH-w1-wIP" firstAttribute="bottom" secondItem="frY-Ma-0oY" secondAttribute="top" id="jS7-o9-gix"/>
<constraint firstItem="nlH-w1-wIP" firstAttribute="top" secondItem="qNB-dz-lSk" secondAttribute="bottom" id="xUZ-Ui-Ous"/>
</constraints>
</view>
<tabBarItem key="tabBarItem" title="Watchlist" image="List" id="6F8-SJ-cH6"/>
<connections>
<outlet property="moviesTableView" destination="nlH-w1-wIP" id="7Ll-cn-T10"/>
</connections>
</viewController>
<placeholder placeholderIdentifier="IBFirstResponder" id="elo-c3-ikF" userLabel="First Responder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="2400" y="475"/>
</scene>
<!--Favorites-->
<scene sceneID="WkE-iS-JbY">
<objects>
<viewController automaticallyAdjustsScrollViewInsets="NO" id="nyU-rg-wox" customClass="FavoritesViewController" customModule="TheMovieManager" customModuleProvider="target" sceneMemberID="viewController">
<layoutGuides>
<viewControllerLayoutGuide type="top" id="LCC-j3-O1k"/>
<viewControllerLayoutGuide type="bottom" id="kcV-Tp-oSj"/>
</layoutGuides>
<view key="view" contentMode="scaleToFill" id="dlB-3a-O7u">
<rect key="frame" x="0.0" y="0.0" width="375" height="667"/>
<autoresizingMask key="autoresizingMask" widthSizable="YES" heightSizable="YES"/>
<subviews>
<tableView clipsSubviews="YES" contentMode="scaleToFill" alwaysBounceVertical="YES" dataMode="prototypes" style="plain" separatorStyle="default" rowHeight="44" sectionHeaderHeight="1" sectionFooterHeight="1" translatesAutoresizingMaskIntoConstraints="NO" id="uYu-ek-mHH">
<rect key="frame" x="0.0" y="64" width="375" height="554"/>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<prototypes>
<tableViewCell contentMode="scaleToFill" selectionStyle="default" indentationWidth="10" reuseIdentifier="FavoriteTableViewCell" id="0P4-Bz-ncf">
<rect key="frame" x="0.0" y="1" width="1000" height="44"/>
<autoresizingMask key="autoresizingMask"/>
<tableViewCellContentView key="contentView" opaque="NO" clipsSubviews="YES" multipleTouchEnabled="YES" contentMode="center" tableViewCell="0P4-Bz-ncf" id="hh2-rb-Thj">
<rect key="frame" x="0.0" y="0.0" width="1000" height="44"/>
<autoresizingMask key="autoresizingMask"/>
</tableViewCellContentView>
</tableViewCell>
</prototypes>
<connections>
<outlet property="dataSource" destination="nyU-rg-wox" id="fml-yv-e8Y"/>
<outlet property="delegate" destination="nyU-rg-wox" id="HN2-Ag-WEh"/>
</connections>
</tableView>
</subviews>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<constraints>
<constraint firstItem="uYu-ek-mHH" firstAttribute="bottom" secondItem="kcV-Tp-oSj" secondAttribute="top" id="Ap7-kC-TJc"/>
<constraint firstItem="uYu-ek-mHH" firstAttribute="leading" secondItem="dlB-3a-O7u" secondAttribute="leading" id="DSQ-QH-0T3"/>
<constraint firstItem="uYu-ek-mHH" firstAttribute="top" secondItem="LCC-j3-O1k" secondAttribute="bottom" id="NGp-Sd-QWH"/>
<constraint firstAttribute="trailing" secondItem="uYu-ek-mHH" secondAttribute="trailing" id="ugI-wX-9uT"/>
</constraints>
</view>
<tabBarItem key="tabBarItem" title="Favorites" image="Favorite" id="t4X-AS-g8M"/>
<connections>
<outlet property="moviesTableView" destination="uYu-ek-mHH" id="VlN-vL-m0r"/>
</connections>
</viewController>
<placeholder placeholderIdentifier="IBFirstResponder" id="33k-GN-iRC" userLabel="First Responder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="2400" y="1221"/>
</scene>
<!--Manager Tab-->
<scene sceneID="xkM-4i-sat">
<objects>
<tabBarController automaticallyAdjustsScrollViewInsets="NO" id="AoF-9E-uwa" userLabel="Manager Tab" sceneMemberID="viewController">
<navigationItem key="navigationItem" title="The Movie Manager" id="779-2I-7NP"/>
<nil key="simulatedBottomBarMetrics"/>
<tabBar key="tabBar" contentMode="scaleToFill" id="kGf-fJ-FKV">
<rect key="frame" x="0.0" y="0.0" width="320" height="49"/>
<autoresizingMask key="autoresizingMask"/>
<color key="backgroundColor" red="0.0" green="0.0" blue="0.0" alpha="0.0" colorSpace="custom" customColorSpace="sRGB"/>
</tabBar>
<connections>
<segue destination="JCr-W7-R9O" kind="relationship" relationship="viewControllers" id="xQy-Ge-PdY"/>
<segue destination="Tb6-sk-v10" kind="relationship" relationship="viewControllers" id="5e4-yZ-FEk"/>
<segue destination="nyU-rg-wox" kind="relationship" relationship="viewControllers" id="aCK-ar-RHd"/>
</connections>
</tabBarController>
<placeholder placeholderIdentifier="IBFirstResponder" id="6w1-cn-r5F" userLabel="First Responder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="1634" y="475"/>
</scene>
<!--Movie Picker-->
<scene sceneID="ef8-sV-IQ7">
<objects>
<viewController automaticallyAdjustsScrollViewInsets="NO" id="JCr-W7-R9O" userLabel="Movie Picker" customClass="MoviePickerViewController" customModule="TheMovieManager" customModuleProvider="target" sceneMemberID="viewController">
<layoutGuides>
<viewControllerLayoutGuide type="top" id="nXG-ab-qmZ"/>
<viewControllerLayoutGuide type="bottom" id="Lfj-rp-eCm"/>
</layoutGuides>
<view key="view" contentMode="scaleToFill" id="9n3-G9-9Vo">
<rect key="frame" x="0.0" y="0.0" width="375" height="667"/>
<autoresizingMask key="autoresizingMask" widthSizable="YES" heightSizable="YES"/>
<subviews>
<searchBar contentMode="redraw" translatesAutoresizingMaskIntoConstraints="NO" id="OV1-u7-N3U">
<rect key="frame" x="0.0" y="64" width="375" height="44"/>
<textInputTraits key="textInputTraits"/>
<connections>
<outlet property="delegate" destination="JCr-W7-R9O" id="c47-8h-t7V"/>
</connections>
</searchBar>
<tableView clipsSubviews="YES" contentMode="scaleToFill" alwaysBounceVertical="YES" dataMode="prototypes" style="plain" separatorStyle="default" rowHeight="44" sectionHeaderHeight="22" sectionFooterHeight="22" translatesAutoresizingMaskIntoConstraints="NO" id="OJJ-hL-Fmw">
<rect key="frame" x="0.0" y="108" width="375" height="510"/>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<prototypes>
<tableViewCell contentMode="scaleToFill" selectionStyle="none" indentationLevel="1" indentationWidth="0.0" reuseIdentifier="MovieSearchCell" id="VAa-UV-18v">
<rect key="frame" x="0.0" y="22" width="375" height="44"/>
<autoresizingMask key="autoresizingMask"/>
<tableViewCellContentView key="contentView" opaque="NO" clipsSubviews="YES" multipleTouchEnabled="YES" contentMode="center" tableViewCell="VAa-UV-18v" id="xrP-g2-xSe">
<rect key="frame" x="0.0" y="0.0" width="375" height="44"/>
<autoresizingMask key="autoresizingMask"/>
</tableViewCellContentView>
</tableViewCell>
</prototypes>
<connections>
<outlet property="dataSource" destination="JCr-W7-R9O" id="inu-my-TtZ"/>
<outlet property="delegate" destination="JCr-W7-R9O" id="dHk-ZI-Wf7"/>
</connections>
</tableView>
</subviews>
<color key="backgroundColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<constraints>
<constraint firstItem="OV1-u7-N3U" firstAttribute="trailing" secondItem="OJJ-hL-Fmw" secondAttribute="trailing" id="5aU-qo-gVZ"/>
<constraint firstItem="OJJ-hL-Fmw" firstAttribute="leading" secondItem="9n3-G9-9Vo" secondAttribute="leading" id="MDG-4r-4gD"/>
<constraint firstItem="OJJ-hL-Fmw" firstAttribute="top" secondItem="OV1-u7-N3U" secondAttribute="bottom" id="MmK-oe-sTx"/>
<constraint firstAttribute="trailing" secondItem="OV1-u7-N3U" secondAttribute="trailing" id="WVj-Wt-6gd"/>
<constraint firstItem="OV1-u7-N3U" firstAttribute="leading" secondItem="OJJ-hL-Fmw" secondAttribute="leading" id="Yi9-MR-mLE"/>
<constraint firstItem="OJJ-hL-Fmw" firstAttribute="bottom" secondItem="Lfj-rp-eCm" secondAttribute="top" id="hrG-2P-Hgh"/>
<constraint firstItem="OV1-u7-N3U" firstAttribute="top" secondItem="nXG-ab-qmZ" secondAttribute="bottom" id="tq9-gq-81i"/>
</constraints>
</view>
<tabBarItem key="tabBarItem" title="Movies" image="Genre" id="jkb-3U-uCD"/>
<connections>
<outlet property="movieSearchBar" destination="OV1-u7-N3U" id="Uoe-2a-WbK"/>
<outlet property="movieTableView" destination="OJJ-hL-Fmw" id="s1v-zX-Odn"/>
</connections>
</viewController>
<placeholder placeholderIdentifier="IBFirstResponder" id="mfn-mq-dkd" userLabel="First Responder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="2400" y="-197"/>
</scene>
<!--Login-->
<scene sceneID="29p-Fc-zeb">
<objects>
<viewController id="72f-zb-tFC" userLabel="Login" customClass="LoginViewController" customModule="TheMovieManager" customModuleProvider="target" sceneMemberID="viewController">
<layoutGuides>
<viewControllerLayoutGuide type="top" id="h47-w5-PVr"/>
<viewControllerLayoutGuide type="bottom" id="Bsd-5A-POu"/>
</layoutGuides>
<view key="view" contentMode="scaleToFill" id="Mku-g0-UUH">
<rect key="frame" x="0.0" y="0.0" width="375" height="667"/>
<autoresizingMask key="autoresizingMask" widthSizable="YES" heightSizable="YES"/>
<subviews>
<stackView opaque="NO" contentMode="scaleToFill" axis="vertical" spacing="10" translatesAutoresizingMaskIntoConstraints="NO" id="Qpz-rr-ekX">
<rect key="frame" x="16" y="55" width="343" height="594"/>
<subviews>
<imageView userInteractionEnabled="NO" contentMode="scaleAspectFit" horizontalHuggingPriority="251" verticalHuggingPriority="251" image="Camera" translatesAutoresizingMaskIntoConstraints="NO" id="SgR-8a-OFB">
<rect key="frame" x="0.0" y="0.0" width="343" height="100"/>
<constraints>
<constraint firstAttribute="height" constant="100" id="Fyy-fD-6ZT"/>
</constraints>
</imageView>
<label opaque="NO" userInteractionEnabled="NO" contentMode="left" horizontalHuggingPriority="251" verticalHuggingPriority="248" text="The Movie Manager" textAlignment="center" lineBreakMode="tailTruncation" baselineAdjustment="alignBaselines" adjustsFontSizeToFit="NO" translatesAutoresizingMaskIntoConstraints="NO" id="fqC-Zd-KDg">
<rect key="frame" x="0.0" y="110" width="343" height="40"/>
<constraints>
<constraint firstAttribute="height" constant="40" id="a6V-o4-Ynj"/>
</constraints>
<fontDescription key="fontDescription" type="system" pointSize="24"/>
<color key="textColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<nil key="highlightedColor"/>
</label>
<button opaque="NO" contentMode="scaleToFill" horizontalHuggingPriority="251" verticalHuggingPriority="249" contentHorizontalAlignment="center" contentVerticalAlignment="center" lineBreakMode="middleTruncation" translatesAutoresizingMaskIntoConstraints="NO" id="PGO-lE-WFI" customClass="BorderedButton" customModule="TheMovieManager" customModuleProvider="target">
<rect key="frame" x="0.0" y="160" width="343" height="44"/>
<constraints>
<constraint firstAttribute="height" constant="44" id="1ZV-L9-WJK"/>
</constraints>
<state key="normal" title="Authenticate with TheMovieDB">
<color key="titleShadowColor" red="0.5" green="0.5" blue="0.5" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
</state>
<connections>
<action selector="loginPressed:" destination="72f-zb-tFC" eventType="touchUpInside" id="V0h-Am-6k2"/>
</connections>
</button>
<label opaque="NO" userInteractionEnabled="NO" contentMode="left" horizontalHuggingPriority="251" verticalHuggingPriority="251" text="" textAlignment="center" lineBreakMode="wordWrap" numberOfLines="0" baselineAdjustment="alignBaselines" adjustsFontSizeToFit="NO" translatesAutoresizingMaskIntoConstraints="NO" id="1Np-P3-PqF">
<rect key="frame" x="0.0" y="214" width="343" height="380"/>
<fontDescription key="fontDescription" type="system" pointSize="17"/>
<color key="textColor" red="1" green="1" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<nil key="highlightedColor"/>
</label>
</subviews>
</stackView>
</subviews>
<color key="backgroundColor" red="0.35070900710000003" green="0.79530321839999996" blue="1" alpha="1" colorSpace="custom" customColorSpace="sRGB"/>
<gestureRecognizers/>
<constraints>
<constraint firstItem="Qpz-rr-ekX" firstAttribute="top" secondItem="h47-w5-PVr" secondAttribute="bottom" constant="35" id="EKZ-L5-QRq"/>
<constraint firstAttribute="bottomMargin" secondItem="Qpz-rr-ekX" secondAttribute="bottom" constant="18" id="K4C-41-yYa"/>
<constraint firstAttribute="trailingMargin" secondItem="Qpz-rr-ekX" secondAttribute="trailing" id="cxP-23-EKf"/>
<constraint firstItem="Qpz-rr-ekX" firstAttribute="leading" secondItem="Mku-g0-UUH" secondAttribute="leadingMargin" id="gFX-wQ-WJt"/>
</constraints>
<connections>
<outletCollection property="gestureRecognizers" destination="RyX-Kq-HJW" appends="YES" id="pyR-KA-Ixf"/>
</connections>
</view>
<connections>
<outlet property="debugTextLabel" destination="1Np-P3-PqF" id="o6s-Ix-2ud"/>
<outlet property="loginButton" destination="PGO-lE-WFI" id="cde-06-1ax"/>
</connections>
</viewController>
<placeholder placeholderIdentifier="IBFirstResponder" id="bVM-SC-zSQ" sceneMemberID="firstResponder"/>
<tapGestureRecognizer id="RyX-Kq-HJW"/>
</objects>
<point key="canvasLocation" x="155" y="475"/>
</scene>
</scenes>
<resources>
<image name="Camera" width="64" height="64"/>
<image name="Favorite" width="32" height="32"/>
<image name="Genre" width="30" height="30"/>
<image name="List" width="32" height="32"/>
</resources>
</document>
| 85.266833 | 400 | 0.536441 |
e5c804c6976f05c7d689779f14be1e052ecc9e03 | 4,540 | xml | XML | ArthikaHFT/app/src/main/res/values/strings.xml | Arthika/REST-API-Android | 855d5ff26d5218f402133b0221cc26751409dec7 | [
"MIT"
] | null | null | null | ArthikaHFT/app/src/main/res/values/strings.xml | Arthika/REST-API-Android | 855d5ff26d5218f402133b0221cc26751409dec7 | [
"MIT"
] | null | null | null | ArthikaHFT/app/src/main/res/values/strings.xml | Arthika/REST-API-Android | 855d5ff26d5218f402133b0221cc26751409dec7 | [
"MIT"
] | null | null | null | <resources>
<string name="app_name">ArthikaHFT</string>
<string name="hello_world">Hello world!</string>
<string name="action_settings">Settings</string>
<string name="prices">Prices</string>
<string name="orders">Orders</string>
<string name="positions">Positions</string>
<string name="start">Start</string>
<string name="stop">Stop</string>
<string name="select_amount">Select Amount: </string>
<string name="select_type">Select Order Type: </string>
<string name="select_validity">Select Validity: </string>
<string name="select_ti">Select TI: </string>
<string name="select_price">Select Price: </string>
<string name="select_account">Select Account: </string>
<string name="pending_orders">Pending Orders</string>
<string name="closed_orders">Closed Orders</string>
<string name="accounting">Accounting</string>
<string name="show_equity">Show Equity</string>
<string name="equity">Equity</string>
<string name="pool_equity">Pool Equity</string>
<string name="strategy_equity">Strategy Equity</string>
<string name="swap">Swap</string>
<string name="cash">Cash</string>
<string name="security">Security</string>
<string name="modify">Modify</string>
<string name="info">Info</string>
<string name="clear">Clear</string>
<string name="cancel_all">Cancel All</string>
<string name="cancel">Cancel</string>
<string name="close">Close</string>
<string name="close_all">Close All</string>
<string name="ok">OK</string>
<string name="yes">Yes</string>
<string name="no">No</string>
<string name="select_new_amount">Select New Amount: </string>
<string name="select_new_price">Select New Price: </string>
<string name="select_domain">Select Domain: </string>
<string name="select_interval">Streaming Interval (ms): </string>
<string name="select_securities">Select Securities: </string>
<string name="strategy">Strategy: </string>
<string name="password">Password: </string>
<string name="domain">Domain: </string>
<string name="getting_prices">Getting prices</string>
<string name="streaming_stopped">Streaming stopped</string>
<string name="click_start">Click \'Start\' for streaming</string>
<string name="conection_message">"Can not connect to the strategy\nPlease verify your connection settings and internet connection"</string>
<string name="cancel_order_message1">Do you want to cancel order</string>
<string name="cancel_all_orders_message">Do you want to cancel ALL orders?</string>
<string name="close_all_positions_message">Do you want to close ALL positions?</string>
<string name="close_positions_message">Do you want to close positions for</string>
<string name="at">at</string>
<string name="in">in</string>
<string name="position_info_security">Security</string>
<string name="position_info_position">Position</string>
<string name="position_info_side">Side</string>
<string name="position_info_pl">P&L</string>
<string name="position_info_closepositions">Close pos.</string>
<string name="position_info_currency">Currency</string>
<string name="position_info_exposure">Exposure</string>
<string name="position_info_totalrisk">Total Risk</string>
<string name="position_info_strategypl">Strategy PL</string>
<string name="position_info_totalequity">Total equity</string>
<string name="position_info_usedmargin">Used margin</string>
<string name="position_info_freemarginy">Free margin</string>
<string name="order_info">Order Info</string>
<string name="order_info_orderid">OrderId</string>
<string name="order_info_fixid">FixId</string>
<string name="order_info_tinterface">TInterface</string>
<string name="order_info_security">Security</string>
<string name="order_info_quantity">Quantity</string>
<string name="order_info_limitprice">Limit price</string>
<string name="order_info_side">Side</string>
<string name="order_info_type">Type</string>
<string name="order_info_finishedprice">Finished price</string>
<string name="order_info_finishedquantity">Finished quantity</string>
<string name="order_info_commission">Commission</string>
<string name="order_info_status">Status</string>
<string name="order_info_price">Price</string>
<string name="click_chart">Click to chart</string>
<string name="click_buy">Click to buy</string>
<string name="click_sell">Click to sell</string>
</resources>
| 54.047619 | 143 | 0.721806 |
66178cb6916fd591cf60901e5b12e8eb15210e59 | 696 | xml | XML | billeder/ProcessedSVG/Cloud_svg.xml | phigne/RobTekAndroidProject | 63fb874fde1b0a03c3c1f20f1b07d647f29ff40b | [
"MIT"
] | null | null | null | billeder/ProcessedSVG/Cloud_svg.xml | phigne/RobTekAndroidProject | 63fb874fde1b0a03c3c1f20f1b07d647f29ff40b | [
"MIT"
] | null | null | null | billeder/ProcessedSVG/Cloud_svg.xml | phigne/RobTekAndroidProject | 63fb874fde1b0a03c3c1f20f1b07d647f29ff40b | [
"MIT"
] | null | null | null | <vector xmlns:android="http://schemas.android.com/apk/res/android"
android:width="100dp"
android:height="100dp"
android:viewportWidth="100.0"
android:viewportHeight="100.0">
<path
android:fillColor="#FF000000"
android:pathData="M43.94,65.64c-8.84,0 -16,-7.16 -16,-16c0,-8.84 7.16,-16 16,-16c6,0 11.23,3.31 13.97,8.2c0.66,-0.11 1.34,-0.2 2.03,-0.2c6.63,0 12,5.37 12,12c0,6.63 -5.37,12 -12,12C57.17,65.64 47.14,65.64 43.94,65.64zM59.94,61.64c4.42,0 8,-3.58 8,-8c0,-4.42 -3.58,-8 -8,-8c-1.6,0 -3.08,0.48 -4.33,1.29c-1.23,-5.32 -5.97,-9.29 -11.66,-9.29c-6.63,0 -12,5.37 -12,12c0,6.63 5.37,12 12,12C47.56,61.64 56.92,61.64 59.94,61.64z"/>
</vector>
| 69.6 | 431 | 0.617816 |
068791495b58a4b7a8e01de873646ec3c38511bf | 1,101 | xml | XML | .idea/modules.xml | eviatar75/M1_JavaQuarkus | ffb7e4268da7fa416f573a5443c40a7b156362a0 | [
"MIT"
] | null | null | null | .idea/modules.xml | eviatar75/M1_JavaQuarkus | ffb7e4268da7fa416f573a5443c40a7b156362a0 | [
"MIT"
] | 1 | 2021-12-07T22:40:46.000Z | 2021-12-07T22:40:46.000Z | .idea/modules.xml | eviatar75/M1_JavaQuarkus | ffb7e4268da7fa416f573a5443c40a7b156362a0 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<project version="4">
<component name="ProjectModuleManager">
<modules>
<module fileurl="file://$PROJECT_DIR$/.idea/M1_JavaQuarkus.iml" filepath="$PROJECT_DIR$/.idea/M1_JavaQuarkus.iml" />
<module fileurl="file://$PROJECT_DIR$/land_publication_service/land_publication_service.iml" filepath="$PROJECT_DIR$/land_publication_service/land_publication_service.iml" />
<module fileurl="file://$PROJECT_DIR$/notary/notary.iml" filepath="$PROJECT_DIR$/notary/notary.iml" />
<module fileurl="file://$PROJECT_DIR$/verification_service_2/verification_service_2.iml" filepath="$PROJECT_DIR$/verification_service_2/verification_service_2.iml" />
<module fileurl="file://$PROJECT_DIR$/verification_service_3/verification_service_3.iml" filepath="$PROJECT_DIR$/verification_service_3/verification_service_3.iml" />
<module fileurl="file://$PROJECT_DIR$/verification_service_4/verification_service_4.iml" filepath="$PROJECT_DIR$/verification_service_4/verification_service_4.iml" />
</modules>
</component>
</project> | 84.692308 | 181 | 0.762943 |
a3f521c10c9eddba6305d5cb2d1b8ff27c211844 | 331 | xml | XML | cat-home/src/test/resources/config/test-minute-monitor.xml | woozhijun/cat | 3d523202c38e37b1a2244b26d4336ebbea5db001 | [
"Apache-2.0"
] | 17,318 | 2015-01-03T03:02:07.000Z | 2022-03-31T02:43:28.000Z | cat-home/src/test/resources/config/test-minute-monitor.xml | MrCoderYu/cat | 674bd9ab70267dd6fc74879e4344af77397f4acd | [
"Apache-2.0"
] | 1,162 | 2015-01-04T08:23:49.000Z | 2022-03-31T15:38:04.000Z | cat-home/src/test/resources/config/test-minute-monitor.xml | MrCoderYu/cat | 674bd9ab70267dd6fc74879e4344af77397f4acd | [
"Apache-2.0"
] | 5,520 | 2015-01-03T03:02:07.000Z | 2022-03-31T16:16:56.000Z | <monitor-rules>
<rule id="two-minute">
<config starttime="00:00" endtime="24:00">
<condition minute="2">
<sub-condition type="DescPer" text="40"></sub-condition>
</condition>
<condition minute="2">
<sub-condition type="DescVal" text="80"></sub-condition>
</condition>
</config>
</rule>
</monitor-rules>
| 25.461538 | 61 | 0.637462 |
ee2a4f14b18d85e89f125159638b6f6e520538cb | 43,805 | xml | XML | misc/iam-online-handwriting-database/lineStrokes/k06/k06-499/k06-499z-01.xml | tedhuang96/pytorch-tvmisc | f36d2f07dd04e87b5ec5f2df20fcea96ec4d2022 | [
"MIT"
] | null | null | null | misc/iam-online-handwriting-database/lineStrokes/k06/k06-499/k06-499z-01.xml | tedhuang96/pytorch-tvmisc | f36d2f07dd04e87b5ec5f2df20fcea96ec4d2022 | [
"MIT"
] | null | null | null | misc/iam-online-handwriting-database/lineStrokes/k06/k06-499/k06-499z-01.xml | tedhuang96/pytorch-tvmisc | f36d2f07dd04e87b5ec5f2df20fcea96ec4d2022 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="ISO-8859-1"?>
<WhiteboardCaptureSession>
<WhiteboardDescription>
<SensorLocation corner="top_left"/>
<DiagonallyOppositeCoords x="6686" y="1348"/>
<VerticallyOppositeCoords x="778" y="1348"/>
<HorizontallyOppositeCoords x="6686" y="689"/>
</WhiteboardDescription>
<StrokeSet>
<Stroke colour="black" start_time="14820277.52" end_time="14820278.06">
<Point x="950" y="983" time="14820277.52"/>
<Point x="965" y="1001" time="14820277.54"/>
<Point x="958" y="992" time="14820277.55"/>
<Point x="955" y="987" time="14820277.57"/>
<Point x="947" y="982" time="14820277.58"/>
<Point x="936" y="977" time="14820277.60"/>
<Point x="910" y="960" time="14820277.61"/>
<Point x="893" y="960" time="14820277.62"/>
<Point x="881" y="977" time="14820277.64"/>
<Point x="854" y="982" time="14820277.66"/>
<Point x="828" y="996" time="14820277.67"/>
<Point x="810" y="1015" time="14820277.68"/>
<Point x="785" y="1020" time="14820277.70"/>
<Point x="782" y="1048" time="14820277.72"/>
<Point x="778" y="1064" time="14820277.73"/>
<Point x="787" y="1084" time="14820277.74"/>
<Point x="803" y="1101" time="14820277.76"/>
<Point x="825" y="1115" time="14820277.78"/>
<Point x="856" y="1136" time="14820277.79"/>
<Point x="880" y="1149" time="14820277.80"/>
<Point x="906" y="1170" time="14820277.82"/>
<Point x="924" y="1193" time="14820277.84"/>
<Point x="931" y="1218" time="14820277.85"/>
<Point x="928" y="1247" time="14820277.86"/>
<Point x="916" y="1277" time="14820277.88"/>
<Point x="894" y="1298" time="14820277.90"/>
<Point x="872" y="1323" time="14820277.91"/>
<Point x="848" y="1339" time="14820277.92"/>
<Point x="827" y="1346" time="14820277.94"/>
<Point x="811" y="1347" time="14820277.96"/>
<Point x="801" y="1348" time="14820277.97"/>
<Point x="793" y="1342" time="14820277.98"/>
<Point x="791" y="1338" time="14820278.00"/>
<Point x="789" y="1329" time="14820278.01"/>
<Point x="790" y="1317" time="14820278.03"/>
<Point x="803" y="1317" time="14820278.04"/>
<Point x="822" y="1313" time="14820278.06"/>
</Stroke>
<Stroke colour="black" start_time="14820278.22" end_time="14820278.88">
<Point x="1054" y="1042" time="14820278.22"/>
<Point x="1061" y="1037" time="14820278.24"/>
<Point x="1060" y="1033" time="14820278.25"/>
<Point x="1056" y="1030" time="14820278.27"/>
<Point x="1061" y="1034" time="14820278.28"/>
<Point x="1058" y="1034" time="14820278.30"/>
<Point x="1061" y="1041" time="14820278.31"/>
<Point x="1056" y="1054" time="14820278.33"/>
<Point x="1056" y="1081" time="14820278.34"/>
<Point x="1054" y="1113" time="14820278.36"/>
<Point x="1049" y="1144" time="14820278.37"/>
<Point x="1044" y="1176" time="14820278.39"/>
<Point x="1047" y="1212" time="14820278.40"/>
<Point x="1047" y="1240" time="14820278.41"/>
<Point x="1044" y="1257" time="14820278.43"/>
<Point x="1047" y="1269" time="14820278.45"/>
<Point x="1048" y="1273" time="14820278.46"/>
<Point x="1049" y="1272" time="14820278.47"/>
<Point x="1049" y="1273" time="14820278.49"/>
<Point x="1049" y="1269" time="14820278.51"/>
<Point x="1042" y="1252" time="14820278.52"/>
<Point x="1038" y="1236" time="14820278.53"/>
<Point x="1030" y="1216" time="14820278.55"/>
<Point x="1019" y="1192" time="14820278.57"/>
<Point x="1013" y="1175" time="14820278.58"/>
<Point x="1007" y="1158" time="14820278.59"/>
<Point x="1000" y="1141" time="14820278.61"/>
<Point x="1001" y="1138" time="14820278.63"/>
<Point x="1003" y="1138" time="14820278.64"/>
<Point x="1006" y="1138" time="14820278.65"/>
<Point x="1020" y="1151" time="14820278.67"/>
<Point x="1035" y="1168" time="14820278.68"/>
<Point x="1052" y="1189" time="14820278.70"/>
<Point x="1071" y="1213" time="14820278.71"/>
<Point x="1090" y="1237" time="14820278.73"/>
<Point x="1102" y="1249" time="14820278.74"/>
<Point x="1121" y="1264" time="14820278.76"/>
<Point x="1127" y="1260" time="14820278.77"/>
<Point x="1140" y="1252" time="14820278.79"/>
<Point x="1159" y="1234" time="14820278.80"/>
<Point x="1166" y="1197" time="14820278.82"/>
<Point x="1177" y="1165" time="14820278.83"/>
<Point x="1182" y="1124" time="14820278.85"/>
<Point x="1192" y="1095" time="14820278.86"/>
<Point x="1192" y="1066" time="14820278.88"/>
</Stroke>
<Stroke colour="black" start_time="14820279.07" end_time="14820279.55">
<Point x="1269" y="1188" time="14820279.07"/>
<Point x="1272" y="1187" time="14820279.09"/>
<Point x="1290" y="1192" time="14820279.11"/>
<Point x="1299" y="1186" time="14820279.12"/>
<Point x="1319" y="1186" time="14820279.14"/>
<Point x="1336" y="1177" time="14820279.15"/>
<Point x="1350" y="1166" time="14820279.17"/>
<Point x="1366" y="1153" time="14820279.19"/>
<Point x="1382" y="1139" time="14820279.20"/>
<Point x="1393" y="1123" time="14820279.21"/>
<Point x="1397" y="1105" time="14820279.23"/>
<Point x="1399" y="1092" time="14820279.24"/>
<Point x="1383" y="1076" time="14820279.27"/>
<Point x="1360" y="1067" time="14820279.27"/>
<Point x="1338" y="1069" time="14820279.29"/>
<Point x="1308" y="1078" time="14820279.30"/>
<Point x="1279" y="1093" time="14820279.32"/>
<Point x="1259" y="1117" time="14820279.33"/>
<Point x="1247" y="1143" time="14820279.35"/>
<Point x="1242" y="1168" time="14820279.36"/>
<Point x="1252" y="1195" time="14820279.38"/>
<Point x="1268" y="1217" time="14820279.39"/>
<Point x="1286" y="1230" time="14820279.41"/>
<Point x="1312" y="1240" time="14820279.42"/>
<Point x="1339" y="1242" time="14820279.44"/>
<Point x="1363" y="1237" time="14820279.45"/>
<Point x="1384" y="1227" time="14820279.47"/>
<Point x="1401" y="1213" time="14820279.48"/>
<Point x="1418" y="1199" time="14820279.49"/>
<Point x="1433" y="1186" time="14820279.51"/>
<Point x="1452" y="1175" time="14820279.53"/>
<Point x="1464" y="1166" time="14820279.54"/>
<Point x="1476" y="1157" time="14820279.55"/>
</Stroke>
<Stroke colour="black" start_time="14820279.73" end_time="14820279.98">
<Point x="1743" y="902" time="14820279.73"/>
<Point x="1748" y="904" time="14820279.75"/>
<Point x="1749" y="907" time="14820279.77"/>
<Point x="1758" y="921" time="14820279.78"/>
<Point x="1761" y="940" time="14820279.80"/>
<Point x="1765" y="963" time="14820279.81"/>
<Point x="1771" y="994" time="14820279.83"/>
<Point x="1770" y="1026" time="14820279.84"/>
<Point x="1780" y="1064" time="14820279.86"/>
<Point x="1779" y="1095" time="14820279.87"/>
<Point x="1786" y="1124" time="14820279.89"/>
<Point x="1791" y="1146" time="14820279.90"/>
<Point x="1795" y="1163" time="14820279.92"/>
<Point x="1797" y="1175" time="14820279.93"/>
<Point x="1793" y="1184" time="14820279.95"/>
<Point x="1790" y="1191" time="14820279.96"/>
<Point x="1783" y="1191" time="14820279.98"/>
</Stroke>
<Stroke colour="black" start_time="14820280.08" end_time="14820280.20">
<Point x="1711" y="1075" time="14820280.08"/>
<Point x="1712" y="1074" time="14820280.10"/>
<Point x="1719" y="1074" time="14820280.12"/>
<Point x="1722" y="1072" time="14820280.13"/>
<Point x="1731" y="1061" time="14820280.15"/>
<Point x="1753" y="1050" time="14820280.16"/>
<Point x="1775" y="1038" time="14820280.18"/>
<Point x="1800" y="1027" time="14820280.19"/>
<Point x="1822" y="1019" time="14820280.20"/>
</Stroke>
<Stroke colour="black" start_time="14820280.41" end_time="14820280.83">
<Point x="2001" y="1052" time="14820280.41"/>
<Point x="1997" y="1051" time="14820280.42"/>
<Point x="1995" y="1047" time="14820280.44"/>
<Point x="1981" y="1039" time="14820280.46"/>
<Point x="1975" y="1035" time="14820280.47"/>
<Point x="1962" y="1030" time="14820280.49"/>
<Point x="1944" y="1026" time="14820280.50"/>
<Point x="1926" y="1027" time="14820280.52"/>
<Point x="1908" y="1032" time="14820280.53"/>
<Point x="1896" y="1044" time="14820280.55"/>
<Point x="1880" y="1059" time="14820280.56"/>
<Point x="1864" y="1078" time="14820280.58"/>
<Point x="1857" y="1104" time="14820280.59"/>
<Point x="1856" y="1126" time="14820280.60"/>
<Point x="1863" y="1146" time="14820280.62"/>
<Point x="1870" y="1156" time="14820280.64"/>
<Point x="1887" y="1163" time="14820280.65"/>
<Point x="1911" y="1163" time="14820280.66"/>
<Point x="1934" y="1155" time="14820280.68"/>
<Point x="1952" y="1139" time="14820280.69"/>
<Point x="1971" y="1122" time="14820280.71"/>
<Point x="1988" y="1100" time="14820280.72"/>
<Point x="2002" y="1081" time="14820280.74"/>
<Point x="2004" y="1062" time="14820280.75"/>
<Point x="2001" y="1047" time="14820280.77"/>
<Point x="1993" y="1037" time="14820280.78"/>
<Point x="1990" y="1035" time="14820280.80"/>
<Point x="1983" y="1037" time="14820280.82"/>
<Point x="1986" y="1046" time="14820280.83"/>
</Stroke>
<Stroke colour="black" start_time="14820281.00" end_time="14820281.42">
<Point x="2190" y="1023" time="14820281.00"/>
<Point x="2191" y="1022" time="14820281.02"/>
<Point x="2187" y="1020" time="14820281.04"/>
<Point x="2178" y="1020" time="14820281.05"/>
<Point x="2163" y="1019" time="14820281.06"/>
<Point x="2146" y="1020" time="14820281.08"/>
<Point x="2126" y="1026" time="14820281.09"/>
<Point x="2108" y="1036" time="14820281.11"/>
<Point x="2087" y="1049" time="14820281.12"/>
<Point x="2072" y="1064" time="14820281.13"/>
<Point x="2063" y="1081" time="14820281.15"/>
<Point x="2058" y="1097" time="14820281.17"/>
<Point x="2058" y="1115" time="14820281.18"/>
<Point x="2062" y="1134" time="14820281.19"/>
<Point x="2075" y="1150" time="14820281.21"/>
<Point x="2093" y="1160" time="14820281.23"/>
<Point x="2112" y="1162" time="14820281.24"/>
<Point x="2128" y="1157" time="14820281.25"/>
<Point x="2145" y="1145" time="14820281.27"/>
<Point x="2164" y="1129" time="14820281.29"/>
<Point x="2170" y="1105" time="14820281.30"/>
<Point x="2174" y="1082" time="14820281.32"/>
<Point x="2175" y="1062" time="14820281.33"/>
<Point x="2171" y="1047" time="14820281.35"/>
<Point x="2160" y="1036" time="14820281.36"/>
<Point x="2151" y="1028" time="14820281.38"/>
<Point x="2147" y="1026" time="14820281.39"/>
<Point x="2142" y="1025" time="14820281.41"/>
<Point x="2142" y="1026" time="14820281.42"/>
</Stroke>
<Stroke colour="black" start_time="14820281.57" end_time="14820281.87">
<Point x="2301" y="880" time="14820281.57"/>
<Point x="2301" y="879" time="14820281.58"/>
<Point x="2302" y="878" time="14820281.59"/>
<Point x="2301" y="879" time="14820281.61"/>
<Point x="2301" y="886" time="14820281.63"/>
<Point x="2306" y="902" time="14820281.64"/>
<Point x="2308" y="924" time="14820281.65"/>
<Point x="2306" y="948" time="14820281.67"/>
<Point x="2301" y="978" time="14820281.69"/>
<Point x="2300" y="1008" time="14820281.70"/>
<Point x="2301" y="1035" time="14820281.71"/>
<Point x="2299" y="1059" time="14820281.73"/>
<Point x="2298" y="1079" time="14820281.75"/>
<Point x="2300" y="1097" time="14820281.76"/>
<Point x="2300" y="1109" time="14820281.77"/>
<Point x="2298" y="1119" time="14820281.79"/>
<Point x="2298" y="1126" time="14820281.80"/>
<Point x="2294" y="1131" time="14820281.82"/>
<Point x="2286" y="1135" time="14820281.83"/>
<Point x="2289" y="1136" time="14820281.85"/>
<Point x="2288" y="1126" time="14820281.87"/>
</Stroke>
<Stroke colour="black" start_time="14820281.97" end_time="14820282.55">
<Point x="2434" y="992" time="14820281.97"/>
<Point x="2448" y="984" time="14820281.98"/>
<Point x="2455" y="980" time="14820282.00"/>
<Point x="2456" y="981" time="14820282.01"/>
<Point x="2450" y="981" time="14820282.03"/>
<Point x="2429" y="984" time="14820282.04"/>
<Point x="2401" y="993" time="14820282.06"/>
<Point x="2371" y="1003" time="14820282.07"/>
<Point x="2342" y="1016" time="14820282.09"/>
<Point x="2312" y="1025" time="14820282.10"/>
<Point x="2297" y="1033" time="14820282.12"/>
<Point x="2291" y="1035" time="14820282.13"/>
<Point x="2290" y="1036" time="14820282.15"/>
<Point x="2291" y="1035" time="14820282.16"/>
<Point x="2300" y="1036" time="14820282.18"/>
<Point x="2323" y="1039" time="14820282.19"/>
<Point x="2345" y="1040" time="14820282.21"/>
<Point x="2376" y="1044" time="14820282.22"/>
<Point x="2403" y="1049" time="14820282.23"/>
<Point x="2427" y="1056" time="14820282.25"/>
<Point x="2441" y="1063" time="14820282.27"/>
<Point x="2456" y="1070" time="14820282.28"/>
<Point x="2462" y="1075" time="14820282.29"/>
<Point x="2469" y="1079" time="14820282.31"/>
<Point x="2468" y="1080" time="14820282.33"/>
<Point x="2468" y="1081" time="14820282.34"/>
<Point x="2468" y="1080" time="14820282.35"/>
<Point x="2468" y="1080" time="14820282.37"/>
<Point x="2465" y="1078" time="14820282.39"/>
<Point x="2466" y="1077" time="14820282.40"/>
<Point x="2466" y="1076" time="14820282.41"/>
<Point x="2467" y="1076" time="14820282.43"/>
<Point x="2467" y="1076" time="14820282.45"/>
<Point x="2467" y="1076" time="14820282.46"/>
<Point x="2467" y="1076" time="14820282.48"/>
<Point x="2470" y="1076" time="14820282.49"/>
<Point x="2471" y="1077" time="14820282.50"/>
<Point x="2470" y="1078" time="14820282.52"/>
<Point x="2469" y="1079" time="14820282.53"/>
<Point x="2468" y="1081" time="14820282.55"/>
</Stroke>
<Stroke colour="black" start_time="14820283.38" end_time="14820283.93">
<Point x="2917" y="1003" time="14820283.38"/>
<Point x="2913" y="1001" time="14820283.40"/>
<Point x="2911" y="995" time="14820283.42"/>
<Point x="2912" y="986" time="14820283.43"/>
<Point x="2917" y="973" time="14820283.46"/>
<Point x="2936" y="958" time="14820283.47"/>
<Point x="2955" y="945" time="14820283.49"/>
<Point x="2975" y="938" time="14820283.50"/>
<Point x="2994" y="935" time="14820283.51"/>
<Point x="3009" y="938" time="14820283.53"/>
<Point x="3016" y="944" time="14820283.55"/>
<Point x="3020" y="954" time="14820283.56"/>
<Point x="3018" y="970" time="14820283.57"/>
<Point x="3006" y="988" time="14820283.59"/>
<Point x="2988" y="1010" time="14820283.61"/>
<Point x="2963" y="1036" time="14820283.62"/>
<Point x="2938" y="1059" time="14820283.63"/>
<Point x="2912" y="1079" time="14820283.65"/>
<Point x="2891" y="1093" time="14820283.67"/>
<Point x="2874" y="1098" time="14820283.68"/>
<Point x="2861" y="1098" time="14820283.69"/>
<Point x="2860" y="1093" time="14820283.71"/>
<Point x="2857" y="1080" time="14820283.73"/>
<Point x="2865" y="1064" time="14820283.74"/>
<Point x="2877" y="1049" time="14820283.75"/>
<Point x="2895" y="1039" time="14820283.77"/>
<Point x="2919" y="1035" time="14820283.79"/>
<Point x="2941" y="1037" time="14820283.80"/>
<Point x="2960" y="1044" time="14820283.81"/>
<Point x="2976" y="1054" time="14820283.83"/>
<Point x="2988" y="1068" time="14820283.84"/>
<Point x="2999" y="1083" time="14820283.86"/>
<Point x="3008" y="1099" time="14820283.87"/>
<Point x="3016" y="1112" time="14820283.89"/>
<Point x="3020" y="1122" time="14820283.90"/>
<Point x="3021" y="1128" time="14820283.92"/>
<Point x="3030" y="1128" time="14820283.93"/>
</Stroke>
<Stroke colour="black" start_time="14820284.13" end_time="14820284.73">
<Point x="3440" y="970" time="14820284.13"/>
<Point x="3441" y="968" time="14820284.15"/>
<Point x="3437" y="958" time="14820284.16"/>
<Point x="3432" y="946" time="14820284.18"/>
<Point x="3415" y="935" time="14820284.19"/>
<Point x="3396" y="927" time="14820284.21"/>
<Point x="3380" y="924" time="14820284.22"/>
<Point x="3358" y="926" time="14820284.24"/>
<Point x="3339" y="934" time="14820284.25"/>
<Point x="3329" y="952" time="14820284.27"/>
<Point x="3313" y="975" time="14820284.28"/>
<Point x="3306" y="1003" time="14820284.30"/>
<Point x="3308" y="1032" time="14820284.31"/>
<Point x="3310" y="1059" time="14820284.33"/>
<Point x="3315" y="1079" time="14820284.34"/>
<Point x="3334" y="1095" time="14820284.36"/>
<Point x="3350" y="1099" time="14820284.37"/>
<Point x="3368" y="1097" time="14820284.39"/>
<Point x="3385" y="1086" time="14820284.40"/>
<Point x="3395" y="1063" time="14820284.42"/>
<Point x="3407" y="1030" time="14820284.43"/>
<Point x="3417" y="991" time="14820284.45"/>
<Point x="3426" y="950" time="14820284.46"/>
<Point x="3433" y="915" time="14820284.48"/>
<Point x="3432" y="881" time="14820284.49"/>
<Point x="3432" y="851" time="14820284.50"/>
<Point x="3431" y="827" time="14820284.52"/>
<Point x="3439" y="812" time="14820284.54"/>
<Point x="3440" y="808" time="14820284.55"/>
<Point x="3445" y="808" time="14820284.56"/>
<Point x="3444" y="810" time="14820284.58"/>
<Point x="3448" y="824" time="14820284.60"/>
<Point x="3457" y="850" time="14820284.61"/>
<Point x="3460" y="883" time="14820284.62"/>
<Point x="3462" y="921" time="14820284.64"/>
<Point x="3465" y="961" time="14820284.66"/>
<Point x="3470" y="997" time="14820284.67"/>
<Point x="3472" y="1027" time="14820284.68"/>
<Point x="3475" y="1052" time="14820284.70"/>
<Point x="3477" y="1071" time="14820284.72"/>
<Point x="3481" y="1082" time="14820284.73"/>
</Stroke>
<Stroke colour="black" start_time="14820284.85" end_time="14820285.27">
<Point x="3571" y="1011" time="14820284.85"/>
<Point x="3571" y="1011" time="14820284.86"/>
<Point x="3573" y="1014" time="14820284.88"/>
<Point x="3580" y="1020" time="14820284.89"/>
<Point x="3592" y="1022" time="14820284.91"/>
<Point x="3602" y="1020" time="14820284.92"/>
<Point x="3619" y="1016" time="14820284.94"/>
<Point x="3631" y="1006" time="14820284.95"/>
<Point x="3644" y="993" time="14820284.97"/>
<Point x="3649" y="978" time="14820284.98"/>
<Point x="3650" y="958" time="14820285.00"/>
<Point x="3639" y="940" time="14820285.01"/>
<Point x="3626" y="932" time="14820285.03"/>
<Point x="3604" y="933" time="14820285.04"/>
<Point x="3576" y="945" time="14820285.06"/>
<Point x="3551" y="967" time="14820285.07"/>
<Point x="3530" y="995" time="14820285.09"/>
<Point x="3515" y="1026" time="14820285.10"/>
<Point x="3505" y="1054" time="14820285.12"/>
<Point x="3510" y="1076" time="14820285.13"/>
<Point x="3516" y="1091" time="14820285.15"/>
<Point x="3534" y="1100" time="14820285.16"/>
<Point x="3551" y="1101" time="14820285.18"/>
<Point x="3575" y="1096" time="14820285.19"/>
<Point x="3599" y="1086" time="14820285.21"/>
<Point x="3620" y="1075" time="14820285.22"/>
<Point x="3637" y="1064" time="14820285.24"/>
<Point x="3654" y="1052" time="14820285.25"/>
<Point x="3666" y="1040" time="14820285.27"/>
</Stroke>
<Stroke colour="black" start_time="14820285.37" end_time="14820285.77">
<Point x="3711" y="1019" time="14820285.37"/>
<Point x="3711" y="1020" time="14820285.38"/>
<Point x="3714" y="1023" time="14820285.40"/>
<Point x="3722" y="1025" time="14820285.41"/>
<Point x="3735" y="1024" time="14820285.43"/>
<Point x="3754" y="1017" time="14820285.44"/>
<Point x="3774" y="1006" time="14820285.46"/>
<Point x="3791" y="991" time="14820285.47"/>
<Point x="3808" y="976" time="14820285.49"/>
<Point x="3812" y="962" time="14820285.50"/>
<Point x="3824" y="951" time="14820285.52"/>
<Point x="3817" y="947" time="14820285.53"/>
<Point x="3814" y="945" time="14820285.55"/>
<Point x="3787" y="949" time="14820285.56"/>
<Point x="3763" y="960" time="14820285.58"/>
<Point x="3741" y="977" time="14820285.59"/>
<Point x="3723" y="998" time="14820285.61"/>
<Point x="3711" y="1020" time="14820285.62"/>
<Point x="3707" y="1044" time="14820285.64"/>
<Point x="3716" y="1068" time="14820285.65"/>
<Point x="3731" y="1085" time="14820285.67"/>
<Point x="3752" y="1097" time="14820285.68"/>
<Point x="3777" y="1100" time="14820285.69"/>
<Point x="3807" y="1098" time="14820285.71"/>
<Point x="3831" y="1092" time="14820285.73"/>
<Point x="3851" y="1083" time="14820285.74"/>
<Point x="3858" y="1071" time="14820285.75"/>
<Point x="3867" y="1059" time="14820285.77"/>
</Stroke>
<Stroke colour="black" start_time="14820285.89" end_time="14820286.60">
<Point x="3895" y="981" time="14820285.89"/>
<Point x="3899" y="979" time="14820285.91"/>
<Point x="3903" y="980" time="14820285.92"/>
<Point x="3894" y="980" time="14820285.93"/>
<Point x="3896" y="989" time="14820285.95"/>
<Point x="3895" y="1008" time="14820285.96"/>
<Point x="3896" y="1032" time="14820285.98"/>
<Point x="3892" y="1059" time="14820285.99"/>
<Point x="3894" y="1091" time="14820286.01"/>
<Point x="3888" y="1121" time="14820286.02"/>
<Point x="3896" y="1148" time="14820286.04"/>
<Point x="3901" y="1170" time="14820286.05"/>
<Point x="3904" y="1184" time="14820286.07"/>
<Point x="3906" y="1189" time="14820286.08"/>
<Point x="3903" y="1187" time="14820286.10"/>
<Point x="3912" y="1186" time="14820286.11"/>
<Point x="3903" y="1177" time="14820286.13"/>
<Point x="3903" y="1164" time="14820286.14"/>
<Point x="3901" y="1146" time="14820286.15"/>
<Point x="3895" y="1124" time="14820286.17"/>
<Point x="3900" y="1099" time="14820286.19"/>
<Point x="3909" y="1070" time="14820286.20"/>
<Point x="3918" y="1042" time="14820286.21"/>
<Point x="3933" y="1018" time="14820286.23"/>
<Point x="3966" y="995" time="14820286.25"/>
<Point x="3991" y="978" time="14820286.26"/>
<Point x="4015" y="967" time="14820286.27"/>
<Point x="4036" y="962" time="14820286.29"/>
<Point x="4056" y="965" time="14820286.31"/>
<Point x="4071" y="974" time="14820286.32"/>
<Point x="4087" y="990" time="14820286.33"/>
<Point x="4090" y="1009" time="14820286.35"/>
<Point x="4097" y="1030" time="14820286.37"/>
<Point x="4092" y="1047" time="14820286.38"/>
<Point x="4084" y="1061" time="14820286.39"/>
<Point x="4073" y="1069" time="14820286.41"/>
<Point x="4063" y="1074" time="14820286.42"/>
<Point x="4050" y="1076" time="14820286.44"/>
<Point x="4037" y="1075" time="14820286.45"/>
<Point x="4026" y="1072" time="14820286.47"/>
<Point x="4015" y="1067" time="14820286.49"/>
<Point x="4003" y="1062" time="14820286.50"/>
<Point x="3996" y="1059" time="14820286.51"/>
<Point x="3990" y="1054" time="14820286.53"/>
<Point x="3985" y="1054" time="14820286.54"/>
<Point x="3985" y="1055" time="14820286.56"/>
<Point x="3984" y="1059" time="14820286.57"/>
<Point x="3987" y="1061" time="14820286.59"/>
<Point x="3994" y="1066" time="14820286.60"/>
</Stroke>
<Stroke colour="black" start_time="14820287.14" end_time="14820287.74">
<Point x="4576" y="826" time="14820287.14"/>
<Point x="4570" y="815" time="14820287.16"/>
<Point x="4563" y="806" time="14820287.18"/>
<Point x="4560" y="802" time="14820287.19"/>
<Point x="4560" y="801" time="14820287.21"/>
<Point x="4560" y="802" time="14820287.22"/>
<Point x="4558" y="813" time="14820287.24"/>
<Point x="4562" y="834" time="14820287.25"/>
<Point x="4560" y="864" time="14820287.27"/>
<Point x="4558" y="896" time="14820287.28"/>
<Point x="4563" y="931" time="14820287.30"/>
<Point x="4563" y="965" time="14820287.31"/>
<Point x="4565" y="997" time="14820287.33"/>
<Point x="4570" y="1025" time="14820287.34"/>
<Point x="4573" y="1045" time="14820287.36"/>
<Point x="4574" y="1056" time="14820287.37"/>
<Point x="4570" y="1059" time="14820287.39"/>
<Point x="4573" y="1059" time="14820287.40"/>
<Point x="4574" y="1056" time="14820287.42"/>
<Point x="4573" y="1044" time="14820287.43"/>
<Point x="4574" y="1025" time="14820287.44"/>
<Point x="4580" y="1000" time="14820287.46"/>
<Point x="4594" y="974" time="14820287.48"/>
<Point x="4608" y="951" time="14820287.49"/>
<Point x="4631" y="938" time="14820287.50"/>
<Point x="4646" y="927" time="14820287.52"/>
<Point x="4671" y="924" time="14820287.54"/>
<Point x="4699" y="928" time="14820287.55"/>
<Point x="4718" y="934" time="14820287.56"/>
<Point x="4736" y="945" time="14820287.58"/>
<Point x="4746" y="957" time="14820287.60"/>
<Point x="4746" y="974" time="14820287.61"/>
<Point x="4734" y="994" time="14820287.62"/>
<Point x="4721" y="1013" time="14820287.64"/>
<Point x="4697" y="1027" time="14820287.66"/>
<Point x="4673" y="1039" time="14820287.67"/>
<Point x="4655" y="1047" time="14820287.68"/>
<Point x="4642" y="1052" time="14820287.70"/>
<Point x="4625" y="1049" time="14820287.72"/>
<Point x="4618" y="1047" time="14820287.73"/>
<Point x="4611" y="1041" time="14820287.74"/>
</Stroke>
<Stroke colour="black" start_time="14820287.90" end_time="14820288.27">
<Point x="4784" y="908" time="14820287.90"/>
<Point x="4784" y="906" time="14820287.92"/>
<Point x="4789" y="906" time="14820287.94"/>
<Point x="4792" y="909" time="14820287.96"/>
<Point x="4795" y="918" time="14820287.97"/>
<Point x="4796" y="933" time="14820287.98"/>
<Point x="4794" y="955" time="14820288.00"/>
<Point x="4789" y="982" time="14820288.02"/>
<Point x="4792" y="1008" time="14820288.03"/>
<Point x="4799" y="1028" time="14820288.04"/>
<Point x="4799" y="1045" time="14820288.06"/>
<Point x="4801" y="1056" time="14820288.08"/>
<Point x="4801" y="1059" time="14820288.09"/>
<Point x="4800" y="1060" time="14820288.10"/>
<Point x="4800" y="1059" time="14820288.12"/>
<Point x="4801" y="1054" time="14820288.13"/>
<Point x="4800" y="1042" time="14820288.15"/>
<Point x="4801" y="1020" time="14820288.16"/>
<Point x="4807" y="994" time="14820288.18"/>
<Point x="4817" y="967" time="14820288.19"/>
<Point x="4823" y="941" time="14820288.21"/>
<Point x="4835" y="920" time="14820288.22"/>
<Point x="4855" y="902" time="14820288.23"/>
<Point x="4870" y="890" time="14820288.25"/>
<Point x="4891" y="883" time="14820288.27"/>
</Stroke>
<Stroke colour="black" start_time="14820288.41" end_time="14820288.89">
<Point x="4934" y="992" time="14820288.41"/>
<Point x="4939" y="994" time="14820288.43"/>
<Point x="4951" y="994" time="14820288.44"/>
<Point x="4963" y="993" time="14820288.46"/>
<Point x="4981" y="985" time="14820288.47"/>
<Point x="5001" y="970" time="14820288.49"/>
<Point x="5016" y="953" time="14820288.50"/>
<Point x="5036" y="933" time="14820288.52"/>
<Point x="5048" y="914" time="14820288.53"/>
<Point x="5055" y="897" time="14820288.55"/>
<Point x="5054" y="883" time="14820288.56"/>
<Point x="5043" y="875" time="14820288.58"/>
<Point x="5023" y="873" time="14820288.59"/>
<Point x="4997" y="880" time="14820288.61"/>
<Point x="4974" y="896" time="14820288.62"/>
<Point x="4946" y="916" time="14820288.64"/>
<Point x="4924" y="943" time="14820288.65"/>
<Point x="4906" y="970" time="14820288.67"/>
<Point x="4905" y="995" time="14820288.68"/>
<Point x="4910" y="1014" time="14820288.70"/>
<Point x="4922" y="1030" time="14820288.71"/>
<Point x="4936" y="1042" time="14820288.73"/>
<Point x="4955" y="1048" time="14820288.74"/>
<Point x="4982" y="1050" time="14820288.75"/>
<Point x="5000" y="1047" time="14820288.77"/>
<Point x="5021" y="1042" time="14820288.79"/>
<Point x="5031" y="1037" time="14820288.80"/>
<Point x="5043" y="1035" time="14820288.81"/>
<Point x="5045" y="1032" time="14820288.83"/>
<Point x="5049" y="1032" time="14820288.85"/>
<Point x="5048" y="1034" time="14820288.86"/>
<Point x="5047" y="1039" time="14820288.87"/>
<Point x="5040" y="1049" time="14820288.89"/>
</Stroke>
<Stroke colour="black" start_time="14820289.96" end_time="14820290.51">
<Point x="5136" y="901" time="14820289.96"/>
<Point x="5136" y="898" time="14820289.98"/>
<Point x="5141" y="895" time="14820290.00"/>
<Point x="5151" y="886" time="14820290.01"/>
<Point x="5172" y="878" time="14820290.02"/>
<Point x="5198" y="873" time="14820290.04"/>
<Point x="5222" y="874" time="14820290.06"/>
<Point x="5241" y="882" time="14820290.07"/>
<Point x="5251" y="893" time="14820290.08"/>
<Point x="5260" y="909" time="14820290.10"/>
<Point x="5261" y="928" time="14820290.11"/>
<Point x="5257" y="948" time="14820290.13"/>
<Point x="5246" y="966" time="14820290.14"/>
<Point x="5234" y="982" time="14820290.16"/>
<Point x="5216" y="995" time="14820290.18"/>
<Point x="5206" y="1003" time="14820290.19"/>
<Point x="5205" y="1006" time="14820290.20"/>
<Point x="5197" y="1005" time="14820290.22"/>
<Point x="5194" y="1001" time="14820290.23"/>
<Point x="5201" y="990" time="14820290.25"/>
<Point x="5203" y="975" time="14820290.26"/>
<Point x="5218" y="962" time="14820290.28"/>
<Point x="5231" y="954" time="14820290.29"/>
<Point x="5250" y="947" time="14820290.31"/>
<Point x="5262" y="946" time="14820290.32"/>
<Point x="5273" y="949" time="14820290.34"/>
<Point x="5288" y="958" time="14820290.35"/>
<Point x="5294" y="970" time="14820290.37"/>
<Point x="5299" y="984" time="14820290.38"/>
<Point x="5301" y="996" time="14820290.41"/>
<Point x="5303" y="1005" time="14820290.42"/>
<Point x="5303" y="1010" time="14820290.44"/>
<Point x="5302" y="1012" time="14820290.45"/>
<Point x="5302" y="1011" time="14820290.47"/>
<Point x="5294" y="1008" time="14820290.48"/>
<Point x="5288" y="1001" time="14820290.50"/>
<Point x="5283" y="984" time="14820290.51"/>
</Stroke>
<Stroke colour="black" start_time="14820290.65" end_time="14820290.95">
<Point x="5366" y="720" time="14820290.65"/>
<Point x="5371" y="714" time="14820290.66"/>
<Point x="5371" y="714" time="14820290.67"/>
<Point x="5371" y="714" time="14820290.69"/>
<Point x="5371" y="717" time="14820290.71"/>
<Point x="5377" y="733" time="14820290.72"/>
<Point x="5377" y="759" time="14820290.73"/>
<Point x="5384" y="793" time="14820290.75"/>
<Point x="5376" y="827" time="14820290.77"/>
<Point x="5385" y="865" time="14820290.78"/>
<Point x="5384" y="902" time="14820290.79"/>
<Point x="5389" y="938" time="14820290.81"/>
<Point x="5395" y="974" time="14820290.83"/>
<Point x="5400" y="1011" time="14820290.84"/>
<Point x="5402" y="1040" time="14820290.85"/>
<Point x="5405" y="1064" time="14820290.87"/>
<Point x="5410" y="1079" time="14820290.89"/>
<Point x="5413" y="1089" time="14820290.90"/>
<Point x="5412" y="1093" time="14820290.91"/>
<Point x="5407" y="1093" time="14820290.93"/>
<Point x="5401" y="1088" time="14820290.95"/>
</Stroke>
<Stroke colour="black" start_time="14820291.09" end_time="14820291.21">
<Point x="5318" y="925" time="14820291.09"/>
<Point x="5319" y="923" time="14820291.11"/>
<Point x="5318" y="924" time="14820291.12"/>
<Point x="5323" y="921" time="14820291.14"/>
<Point x="5340" y="916" time="14820291.15"/>
<Point x="5363" y="904" time="14820291.17"/>
<Point x="5381" y="893" time="14820291.18"/>
<Point x="5403" y="881" time="14820291.20"/>
<Point x="5421" y="871" time="14820291.21"/>
</Stroke>
<Stroke colour="black" start_time="14820291.35" end_time="14820292.07">
<Point x="5489" y="736" time="14820291.35"/>
<Point x="5493" y="735" time="14820291.37"/>
<Point x="5493" y="733" time="14820291.38"/>
<Point x="5494" y="734" time="14820291.40"/>
<Point x="5493" y="739" time="14820291.41"/>
<Point x="5490" y="759" time="14820291.43"/>
<Point x="5478" y="789" time="14820291.44"/>
<Point x="5470" y="823" time="14820291.46"/>
<Point x="5459" y="861" time="14820291.47"/>
<Point x="5453" y="896" time="14820291.48"/>
<Point x="5448" y="926" time="14820291.50"/>
<Point x="5451" y="955" time="14820291.52"/>
<Point x="5455" y="979" time="14820291.53"/>
<Point x="5455" y="1001" time="14820291.54"/>
<Point x="5460" y="1015" time="14820291.56"/>
<Point x="5466" y="1025" time="14820291.58"/>
<Point x="5466" y="1026" time="14820291.59"/>
<Point x="5470" y="1028" time="14820291.60"/>
<Point x="5467" y="1027" time="14820291.62"/>
<Point x="5466" y="1025" time="14820291.64"/>
<Point x="5468" y="1015" time="14820291.65"/>
<Point x="5471" y="1000" time="14820291.66"/>
<Point x="5475" y="982" time="14820291.68"/>
<Point x="5477" y="970" time="14820291.70"/>
<Point x="5479" y="957" time="14820291.71"/>
<Point x="5485" y="950" time="14820291.72"/>
<Point x="5484" y="948" time="14820291.74"/>
<Point x="5492" y="952" time="14820291.76"/>
<Point x="5503" y="961" time="14820291.77"/>
<Point x="5512" y="976" time="14820291.78"/>
<Point x="5525" y="992" time="14820291.80"/>
<Point x="5542" y="1011" time="14820291.81"/>
<Point x="5560" y="1027" time="14820291.83"/>
<Point x="5578" y="1039" time="14820291.84"/>
<Point x="5602" y="1043" time="14820291.86"/>
<Point x="5627" y="1044" time="14820291.87"/>
<Point x="5651" y="1036" time="14820291.89"/>
<Point x="5675" y="1023" time="14820291.90"/>
<Point x="5699" y="1006" time="14820291.92"/>
<Point x="5721" y="989" time="14820291.93"/>
<Point x="5740" y="971" time="14820291.95"/>
<Point x="5755" y="957" time="14820291.96"/>
<Point x="5766" y="942" time="14820291.98"/>
<Point x="5771" y="930" time="14820291.99"/>
<Point x="5777" y="923" time="14820292.01"/>
<Point x="5778" y="921" time="14820292.02"/>
<Point x="5774" y="921" time="14820292.04"/>
<Point x="5773" y="921" time="14820292.05"/>
<Point x="5769" y="922" time="14820292.07"/>
</Stroke>
<Stroke colour="black" start_time="14820293.10" end_time="14820293.58">
<Point x="6090" y="887" time="14820293.10"/>
<Point x="6090" y="884" time="14820293.11"/>
<Point x="6095" y="882" time="14820293.13"/>
<Point x="6111" y="879" time="14820293.15"/>
<Point x="6131" y="877" time="14820293.16"/>
<Point x="6148" y="878" time="14820293.18"/>
<Point x="6167" y="885" time="14820293.19"/>
<Point x="6177" y="897" time="14820293.21"/>
<Point x="6191" y="916" time="14820293.22"/>
<Point x="6192" y="936" time="14820293.24"/>
<Point x="6193" y="958" time="14820293.25"/>
<Point x="6181" y="979" time="14820293.27"/>
<Point x="6170" y="999" time="14820293.28"/>
<Point x="6148" y="1015" time="14820293.29"/>
<Point x="6125" y="1029" time="14820293.31"/>
<Point x="6099" y="1034" time="14820293.33"/>
<Point x="6091" y="1035" time="14820293.34"/>
<Point x="6084" y="1029" time="14820293.35"/>
<Point x="6085" y="1019" time="14820293.37"/>
<Point x="6092" y="1002" time="14820293.39"/>
<Point x="6107" y="986" time="14820293.40"/>
<Point x="6134" y="970" time="14820293.41"/>
<Point x="6161" y="957" time="14820293.43"/>
<Point x="6186" y="953" time="14820293.45"/>
<Point x="6214" y="955" time="14820293.46"/>
<Point x="6233" y="960" time="14820293.47"/>
<Point x="6248" y="968" time="14820293.49"/>
<Point x="6259" y="977" time="14820293.51"/>
<Point x="6266" y="984" time="14820293.52"/>
<Point x="6265" y="989" time="14820293.53"/>
<Point x="6268" y="993" time="14820293.55"/>
<Point x="6252" y="994" time="14820293.57"/>
<Point x="6244" y="994" time="14820293.58"/>
</Stroke>
<Stroke colour="black" start_time="14820293.71" end_time="14820294.37">
<Point x="6230" y="873" time="14820293.71"/>
<Point x="6230" y="876" time="14820293.73"/>
<Point x="6225" y="871" time="14820293.74"/>
<Point x="6230" y="872" time="14820293.76"/>
<Point x="6234" y="873" time="14820293.77"/>
<Point x="6232" y="885" time="14820293.79"/>
<Point x="6230" y="903" time="14820293.80"/>
<Point x="6222" y="925" time="14820293.82"/>
<Point x="6218" y="948" time="14820293.83"/>
<Point x="6215" y="970" time="14820293.85"/>
<Point x="6205" y="986" time="14820293.86"/>
<Point x="6207" y="996" time="14820293.88"/>
<Point x="6202" y="1001" time="14820293.89"/>
<Point x="6210" y="1003" time="14820293.91"/>
<Point x="6206" y="1001" time="14820293.92"/>
<Point x="6203" y="996" time="14820293.93"/>
<Point x="6205" y="983" time="14820293.95"/>
<Point x="6208" y="967" time="14820293.96"/>
<Point x="6215" y="946" time="14820293.98"/>
<Point x="6220" y="935" time="14820293.99"/>
<Point x="6219" y="918" time="14820294.01"/>
<Point x="6228" y="910" time="14820294.02"/>
<Point x="6230" y="900" time="14820294.04"/>
<Point x="6238" y="897" time="14820294.05"/>
<Point x="6246" y="900" time="14820294.07"/>
<Point x="6261" y="910" time="14820294.08"/>
<Point x="6271" y="926" time="14820294.10"/>
<Point x="6280" y="944" time="14820294.11"/>
<Point x="6285" y="963" time="14820294.13"/>
<Point x="6307" y="982" time="14820294.14"/>
<Point x="6313" y="995" time="14820294.16"/>
<Point x="6331" y="1005" time="14820294.17"/>
<Point x="6338" y="1008" time="14820294.19"/>
<Point x="6355" y="1005" time="14820294.20"/>
<Point x="6365" y="992" time="14820294.22"/>
<Point x="6380" y="974" time="14820294.23"/>
<Point x="6391" y="955" time="14820294.25"/>
<Point x="6406" y="937" time="14820294.26"/>
<Point x="6406" y="915" time="14820294.28"/>
<Point x="6411" y="901" time="14820294.29"/>
<Point x="6414" y="881" time="14820294.31"/>
<Point x="6418" y="877" time="14820294.32"/>
<Point x="6412" y="868" time="14820294.34"/>
<Point x="6416" y="871" time="14820294.35"/>
<Point x="6410" y="884" time="14820294.37"/>
</Stroke>
<Stroke colour="black" start_time="14820294.53" end_time="14820295.25">
<Point x="6586" y="895" time="14820294.53"/>
<Point x="6582" y="892" time="14820294.55"/>
<Point x="6570" y="885" time="14820294.56"/>
<Point x="6556" y="881" time="14820294.58"/>
<Point x="6540" y="873" time="14820294.60"/>
<Point x="6519" y="883" time="14820294.61"/>
<Point x="6490" y="884" time="14820294.62"/>
<Point x="6472" y="898" time="14820294.64"/>
<Point x="6449" y="916" time="14820294.66"/>
<Point x="6434" y="941" time="14820294.67"/>
<Point x="6431" y="959" time="14820294.68"/>
<Point x="6432" y="976" time="14820294.70"/>
<Point x="6435" y="989" time="14820294.72"/>
<Point x="6441" y="1001" time="14820294.73"/>
<Point x="6448" y="1007" time="14820294.74"/>
<Point x="6468" y="1010" time="14820294.76"/>
<Point x="6473" y="1003" time="14820294.77"/>
<Point x="6495" y="993" time="14820294.79"/>
<Point x="6507" y="971" time="14820294.80"/>
<Point x="6519" y="942" time="14820294.82"/>
<Point x="6531" y="905" time="14820294.83"/>
<Point x="6543" y="881" time="14820294.85"/>
<Point x="6543" y="850" time="14820294.86"/>
<Point x="6548" y="815" time="14820294.88"/>
<Point x="6551" y="783" time="14820294.89"/>
<Point x="6554" y="752" time="14820294.91"/>
<Point x="6556" y="731" time="14820294.92"/>
<Point x="6554" y="716" time="14820294.94"/>
<Point x="6556" y="702" time="14820294.95"/>
<Point x="6552" y="692" time="14820294.97"/>
<Point x="6553" y="689" time="14820294.98"/>
<Point x="6553" y="689" time="14820295.00"/>
<Point x="6557" y="690" time="14820295.01"/>
<Point x="6556" y="703" time="14820295.03"/>
<Point x="6562" y="725" time="14820295.04"/>
<Point x="6563" y="750" time="14820295.06"/>
<Point x="6575" y="784" time="14820295.07"/>
<Point x="6575" y="820" time="14820295.09"/>
<Point x="6586" y="862" time="14820295.10"/>
<Point x="6590" y="890" time="14820295.12"/>
<Point x="6609" y="931" time="14820295.13"/>
<Point x="6623" y="951" time="14820295.15"/>
<Point x="6642" y="978" time="14820295.16"/>
<Point x="6653" y="991" time="14820295.18"/>
<Point x="6671" y="1006" time="14820295.19"/>
<Point x="6678" y="1013" time="14820295.20"/>
<Point x="6686" y="1018" time="14820295.22"/>
<Point x="6684" y="1023" time="14820295.24"/>
<Point x="6669" y="1024" time="14820295.25"/>
</Stroke>
</StrokeSet>
</WhiteboardCaptureSession>
| 51.77896 | 75 | 0.551079 |
9982cc5f453c6c287e31845c973e01a56e947941 | 1,544 | xml | XML | data/1868/08/14/DDD_ddd_010141058_mpeg21/DDD_010141058_0009_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | data/1868/08/14/DDD_ddd_010141058_mpeg21/DDD_010141058_0009_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | data/1868/08/14/DDD_ddd_010141058_mpeg21/DDD_010141058_0009_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<text>
<title>BINNENGEKOMEN.</title>
<p>TEXEL, 12 Ang., W. Z. W.; Nina, S., Bordeaux. - Blackness, Dickenson Sunderland. -Whim, Smith, Yarmouth. - Daphne, Fredri_en,Geffle.-Hendrik Wergeland.Berkland, Stockholm.- Argo, Aeger, Porsgrund. — Gisteren nog: Hermanus Izaak, v. d. Veen, Suriname. - Mount Carroel, Bravy, Taganrog.- Frederikke, Mathiessen, Christiania. VLIE, 11 Aug., W. Z. W.; Lydia, Dobson, Runcorn. - Alida, Borgman, Christiania. - Minerva, Jans, Oudsoen. — 12 Aug.; Onoine, S., Koningsbergen. HELLEVOETSLUIS, 12 Aug., W.Z.W.;lntegrity, Hamden, Rye. - Wm. Harris, Lennel, Fowey. - Ossena, Hill, Liverpool. - Planet, Campbell, Newc. - Eagle, "Hawkins, Ipswich. - Thames, Richardson, id. - Dantzig, S., Dantzig. - Silanus, Schjersig, Drammen. - Christian Agathon, Weidemann, Holmstrand. - Elisabeth, Schoon, Bergen. BRIELLE, 12 Ang., W. Z. W.; Florence,S.,Londen.-Zealous, S., Harwich. BROUWERSHAVEN,^ Ang., W.Z.W.—N.W.; Hochelaya, Eger, Rangoon n. Rottvßrodrene, Meylander, Akyab n.Dordt.- Aurora, Utley, Rott. n. Philadelph. A. SHIELDS, 10 Aug.; Lambertha, Karst, Rott. GIBRALTAR, 4 Aug.-, Boreas, de Jong, Vlaardingen. LIVORNO, 31 Julij-, Orion, S., Amsterdam. GENUA. 6 Aug.; Gesina, Doekes, Amsterd. NAPELS, 1 Aug.; Jacob den Breems, v. Gelderen, Vlaard. TRIEST, 5 Ang.; Maria, Hildebrandt, Antw. VEEA CRUZ, 5 Julij: Verwisseling, Mnnnix, Genua. AMOY, 16 Junij; Landbouw, Sissingh, Soerabaya. ILO ILO.2BMei; Louise Kroonpr. f. Zweden, Meppelder -a. . N./. V-'M</p>
</text>
| 257.333333 | 1,454 | 0.70013 |
5697b8ddc482886308bfc8a53e92da3d129c9619 | 845 | xml | XML | _site/feed.xml | fillerInk/blog | 84631134cc773c1777f2b0e568ab1f2174f038db | [
"MIT"
] | 2 | 2019-12-23T18:44:34.000Z | 2019-12-24T10:45:37.000Z | _site/feed.xml | fillerInk/blog | 84631134cc773c1777f2b0e568ab1f2174f038db | [
"MIT"
] | null | null | null | _site/feed.xml | fillerInk/blog | 84631134cc773c1777f2b0e568ab1f2174f038db | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<rss version="2.0" xmlns:atom="http://www.w3.org/2005/Atom" xmlns:dc="http://purl.org/dc/elements/1.1/">
<channel>
<title>Sreeram</title>
<link>http://localhost:4000</link>
<atom:link href="http://localhost:4000/feed.xml" rel="self" type="application/rss+xml" />
<item>
<title>My YouTube channel</title>
<description><h1 id="how-i-started-my-youtube-channel">How I started my YouTube channel?</h1>
<p>So I had this idea for a YouTube channel for a really long time.</p>
</description>
<pubDate>Sat, 28 Dec 2019 00:00:00 +0530</pubDate>
<link>http://localhost:4000/2019-12-28/new-post/</link>
<guid isPermaLink="true">http://localhost:4000/2019-12-28/new-post/</guid>
</item>
</channel>
</rss>
| 40.238095 | 123 | 0.640237 |
a48d43ae719f3c53aca51d2878c1ff549c22e1e1 | 2,331 | xml | XML | app/src/main/res/layout/list_item_financial_product.xml | sumincy/Flowmobile3 | b4e3863cafb0a507d2abffc0fc175af1d2a028e9 | [
"MIT"
] | null | null | null | app/src/main/res/layout/list_item_financial_product.xml | sumincy/Flowmobile3 | b4e3863cafb0a507d2abffc0fc175af1d2a028e9 | [
"MIT"
] | null | null | null | app/src/main/res/layout/list_item_financial_product.xml | sumincy/Flowmobile3 | b4e3863cafb0a507d2abffc0fc175af1d2a028e9 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:background="@color/white"
android:orientation="vertical"
android:padding="8dp">
<LinearLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:gravity="center_vertical"
android:orientation="horizontal">
<TextView
android:id="@+id/tv_amount"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="16dp"
android:text="2.5%"
android:textColor="@color/orangered"
android:textSize="30sp" />
<Space
android:layout_width="0dp"
android:layout_height="0dp"
android:layout_weight="0.5" />
<TextView
android:id="@+id/tv_productName"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginRight="16dp"
android:text="金融投资27期"
android:textColor="@color/dark_gary_text"
android:textSize="20sp" />
</LinearLayout>
<LinearLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:gravity="center_vertical"
android:orientation="horizontal">
<TextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="16dp"
android:layout_marginTop="4dp"
android:text="参考收益"
android:textColor="@color/light_gary_text"
android:textSize="14sp" />
<Space
android:layout_width="0dp"
android:layout_height="0dp"
android:layout_weight="0.5" />
<TextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginTop="4dp"
android:layout_marginRight="16dp"
android:text="投资期限63天"
android:textColor="@color/light_gary_text"
android:textSize="14sp" />
</LinearLayout>
</LinearLayout> | 32.830986 | 72 | 0.6139 |
a4cbef99127b4f02698e173fc666680ec26084b4 | 37,846 | xml | XML | db/bills/s/s756/fdsys_billstatus.xml | peter765/power-polls | 9a03a4c61fdb95a3ea4cd37db328665203f88468 | [
"MIT"
] | null | null | null | db/bills/s/s756/fdsys_billstatus.xml | peter765/power-polls | 9a03a4c61fdb95a3ea4cd37db328665203f88468 | [
"MIT"
] | null | null | null | db/bills/s/s756/fdsys_billstatus.xml | peter765/power-polls | 9a03a4c61fdb95a3ea4cd37db328665203f88468 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<billStatus>
<bill>
<policyArea>
<name>Environmental Protection</name>
</policyArea>
<summaries>
<billSummaries />
</summaries>
<actions>
<item>
<actionDate>2017-08-08</actionDate>
<committee>
<name>Water, Power and Oceans Subcommittee</name>
<systemCode>hsii13</systemCode>
</committee>
<links />
<sourceSystem>
<code>1</code>
<name>House committee actions</name>
</sourceSystem>
<text>Referred to the Subcommittee on Water, Power and Oceans.</text>
<type>Committee</type>
</item>
<item>
<text>Referred to the Committee on Transportation and Infrastructure, and in addition to the Committee on Natural Resources, for a period to be subsequently determined by the Speaker, in each case for consideration of such provisions as fall within the jurisdiction of the committee concerned.</text>
<sourceSystem>
<code>2</code>
<name>House floor actions</name>
</sourceSystem>
<links />
<actionCode>H11100</actionCode>
<committee>
<name>Natural Resources Committee</name>
<systemCode>hsii00</systemCode>
</committee>
<type>IntroReferral</type>
<actionDate>2017-08-04</actionDate>
</item>
<item>
<text>Referred to the Committee on Transportation and Infrastructure, and in addition to the Committee on Natural Resources, for a period to be subsequently determined by the Speaker, in each case for consideration of such provisions as fall within the jurisdiction of the committee concerned.</text>
<sourceSystem>
<code>2</code>
<name>House floor actions</name>
</sourceSystem>
<links />
<actionCode>H11100</actionCode>
<committee>
<name>Transportation and Infrastructure Committee</name>
<systemCode>hspw00</systemCode>
</committee>
<type>IntroReferral</type>
<actionDate>2017-08-04</actionDate>
</item>
<item>
<actionTime>13:06:35</actionTime>
<text>Received in the House.</text>
<links />
<actionCode>H14000</actionCode>
<committee />
<type>Floor</type>
<actionDate>2017-08-04</actionDate>
<sourceSystem>
<code>2</code>
<name>House floor actions</name>
</sourceSystem>
</item>
<item>
<actionDate>2017-08-04</actionDate>
<committee />
<links />
<sourceSystem>
<code>0</code>
<name>Senate</name>
</sourceSystem>
<text>Message on Senate action sent to the House.</text>
<type>Floor</type>
</item>
<item>
<actionDate>2017-08-03</actionDate>
<committee />
<links />
<sourceSystem>
<code>0</code>
<name>Senate</name>
</sourceSystem>
<text>Passed Senate with amendments by Unanimous Consent.</text>
<type>Floor</type>
</item>
<item>
<text>Passed/agreed to in Senate: Passed Senate with amendments by Unanimous Consent.</text>
<sourceSystem>
<code>9</code>
<name>Library of Congress</name>
</sourceSystem>
<links />
<actionCode>17000</actionCode>
<committee />
<type>Floor</type>
<actionDate>2017-08-03</actionDate>
</item>
<item>
<actionDate>2017-08-03</actionDate>
<committee />
<links>
<link>
<url>https://www.congress.gov/congressional-record/volume-163/senate-section/page/S4895</url>
<name>S4895</name>
</link>
</links>
<sourceSystem>
<code>0</code>
<name>Senate</name>
</sourceSystem>
<text>Measure laid before Senate by unanimous consent. (consideration: CR S4895)</text>
<type>Floor</type>
</item>
<item>
<actionDate>2017-07-24</actionDate>
<committee />
<links />
<sourceSystem>
<code>0</code>
<name>Senate</name>
</sourceSystem>
<text>Placed on Senate Legislative Calendar under General Orders. Calendar No. 181.</text>
<type>Calendars</type>
</item>
<item>
<actionDate>2017-07-24</actionDate>
<committee>
<name>Commerce, Science, and Transportation Committee</name>
<systemCode>sscm00</systemCode>
</committee>
<links>
<link>
<url>https://www.congress.gov/congressional-report/115th-congress/senate-report/135</url>
<name>report No. 115-135</name>
</link>
</links>
<sourceSystem>
<code>0</code>
<name>Senate</name>
</sourceSystem>
<text>Committee on Commerce, Science, and Transportation. Reported by Senator Thune without amendment. With written report No. 115-135.</text>
<type>Committee</type>
</item>
<item>
<text>Committee on Commerce, Science, and Transportation. Reported by Senator Thune without amendment. With written report No. 115-135.</text>
<sourceSystem>
<code>9</code>
<name>Library of Congress</name>
</sourceSystem>
<links>
<link>
<url>https://www.congress.gov/congressional-report/115th-congress/senate-report/135</url>
<name>report No. 115-135</name>
</link>
</links>
<actionCode>14000</actionCode>
<committee>
<name>Commerce, Science, and Transportation Committee</name>
<systemCode>sscm00</systemCode>
</committee>
<type>Committee</type>
<actionDate>2017-07-24</actionDate>
</item>
<item>
<actionDate>2017-04-05</actionDate>
<committee>
<name>Commerce, Science, and Transportation Committee</name>
<systemCode>sscm00</systemCode>
</committee>
<links />
<sourceSystem>
<code>0</code>
<name>Senate</name>
</sourceSystem>
<text>Committee on Commerce, Science, and Transportation. Ordered to be reported without amendment favorably.</text>
<type>Committee</type>
</item>
<item>
<actionDate>2017-03-29</actionDate>
<committee>
<name>Commerce, Science, and Transportation Committee</name>
<systemCode>sscm00</systemCode>
</committee>
<links />
<sourceSystem>
<code>0</code>
<name>Senate</name>
</sourceSystem>
<text>Read twice and referred to the Committee on Commerce, Science, and Transportation.</text>
<type>IntroReferral</type>
</item>
<item>
<text>Introduced in Senate</text>
<sourceSystem>
<code>9</code>
<name>Library of Congress</name>
</sourceSystem>
<links />
<actionCode>10000</actionCode>
<committee />
<type>IntroReferral</type>
<actionDate>2017-03-29</actionDate>
</item>
<actionTypeCounts>
<placedOnCalendarGeneralOrders>1</placedOnCalendarGeneralOrders>
<billReferrals>2</billReferrals>
<introducedInSenate>1</introducedInSenate>
<reportedToSenate>2</reportedToSenate>
<sentToHouse>1</sentToHouse>
<placeholderTextForH>1</placeholderTextForH>
<passedAgreedToInSenate>1</passedAgreedToInSenate>
<passedSenate>1</passedSenate>
<orderedReported>1</orderedReported>
<referredToCommittee>1</referredToCommittee>
<measureLaidBeforeSenate>1</measureLaidBeforeSenate>
<receivedInTheHouse>1</receivedInTheHouse>
</actionTypeCounts>
<actionByCounts>
<houseOfRepresentatives>4</houseOfRepresentatives>
<senate>10</senate>
</actionByCounts>
</actions>
<title>SOS Act of 2017</title>
<notes />
<cboCostEstimates>
<item>
<url>https://www.cbo.gov/publication/52686</url>
<pubDate>2017-05-02T19:27:00Z</pubDate>
<title>S. 756, Save Our Seas Act of 2017</title>
</item>
</cboCostEstimates>
<titles>
<item>
<title>SOS Act of 2017</title>
<titleType>Short Titles as Passed Senate</titleType>
<parentTitleType>Short Titles Senate</parentTitleType>
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>Save Our Seas Act of 2017</title>
<titleType>Short Titles as Passed Senate</titleType>
<parentTitleType>Short Titles Senate</parentTitleType>
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>SOS Act of 2017</title>
<titleType>Short Titles as Reported to Senate</titleType>
<parentTitleType>Short Titles Senate</parentTitleType>
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>Save Our Seas Act of 2017</title>
<titleType>Short Titles as Reported to Senate</titleType>
<parentTitleType>Short Titles Senate</parentTitleType>
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>SOS Act of 2017</title>
<titleType>Short Titles as Introduced</titleType>
<parentTitleType />
<chamberName />
<chamberCode />
</item>
<item>
<title>Save Our Seas Act of 2017</title>
<titleType>Short Titles as Introduced</titleType>
<parentTitleType />
<chamberName />
<chamberCode />
</item>
<item>
<title>A bill to reauthorize and amend the Marine Debris Act to promote international action to reduce marine debris, and for other purposes.</title>
<titleType>Official Title as Introduced</titleType>
<parentTitleType />
<chamberName />
<chamberCode />
</item>
<item>
<title>SOS Act of 2017</title>
<titleType>Display Title</titleType>
<parentTitleType />
<chamberName />
<chamberCode />
</item>
<item>
<title>SOS Act of 2017</title>
<titleType>(Extracted from GPO) Short Titles as Passed Senate</titleType>
<parentTitleType />
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>Save Our Seas Act of 2017</title>
<titleType>(Extracted from GPO) Short Titles as Passed Senate</titleType>
<parentTitleType />
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>SOS Act of 2017</title>
<titleType>(Extracted from GPO) Short Titles as Reported to Senate</titleType>
<parentTitleType />
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>Save Our Seas Act of 2017</title>
<titleType>(Extracted from GPO) Short Titles as Reported to Senate</titleType>
<parentTitleType />
<chamberName>Senate</chamberName>
<chamberCode>S</chamberCode>
</item>
<item>
<title>SOS Act of 2017</title>
<titleType>(Extracted from GPO) Short Titles as Introduced</titleType>
<parentTitleType />
<chamberName />
<chamberCode />
</item>
<item>
<title>Save Our Seas Act of 2017</title>
<titleType>(Extracted from GPO) Short Titles as Introduced</titleType>
<parentTitleType />
<chamberName />
<chamberCode />
</item>
</titles>
<createDate>2017-03-30T04:33:14Z</createDate>
<introducedDate>2017-03-29</introducedDate>
<congress>115</congress>
<committeeReports>
<committeeReport>
<citation>S. Rept. 115-135</citation>
</committeeReport>
</committeeReports>
<calendarNumbers>
<item>
<calendar>Senate Calendar of Business</calendar>
<number>0181</number>
</item>
</calendarNumbers>
<billNumber>756</billNumber>
<version>1.0.0</version>
<billType>S</billType>
<originChamber>Senate</originChamber>
<sponsors>
<item>
<state>AK</state>
<middleName />
<lastName>Sullivan</lastName>
<byRequestType />
<firstName>Dan</firstName>
<fullName>Sen. Sullivan, Dan [R-AK]</fullName>
<bioguideId>S001198</bioguideId>
<party>R</party>
<identifiers>
<bioguideId>S001198</bioguideId>
<gpoId />
<lisID>2290</lisID>
</identifiers>
</item>
</sponsors>
<laws />
<amendments>
<amendment>
<purpose>To improve the bill.</purpose>
<type>SAMDT</type>
<links />
<notes />
<actions>
<count>6</count>
<actions>
<item>
<actionDate>2017-08-03</actionDate>
<committee />
<links>
<link>
<name>S.Amdt.773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
<link>
<name>SA 773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
</links>
<sourceSystem>
<name>Senate</name>
<code>0</code>
</sourceSystem>
<text>Amendment SA 773 agreed to in Senate by Unanimous Consent.</text>
<type>Floor</type>
</item>
<item>
<actionDate>2017-08-03</actionDate>
<committee />
<links>
<link>
<name>S.Amdt.773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
<link>
<name>S4895</name>
<url>https://www.congress.gov/congressional-record/volume-163/senate-section/page/S4895</url>
</link>
<link>
<name>SA 773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
</links>
<sourceSystem>
<name>Senate</name>
<code>0</code>
</sourceSystem>
<text>Amendment SA 773 proposed by Senator Murkowski for Senator Sullivan. (consideration: CR S4895; text: CR S4895)</text>
<type>Floor</type>
</item>
<item>
<actionDate>2017-08-03</actionDate>
<committee />
<links />
<text />
</item>
<item>
<links>
<link>
<name>S.Amdt.773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
<link>
<name>S4895</name>
<url>https://www.congress.gov/congressional-record/volume-163/senate-section/page/S4895</url>
</link>
<link>
<name>SA 773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
</links>
<text>Senate amendment proposed (on the floor): Amendment SA 773 proposed by Senator Murkowski for Senator Sullivan.(consideration: CR S4895; text: CR S4895)</text>
<sourceSystem>
<name>Library of Congress</name>
<code>9</code>
</sourceSystem>
<committee />
<actionDate>2017-08-03</actionDate>
<type>Floor</type>
<actionCode>93000</actionCode>
</item>
<item>
<links>
<link>
<name>S.Amdt.773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
<link>
<name>SA 773</name>
<url>https://www.congress.gov/amendment/115th-congress/senate-amendment/773</url>
</link>
</links>
<text>Senate amendment agreed to: Amendment SA 773 agreed to in Senate by Unanimous Consent.</text>
<sourceSystem>
<name>Library of Congress</name>
<code>9</code>
</sourceSystem>
<committee />
<actionDate>2017-08-03</actionDate>
<type>Floor</type>
<actionCode>94000</actionCode>
</item>
<item>
<links />
<text>Senate amendment submitted</text>
<sourceSystem>
<name>Library of Congress</name>
<code>9</code>
</sourceSystem>
<committee />
<actionDate>2017-08-03</actionDate>
<type>Floor</type>
<actionCode>91000</actionCode>
</item>
</actions>
<actionTypeCounts>
<senateAmendmentAgreedTo>1</senateAmendmentAgreedTo>
<amendmentAgreedTo>1</amendmentAgreedTo>
<senateAmendmentSubmitted>1</senateAmendmentSubmitted>
<senateAmendmentProposedOnTheFloor>1</senateAmendmentProposedOnTheFloor>
<amendmentProposed>1</amendmentProposed>
</actionTypeCounts>
<actionByCounts>
<senate>5</senate>
</actionByCounts>
</actions>
<updateDate>2017-09-10T22:57:22Z</updateDate>
<version>1.0.0</version>
<type>SAMDT</type>
<chamber>Senate</chamber>
<proposedDate>2017-08-03T04:00:00Z</proposedDate>
<sponsors>
<item>
<bioguideId>S001198</bioguideId>
<lastName>Sullivan</lastName>
<state>AK</state>
<identifiers>
<bioguideId>S001198</bioguideId>
<gpoId />
<lisID>2290</lisID>
</identifiers>
<firstName>Dan</firstName>
<middleName />
<party>R</party>
<fullName>Sen. Sullivan, Dan [R-AK]</fullName>
</item>
</sponsors>
<congress>115</congress>
<createDate>2017-08-04T13:57:25Z</createDate>
<amendments>
<count>0</count>
</amendments>
<amendedBill>
<congress>115</congress>
<originChamberCode>S</originChamberCode>
<originChamber>Senate</originChamber>
<type>S</type>
<number>756</number>
<title>SOS Act of 2017</title>
</amendedBill>
<description />
<number>773</number>
<purpose>To improve the bill.</purpose>
<cosponsors>
<currentCount>0</currentCount>
<totalCount>0</totalCount>
</cosponsors>
<amendedAmendment />
<submittedDate>2017-08-03T04:00:00Z</submittedDate>
<titles />
<congress>115</congress>
<description />
<latestAction>
<text>Amendment SA 773 agreed to in Senate by Unanimous Consent.</text>
<actionDate>2017-08-03</actionDate>
</latestAction>
<number>773</number>
</amendment>
</amendments>
<subjects>
<billSubjects>
<policyArea>
<name>Environmental Protection</name>
</policyArea>
<legislativeSubjects>
<item>
<name>Coast guard</name>
</item>
<item>
<name>Department of Commerce</name>
</item>
<item>
<name>Department of Homeland Security</name>
</item>
<item>
<name>Department of State</name>
</item>
<item>
<name>Department of the Interior</name>
</item>
<item>
<name>Economic performance and conditions</name>
</item>
<item>
<name>Environmental assessment, monitoring, research</name>
</item>
<item>
<name>Executive agency funding and structure</name>
</item>
<item>
<name>Government information and archives</name>
</item>
<item>
<name>Government studies and investigations</name>
</item>
<item>
<name>Infrastructure development</name>
</item>
<item>
<name>International law and treaties</name>
</item>
<item>
<name>International organizations and cooperation</name>
</item>
<item>
<name>Marine and coastal resources, fisheries</name>
</item>
<item>
<name>Marine and inland water transportation</name>
</item>
<item>
<name>Marine pollution</name>
</item>
<item>
<name>Materials</name>
</item>
<item>
<name>Research and development</name>
</item>
<item>
<name>Rural conditions and development</name>
</item>
<item>
<name>Solid waste and recycling</name>
</item>
<item>
<name>Trade agreements and negotiations</name>
</item>
<item>
<name>Wildlife conservation and habitat protection</name>
</item>
</legislativeSubjects>
</billSubjects>
</subjects>
<updateDate>2017-09-11T02:58:09Z</updateDate>
<relatedBills>
<item>
<type>HR</type>
<congress>115</congress>
<number>2748</number>
<latestTitle>SOS Act of 2017</latestTitle>
<latestAction>
<actionDate>2017-06-12</actionDate>
<text>Referred to the Subcommittee on Water, Power and Oceans.</text>
</latestAction>
<relationshipDetails>
<item>
<type>Identical bill</type>
<identifiedBy>CRS</identifiedBy>
</item>
</relationshipDetails>
</item>
</relatedBills>
<latestAction>
<links />
<actionDate>2017-08-08</actionDate>
<text>Referred to the Subcommittee on Water, Power and Oceans.</text>
</latestAction>
<cosponsors>
<item>
<sponsorshipDate>2017-03-29</sponsorshipDate>
<party>D</party>
<firstName>Sheldon</firstName>
<bioguideId>W000802</bioguideId>
<lastName>Whitehouse</lastName>
<fullName>Sen. Whitehouse, Sheldon [D-RI]</fullName>
<middleName />
<state>RI</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>True</isOriginalCosponsor>
<identifiers>
<bioguideId>W000802</bioguideId>
<gpoId>8264</gpoId>
<lisID>1823</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-03-29</sponsorshipDate>
<party>D</party>
<firstName>Cory</firstName>
<bioguideId>B001288</bioguideId>
<lastName>Booker</lastName>
<fullName>Sen. Booker, Cory A. [D-NJ]</fullName>
<middleName>A.</middleName>
<state>NJ</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>True</isOriginalCosponsor>
<identifiers>
<bioguideId>B001288</bioguideId>
<lisID>2194</lisID>
<gpoId />
</identifiers>
</item>
<item>
<sponsorshipDate>2017-03-29</sponsorshipDate>
<party>D</party>
<firstName>Christopher</firstName>
<bioguideId>C001088</bioguideId>
<lastName>Coons</lastName>
<fullName>Sen. Coons, Christopher A. [D-DE]</fullName>
<middleName>A.</middleName>
<state>DE</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>True</isOriginalCosponsor>
<identifiers>
<gpoId>8297</gpoId>
<bioguideId>C001088</bioguideId>
<lisID>1984</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-03-29</sponsorshipDate>
<party>D</party>
<firstName>Gary</firstName>
<bioguideId>P000595</bioguideId>
<lastName>Peters</lastName>
<fullName>Sen. Peters, Gary C. [D-MI]</fullName>
<middleName>C.</middleName>
<state>MI</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>True</isOriginalCosponsor>
<identifiers>
<gpoId>7994</gpoId>
<bioguideId>P000595</bioguideId>
<lisID>1929</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-03-29</sponsorshipDate>
<party>R</party>
<firstName>JIM</firstName>
<bioguideId>I000024</bioguideId>
<lastName>INHOFE</lastName>
<fullName>Sen. Inhofe, James M. [R-OK]</fullName>
<middleName />
<state>OK</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>True</isOriginalCosponsor>
<identifiers>
<gpoId>8322</gpoId>
<bioguideId>I000024</bioguideId>
<lisID>583</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-03-29</sponsorshipDate>
<party>R</party>
<firstName>Thomas</firstName>
<bioguideId>T000476</bioguideId>
<lastName>Tillis</lastName>
<fullName>Sen. Tillis, Thom [R-NC]</fullName>
<middleName>Roland</middleName>
<state>NC</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>True</isOriginalCosponsor>
<identifiers>
<bioguideId>T000476</bioguideId>
<gpoId />
<lisID>2291</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-03-29</sponsorshipDate>
<party>R</party>
<firstName>Lisa</firstName>
<bioguideId>M001153</bioguideId>
<lastName>Murkowski</lastName>
<fullName>Sen. Murkowski, Lisa [R-AK]</fullName>
<middleName />
<state>AK</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>True</isOriginalCosponsor>
<identifiers>
<bioguideId>M001153</bioguideId>
<lisID>1694</lisID>
<gpoId>8234</gpoId>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-05-24</sponsorshipDate>
<party>D</party>
<firstName>RON</firstName>
<bioguideId>W000779</bioguideId>
<lastName>WYDEN</lastName>
<fullName>Sen. Wyden, Ron [D-OR]</fullName>
<middleName />
<state>OR</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>W000779</bioguideId>
<lisID>1247</lisID>
<gpoId>8265</gpoId>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-05-24</sponsorshipDate>
<party>D</party>
<firstName>TOM</firstName>
<bioguideId>U000039</bioguideId>
<lastName>UDALL</lastName>
<fullName>Sen. Udall, Tom [D-NM]</fullName>
<middleName />
<state>NM</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>U000039</bioguideId>
<lisID>1567</lisID>
<gpoId>8260</gpoId>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-05-24</sponsorshipDate>
<party>D</party>
<firstName>Brian</firstName>
<bioguideId>S001194</bioguideId>
<lastName>Schatz</lastName>
<fullName>Sen. Schatz, Brian [D-HI]</fullName>
<middleName />
<state>HI</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<lisID>2173</lisID>
<bioguideId>S001194</bioguideId>
<gpoId />
</identifiers>
</item>
<item>
<sponsorshipDate>2017-05-24</sponsorshipDate>
<party>I</party>
<firstName>Angus</firstName>
<bioguideId>K000383</bioguideId>
<lastName>King</lastName>
<fullName>Sen. King, Angus S., Jr. [I-ME]</fullName>
<middleName />
<state>ME</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>K000383</bioguideId>
<lisID>2185</lisID>
<gpoId />
</identifiers>
</item>
<item>
<sponsorshipDate>2017-05-24</sponsorshipDate>
<party>R</party>
<firstName>John</firstName>
<bioguideId>K000393</bioguideId>
<lastName>Kennedy</lastName>
<fullName>Sen. Kennedy, John [R-LA]</fullName>
<middleName>Neely</middleName>
<state>LA</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>K000393</bioguideId>
<lisID>2303</lisID>
<gpoId />
</identifiers>
</item>
<item>
<sponsorshipDate>2017-05-24</sponsorshipDate>
<party>R</party>
<firstName>SUSAN</firstName>
<bioguideId>C001035</bioguideId>
<lastName>COLLINS</lastName>
<fullName>Sen. Collins, Susan M. [R-ME]</fullName>
<middleName>MARGARET</middleName>
<state>ME</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<gpoId>8291</gpoId>
<bioguideId>C001035</bioguideId>
<lisID>1541</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-05-24</sponsorshipDate>
<party>R</party>
<firstName>Bill</firstName>
<bioguideId>C001075</bioguideId>
<lastName>Cassidy</lastName>
<fullName>Sen. Cassidy, Bill [R-LA]</fullName>
<middleName />
<state>LA</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>C001075</bioguideId>
<gpoId>7964</gpoId>
<lisID>1925</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-07-11</sponsorshipDate>
<party>R</party>
<firstName>ROB</firstName>
<bioguideId>P000449</bioguideId>
<lastName>PORTMAN</lastName>
<fullName>Sen. Portman, Rob [R-OH]</fullName>
<middleName />
<state>OH</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<gpoId>8266</gpoId>
<bioguideId>P000449</bioguideId>
<lisID>924</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-07-11</sponsorshipDate>
<party>D</party>
<firstName>Chris</firstName>
<bioguideId>V000128</bioguideId>
<lastName>Van Hollen</lastName>
<fullName>Sen. Van Hollen, Chris [D-MD]</fullName>
<middleName />
<state>MD</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>V000128</bioguideId>
<gpoId>7983</gpoId>
<lisID>1729</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-07-11</sponsorshipDate>
<party>D</party>
<firstName>Elizabeth</firstName>
<bioguideId>W000817</bioguideId>
<lastName>Warren</lastName>
<fullName>Sen. Warren, Elizabeth [D-MA]</fullName>
<middleName>A.</middleName>
<state>MA</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>W000817</bioguideId>
<lisID>2182</lisID>
<gpoId />
</identifiers>
</item>
<item>
<sponsorshipDate>2017-07-11</sponsorshipDate>
<party>D</party>
<firstName>EDWARD</firstName>
<bioguideId>M000133</bioguideId>
<lastName>MARKEY</lastName>
<fullName>Sen. Markey, Edward J. [D-MA]</fullName>
<middleName>J.</middleName>
<state>MA</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<gpoId>7972</gpoId>
<bioguideId>M000133</bioguideId>
<lisID>735</lisID>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-08-03</sponsorshipDate>
<party>D</party>
<firstName>Jeanne</firstName>
<bioguideId>S001181</bioguideId>
<lastName>Shaheen</lastName>
<fullName>Sen. Shaheen, Jeanne [D-NH]</fullName>
<middleName />
<state>NH</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<lisID>1901</lisID>
<bioguideId>S001181</bioguideId>
<gpoId>8276</gpoId>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-08-03</sponsorshipDate>
<party>R</party>
<firstName>Marco</firstName>
<bioguideId>R000595</bioguideId>
<lastName>Rubio</lastName>
<fullName>Sen. Rubio, Marco [R-FL]</fullName>
<middleName />
<state>FL</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>R000595</bioguideId>
<lisID>2084</lisID>
<gpoId>8242</gpoId>
</identifiers>
</item>
<item>
<sponsorshipDate>2017-08-03</sponsorshipDate>
<party>D</party>
<firstName>Christopher</firstName>
<bioguideId>M001169</bioguideId>
<lastName>Murphy</lastName>
<fullName>Sen. Murphy, Christopher [D-CT]</fullName>
<middleName />
<state>CT</state>
<sponsorshipWithdrawnDate />
<isOriginalCosponsor>False</isOriginalCosponsor>
<identifiers>
<bioguideId>M001169</bioguideId>
<lisID>1837</lisID>
<gpoId>7870</gpoId>
</identifiers>
</item>
</cosponsors>
<recordedVotes />
<committees>
<billCommittees>
<item>
<subcommittees>
<item>
<activities>
<item>
<name>Referred to</name>
<date>2017-08-08T13:15:20Z</date>
</item>
</activities>
<name>Water, Power and Oceans Subcommittee</name>
<systemCode>hsii13</systemCode>
</item>
</subcommittees>
<systemCode>hsii00</systemCode>
<type>Standing</type>
<name>Natural Resources Committee</name>
<activities>
<item>
<name>Referred to</name>
<date>2017-08-04T18:45:05Z</date>
</item>
</activities>
<chamber>House</chamber>
</item>
<item>
<subcommittees />
<systemCode>hspw00</systemCode>
<type>Standing</type>
<name>Transportation and Infrastructure Committee</name>
<activities>
<item>
<name>Referred to</name>
<date>2017-08-04T18:45:04Z</date>
</item>
</activities>
<chamber>House</chamber>
</item>
<item>
<subcommittees />
<systemCode>sscm00</systemCode>
<type>Standing</type>
<name>Commerce, Science, and Transportation Committee</name>
<activities>
<item>
<name>Reported by</name>
<date>2017-07-24T23:07:55Z</date>
</item>
<item>
<name>Markup by</name>
<date>2017-04-05T14:00:00Z</date>
</item>
<item>
<name>Referred to</name>
<date>2017-03-29T15:21:19Z</date>
</item>
</activities>
<chamber>Senate</chamber>
</item>
</billCommittees>
</committees>
</bill>
<dublinCore xmlns:dc="http://purl.org/dc/elements/1.1/">
<dc:format>text/xml</dc:format>
<dc:language>EN</dc:language>
<dc:rights>Pursuant to Title 17 Section 105 of the United States Code, this file is not subject to copyright protection and is in the public domain.</dc:rights>
<dc:contributor>Congressional Research Service, Library of Congress</dc:contributor>
<dc:description>This file contains bill summaries and statuses for federal legislation. A bill summary describes the most significant provisions of a piece of legislation and details the effects the legislative text may have on current law and federal programs. Bill summaries are authored by the Congressional Research Service (CRS) of the Library of Congress. As stated in Public Law 91-510 (2 USC 166 (d)(6)), one of the duties of CRS is "to prepare summaries and digests of bills and resolutions of a public general nature introduced in the Senate or House of Representatives". For more information, refer to the User Guide that accompanies this file.</dc:description>
</dublinCore>
</billStatus>
| 34.881106 | 676 | 0.563626 |
4859f7e071b84e1aeafa762ee334d82046b6619c | 2,283 | xml | XML | p1/p1-t22/p1-t22-c175-s195.xml | morrissinger/MassGenLaws | 8d740ef0e0fb8334174fac7ff1ab97c579f54862 | [
"Unlicense"
] | 1 | 2020-11-25T20:33:55.000Z | 2020-11-25T20:33:55.000Z | p1/p1-t22/p1-t22-c175-s195.xml | morrissinger/MassGenLaws | 8d740ef0e0fb8334174fac7ff1ab97c579f54862 | [
"Unlicense"
] | null | null | null | p1/p1-t22/p1-t22-c175-s195.xml | morrissinger/MassGenLaws | 8d740ef0e0fb8334174fac7ff1ab97c579f54862 | [
"Unlicense"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<law>
<structure>
<unit label="part" identifier="1" order_by="1" level="1">Administration Of The Government</unit>
<unit label="title" identifier="22" order_by="22" level="2">Corporations</unit>
<unit label="chapter" identifier="175" order_by="175" level="3">Insurance</unit>
</structure>
<section_number>195</section_number>
<catch_line>Insurance Companies Writing Fire And Multiple Peril Policies Required To Contribute To Costs Of Training Firefighting Personnel, Enforcement Of Certain Fire Code Regulations, Fire Education Programs, Equipment And Facility Improvements</catch_line>
<order_by>195</order_by>
<text>
<section prefix="a">
Sums for the estimated expenses for the purposes specified in subsection (b) shall be paid to the commonwealth by insurance companies writing fire, homeowners multiple peril or commercial multiple peril policies on property situated in the commonwealth within 30 days after notice from the commissioner of such estimated expenses. The commissioner shall apportion such estimated charges among all such companies and shall assess them for the same on a fair and reasonable basis. The commissioner shall subsequently apportion actual costs among all such companies and shall make assessment adjustments for the same for any variation between estimated and actual costs on a fair and reasonable basis. Such estimated and actual costs shall include an amount equal to the cost of fringe benefits as established by the secretary of administration and finance under section 6B of chapter 29.
</section>
<section prefix="b">
The costs to be paid under subsection (a) shall be for the following purposes: (1) the operation of state fire training facilities and curriculum for firefighting personnel; (2) implementing sections 26G1/2 and 34A to 34D, inclusive, of chapter 148, and chapter 304 of the acts of 2004; (3) student awareness of fire education programs; (4) the firefighting equipment grant program; and (5) capital improvements to state fire service facilities, including reimbursing the General Fund for debt service on bonds issued to pay for these capital improvements.
</section>
</text>
</law> | 120.157895 | 895 | 0.766535 |
94c9abbbb41e95850a91de8ada10a4e4032bf1d0 | 1,153 | xml | XML | RFC-cite-refs/xml/reference.RFC.7264.xml | matcdac/IETF_RFCs | c73caa411e90949c468478d1b3fb094260e4506e | [
"ADSL"
] | null | null | null | RFC-cite-refs/xml/reference.RFC.7264.xml | matcdac/IETF_RFCs | c73caa411e90949c468478d1b3fb094260e4506e | [
"ADSL"
] | null | null | null | RFC-cite-refs/xml/reference.RFC.7264.xml | matcdac/IETF_RFCs | c73caa411e90949c468478d1b3fb094260e4506e | [
"ADSL"
] | 1 | 2021-12-09T08:28:12.000Z | 2021-12-09T08:28:12.000Z | <?xml version='1.0' encoding='UTF-8'?>
<reference anchor='RFC7264' target='https://www.rfc-editor.org/info/rfc7264'>
<front>
<title>An Extension to the REsource LOcation And Discovery (RELOAD) Protocol to Support Relay Peer Routing</title>
<author initials='N.' surname='Zong' fullname='N. Zong'><organization /></author>
<author initials='X.' surname='Jiang' fullname='X. Jiang'><organization /></author>
<author initials='R.' surname='Even' fullname='R. Even'><organization /></author>
<author initials='Y.' surname='Zhang' fullname='Y. Zhang'><organization /></author>
<date year='2014' month='June' />
<abstract><t>This document defines an optional extension to the REsource LOcation And Discovery (RELOAD) protocol to support the relay peer routing mode. RELOAD recommends symmetric recursive routing for routing messages. The new optional extension provides a shorter route for responses, thereby reducing overhead on intermediate peers. This document also describes potential cases where this extension can be used.</t></abstract>
</front>
<seriesInfo name='RFC' value='7264'/>
<seriesInfo name='DOI' value='10.17487/RFC7264'/>
</reference>
| 72.0625 | 434 | 0.752819 |
a9fc906544b729f084b18045a7b7a9703a6ae59a | 30,395 | xml | XML | XML/Q99973.xml | griffincalme/ATP-binding_lysine_Yue_Qi | b673bf7990acb63097cd6c804be81758012b4c7e | [
"MIT"
] | null | null | null | XML/Q99973.xml | griffincalme/ATP-binding_lysine_Yue_Qi | b673bf7990acb63097cd6c804be81758012b4c7e | [
"MIT"
] | null | null | null | XML/Q99973.xml | griffincalme/ATP-binding_lysine_Yue_Qi | b673bf7990acb63097cd6c804be81758012b4c7e | [
"MIT"
] | null | null | null | <?xml version='1.0' encoding='UTF-8'?>
<uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry dataset="Swiss-Prot" created="2004-05-24" modified="2017-05-10" version="153">
<accession>Q99973</accession>
<accession>A0AUV9</accession>
<name>TEP1_HUMAN</name>
<protein>
<recommendedName>
<fullName>Telomerase protein component 1</fullName>
</recommendedName>
<alternativeName>
<fullName>Telomerase-associated protein 1</fullName>
<shortName>Telomerase protein 1</shortName>
</alternativeName>
<alternativeName>
<fullName>p240</fullName>
</alternativeName>
<alternativeName>
<fullName>p80 telomerase homolog</fullName>
</alternativeName>
</protein>
<gene>
<name type="primary">TEP1</name>
<name type="synonym">TLP1</name>
<name type="synonym">TP1</name>
</gene>
<organism>
<name type="scientific">Homo sapiens</name>
<name type="common">Human</name>
<dbReference type="NCBI Taxonomy" id="9606"/>
<lineage>
<taxon>Eukaryota</taxon>
<taxon>Metazoa</taxon>
<taxon>Chordata</taxon>
<taxon>Craniata</taxon>
<taxon>Vertebrata</taxon>
<taxon>Euteleostomi</taxon>
<taxon>Mammalia</taxon>
<taxon>Eutheria</taxon>
<taxon>Euarchontoglires</taxon>
<taxon>Primates</taxon>
<taxon>Haplorrhini</taxon>
<taxon>Catarrhini</taxon>
<taxon>Hominidae</taxon>
<taxon>Homo</taxon>
</lineage>
</organism>
<reference key="1">
<citation type="journal article" date="1997" name="Science" volume="275" first="973" last="977">
<title>A mammalian telomerase-associated protein.</title>
<authorList>
<person name="Harrington L."/>
<person name="McPhail T."/>
<person name="Mar V."/>
<person name="Zhou W."/>
<person name="Oulton R."/>
<person name="Bass M.B."/>
<person name="Arruda I."/>
<person name="Robinson M.O."/>
</authorList>
<dbReference type="PubMed" id="9020079"/>
<dbReference type="DOI" id="10.1126/science.275.5302.973"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1)</scope>
<scope>TISSUE SPECIFICITY</scope>
<scope>VARIANTS PRO-116; GLY-553; CYS-1055; GLN-1155 AND PRO-1195</scope>
</reference>
<reference key="2">
<citation type="journal article" date="2004" name="Genome Res." volume="14" first="2121" last="2127">
<title>The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).</title>
<authorList>
<consortium name="The MGC Project Team"/>
</authorList>
<dbReference type="PubMed" id="15489334"/>
<dbReference type="DOI" id="10.1101/gr.2596504"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1)</scope>
<source>
<tissue>Cerebellum</tissue>
</source>
</reference>
<reference key="3">
<citation type="journal article" date="2007" name="BMC Genomics" volume="8" first="399" last="399">
<title>The full-ORF clone resource of the German cDNA consortium.</title>
<authorList>
<person name="Bechtel S."/>
<person name="Rosenfelder H."/>
<person name="Duda A."/>
<person name="Schmidt C.P."/>
<person name="Ernst U."/>
<person name="Wellenreuther R."/>
<person name="Mehrle A."/>
<person name="Schuster C."/>
<person name="Bahr A."/>
<person name="Bloecker H."/>
<person name="Heubner D."/>
<person name="Hoerlein A."/>
<person name="Michel G."/>
<person name="Wedler H."/>
<person name="Koehrer K."/>
<person name="Ottenwaelder B."/>
<person name="Poustka A."/>
<person name="Wiemann S."/>
<person name="Schupp I."/>
</authorList>
<dbReference type="PubMed" id="17974005"/>
<dbReference type="DOI" id="10.1186/1471-2164-8-399"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2288-2627 (ISOFORM 2)</scope>
<source>
<tissue>Salivary gland</tissue>
</source>
</reference>
<reference key="4">
<citation type="journal article" date="1997" name="Genes Dev." volume="11" first="3109" last="3115">
<title>Human telomerase contains evolutionarily conserved catalytic and structural subunits.</title>
<authorList>
<person name="Harrington L."/>
<person name="Zhou W."/>
<person name="McPhail T."/>
<person name="Oulton R."/>
<person name="Yeung D.S."/>
<person name="Mar V."/>
<person name="Bass M.B."/>
<person name="Robinson M.O."/>
</authorList>
<dbReference type="PubMed" id="9389643"/>
<dbReference type="DOI" id="10.1101/gad.11.23.3109"/>
</citation>
<scope>IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX</scope>
</reference>
<reference key="5">
<citation type="journal article" date="1999" name="J. Biol. Chem." volume="274" first="32712" last="32717">
<title>Vaults and telomerase share a common subunit, TEP1.</title>
<authorList>
<person name="Kickhoefer V.A."/>
<person name="Stephen A.G."/>
<person name="Harrington L."/>
<person name="Robinson M.O."/>
<person name="Rome L.H."/>
</authorList>
<dbReference type="PubMed" id="10551828"/>
<dbReference type="DOI" id="10.1074/jbc.274.46.32712"/>
</citation>
<scope>IDENTIFICATION IN THE VAULTS RIBONUCLEOPROTEIN PARTICLE</scope>
<scope>RNA-BINDING</scope>
</reference>
<reference key="6">
<citation type="journal article" date="2000" name="Mol. Biol. Cell" volume="11" first="3329" last="3340">
<title>Polymerization defects within human telomerase are distinct from telomerase RNA and TEP1 binding.</title>
<authorList>
<person name="Beattie T.L."/>
<person name="Zhou W."/>
<person name="Robinson M.O."/>
<person name="Harrington L."/>
</authorList>
<dbReference type="PubMed" id="11029039"/>
<dbReference type="DOI" id="10.1091/mbc.11.10.3329"/>
</citation>
<scope>IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX</scope>
</reference>
<reference key="7">
<citation type="journal article" date="2009" name="Science" volume="323" first="644" last="648">
<title>A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis.</title>
<authorList>
<person name="Venteicher A.S."/>
<person name="Abreu E.B."/>
<person name="Meng Z."/>
<person name="McCann K.E."/>
<person name="Terns R.M."/>
<person name="Veenstra T.D."/>
<person name="Terns M.P."/>
<person name="Artandi S.E."/>
</authorList>
<dbReference type="PubMed" id="19179534"/>
<dbReference type="DOI" id="10.1126/science.1165357"/>
</citation>
<scope>IDENTIFICATION IN THE TELOMERASE HOLOENZYME COMPLEX</scope>
</reference>
<comment type="function">
<text evidence="1">Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC (By similarity).</text>
</comment>
<comment type="subunit">
<text evidence="1">Component of the telomerase holoenzyme complex at least composed of TERT, DKC1, WRAP53/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). Component of the vault ribonucleoprotein particle, at least composed of MVP, PARP4 and one or more vault RNAs (vRNAs). Binds to VAULTRC1, VAULTRC2 and VAULTRC4/hvg4 vRNAs (By similarity).</text>
</comment>
<comment type="subcellular location">
<subcellularLocation>
<location evidence="6">Nucleus</location>
</subcellularLocation>
<subcellularLocation>
<location>Chromosome</location>
<location>Telomere</location>
</subcellularLocation>
</comment>
<comment type="alternative products">
<event type="alternative splicing"/>
<isoform>
<id>Q99973-1</id>
<name>1</name>
<sequence type="displayed"/>
</isoform>
<isoform>
<id>Q99973-2</id>
<name>2</name>
<sequence type="described" ref="VSP_010359"/>
<text>May be due to an exon inclusion.</text>
</isoform>
</comment>
<comment type="tissue specificity">
<text evidence="4">Ubiquitous.</text>
</comment>
<dbReference type="EMBL" id="U86136">
<property type="protein sequence ID" value="AAC51107.1"/>
<property type="molecule type" value="mRNA"/>
</dbReference>
<dbReference type="EMBL" id="BC126107">
<property type="protein sequence ID" value="AAI26108.1"/>
<property type="molecule type" value="mRNA"/>
</dbReference>
<dbReference type="EMBL" id="BX640983">
<property type="protein sequence ID" value="CAE45993.1"/>
<property type="molecule type" value="mRNA"/>
</dbReference>
<dbReference type="CCDS" id="CCDS9548.1">
<molecule id="Q99973-1"/>
</dbReference>
<dbReference type="RefSeq" id="NP_009041.2">
<molecule id="Q99973-1"/>
<property type="nucleotide sequence ID" value="NM_007110.4"/>
</dbReference>
<dbReference type="RefSeq" id="XP_005268084.1">
<molecule id="Q99973-1"/>
<property type="nucleotide sequence ID" value="XM_005268027.4"/>
</dbReference>
<dbReference type="UniGene" id="Hs.508835"/>
<dbReference type="ProteinModelPortal" id="Q99973"/>
<dbReference type="BioGrid" id="112870">
<property type="interactions" value="13"/>
</dbReference>
<dbReference type="IntAct" id="Q99973">
<property type="interactions" value="1"/>
</dbReference>
<dbReference type="MINT" id="MINT-112815"/>
<dbReference type="STRING" id="9606.ENSP00000262715"/>
<dbReference type="iPTMnet" id="Q99973"/>
<dbReference type="PhosphoSitePlus" id="Q99973"/>
<dbReference type="SwissPalm" id="Q99973"/>
<dbReference type="BioMuta" id="TEP1"/>
<dbReference type="DMDM" id="215273899"/>
<dbReference type="EPD" id="Q99973"/>
<dbReference type="MaxQB" id="Q99973"/>
<dbReference type="PaxDb" id="Q99973"/>
<dbReference type="PeptideAtlas" id="Q99973"/>
<dbReference type="PRIDE" id="Q99973"/>
<dbReference type="Ensembl" id="ENST00000262715">
<molecule id="Q99973-1"/>
<property type="protein sequence ID" value="ENSP00000262715"/>
<property type="gene ID" value="ENSG00000129566"/>
</dbReference>
<dbReference type="GeneID" id="7011"/>
<dbReference type="KEGG" id="hsa:7011"/>
<dbReference type="UCSC" id="uc001vxe.4">
<molecule id="Q99973-1"/>
<property type="organism name" value="human"/>
</dbReference>
<dbReference type="CTD" id="7011"/>
<dbReference type="DisGeNET" id="7011"/>
<dbReference type="GeneCards" id="TEP1"/>
<dbReference type="H-InvDB" id="HIX0026646"/>
<dbReference type="HGNC" id="HGNC:11726">
<property type="gene designation" value="TEP1"/>
</dbReference>
<dbReference type="HPA" id="HPA029206"/>
<dbReference type="MIM" id="601686">
<property type="type" value="gene"/>
</dbReference>
<dbReference type="neXtProt" id="NX_Q99973"/>
<dbReference type="OpenTargets" id="ENSG00000129566"/>
<dbReference type="PharmGKB" id="PA36443"/>
<dbReference type="eggNOG" id="KOG3602">
<property type="taxonomic scope" value="Eukaryota"/>
</dbReference>
<dbReference type="eggNOG" id="KOG4155">
<property type="taxonomic scope" value="Eukaryota"/>
</dbReference>
<dbReference type="eggNOG" id="ENOG410XP3K">
<property type="taxonomic scope" value="LUCA"/>
</dbReference>
<dbReference type="GeneTree" id="ENSGT00870000136448"/>
<dbReference type="HOGENOM" id="HOG000154545"/>
<dbReference type="HOVERGEN" id="HBG059633"/>
<dbReference type="InParanoid" id="Q99973"/>
<dbReference type="KO" id="K11127"/>
<dbReference type="OMA" id="AQLWKTC"/>
<dbReference type="OrthoDB" id="EOG091G003L"/>
<dbReference type="PhylomeDB" id="Q99973"/>
<dbReference type="TreeFam" id="TF328424"/>
<dbReference type="SignaLink" id="Q99973"/>
<dbReference type="ChiTaRS" id="TEP1">
<property type="organism name" value="human"/>
</dbReference>
<dbReference type="GeneWiki" id="TEP1"/>
<dbReference type="GenomeRNAi" id="7011"/>
<dbReference type="PRO" id="PR:Q99973"/>
<dbReference type="Proteomes" id="UP000005640">
<property type="component" value="Chromosome 14"/>
</dbReference>
<dbReference type="Bgee" id="ENSG00000129566"/>
<dbReference type="CleanEx" id="HS_TEP1"/>
<dbReference type="ExpressionAtlas" id="Q99973">
<property type="expression patterns" value="baseline and differential"/>
</dbReference>
<dbReference type="Genevisible" id="Q99973">
<property type="organism ID" value="HS"/>
</dbReference>
<dbReference type="GO" id="GO:0071013">
<property type="term" value="C:catalytic step 2 spliceosome"/>
<property type="evidence" value="ECO:0000318"/>
<property type="project" value="GO_Central"/>
</dbReference>
<dbReference type="GO" id="GO:0000781">
<property type="term" value="C:chromosome, telomeric region"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-SubCell"/>
</dbReference>
<dbReference type="GO" id="GO:0005737">
<property type="term" value="C:cytoplasm"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="MGI"/>
</dbReference>
<dbReference type="GO" id="GO:0030529">
<property type="term" value="C:intracellular ribonucleoprotein complex"/>
<property type="evidence" value="ECO:0000304"/>
<property type="project" value="UniProtKB"/>
</dbReference>
<dbReference type="GO" id="GO:0016363">
<property type="term" value="C:nuclear matrix"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="MGI"/>
</dbReference>
<dbReference type="GO" id="GO:0071011">
<property type="term" value="C:precatalytic spliceosome"/>
<property type="evidence" value="ECO:0000318"/>
<property type="project" value="GO_Central"/>
</dbReference>
<dbReference type="GO" id="GO:0005697">
<property type="term" value="C:telomerase holoenzyme complex"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="UniProtKB"/>
</dbReference>
<dbReference type="GO" id="GO:0005682">
<property type="term" value="C:U5 snRNP"/>
<property type="evidence" value="ECO:0000318"/>
<property type="project" value="GO_Central"/>
</dbReference>
<dbReference type="GO" id="GO:0005524">
<property type="term" value="F:ATP binding"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-KW"/>
</dbReference>
<dbReference type="GO" id="GO:0019899">
<property type="term" value="F:enzyme binding"/>
<property type="evidence" value="ECO:0000353"/>
<property type="project" value="BHF-UCL"/>
</dbReference>
<dbReference type="GO" id="GO:0002039">
<property type="term" value="F:p53 binding"/>
<property type="evidence" value="ECO:0000353"/>
<property type="project" value="BHF-UCL"/>
</dbReference>
<dbReference type="GO" id="GO:0003723">
<property type="term" value="F:RNA binding"/>
<property type="evidence" value="ECO:0000250"/>
<property type="project" value="UniProtKB"/>
</dbReference>
<dbReference type="GO" id="GO:0003720">
<property type="term" value="F:telomerase activity"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="Ensembl"/>
</dbReference>
<dbReference type="GO" id="GO:0070034">
<property type="term" value="F:telomerase RNA binding"/>
<property type="evidence" value="ECO:0000250"/>
<property type="project" value="BHF-UCL"/>
</dbReference>
<dbReference type="GO" id="GO:0008380">
<property type="term" value="P:RNA splicing"/>
<property type="evidence" value="ECO:0000318"/>
<property type="project" value="GO_Central"/>
</dbReference>
<dbReference type="GO" id="GO:0000722">
<property type="term" value="P:telomere maintenance via recombination"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="UniProtKB"/>
</dbReference>
<dbReference type="Gene3D" id="2.130.10.10">
<property type="match status" value="5"/>
</dbReference>
<dbReference type="InterPro" id="IPR025139">
<property type="entry name" value="DUF4062"/>
</dbReference>
<dbReference type="InterPro" id="IPR007111">
<property type="entry name" value="NACHT_NTPase"/>
</dbReference>
<dbReference type="InterPro" id="IPR027417">
<property type="entry name" value="P-loop_NTPase"/>
</dbReference>
<dbReference type="InterPro" id="IPR008850">
<property type="entry name" value="TEP1_N"/>
</dbReference>
<dbReference type="InterPro" id="IPR008858">
<property type="entry name" value="TROVE_dom"/>
</dbReference>
<dbReference type="InterPro" id="IPR015943">
<property type="entry name" value="WD40/YVTN_repeat-like_dom"/>
</dbReference>
<dbReference type="InterPro" id="IPR001680">
<property type="entry name" value="WD40_repeat"/>
</dbReference>
<dbReference type="InterPro" id="IPR019775">
<property type="entry name" value="WD40_repeat_CS"/>
</dbReference>
<dbReference type="InterPro" id="IPR017986">
<property type="entry name" value="WD40_repeat_dom"/>
</dbReference>
<dbReference type="Pfam" id="PF13271">
<property type="entry name" value="DUF4062"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="Pfam" id="PF05386">
<property type="entry name" value="TEP1_N"/>
<property type="match status" value="4"/>
</dbReference>
<dbReference type="Pfam" id="PF05731">
<property type="entry name" value="TROVE"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="Pfam" id="PF00400">
<property type="entry name" value="WD40"/>
<property type="match status" value="5"/>
</dbReference>
<dbReference type="SMART" id="SM00320">
<property type="entry name" value="WD40"/>
<property type="match status" value="18"/>
</dbReference>
<dbReference type="SUPFAM" id="SSF50978">
<property type="entry name" value="SSF50978"/>
<property type="match status" value="5"/>
</dbReference>
<dbReference type="SUPFAM" id="SSF52540">
<property type="entry name" value="SSF52540"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS50837">
<property type="entry name" value="NACHT"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS51226">
<property type="entry name" value="TEP1_N"/>
<property type="match status" value="4"/>
</dbReference>
<dbReference type="PROSITE" id="PS50988">
<property type="entry name" value="TROVE"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS00678">
<property type="entry name" value="WD_REPEATS_1"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS50082">
<property type="entry name" value="WD_REPEATS_2"/>
<property type="match status" value="7"/>
</dbReference>
<dbReference type="PROSITE" id="PS50294">
<property type="entry name" value="WD_REPEATS_REGION"/>
<property type="match status" value="2"/>
</dbReference>
<proteinExistence type="evidence at protein level"/>
<keyword id="KW-0025">Alternative splicing</keyword>
<keyword id="KW-0067">ATP-binding</keyword>
<keyword id="KW-0158">Chromosome</keyword>
<keyword id="KW-0181">Complete proteome</keyword>
<keyword id="KW-0547">Nucleotide-binding</keyword>
<keyword id="KW-0539">Nucleus</keyword>
<keyword id="KW-0621">Polymorphism</keyword>
<keyword id="KW-1185">Reference proteome</keyword>
<keyword id="KW-0677">Repeat</keyword>
<keyword id="KW-0687">Ribonucleoprotein</keyword>
<keyword id="KW-0694">RNA-binding</keyword>
<keyword id="KW-0779">Telomere</keyword>
<keyword id="KW-0853">WD repeat</keyword>
<feature type="chain" description="Telomerase protein component 1" id="PRO_0000050982">
<location>
<begin position="1"/>
<end position="2627"/>
</location>
</feature>
<feature type="repeat" description="TEP1 N-terminal 1">
<location>
<begin position="1"/>
<end position="30"/>
</location>
</feature>
<feature type="repeat" description="TEP1 N-terminal 2">
<location>
<begin position="31"/>
<end position="60"/>
</location>
</feature>
<feature type="repeat" description="TEP1 N-terminal 3">
<location>
<begin position="61"/>
<end position="90"/>
</location>
</feature>
<feature type="repeat" description="TEP1 N-terminal 4">
<location>
<begin position="91"/>
<end position="120"/>
</location>
</feature>
<feature type="domain" description="TROVE" evidence="3">
<location>
<begin position="223"/>
<end position="676"/>
</location>
</feature>
<feature type="domain" description="NACHT" evidence="2">
<location>
<begin position="1162"/>
<end position="1490"/>
</location>
</feature>
<feature type="repeat" description="WD 1">
<location>
<begin position="1411"/>
<end position="1448"/>
</location>
</feature>
<feature type="repeat" description="WD 2">
<location>
<begin position="1674"/>
<end position="1713"/>
</location>
</feature>
<feature type="repeat" description="WD 3">
<location>
<begin position="1716"/>
<end position="1754"/>
</location>
</feature>
<feature type="repeat" description="WD 4">
<location>
<begin position="1757"/>
<end position="1796"/>
</location>
</feature>
<feature type="repeat" description="WD 5">
<location>
<begin position="1798"/>
<end position="1837"/>
</location>
</feature>
<feature type="repeat" description="WD 6">
<location>
<begin position="1840"/>
<end position="1879"/>
</location>
</feature>
<feature type="repeat" description="WD 7">
<location>
<begin position="1882"/>
<end position="1921"/>
</location>
</feature>
<feature type="repeat" description="WD 8">
<location>
<begin position="1925"/>
<end position="1964"/>
</location>
</feature>
<feature type="repeat" description="WD 9">
<location>
<begin position="1967"/>
<end position="2005"/>
</location>
</feature>
<feature type="repeat" description="WD 10">
<location>
<begin position="2008"/>
<end position="2047"/>
</location>
</feature>
<feature type="repeat" description="WD 11">
<location>
<begin position="2059"/>
<end position="2098"/>
</location>
</feature>
<feature type="repeat" description="WD 12">
<location>
<begin position="2105"/>
<end position="2143"/>
</location>
</feature>
<feature type="repeat" description="WD 13">
<location>
<begin position="2146"/>
<end position="2183"/>
</location>
</feature>
<feature type="repeat" description="WD 14">
<location>
<begin position="2185"/>
<end position="2233"/>
</location>
</feature>
<feature type="repeat" description="WD 15">
<location>
<begin position="2236"/>
<end position="2275"/>
</location>
</feature>
<feature type="repeat" description="WD 16">
<location>
<begin position="2278"/>
<end position="2317"/>
</location>
</feature>
<feature type="repeat" description="WD 17">
<location>
<begin position="2319"/>
<end position="2355"/>
</location>
</feature>
<feature type="repeat" description="WD 18">
<location>
<begin position="2368"/>
<end position="2417"/>
</location>
</feature>
<feature type="repeat" description="WD 19">
<location>
<begin position="2459"/>
<end position="2500"/>
</location>
</feature>
<feature type="repeat" description="WD 20">
<location>
<begin position="2553"/>
<end position="2590"/>
</location>
</feature>
<feature type="repeat" description="WD 21">
<location>
<begin position="2592"/>
<end position="2626"/>
</location>
</feature>
<feature type="nucleotide phosphate-binding region" description="ATP" evidence="2">
<location>
<begin position="1168"/>
<end position="1175"/>
</location>
</feature>
<feature type="splice variant" description="In isoform 2." id="VSP_010359" evidence="5">
<original>ESSFLCASSDGILWNLAKCSPEGEWTTGNMWQ</original>
<variation>ALMGSYGTWPNAAQKENGPQVTCGR</variation>
<location>
<begin position="2475"/>
<end position="2506"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs1760897." id="VAR_018490" evidence="4">
<original>S</original>
<variation>P</variation>
<location>
<position position="116"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs10083536." id="VAR_047631">
<original>T</original>
<variation>M</variation>
<location>
<position position="137"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs1760898." id="VAR_018491">
<original>N</original>
<variation>K</variation>
<location>
<position position="307"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs2228035." id="VAR_047632">
<original>K</original>
<variation>R</variation>
<location>
<position position="368"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs17111188." id="VAR_047633">
<original>K</original>
<variation>N</variation>
<location>
<position position="434"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs4982051." id="VAR_047634">
<original>S</original>
<variation>L</variation>
<location>
<position position="510"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs2228040." id="VAR_047635" evidence="4">
<original>A</original>
<variation>G</variation>
<location>
<position position="553"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs34179031." id="VAR_047636">
<original>R</original>
<variation>H</variation>
<location>
<position position="933"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs1760903." id="VAR_018492" evidence="4">
<original>R</original>
<variation>C</variation>
<location>
<position position="1055"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs2228041." id="VAR_047637" evidence="4">
<original>R</original>
<variation>Q</variation>
<location>
<position position="1155"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs1760904." id="VAR_018493" evidence="4">
<original>S</original>
<variation>P</variation>
<location>
<position position="1195"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs12886088." id="VAR_047638">
<original>R</original>
<variation>Q</variation>
<location>
<position position="1351"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs2229100." id="VAR_047639">
<original>G</original>
<variation>R</variation>
<location>
<position position="1408"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs1713457." id="VAR_018494">
<original>S</original>
<variation>T</variation>
<location>
<position position="1447"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs1713456." id="VAR_018495">
<original>C</original>
<variation>Y</variation>
<location>
<position position="1468"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs34401320." id="VAR_047640">
<original>R</original>
<variation>Q</variation>
<location>
<position position="1661"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs8022805." id="VAR_047641">
<original>R</original>
<variation>Q</variation>
<location>
<position position="1772"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs1713449." id="VAR_018496">
<original>V</original>
<variation>I</variation>
<location>
<position position="2214"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs35929175." id="VAR_047642">
<original>A</original>
<variation>S</variation>
<location>
<position position="2310"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs938886." id="VAR_018497">
<original>I</original>
<variation>M</variation>
<location>
<position position="2486"/>
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs2104978." id="VAR_018498">
<original>H</original>
<variation>R</variation>
<location>
<position position="2562"/>
</location>
</feature>
<evidence key="1" type="ECO:0000250"/>
<evidence key="2" type="ECO:0000255">
<source>
<dbReference type="PROSITE-ProRule" id="PRU00136"/>
</source>
</evidence>
<evidence key="3" type="ECO:0000255">
<source>
<dbReference type="PROSITE-ProRule" id="PRU00343"/>
</source>
</evidence>
<evidence key="4" type="ECO:0000269">
<source>
<dbReference type="PubMed" id="9020079"/>
</source>
</evidence>
<evidence key="5" type="ECO:0000303">
<source>
<dbReference type="PubMed" id="17974005"/>
</source>
</evidence>
<evidence key="6" type="ECO:0000305"/>
<sequence length="2627" mass="290490" checksum="32628238704A8860" modified="2008-11-25" version="2">
MEKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKT
MEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKS
TVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISA
TETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLTSGDSESHPEPTDHV
LQEKKMALLSLLCSTLVSEVNMNNTSDPTLAAIFEICRELALLEPEFILKASLYARQQLN
VRNVANNILAIAAFLPACRPHLRRYFCAIVQLPSDWIQVAELYQSLAEGDKNKLVPLPAC
LRTAMTDKFAQFDEYQLAKYNPRKHRAKRHPRRPPRSPGMEPPFSHRCFPRYIGFLREEQ
RKFEKAGDTVSEKKNPPRFTLKKLVQRLHIHKPAQHVQALLGYRYPSNLQLFSRSRLPGP
WDSSRAGKRMKLSRPETWERELSLRGNKASVWEELIENGKLPFMAMLRNLCNLLRVGISS
RHHELILQRLQHAKSVIHSRQFPFRFLNAHDAIDALEAQLRNQALPFPSNITLMRRILTR
NEKNRPRRRFLCHLSRQQLRMAMRIPVLYEQLKREKLRVHKARQWKYDGEMLNRYRQALE
TAVNLSVKHSLPLLPGRTVLVYLTDANADRLCPKSNPQGPPLNYALLLIGMMITRAEQVD
VVLCGGDTLKTAVLKAEEGILKTAIKLQAQVQEFDENDGWSLNTFGKYLLSLAGQRVPVD
RVILLGQSMDDGMINVAKQLYWQRVNSKCLFVGILLRRVQYLSTDLNPNDVTLSGCTDAI
LKFIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSLRPLEEDTPSPLAPVSQQGWRSIR
LFISSTFRDMHGERDLLLRSVLPALQARAAPHRISLHGIDLRWGVTEEETRRNRQLEVCL
GEVENAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVMQFLNRNQRLQ
PSAQALIYFRDSSFLSSVPDAWKSDFVSESEEAARRISELKSYLSRQKGITCRRYPCEWG
GVAAGRPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKP
PSPARPRLLQDTVQRLMLPHGRLSLVTGQSGQGKTAFLASLVSALQAPDGAKVASLVFFH
FSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRLLPKSAESLHPGQT
QVLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQSQGAHVLALGP
LEASARARLVREELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQ
VSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVWRT
LPKGTKSWEEAVAAGNSGDPYPMGPFACLVQSLRSLLGEGPLERPGARLCLPDGPLRTAA
KRCYGKRPGLEDTAHILIAAQLWKTCDADASGTFRSCPPEALGDLPYHLLQSGNRGLLSK
FLTNLHVVAAHLELGLVSRLLEAHALYASSVPKEEQKLPEADVAVFRTFLRQQASILSQY
PRLLPQQAANQPLDSPLCHQASLLSRRWHLQHTLRWLNKPRTMKNQQSSSLSLAVSSSPT
AVAFSTNGQRAAVGTANGTVYLLDLRTWQEEKSVVSGCDGISACLFLSDDTLFLTAFDGL
LELWDLQHGCRVLQTKAHQYQITGCCLSPDCRLLATVCLGGCLKLWDTVRGQLAFQHTYP
KSLNCVAFHPEGQVIATGSWAGSISFFQVDGLKVTKDLGAPGASIRTLAFNVPGGVVAVG
RLDSMVELWAWREGARLAAFPAHHGFVAAALFLHAGCQLLTAGEDGKVQVWSGSLGRPRG
HLGSLSLSPALSVALSPDGDRVAVGYRADGIRIYKISSGSQGAQGQALDVAVSALAWLSP
KVLVSGAEDGSLQGWALKECSLQSLWLLSRFQKPVLGLATSQELLASASEDFTVQLWPRQ
LLTRPHKAEDFPCGTELRGHEGPVSCCSFSTDGGSLATGGRDRSLLCWDVRTPKTPVLIH
SFPACHRDWVTGCAWTKDNLLISCSSDGSVGLWDPESGQRLGQFLGHQSAVSAVAAVEEH
VVSVSRDGTLKVWDHQGVELTSIPAHSGPISHCAAAMEPRAAGQPGSELLVVTVGLDGAT
RLWHPLLVCQTHTLLGHSGPVRAAAVSETSGLMLTASEDGSVRLWQVPKEADDTCIPRSS
AAVTAVAWAPDGSMAVSGNQAGELILWQEAKAVATAQAPGHIGALIWSSAHTFFVLSADE
KISEWQVKLRKGSAPGNLSLHLNRILQEDLGVLTSLDWAPDGHFLILAKADLKLLCMKPG
DAPSEIWSSYTENPMILSTHKEYGIFVLQPKDPGVLSFLRQKESGEFEERLNFDINLENP
SRTLISITQAKPESESSFLCASSDGILWNLAKCSPEGEWTTGNMWQKKANTPETQTPGTD
PSTCRESDASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLW
ERPSMQLLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE
</sequence>
</entry>
<copyright>
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
</copyright>
</uniprot> | 33.998881 | 413 | 0.749268 |
3af527445048a8562d870ae8f81291ff42b24186 | 604 | xml | XML | app/src/main/res/layout/fragment_inbox_compose.xml | ambi-disc/lactation-android | 92eb358c547a09d1f4207fdaae87ad179e34ba23 | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layout/fragment_inbox_compose.xml | ambi-disc/lactation-android | 92eb358c547a09d1f4207fdaae87ad179e34ba23 | [
"Apache-2.0"
] | 1 | 2017-10-03T00:39:48.000Z | 2017-10-03T04:15:01.000Z | app/src/main/res/layout/fragment_inbox_compose.xml | ambi-disc/lactation-android | 92eb358c547a09d1f4207fdaae87ad179e34ba23 | [
"Apache-2.0"
] | null | null | null | <FrameLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:tools="http://schemas.android.com/tools"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
xmlns:app="http://schemas.android.com/apk/res-auto"
tools:context="org.lactor.consultant.inbox.ui.tabfragment.SentInboxFragment">
<!-- TODO: Update blank fragment layout -->
<TextView
android:layout_width="match_parent"
android:layout_height="match_parent"
android:text="Sent"
android:padding="10dp"
android:textSize="34sp" />
</FrameLayout>
| 35.529412 | 81 | 0.701987 |
0a9477859d29e3cfe2ba89fc766b29e7a94e20bc | 6,272 | filters | XML | pratice/open_vr/build/vs-2013/openvr_api.vcxproj.filters | wish-wish/skyheroes | 6411a3834f0ef152371d732ef76321793e5a3955 | [
"MIT"
] | null | null | null | pratice/open_vr/build/vs-2013/openvr_api.vcxproj.filters | wish-wish/skyheroes | 6411a3834f0ef152371d732ef76321793e5a3955 | [
"MIT"
] | null | null | null | pratice/open_vr/build/vs-2013/openvr_api.vcxproj.filters | wish-wish/skyheroes | 6411a3834f0ef152371d732ef76321793e5a3955 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="4.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<ItemGroup>
<Filter Include="headers">
<UniqueIdentifier>{E12E153C-4D0E-94D7-5626-1FAEC284FA38}</UniqueIdentifier>
</Filter>
<Filter Include="samples">
<UniqueIdentifier>{5AFF6082-C6DE-DF1D-CFF6-6AF43B55467F}</UniqueIdentifier>
</Filter>
<Filter Include="samples\driver_sample">
<UniqueIdentifier>{56189FC4-C284-5ABF-8B78-F21CF7A37C27}</UniqueIdentifier>
</Filter>
<Filter Include="samples\hellovr_dx12">
<UniqueIdentifier>{A311F414-8FA0-7DDE-38BF-91D9242D8E84}</UniqueIdentifier>
</Filter>
<Filter Include="samples\hellovr_opengl">
<UniqueIdentifier>{E991743B-D58B-9D8D-BEF8-339EAA9103FA}</UniqueIdentifier>
</Filter>
<Filter Include="samples\hellovr_vulkan">
<UniqueIdentifier>{F5F1264C-E1EB-4F9E-CA58-E6AEB6F1B50A}</UniqueIdentifier>
</Filter>
<Filter Include="samples\helloworldoverlay">
<UniqueIdentifier>{070162D8-73C3-9562-BC73-24EF28756E40}</UniqueIdentifier>
</Filter>
<Filter Include="samples\shared">
<UniqueIdentifier>{607554EE-4C43-48F4-35D7-B81A21442459}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty">
<UniqueIdentifier>{148024A9-0064-E5FE-69C4-DF5155C7CF80}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\glew">
<UniqueIdentifier>{328028C6-9EB7-705D-A7C1-D48013789756}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\glew\glew-1.11.0">
<UniqueIdentifier>{1CC24066-887B-AB10-11DB-C5EA7D936180}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\glew\glew-1.11.0\include">
<UniqueIdentifier>{8F450CAC-FBAA-9F32-8483-410BF0E794A1}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\glew\glew-1.11.0\include\GL">
<UniqueIdentifier>{9160B1E6-7DDE-0180-66D6-BF1752F343A8}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\sdl2-2.0.3">
<UniqueIdentifier>{960EF99A-0227-E0C4-CBD3-6F5E37AB745E}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\sdl2-2.0.3\include">
<UniqueIdentifier>{096C9E8D-7530-9D7D-3E96-CD47AA1939B3}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\vulkan-1.0.49.0">
<UniqueIdentifier>{492674A1-3562-770B-9E74-8F028ACF1F26}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\vulkan-1.0.49.0\include">
<UniqueIdentifier>{BC864380-A8EE-094E-115A-1E64FDE0203A}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\vulkan-1.0.49.0\include\shaderc">
<UniqueIdentifier>{A53FF8AF-91D3-ED57-FA97-470CE64A284A}</UniqueIdentifier>
</Filter>
<Filter Include="samples\thirdparty\vulkan-1.0.49.0\include\vulkan">
<UniqueIdentifier>{DC3C5D6A-4803-BA86-915E-48E9FD6328EB}</UniqueIdentifier>
</Filter>
<Filter Include="samples\tracked_camera_openvr_sample">
<UniqueIdentifier>{69043F15-55EB-000D-FE3B-672AEA017A73}</UniqueIdentifier>
</Filter>
<Filter Include="src">
<UniqueIdentifier>{2DAB880B-99B4-887C-2230-9F7C8E38947C}</UniqueIdentifier>
</Filter>
<Filter Include="src\json">
<UniqueIdentifier>{164732CF-0214-8DDA-2B2D-7B821759C268}</UniqueIdentifier>
</Filter>
<Filter Include="src\vrcommon">
<UniqueIdentifier>{8D74F9C8-79D7-886D-225D-C1230E9F54F0}</UniqueIdentifier>
</Filter>
</ItemGroup>
<ItemGroup>
<ClInclude Include="..\..\headers\openvr.h">
<Filter>headers</Filter>
</ClInclude>
<ClInclude Include="..\..\headers\openvr_capi.h">
<Filter>headers</Filter>
</ClInclude>
<ClInclude Include="..\..\headers\openvr_driver.h">
<Filter>headers</Filter>
</ClInclude>
<ClInclude Include="..\..\src\ivrclientcore.h">
<Filter>src</Filter>
</ClInclude>
<ClInclude Include="..\..\src\json\json.h">
<Filter>src\json</Filter>
</ClInclude>
<ClInclude Include="..\..\src\json\json-forwards.h">
<Filter>src\json</Filter>
</ClInclude>
<ClInclude Include="..\..\src\vrcommon\dirtools_public.h">
<Filter>src\vrcommon</Filter>
</ClInclude>
<ClInclude Include="..\..\src\vrcommon\envvartools_public.h">
<Filter>src\vrcommon</Filter>
</ClInclude>
<ClInclude Include="..\..\src\vrcommon\hmderrors_public.h">
<Filter>src\vrcommon</Filter>
</ClInclude>
<ClInclude Include="..\..\src\vrcommon\pathtools_public.h">
<Filter>src\vrcommon</Filter>
</ClInclude>
<ClInclude Include="..\..\src\vrcommon\sharedlibtools_public.h">
<Filter>src\vrcommon</Filter>
</ClInclude>
<ClInclude Include="..\..\src\vrcommon\strtools_public.h">
<Filter>src\vrcommon</Filter>
</ClInclude>
<ClInclude Include="..\..\src\vrcommon\vrpathregistry_public.h">
<Filter>src\vrcommon</Filter>
</ClInclude>
</ItemGroup>
<ItemGroup>
<None Include="..\..\headers\openvr_api.cs">
<Filter>headers</Filter>
</None>
<None Include="..\..\headers\openvr_api.json">
<Filter>headers</Filter>
</None>
</ItemGroup>
<ItemGroup>
<ClCompile Include="..\..\src\jsoncpp.cpp">
<Filter>src</Filter>
</ClCompile>
<ClCompile Include="..\..\src\openvr_api_public.cpp">
<Filter>src</Filter>
</ClCompile>
<ClCompile Include="..\..\src\vrcommon\dirtools_public.cpp">
<Filter>src\vrcommon</Filter>
</ClCompile>
<ClCompile Include="..\..\src\vrcommon\envvartools_public.cpp">
<Filter>src\vrcommon</Filter>
</ClCompile>
<ClCompile Include="..\..\src\vrcommon\hmderrors_public.cpp">
<Filter>src\vrcommon</Filter>
</ClCompile>
<ClCompile Include="..\..\src\vrcommon\pathtools_public.cpp">
<Filter>src\vrcommon</Filter>
</ClCompile>
<ClCompile Include="..\..\src\vrcommon\sharedlibtools_public.cpp">
<Filter>src\vrcommon</Filter>
</ClCompile>
<ClCompile Include="..\..\src\vrcommon\strtools_public.cpp">
<Filter>src\vrcommon</Filter>
</ClCompile>
<ClCompile Include="..\..\src\vrcommon\vrpathregistry_public.cpp">
<Filter>src\vrcommon</Filter>
</ClCompile>
</ItemGroup>
</Project> | 41.263158 | 88 | 0.684949 |
ec00d38e2c035122d669fbeeed2db5e877aa5779 | 1,577 | xml | XML | Library/src/main/res/layout/activity_web_view_login.xml | Infomaniak/android-login | 6e4536a307a9d7e70b4e4c9f6f5506d94cc40952 | [
"Apache-2.0"
] | 1 | 2022-03-29T10:23:19.000Z | 2022-03-29T10:23:19.000Z | Library/src/main/res/layout/activity_web_view_login.xml | Infomaniak/android-login | 6e4536a307a9d7e70b4e4c9f6f5506d94cc40952 | [
"Apache-2.0"
] | 3 | 2022-02-08T12:48:09.000Z | 2022-03-17T08:24:58.000Z | Library/src/main/res/layout/activity_web_view_login.xml | Infomaniak/android-login | 6e4536a307a9d7e70b4e4c9f6f5506d94cc40952 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<androidx.coordinatorlayout.widget.CoordinatorLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:app="http://schemas.android.com/apk/res-auto"
xmlns:tools="http://schemas.android.com/tools"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:orientation="vertical"
tools:context="com.infomaniak.lib.login.WebViewLoginActivity">
<com.google.android.material.appbar.AppBarLayout
android:layout_width="match_parent"
android:layout_height="wrap_content">
<androidx.appcompat.widget.Toolbar
android:id="@+id/toolbar"
android:layout_width="match_parent"
android:layout_height="?attr/actionBarSize"
android:elevation="2dp"
android:theme="?attr/themeLoginToolbar"
android:visibility="visible"
app:menu="@menu/webview_menu"
app:title="login.infomaniak.com" />
<ProgressBar
android:id="@+id/progressBar"
style="@style/Widget.AppCompat.ProgressBar.Horizontal"
android:layout_width="match_parent"
android:layout_height="2dp"
android:layout_gravity="bottom" />
</com.google.android.material.appbar.AppBarLayout>
<WebView
android:id="@+id/webview"
android:layout_width="match_parent"
android:layout_height="match_parent"
app:layout_behavior="@string/appbar_scrolling_view_behavior" />
</androidx.coordinatorlayout.widget.CoordinatorLayout> | 39.425 | 111 | 0.680406 |
2e4b8154f35052e2adc52157878787c7c788950b | 12,189 | xml | XML | challenges/tribute/poller/for-release/POLL_00183.xml | pingjuiliao/cb-multios | 64ededd0b87030eda7c40c4388a4ad8283712d8e | [
"MIT"
] | 473 | 2016-08-01T12:48:16.000Z | 2022-03-09T18:13:14.000Z | challenges/tribute/poller/for-release/POLL_00183.xml | pingjuiliao/cb-multios | 64ededd0b87030eda7c40c4388a4ad8283712d8e | [
"MIT"
] | 71 | 2016-08-01T03:33:44.000Z | 2022-03-09T18:37:04.000Z | challenges/tribute/poller/for-release/POLL_00183.xml | pingjuiliao/cb-multios | 64ededd0b87030eda7c40c4388a4ad8283712d8e | [
"MIT"
] | 121 | 2016-08-01T04:07:53.000Z | 2022-03-07T11:08:09.000Z | <?xml version="1.0" standalone="no" ?>
<!DOCTYPE pov SYSTEM "/usr/share/cgc-docs/replay.dtd">
<pov>
<cbid>EAGLE_00004</cbid>
<replay>
<write>
<data>aPenFullOfSheep:)\n</data>
<data>mov r2,-735385331\npush r2\n</data>
<data>push 1576354730\n</data>
<data>push -886452055\n</data>
<data>push 933542933\n</data>
<data>pop m0\nout m0\n</data>
<data>push 805408330\n</data>
<data>pop m1\nout m1\n</data>
<data>mov r2,1300893392\npush r2\n</data>
<data>pop m2\nout m2\n</data>
<data>pop r0\nout r0\nmov m3,r0\n</data>
<data>push -1899848643\n</data>
<data>mov r2,1663818332\npush r2\n</data>
<data>mov r0,-1503529026\npush r0\n</data>
<data>mov r3,1572217627\npush r3\n</data>
<data>pop m4\nout m4\n</data>
<data>mov r3,-973722670\npush r3\n</data>
<data>pop m5\nout m5\n</data>
<data>pop m6\nout m6\n</data>
<data>push 1374694004\n</data>
<data>push 1319730217\n</data>
<data>pop r0\nout r0\nmov m7,r0\n</data>
<data>mov r1,-1459344943\npush r1\n</data>
<data>push 722891068\n</data>
<data>push 1017976699\n</data>
<data>push 1311111916\n</data>
<data>pop r2\nout r2\nmov m8,r2\n</data>
<data>pop m9\nout m9\n</data>
<data>pop m10\nout m10\n</data>
<data>pop r1\nout r1\nmov m11,r1\n</data>
<data>pop r3\nout r3\nmov m12,r3\n</data>
<data>pop r2\nout r2\nmov m13,r2\n</data>
<data>pop m14\nout m14\n</data>
<data>pop m15\nout m15\n</data>
<data>pop m16\nout m16\n</data>
<data>mov r3,887979583\n</data>
<data>shr r3,1\n</data>
<data>out r3\n</data>
<data>out 443989791\n</data>
<data>mov r0,m0\nmul r3,r0\n</data>
<data>out r3\n</data>
<data>out 2029285771\n</data>
<data>swp r3\n</data>
<data>out r3\n</data>
<data>out -1955466120\n</data>
<data>shl r3,4\n</data>
<data>out r3\n</data>
<data>out -1222686848\n</data>
<data>shl r3,2\n</data>
<data>out r3\n</data>
<data>out -595780096\n</data>
<data>div r3,m1\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>mul r3,m2\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>mov r2,m3\nmul r3,r2\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>shr r3,4\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>shr r3,7\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>swp r3\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>mul r3,m4\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>shl r3,2\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>mov r0,m5\nmod r3,r0\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>mov r1,m6\nsub r3,r1\n</data>
<data>out r3\n</data>
<data>out 1503529026\n</data>
<data>mul r3,m7\n</data>
<data>out r3\n</data>
<data>out 1977698962\n</data>
<data>mul r3,m8\n</data>
<data>out r3\n</data>
<data>out -241347944\n</data>
<data>mul r3,m9\n</data>
<data>out r3\n</data>
<data>out -1447405816\n</data>
<data>shl r3,5\n</data>
<data>out r3\n</data>
<data>out 927654144\n</data>
<data>shr r3,4\n</data>
<data>out r3\n</data>
<data>out 57978384\n</data>
<data>div r3,m10\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>add r3,m11\n</data>
<data>out r3\n</data>
<data>out -1459344943\n</data>
<data>shl r3,2\n</data>
<data>out r3\n</data>
<data>out -1542412476\n</data>
<data>shr r3,3\n</data>
<data>out r3\n</data>
<data>out -192801560\n</data>
<data>swp r3\n</data>
<data>out r3\n</data>
<data>out -401308940\n</data>
<data>add r3,m12\n</data>
<data>out r3\n</data>
<data>out 973385064\n</data>
<data>div r3,m13\n</data>
<data>out r3\n</data>
<data>out 0\n</data>
<data>add r3,m14\n</data>
<data>out r3\n</data>
<data>out -1899848643\n</data>
<data>swp r3\n</data>
<data>out r3\n</data>
<data>out 1033683598\n</data>
<data>shr r3,3\n</data>
<data>out r3\n</data>
<data>out 129210449\n</data>
<data>sub r3,m15\n</data>
<data>out r3\n</data>
<data>out -1447144281\n</data>
<data>mov r1,m16\nmod r3,r1\n</data>
<data>out r3\n</data>
<data>out -711758950\n</data>
<data>END\n</data>
</write>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x37a4bc15\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x30018e4a\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x4d8a0ed0\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xcb29d0a9\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x5db6231b\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xc5f62bd2\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa661f7be\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x4ea97c29\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x4e25faec\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x3cad177b\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x2b16713c\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa90429d1\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x51f02a74\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x632bda5c\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x8ec29c3d\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x5df543aa\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xd42ae90d\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x1a76bf1f\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x1a76bf1f\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x78f4718b\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x78f4718b\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x8b71f478\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x8b71f478\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xb71f4780\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xb71f4780\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xdc7d1e00\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xdc7d1e00\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x599e0842\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x599e0842\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x75e14a92\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x75e14a92\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xf19d5298\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xf19d5298\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa9ba5708\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa9ba5708\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x374ae100\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x374ae100\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x0374ae10\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x0374ae10\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa90429d1\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa90429d1\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa410a744\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa410a744\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xf48214e8\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xf48214e8\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xe81482f4\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xe81482f4\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x3a04ad68\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x3a04ad68\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x00000000\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x8ec29c3d\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x8ec29c3d\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x3d9cc28e\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x3d9cc28e\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x07b39851\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0x07b39851\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa9be54a7\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xa9be54a7\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xd5936b9a\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>OUT: 0xd5936b9a\n</data></match></read>
<read echo="ascii"><delim>\n</delim><match><data>COMPLETE\n</data></match></read>
</replay>
</pov>
| 54.173333 | 91 | 0.615883 |
9f096e1e5f96da6c3ecea0eaa5dff5efe68565ae | 9,801 | xml | XML | manuscript_descriptions/0002/mscodex933_TEI.xml | sims-mss/openn-xml | 2cb748a89141ee970cac74cade9c1092ff640610 | [
"CC-BY-4.0"
] | 1 | 2016-12-21T09:57:25.000Z | 2016-12-21T09:57:25.000Z | manuscript_descriptions/0002/mscodex933_TEI.xml | sims-mss/openn-xml | 2cb748a89141ee970cac74cade9c1092ff640610 | [
"CC-BY-4.0"
] | null | null | null | manuscript_descriptions/0002/mscodex933_TEI.xml | sims-mss/openn-xml | 2cb748a89141ee970cac74cade9c1092ff640610 | [
"CC-BY-4.0"
] | null | null | null | <?xml version='1.0' encoding='UTF-8'?>
<TEI xmlns="http://www.tei-c.org/ns/1.0">
<teiHeader>
<fileDesc>
<titleStmt>
<title>Description of University of Pennsylvania Ms. Codex 933: Roman de Troie, fragment</title>
</titleStmt>
<publicationStmt>
<publisher>The University of Pennsylvania Libraries</publisher>
<availability>
<licence target="http://creativecommons.org/licenses/by/4.0/legalcode">
This description is ©2015 University of
Pennsylvania Libraries. It is licensed under a Creative Commons
Attribution License version 4.0 (CC-BY-4.0
https://creativecommons.org/licenses/by/4.0/legalcode. For a
description of the terms of use see the Creative Commons Deed
https://creativecommons.org/licenses/by/4.0/. </licence>
<licence target="http://creativecommons.org/publicdomain/mark/1.0/"> All
referenced images and their content are free of known copyright
restrictions and in the public domain. See the Creative Commons
Public Domain Mark page for usage details,
http://creativecommons.org/publicdomain/mark/1.0/. </licence>
</availability>
</publicationStmt>
<notesStmt>
<note>Ms. codex.</note>
<note>Title from Constans's edition.</note>
<note>Incipit: Me ... me covendi a retrere / Anci[es que] ie trespas avant ...</note>
<note>Explicit: ... [De tant] com[---] plus [lor targereiz] / Plus grant damage [fereiz;].</note>
<note>A physical description completed in 1979 by J. C. Atkinson is shelved with the manuscript.</note>
</notesStmt>
<sourceDesc>
<msDesc>
<msIdentifier>
<settlement>Philadelphia</settlement>
<institution>University of Pennsylvania</institution>
<repository>Rare Book & Manuscript Library</repository>
<idno type="call-number">Ms. Codex 933</idno>
<altIdentifier type="bibid">
<idno>3570010</idno>
</altIdentifier>
<altIdentifier type="resource">
<idno>http://hdl.library.upenn.edu/1017/d/medren/3570010</idno>
</altIdentifier>
</msIdentifier>
<msContents>
<summary>Fragment of the medieval Romance of Troy, written in octosyllabic couplets. The fragment corresponds, with numerous variants, to verses 6658-7024 in Volume I of Constans's critical edition of this text, in which the allies of Priam are listed and Palamedes arrives.</summary>
<textLang>Old French</textLang>
<msItem>
<title>Roman de Troie, fragment</title>
<author>Benoît, de Sainte-More, 12th cent</author>
<respStmt>
<resp>former owner</resp>
<persName>Olschki, Leo S. 1861-1940</persName>
</respStmt>
</msItem>
</msContents>
<physDesc>
<objectDesc>
<supportDesc material="parchment">
<support>
<p>parchment</p>
</support>
<extent>2 leaves : 290 x 205 (240 x 154) mm. bound to 298 x 211 mm</extent>
<foliation>Parchment, ii (modern paper) + 2 + ii (modern paper); [1-2]; modern foliation in pencil, lower right recto. Single bifolium, formerly the center folios of a quire.</foliation>
</supportDesc>
<layoutDesc>
<layout>Written in 2 columns of 47 lines; ruled in ink, with double verticals at the left margin of each column.</layout>
</layoutDesc>
</objectDesc>
<scriptDesc>
<scriptNote>Written in a Gothic book script.</scriptNote>
</scriptDesc>
<bindingDesc>
<binding>
<p>Modern pasteboard.</p>
</binding>
</bindingDesc>
</physDesc>
<history>
<origin>
<p>Written in France, ca. 1300 (Zacour-Hirsch).</p>
<origDate>ca. 1300</origDate>
<origPlace>France</origPlace>
</origin>
<provenance>Formerly owned by Leo S. Olschki; sold from his collection, 1952.</provenance>
</history>
</msDesc>
</sourceDesc>
</fileDesc>
<profileDesc>
<textClass>
<keywords n="subjects">
<term>Trojan War</term>
</keywords>
<keywords n="form/genre">
<term>Codices</term>
<term>Fragments</term>
<term>Romances (literary genre)</term>
<term>Manuscripts, French--13th century</term>
<term>Manuscripts, French--14th century</term>
<term>Manuscripts, Medieval</term>
</keywords>
</textClass>
</profileDesc>
</teiHeader>
<facsimile>
<surface n="Front cover">
<graphic height="5058px" url="master/0370_0000.tif" width="3682px"/>
<graphic height="190px" url="thumb/0370_0000_thumb.jpg" width="138px"/>
<graphic height="1800px" url="web/0370_0000_web.jpg" width="1310px"/>
</surface>
<surface n="Inside front cover">
<graphic height="5269px" url="master/0370_0001.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0001_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0001_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 1 recto">
<graphic height="5269px" url="master/0370_0002.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0002_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0002_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 1 verso">
<graphic height="5269px" url="master/0370_0003.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0003_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0003_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 2 recto">
<graphic height="5269px" url="master/0370_0004.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0004_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0004_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 2 verso">
<graphic height="5269px" url="master/0370_0005.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0005_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0005_web.jpg" width="1301px"/>
</surface>
<surface n="1r">
<graphic height="5269px" url="master/0370_0006.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0006_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0006_web.jpg" width="1301px"/>
</surface>
<surface n="1v">
<graphic height="5269px" url="master/0370_0007.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0007_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0007_web.jpg" width="1301px"/>
</surface>
<surface n="2r">
<graphic height="5269px" url="master/0370_0008.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0008_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0008_web.jpg" width="1301px"/>
</surface>
<surface n="2v">
<graphic height="5269px" url="master/0370_0009.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0009_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0009_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 1 recto">
<graphic height="5269px" url="master/0370_0010.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0010_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0010_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 1 verso">
<graphic height="5269px" url="master/0370_0011.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0011_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0011_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 2 recto">
<graphic height="5269px" url="master/0370_0012.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0012_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0012_web.jpg" width="1301px"/>
</surface>
<surface n="Flyleaf 2 verso">
<graphic height="5269px" url="master/0370_0013.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0013_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0013_web.jpg" width="1301px"/>
</surface>
<surface n="Inside back cover">
<graphic height="5269px" url="master/0370_0014.tif" width="3810px"/>
<graphic height="190px" url="thumb/0370_0014_thumb.jpg" width="137px"/>
<graphic height="1800px" url="web/0370_0014_web.jpg" width="1301px"/>
</surface>
<surface n="Back cover">
<graphic height="5058px" url="master/0370_0015.tif" width="3682px"/>
<graphic height="190px" url="thumb/0370_0015_thumb.jpg" width="138px"/>
<graphic height="1800px" url="web/0370_0015_web.jpg" width="1310px"/>
</surface>
<surface n="Spine">
<graphic height="5058px" url="master/0370_0016.tif" width="3682px"/>
<graphic height="190px" url="thumb/0370_0016_thumb.jpg" width="138px"/>
<graphic height="1800px" url="web/0370_0016_web.jpg" width="1310px"/>
</surface>
</facsimile>
</TEI>
| 50.261538 | 296 | 0.609428 |
018762dd327590aeb1a403d46e790de9082eed8a | 2,541 | xml | XML | data/1867/01/11/DDD_ddd_010926193_mpeg21/DDD_010926193_0003_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | data/1867/01/11/DDD_ddd_010926193_mpeg21/DDD_010926193_0003_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | data/1867/01/11/DDD_ddd_010926193_mpeg21/DDD_010926193_0003_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<text>
<title>PROCES-VERBAAL.</title>
<p>I. van.de opening der stembriefjes, die ter benoeming van één lid van den Gemeenteraad van Leyden den 8sle™ Januarij 1867 zijn ingeleverd. Op heden: den negenden Januarij achttienhonderd zeven en zestig, in de gemeente Leyden, is door het bureau van stemopneming in de ter inlevering van stembriefjes bestemde zaal op het Raadhuis plaats genomen, des morgens le negen ure. Het bureau is zamengesteld uit den heer 11.' P.' C. Stoffels, wethouder, voorzitter, en de heeren dr. C. W. H. van Kaathoven en prof. J. van der Hoeven, leden I van den gemeenteraad , slemopnemers. j De voorzitter plaatst op de tafel twee stembussen, bij hem den 8st™ Januarij 1867 j overgebragt uit de beide afdeelingen der gemeente Leyden. De zegels der bussen worden onderzocht en bevonden ongeschonden te zijn. I' De bussen worden achtereenvolgens geopend en bevonden achthonderd een en twintig stembriefjes te bevatten. ; Dit getal met de lijsten der kiezers, die briefjes hebben ingeleverd, vergeleken i zijnde, is eebleken te liin even sroot als het sela! dier kiezers. '■:' Nadat de briefjes zijn Hooi eengemengd, worden zij door den voorzitter een voor een geopend en o\erluid voorgelezen. .-mv; Het bureau heeft van onwaarde verklaard twaalf stembriefjes, die oningevuld waren. [ Het getal der geldige uitgebragte stemmen is mitsdien geweesl achthonderd negen. Van dit gelal zijn uitgebragt op de heeren: K Prof. A. Rutgers 412 stemmen, dr. IL Boursse Wils 365,. mr. J. T. Buys 9, m. J. L. Klaverwijden en A. J. L. Beudt ieder 3, P. Randoe en mr. S. Vissering ieder 2, d. H. C. Rogge, H. C. Vlek, m. M. H. A. Lisman, M. van Weeren, A. H. Eigeman, mr. P. C. Lezwijn, T. W. van Hartrop, jhr. 11. van Alphen, dr. G. W. A. Plaat, dr. C. C. J. Teerlink, J. M. Hoppenbrouwer, P. G. Iloutliuysen en mr. H. A. Neeb, ieder ééne stem. '~ Heeft alzoo de volstrekte meerderheid van stemmen verkregen prof. A. Rutgers. - Is derhalve verkozen tot lid van den gemeenteraad van Leyden, om af te treden in 1869, de heer- Prof. ANTHONY RUTGERS, wonende alhier. ' En zijn tegen deze opening van stembriefjes door de in de zaal aanwezige kiezers < geene bezwaren ingebragt. En is na afloop van dit een en ander proces-verbaal opgemaakt, in tegenwoordigheid van allen die zich in de zaal bevonden. Gedaan te Leyden den 9deß Januarij 1867. STOFFELS, Voorzitter. . " > Dr. C. W. H. VAN K.A ATHOVEN,) _, J. VAN DER HOEVEN, Stemopnemers.</p>
</text>
| 423.5 | 2,450 | 0.756002 |
3e478dc61e5f1c98a9d7be48629a27766e820ed3 | 6,175 | xml | XML | pom.xml | CyanRYi/Heimdallr | 0435c9c04ca1b4470c4fbd30c74b83ef71dd7faf | [
"MIT"
] | null | null | null | pom.xml | CyanRYi/Heimdallr | 0435c9c04ca1b4470c4fbd30c74b83ef71dd7faf | [
"MIT"
] | null | null | null | pom.xml | CyanRYi/Heimdallr | 0435c9c04ca1b4470c4fbd30c74b83ef71dd7faf | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<project xmlns="http://maven.apache.org/POM/4.0.0"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd">
<modelVersion>4.0.0</modelVersion>
<groupId>tech.sollabs</groupId>
<artifactId>heimdallr</artifactId>
<version>0.4.0-SNAPSHOT</version>
<packaging>jar</packaging>
<developers>
<developer>
<id>cyan.r.yi</id>
<url>www.sollabs.tech</url>
<name>Cyan Raphael Yi</name>
<email>cyan.r.yi@gmail.com</email>
<organization>sollabs</organization>
<organizationUrl>www.sollabs.tech</organizationUrl>
<timezone>GMT+0900</timezone>
</developer>
</developers>
<name>heimdallr</name>
<description>Spring Extension 4th Series. Spring Security Extension</description>
<url>https://heimdallr.sollabs.tech</url>
<licenses>
<license>
<name>MIT</name>
<url>https://opensource.org/licenses/MIT</url>
<distribution>repo</distribution>
</license>
</licenses>
<scm>
<url>https://github.com/CyanRYi/Heimdallr.git</url>
<tag>github</tag>
</scm>
<properties>
<project.build.sourceEncoding>UTF-8</project.build.sourceEncoding>
<spring.version>4.2.0.RELEASE</spring.version>
<spring.security.version>4.2.0.RELEASE</spring.security.version>
</properties>
<dependencies>
<dependency>
<groupId>org.springframework.security</groupId>
<artifactId>spring-security-web</artifactId>
<version>${spring.security.version}</version>
</dependency>
<dependency>
<groupId>org.springframework.security</groupId>
<artifactId>spring-security-config</artifactId>
<version>${spring.security.version}</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-web</artifactId>
<version>${spring.version}</version>
</dependency>
<dependency>
<groupId>com.googlecode.json-simple</groupId>
<artifactId>json-simple</artifactId>
<version>1.1.1</version>
</dependency>
<dependency>
<groupId>commons-logging</groupId>
<artifactId>commons-logging</artifactId>
<version>1.2</version>
<scope>compile</scope>
<optional>true</optional>
</dependency>
<dependency>
<groupId>javax.servlet</groupId>
<artifactId>javax.servlet-api</artifactId>
<version>3.0.1</version>
<scope>provided</scope>
</dependency>
<dependency>
<groupId>org.springframework.security</groupId>
<artifactId>spring-security-test</artifactId>
<version>${spring.security.version}</version>
<scope>test</scope>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-webmvc</artifactId>
<version>${spring.version}</version>
<scope>test</scope>
</dependency>
<dependency>
<groupId>junit</groupId>
<artifactId>junit</artifactId>
<version>4.12</version>
<scope>test</scope>
</dependency>
<dependency>
<groupId>org.mockito</groupId>
<artifactId>mockito-core</artifactId>
<version>1.10.19</version>
<scope>test</scope>
</dependency>
<dependency>
<groupId>org.hamcrest</groupId>
<artifactId>hamcrest-all</artifactId>
<version>1.3</version>
<scope>test</scope>
</dependency>
</dependencies>
<build>
<plugins>
<plugin>
<groupId>org.apache.maven.plugins</groupId>
<artifactId>maven-source-plugin</artifactId>
<version>3.0.1</version>
<executions>
<execution>
<id>attach-sources</id>
<goals>
<goal>jar</goal>
</goals>
</execution>
</executions>
</plugin>
<plugin>
<groupId>org.apache.maven.plugins</groupId>
<artifactId>maven-javadoc-plugin</artifactId>
<executions>
<execution>
<id>attach-javadocs</id>
<goals>
<goal>jar</goal>
</goals>
</execution>
</executions>
</plugin>
<plugin>
<groupId>org.apache.maven.plugins</groupId>
<artifactId>maven-gpg-plugin</artifactId>
<version>1.5</version>
<executions>
<execution>
<id>sign-artifacts</id>
<phase>verify</phase>
<goals>
<goal>sign</goal>
</goals>
</execution>
</executions>
</plugin>
<plugin>
<groupId>org.apache.maven.plugins</groupId>
<artifactId>maven-compiler-plugin</artifactId>
<configuration>
<source>7</source>
<target>7</target>
</configuration>
</plugin>
</plugins>
</build>
<distributionManagement>
<snapshotRepository>
<id>ossrh</id>
<url>https://oss.sonatype.org/content/repositories/snapshots</url>
</snapshotRepository>
<repository>
<id>ossrh</id>
<url>https://oss.sonatype.org/service/local/staging/deploy/maven2/</url>
</repository>
</distributionManagement>
</project> | 35.488506 | 108 | 0.52081 |
011a9011551585760f360f0d2280d6dfead000dd | 12,269 | xaml | XML | anidow/Pages/NyaaView.xaml | MemeLabs/Anidow | 0f140c2c484489d04417aef1a75cc43664cfd81c | [
"MIT"
] | 2 | 2021-05-24T14:00:18.000Z | 2022-01-17T21:43:19.000Z | anidow/Pages/NyaaView.xaml | MemeLabs/Anidow | 0f140c2c484489d04417aef1a75cc43664cfd81c | [
"MIT"
] | 1 | 2021-04-21T14:15:03.000Z | 2021-04-21T15:07:06.000Z | anidow/Pages/NyaaView.xaml | MemeLabs/Anidow | 0f140c2c484489d04417aef1a75cc43664cfd81c | [
"MIT"
] | null | null | null | <UserControl
x:Class="Anidow.Pages.NyaaView"
xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"
xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"
xmlns:adonisUi="clr-namespace:AdonisUI;assembly=AdonisUI"
xmlns:converters="clr-namespace:Anidow.Converters"
xmlns:d="http://schemas.microsoft.com/expression/blend/2008"
xmlns:extensions="clr-namespace:AdonisUI.Extensions;assembly=AdonisUI"
xmlns:iconPacks="http://metro.mahapps.com/winfx/xaml/iconpacks"
xmlns:listViewLayout="clr-namespace:Itenso.Windows.Controls.ListViewLayout;assembly=Itenso.Windows.Controls.ListViewLayout"
xmlns:local="clr-namespace:Anidow.Pages"
xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"
xmlns:model="clr-namespace:Anidow.Model"
xmlns:s="https://github.com/canton7/Stylet"
xmlns:shared="clr-namespace:Anidow.Pages.Components.Shared"
d:DataContext="{d:DesignInstance local:NyaaViewModel}"
d:DesignHeight="450"
d:DesignWidth="800"
mc:Ignorable="d">
<Grid>
<Grid.RowDefinitions>
<RowDefinition Height="Auto" />
<RowDefinition Height="*" />
<RowDefinition Height="Auto" />
</Grid.RowDefinitions>
<GroupBox Margin="2" extensions:CornerRadiusExtension.CornerRadius="4">
<Grid>
<Grid.ColumnDefinitions>
<ColumnDefinition Width="*" />
<ColumnDefinition Width="Auto" />
<ColumnDefinition Width="Auto" />
<ColumnDefinition Width="Auto" />
</Grid.ColumnDefinitions>
<TextBlock VerticalAlignment="Center" Text="{Binding LastSearch, StringFormat=Last search: {0}}" />
<ComboBox
Grid.Column="1"
ItemsSource="{Binding Filters}"
SelectedIndex="{Binding SelectedFilterIndex}" />
<TextBox
Grid.Column="2"
MinWidth="200"
Margin="{adonisUi:Space 1,
0}"
extensions:WatermarkExtension.Watermark="Search ..."
IsEnabled="{Binding CanGetItems, Mode=OneWay}"
PreviewKeyDown="{s:Action OnPreviewKeyDown}"
Text="{Binding SearchText, UpdateSourceTrigger=PropertyChanged}" />
<Button
Grid.Column="3"
Command="{s:Action GetItems}"
Content="{iconPacks:FontAwesome SearchSolid}"
Style="{DynamicResource {x:Static adonisUi:Styles.AccentButton}}"
ToolTip="Search" />
</Grid>
</GroupBox>
<ListView
Grid.Row="1"
Margin="2"
extensions:GridViewSortExtension.AutoSort="True"
listViewLayout:ListViewLayoutManager.Enabled="true"
ItemContainerStyle="{StaticResource ListViewItemBase}"
ItemsSource="{Binding Items, NotifyOnSourceUpdated=True}"
Loaded="{s:Action ListLoaded}"
ScrollViewer.HorizontalScrollBarVisibility="Disabled"
SelectedItem="{Binding ActiveItem}">
<ListView.View>
<GridView AllowsColumnReorder="False">
<GridViewColumn
extensions:GridViewSortExtension.PropertyName="Name"
listViewLayout:RangeColumn.IsFillColumn="true"
Header="Name"
HeaderContainerStyle="{StaticResource GridViewFirstCenteredContainerStyle}">
<GridViewColumn.CellTemplate>
<DataTemplate DataType="model:NyaaTorrentItem">
<TextBlock
x:Name="Name"
HorizontalAlignment="Stretch"
Text="{Binding Name}"
TextTrimming="CharacterEllipsis"
TextWrapping="NoWrap"
ToolTip="{Binding Name}"
ToolTipService.Placement="Bottom" />
<DataTemplate.Triggers>
<DataTrigger Binding="{Binding Quality}" Value="Trusted">
<Setter TargetName="Name" Property="Foreground" Value="#FF98D9A8" />
</DataTrigger>
<DataTrigger Binding="{Binding Quality}" Value="Remake">
<Setter TargetName="Name" Property="Foreground" Value="#FFF0B080" />
</DataTrigger>
</DataTemplate.Triggers>
</DataTemplate>
</GridViewColumn.CellTemplate>
</GridViewColumn>
<GridViewColumn
Width="85"
extensions:GridViewSortExtension.PropertyName="Seeders"
listViewLayout:FixedColumn.Width="85"
DisplayMemberBinding="{Binding Seeders}"
Header="Seeders"
HeaderContainerStyle="{StaticResource GridViewCenteredContainerStyle}" />
<GridViewColumn
Width="90"
extensions:GridViewSortExtension.PropertyName="Leechers"
listViewLayout:FixedColumn.Width="90"
DisplayMemberBinding="{Binding Leechers}"
Header="Leechers"
HeaderContainerStyle="{StaticResource GridViewCenteredContainerStyle}" />
<GridViewColumn
Width="120"
extensions:GridViewSortExtension.PropertyName="ReleasedLocal"
listViewLayout:FixedColumn.Width="120"
Header="Added"
HeaderContainerStyle="{StaticResource GridViewLastCenteredContainerStyle}">
<GridViewColumn.CellTemplate>
<DataTemplate DataType="model:NyaaTorrentItem">
<TextBlock Text="{Binding Added}" ToolTipService.Placement="Bottom">
<TextBlock.ToolTip>
<ToolTip Content="{Binding ReleasedLocal}" ContentStringFormat="{}{0:g}" />
</TextBlock.ToolTip>
</TextBlock>
</DataTemplate>
</GridViewColumn.CellTemplate>
</GridViewColumn>
</GridView>
</ListView.View>
</ListView>
<Expander
Grid.Row="2"
Margin="2,0"
extensions:GroupBoxExtension.HeaderBackground="{DynamicResource {x:Static adonisUi:Brushes.AccentBrush}}"
Style="{StaticResource ExpanderCustom}"
Visibility="{Binding ActiveItem, Converter={x:Static converters:IsNullToVisibilityConverter.Instance}}">
<Expander.Header>
<Grid>
<Grid.Resources>
<Style TargetType="Grid">
<Style.Setters>
<Setter Property="TextElement.Foreground" Value="White" />
</Style.Setters>
</Style>
</Grid.Resources>
<Grid.ColumnDefinitions>
<ColumnDefinition Width="Auto" />
<ColumnDefinition Width="Auto" />
<ColumnDefinition Width="Auto" />
<ColumnDefinition Width="Auto" />
<ColumnDefinition Width="*" />
<ColumnDefinition Width="Auto" />
</Grid.ColumnDefinitions>
<TextBlock
Margin="0,0,4,0"
VerticalAlignment="Center"
FontWeight="Bold"
Text="Download" />
<TextBlock
Grid.Column="1"
Margin="4,0"
VerticalAlignment="Center"
Opacity=".7"
Text="{Binding ActiveItem.Seeders, StringFormat=Seeders: {0}}" />
<TextBlock
Grid.Column="2"
Margin="4,0"
VerticalAlignment="Center"
Opacity=".7"
Text="{Binding ActiveItem.Leechers, StringFormat=Leechers: {0}}" />
<TextBlock
Grid.Column="3"
Margin="4,0"
VerticalAlignment="Center"
Opacity=".7"
Text="{Binding ActiveItem.Downloads, StringFormat=Downloads: {0}}" />
<TextBlock
Grid.Column="4"
Margin="4,0"
VerticalAlignment="Center"
Opacity=".7"
Text="{Binding ActiveItem.Size, StringFormat=Size: {0}}" />
<Button
Grid.Column="5"
Margin="0,-4"
BorderThickness="0"
Command="{s:Action DeselectItem}"
Content="{iconPacks:FontAwesome TimesSolid,
Height=15,
Width=15}" />
</Grid>
</Expander.Header>
<Grid Margin="8">
<Grid.RowDefinitions>
<RowDefinition Height="Auto" />
<RowDefinition Height="Auto" />
<RowDefinition Height="Auto" />
</Grid.RowDefinitions>
<Grid>
<Grid.ColumnDefinitions>
<ColumnDefinition Width="*" />
<ColumnDefinition Width="Auto" />
</Grid.ColumnDefinitions>
<TextBox
IsReadOnly="True"
Text="{Binding ActiveItem.Name}"
TextAlignment="Left"
TextWrapping="Wrap" />
<Button
Grid.Column="1"
Margin="8,0,0,0"
Command="{s:Action OpenExternalLink}"
CommandParameter="{Binding ActiveItem}"
Content="{iconPacks:FontAwesome ExternalLinkAltSolid}" />
</Grid>
<Grid Grid.Row="1" Margin="0,8">
<Grid.ColumnDefinitions>
<ColumnDefinition Width="*" />
<ColumnDefinition Width="Auto" />
</Grid.ColumnDefinitions>
<TextBox Text="{Binding ActiveItem.Folder, UpdateSourceTrigger=PropertyChanged, Mode=TwoWay}" />
<Button
Grid.Column="1"
Margin="8,0,0,0"
Command="{s:Action OpenFolderBrowserDialog}"
Content="{iconPacks:FontAwesome FolderOpenSolid}" />
</Grid>
<Button
Grid.Row="2"
Command="{s:Action Download,
ActionNotFound=Disable}"
CommandParameter="{Binding ActiveItem}"
Content="Download"
IsEnabled="{Binding ActiveItem.CanDownload}"
Style="{DynamicResource {x:Static adonisUi:Styles.AccentButton}}" />
</Grid>
</Expander>
<shared:LoadingOverlay
Grid.Row="1"
Grid.RowSpan="2"
DataContext="{Binding CanGetItems}" />
</Grid>
</UserControl> | 49.471774 | 127 | 0.473633 |
6a04dfdee24d92a109a0218a7096946529b28819 | 677 | xml | XML | src/Vts/Modeling/Resources/ReferenceNurbs/SpatialFrequencyDomain/TestAndExamples/timeValuesEXAMPLE.xml | VirtualPhotonics/Vts.Silverlight | f7b39f8143da32f060ab1862735dfbde9beed3de | [
"MIT"
] | 1 | 2022-02-09T12:15:21.000Z | 2022-02-09T12:15:21.000Z | src/Vts/Modeling/Resources/ReferenceNurbs/SpatialFrequencyDomain/TestAndExamples/timeValuesEXAMPLE.xml | VirtualPhotonics/Vts.Silverlight | f7b39f8143da32f060ab1862735dfbde9beed3de | [
"MIT"
] | null | null | null | src/Vts/Modeling/Resources/ReferenceNurbs/SpatialFrequencyDomain/TestAndExamples/timeValuesEXAMPLE.xml | VirtualPhotonics/Vts.Silverlight | f7b39f8143da32f060ab1862735dfbde9beed3de | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<ForwardSolverError xmlns="http://schemas.datacontract.org/2004/07/Vts.Reporting" xmlns:i="http://www.w3.org/2001/XMLSchema-instance">
<MinValue xmlns:a="http://schemas.microsoft.com/2003/10/Serialization/Arrays" xmlns="http://schemas.datacontract.org/2004/07/Vts.Reporting">
<a:double>0</a:double>
</MinValue>
<MaxValue xmlns:a="http://schemas.microsoft.com/2003/10/Serialization/Arrays" xmlns="http://schemas.datacontract.org/2004/07/Vts.Reporting">
<a:double>10</a:double>
</MaxValue>
<Degree xmlns:a="http://schemas.microsoft.com/2003/10/Serialization/Arrays">
<a:int>3</a:int>
</Degree>
</ForwardSolverError> | 56.416667 | 142 | 0.726736 |
41450a52bc24f5c2d0b070efb31fcdee365d6a03 | 52 | plist | XML | pkgs/mimohack_2.0/Library/MobileSubstrate/DynamicLibraries/MimoHack.plist | d0ura/repo-1 | 2a85fc7d2926e8ff31187eb42576c77e50be90c0 | [
"MIT"
] | 23 | 2017-09-05T17:47:09.000Z | 2021-11-08T10:46:47.000Z | pkgs/mimohack_2.0/Library/MobileSubstrate/DynamicLibraries/MimoHack.plist | d0ura/repo-1 | 2a85fc7d2926e8ff31187eb42576c77e50be90c0 | [
"MIT"
] | 5 | 2017-06-08T08:06:42.000Z | 2022-01-22T04:13:07.000Z | pkgs/mimohack_2.0/Library/MobileSubstrate/DynamicLibraries/MimoHack.plist | d0ura/repo-1 | 2a85fc7d2926e8ff31187eb42576c77e50be90c0 | [
"MIT"
] | 18 | 2019-12-15T11:27:44.000Z | 2022-03-06T10:09:00.000Z | { Filter = { Bundles = ( "com.getmimo.mimo" ); }; }
| 26 | 51 | 0.519231 |
5f1a64cc0a932944560a06c00fd339eba1ca7dc2 | 3,043 | xml | XML | ImageSliderWithIndicatorExample/app/src/main/res/layout/recyclarview_adapter.xml | EckiHag/Android-Example | 3de9f8e2ddab4210d5605c7f8ee770f5e3059f94 | [
"Apache-2.0"
] | 101 | 2018-08-02T09:34:02.000Z | 2021-05-28T12:20:38.000Z | ImageSliderWithIndicatorExample/app/src/main/res/layout/recyclarview_adapter.xml | EckiHag/Android-Example | 3de9f8e2ddab4210d5605c7f8ee770f5e3059f94 | [
"Apache-2.0"
] | 5 | 2021-06-01T17:49:40.000Z | 2021-07-17T17:00:57.000Z | ImageSliderWithIndicatorExample/app/src/main/res/layout/recyclarview_adapter.xml | EckiHag/Android-Example | 3de9f8e2ddab4210d5605c7f8ee770f5e3059f94 | [
"Apache-2.0"
] | 183 | 2018-08-09T07:33:54.000Z | 2021-05-31T14:40:30.000Z |
<androidx.cardview.widget.CardView xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:card_view="http://schemas.android.com/apk/res-auto"
android:id="@+id/card_view"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_margin="5dp"
card_view:cardCornerRadius="4dp">
<LinearLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:orientation="vertical">
<RelativeLayout
android:layout_width="match_parent"
android:layout_height="50dp"
android:orientation="horizontal"
android:weightSum="3">
<ImageView
android:id="@+id/imgTitle"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:padding="3dp" />
</RelativeLayout>
<LinearLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:orientation="vertical"
android:padding="10dp">
<TextView
android:id="@+id/tvTitle"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:gravity="center"
android:lines="3"
android:padding="5dp"
android:text="TextView"
android:textColor="@android:color/black"
android:textStyle="bold" />
<TextView
android:id="@+id/tvOffer"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:gravity="center"
android:lines="2"
android:padding="5dp"
android:text="TextView"
android:textColor="@android:color/black"
android:textStyle="bold" />
<Button
android:id="@+id/btnGetOffer"
android:layout_width="match_parent"
android:layout_height="35dp"
android:layout_gravity="center"
android:layout_marginLeft="25dp"
android:layout_marginRight="25dp"
android:background="@color/orange"
android:gravity="center"
android:padding="5dp"
android:text="@string/get_offer"
android:textColor="@android:color/white"
android:textStyle="bold" />
<TextView
android:id="@+id/tvAllOffers"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:gravity="center"
android:padding="5dp"
android:text="View All Offers"
android:textColor="@android:color/black"
android:textStyle="bold" />
</LinearLayout>
</LinearLayout>
</androidx.cardview.widget.CardView> | 36.22619 | 93 | 0.560302 |
5981de33ea382fecd52cc9936ba27f1eda18fc2e | 2,833 | xml | XML | trainingdata/cache/60/42761560.xml | jremillard/osm-changeset-classification | 61b21d526300c1152f7b29c0c93f2953dd1cd323 | [
"MIT"
] | 16 | 2018-03-05T14:21:53.000Z | 2021-07-11T23:16:21.000Z | trainingdata/cache/60/42761560.xml | jremillard/osm-changeset-classification | 61b21d526300c1152f7b29c0c93f2953dd1cd323 | [
"MIT"
] | 2 | 2018-03-05T16:33:10.000Z | 2018-04-13T01:15:11.000Z | trainingdata/cache/60/42761560.xml | jremillard/osm-changeset-classification | 61b21d526300c1152f7b29c0c93f2953dd1cd323 | [
"MIT"
] | 2 | 2018-03-14T13:06:34.000Z | 2020-09-12T01:50:21.000Z | <changeset id="42761560" schema="2">
<counts nodesAdded="20" nodesDeleted="3" nodesModified="2" relationsAdded="1" relationsDeleted="0" relationsModified="1" waysAdded="9" waysDeleted="0" waysModified="3" />
<meta>
<tag k="build" v="2.4-21-g233799c" />
<tag k="comment" v="Rathaus, Heiligenwald Schiffweiler" />
<tag k="created_by" v="Potlatch 2" />
<tag k="version" v="2.4" />
</meta>
<body>
<tag id="582171680" k="bus" o="none" type="node" v="yes" />
<tag id="582171680" k="name" o="modify" type="node" v="Rathaus, Heiligenwald Schiffweiler" />
<tag id="582171680" k="highway" o="none" type="node" v="bus_stop" />
<tag id="582171680" k="stop_id" o="none" type="node" v="34705" />
<tag id="582171680" k="public_transport" o="none" type="node" v="stop_position" />
<tag id="582171681" k="bus" o="none" type="node" v="yes" />
<tag id="582171681" k="name" o="modify" type="node" v="Rathaus, Heiligenwald Schiffweiler" />
<tag id="582171681" k="highway" o="none" type="node" v="bus_stop" />
<tag id="582171681" k="stop_id" o="none" type="node" v="34705" />
<tag id="582171681" k="public_transport" o="none" type="node" v="stop_position" />
<tag id="148251818" k="lit" o="add" type="way" v="yes" />
<tag id="148251818" k="name" o="none" type="way" v="Langgasse" />
<tag id="148251818" k="lanes" o="add" type="way" v="1" />
<tag id="148251818" k="oneway" o="none" type="way" v="yes" />
<tag id="148251818" k="highway" o="none" type="way" v="living_street" />
<tag id="148251818" k="surface" o="modify" type="way" v="asphalt" />
<tag id="148264641" k="area" o="add" type="way" v="yes" />
<tag id="148264641" k="access" o="add" type="way" v="yes" />
<tag id="148264641" k="amenity" o="none" type="way" v="parking" />
<tag id="148264641" k="parking" o="add" type="way" v="surface" />
<tag id="148264641" k="surface" o="add" type="way" v="paving_stones" />
<tag id="446723410" k="barrier" o="add" type="way" v="fence" />
<tag id="446723412" k="barrier" o="add" type="way" v="fence" />
<tag id="446723413" k="barrier" o="add" type="way" v="fence" />
<tag id="446723415" k="barrier" o="add" type="way" v="fence" />
<tag id="446723416" k="barrier" o="add" type="way" v="fence" />
<tag id="446723809" k="barrier" o="add" type="way" v="fence" />
<tag id="446723810" k="barrier" o="add" type="way" v="fence" />
<tag id="6623966" k="type" o="none" type="relation" v="multipolygon" />
<tag id="6623966" k="landuse" o="none" type="relation" v="residential" />
<tag id="6637539" k="type" o="add" type="relation" v="multipolygon" />
<tag id="6637539" k="leisure" o="add" type="relation" v="garden" />
<tag id="6637539" k="garden:type" o="add" type="relation" v="private" />
</body>
</changeset>
| 62.955556 | 172 | 0.604659 |
12b79558d3889c0a21ddbcc91108f8c99a2cee14 | 2,687 | xml | XML | Gray_Binarization_dspbuilder/db/alt_dspbuilder_if_statement.jvgen_cache.xml | Given-Jiang/Gray_Binarization | 8f494305bba8e9bd7dae96d30f5c34fc57ec9d53 | [
"MIT"
] | null | null | null | Gray_Binarization_dspbuilder/db/alt_dspbuilder_if_statement.jvgen_cache.xml | Given-Jiang/Gray_Binarization | 8f494305bba8e9bd7dae96d30f5c34fc57ec9d53 | [
"MIT"
] | null | null | null | Gray_Binarization_dspbuilder/db/alt_dspbuilder_if_statement.jvgen_cache.xml | Given-Jiang/Gray_Binarization | 8f494305bba8e9bd7dae96d30f5c34fc57ec9d53 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<jvgen name="alt_dspbuilder_if_statement" family="Cyclone V"
style="COMPLEX" fixed-name="false" temporary="false">
<instance version="13.1" decorated-name="alt_dspbuilder_if_statement_GN7VA7SRUP">
<generic name="HDLTYPE" value="STD_LOGIC_VECTOR"/>
<generic name="WIDTH" value="24"/>
<generic name="IF_EXPRESSION" value="(a=b) and (a /= c)"/>
<generic name="BWR" value="0"/>
<generic name="SIGNED" value="0"/>
<generic name="USE_ELSE_INPUT" value="0"/>
<generic name="USE_ELSE_OUTPUT" value="0"/>
<generic name="NUMBER_INPUTS" value="3"/>
<port name="a" dir="Input"
vhdl-type="std_logic_vector(24-1 downto 0)" width="24" lowerbound="0"/>
<port name="b" dir="Input"
vhdl-type="std_logic_vector(24-1 downto 0)" width="24" lowerbound="0"/>
<port name="c" dir="Input"
vhdl-type="std_logic_vector(24-1 downto 0)" width="24" lowerbound="0"/>
<port name="true" dir="Output" vhdl-type="std_logic" width="1" lowerbound="0"/>
<generated-file file-type="VHDL" filename="alt_dspbuilder_if_statement_GN7VA7SRUP.vhd"/>
</instance>
<instance version="13.1" decorated-name="alt_dspbuilder_if_statement_GNYT6HZJI5">
<generic name="HDLTYPE" value="STD_LOGIC_VECTOR"/>
<generic name="WIDTH" value="8"/>
<generic name="IF_EXPRESSION" value="a>b"/>
<generic name="BWR" value="0"/>
<generic name="SIGNED" value="0"/>
<generic name="USE_ELSE_INPUT" value="0"/>
<generic name="USE_ELSE_OUTPUT" value="0"/>
<generic name="NUMBER_INPUTS" value="2"/>
<port name="a" dir="Input"
vhdl-type="std_logic_vector(8-1 downto 0)" width="8" lowerbound="0"/>
<port name="b" dir="Input"
vhdl-type="std_logic_vector(8-1 downto 0)" width="8" lowerbound="0"/>
<port name="true" dir="Output" vhdl-type="std_logic" width="1" lowerbound="0"/>
<generated-file file-type="VHDL" filename="alt_dspbuilder_if_statement_GNYT6HZJI5.vhd"/>
</instance>
<parameter-static name="HDLTYPE" default="STD_LOGIC_VECTOR" type="STRING"/>
<parameter-static name="WIDTH" default="8" type="NATURAL"/>
<parameter-static name="IF_EXPRESSION" default="a" type="STRING"/>
<parameter-static name="BWR" default="0" type="NATURAL"/>
<parameter-static name="SIGNED" default="1" type="NATURAL"/>
<parameter-static name="USE_ELSE_INPUT" default="0" type="NATURAL"/>
<parameter-static name="USE_ELSE_OUTPUT" default="0" type="NATURAL"/>
<parameter-static name="NUMBER_INPUTS" default="1" type="INTEGER"/>
</jvgen>
| 57.170213 | 96 | 0.642724 |
31f9a0a6c02c8bb1c929cba5a1aa7d7dc3e82c7d | 33,360 | xml | XML | Exceptions/Java/Exceptions/ConnectException/.idea/workspace.xml | GabeStah/Airbrake.io | df324d9feda42dee41b4aede6000960ba99c28ea | [
"MIT"
] | 1 | 2019-11-26T20:40:56.000Z | 2019-11-26T20:40:56.000Z | Exceptions/Java/Exceptions/ConnectException/.idea/workspace.xml | GabeStah/Airbrake.io | df324d9feda42dee41b4aede6000960ba99c28ea | [
"MIT"
] | 18 | 2020-02-28T20:35:27.000Z | 2022-02-26T03:34:27.000Z | Exceptions/Java/Exceptions/ConnectException/.idea/workspace.xml | GabeStah/Airbrake.io | df324d9feda42dee41b4aede6000960ba99c28ea | [
"MIT"
] | 1 | 2019-12-26T19:33:30.000Z | 2019-12-26T19:33:30.000Z | <?xml version="1.0" encoding="UTF-8"?>
<project version="4">
<component name="ChangeListManager">
<list default="true" id="461e106d-3c4e-4fb8-9b3c-9450194fc39e" name="Default" comment="" />
<ignored path="$PROJECT_DIR$/out/" />
<option name="EXCLUDED_CONVERTED_TO_IGNORED" value="true" />
<option name="TRACKING_ENABLED" value="true" />
<option name="SHOW_DIALOG" value="false" />
<option name="HIGHLIGHT_CONFLICTS" value="true" />
<option name="HIGHLIGHT_NON_ACTIVE_CHANGELIST" value="false" />
<option name="LAST_RESOLUTION" value="IGNORE" />
</component>
<component name="FileEditorManager">
<leaf SIDE_TABS_SIZE_LIMIT_KEY="300">
<file leaf-file-name="Main.java" pinned="false" current-in-tab="true">
<entry file="file://$PROJECT_DIR$/src/io/airbrake/Main.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="187">
<caret line="11" column="47" lean-forward="true" selection-start-line="11" selection-start-column="47" selection-end-line="11" selection-end-column="47" />
<folding>
<element signature="imports" expanded="true" />
</folding>
</state>
</provider>
</entry>
</file>
<file leaf-file-name="HttpsURLConnection.class" pinned="false" current-in-tab="false">
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/jre/lib/rt.jar!/javax/net/ssl/HttpsURLConnection.class">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="102">
<caret line="13" column="22" lean-forward="false" selection-start-line="13" selection-start-column="22" selection-end-line="13" selection-end-column="22" />
<folding />
</state>
</provider>
</entry>
</file>
<file leaf-file-name="MessageFormat.java" pinned="false" current-in-tab="false">
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/text/MessageFormat.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="5083">
<caret line="343" column="13" lean-forward="false" selection-start-line="343" selection-start-column="13" selection-end-line="343" selection-end-column="13" />
<folding />
</state>
</provider>
</entry>
</file>
<file leaf-file-name="Logging.java" pinned="false" current-in-tab="false">
<entry file="file://$PROJECT_DIR$/../../../../lib/java/src/io/airbrake/utility/Logging.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="187">
<caret line="14" column="33" lean-forward="false" selection-start-line="14" selection-start-column="33" selection-end-line="14" selection-end-column="33" />
<folding />
</state>
</provider>
</entry>
</file>
<file leaf-file-name="URL.java" pinned="false" current-in-tab="false">
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URL.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="15079">
<caret line="944" column="15" lean-forward="false" selection-start-line="944" selection-start-column="15" selection-end-line="944" selection-end-column="15" />
<folding />
</state>
</provider>
</entry>
</file>
<file leaf-file-name="HttpURLConnection.java" pinned="false" current-in-tab="false">
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/HttpURLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="8568">
<caret line="544" column="18" lean-forward="false" selection-start-line="544" selection-start-column="18" selection-end-line="544" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
</file>
<file leaf-file-name="URLConnection.java" pinned="false" current-in-tab="false">
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="11373">
<caret line="734" column="18" lean-forward="false" selection-start-line="734" selection-start-column="18" selection-end-line="734" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
</file>
</leaf>
</component>
<component name="FindInProjectRecents">
<findStrings>
<find>processres</find>
</findStrings>
</component>
<component name="GradleLocalSettings">
<option name="externalProjectsViewState">
<projects_view />
</option>
</component>
<component name="IdeDocumentHistory">
<option name="CHANGED_PATHS">
<list>
<option value="$PROJECT_DIR$/../../../../lib/java/src/io/airbrake/utility/Logging.java" />
<option value="$PROJECT_DIR$/src/io/airbrake/Main.java" />
</list>
</option>
</component>
<component name="JsBuildToolGruntFileManager" detection-done="true" sorting="DEFINITION_ORDER" />
<component name="JsBuildToolPackageJson" detection-done="true" sorting="DEFINITION_ORDER" />
<component name="JsGulpfileManager">
<detection-done>true</detection-done>
<sorting>DEFINITION_ORDER</sorting>
</component>
<component name="ProjectFrameBounds" extendedState="6">
<option name="x" value="-8" />
<option name="y" value="-8" />
<option name="width" value="1936" />
<option name="height" value="1096" />
</component>
<component name="ProjectView">
<navigator currentView="ProjectPane" proportions="" version="1">
<flattenPackages />
<showMembers />
<showModules />
<showLibraryContents />
<hideEmptyPackages />
<abbreviatePackageNames />
<autoscrollToSource />
<autoscrollFromSource />
<sortByType />
<manualOrder />
<foldersAlwaysOnTop value="true" />
</navigator>
<panes>
<pane id="Scratches" />
<pane id="Scope" />
<pane id="PackagesPane" />
<pane id="AndroidView" />
<pane id="ProjectPane" />
</panes>
</component>
<component name="PropertiesComponent">
<property name="WebServerToolWindowFactoryState" value="false" />
<property name="aspect.path.notification.shown" value="true" />
<property name="last_opened_file_path" value="$PROJECT_DIR$/../../../../lib/java/src/lib.iml" />
<property name="project.structure.last.edited" value="Modules" />
<property name="project.structure.proportion" value="0.15" />
<property name="project.structure.side.proportion" value="0.2" />
</component>
<component name="RunDashboard">
<option name="ruleStates">
<list>
<RuleState>
<option name="name" value="ConfigurationTypeDashboardGroupingRule" />
</RuleState>
<RuleState>
<option name="name" value="StatusDashboardGroupingRule" />
</RuleState>
</list>
</option>
</component>
<component name="RunManager" selected="Application.Main">
<configuration name="Main" type="Application" factoryName="Application" temporary="true">
<extension name="coverage" enabled="false" merge="false" sample_coverage="true" runner="idea" />
<option name="MAIN_CLASS_NAME" value="io.airbrake.Main" />
<option name="VM_PARAMETERS" value="" />
<option name="PROGRAM_PARAMETERS" value="" />
<option name="WORKING_DIRECTORY" value="file://$PROJECT_DIR$" />
<option name="ALTERNATIVE_JRE_PATH_ENABLED" value="false" />
<option name="ALTERNATIVE_JRE_PATH" value="" />
<option name="ENABLE_SWING_INSPECTOR" value="false" />
<option name="ENV_VARIABLES" />
<option name="PASS_PARENT_ENVS" value="true" />
<module name="ConnectException" />
<envs />
<RunnerSettings RunnerId="Run" />
<ConfigurationWrapper RunnerId="Run" />
</configuration>
<configuration default="true" type="Application" factoryName="Application">
<extension name="coverage" enabled="false" merge="false" sample_coverage="true" runner="idea" />
<option name="MAIN_CLASS_NAME" />
<option name="VM_PARAMETERS" />
<option name="PROGRAM_PARAMETERS" />
<option name="WORKING_DIRECTORY" />
<option name="ALTERNATIVE_JRE_PATH_ENABLED" value="false" />
<option name="ALTERNATIVE_JRE_PATH" />
<option name="ENABLE_SWING_INSPECTOR" value="false" />
<option name="ENV_VARIABLES" />
<option name="PASS_PARENT_ENVS" value="true" />
<module name="" />
<envs />
<method />
</configuration>
<recent_temporary>
<list size="1">
<item index="0" class="java.lang.String" itemvalue="Application.Main" />
</list>
</recent_temporary>
</component>
<component name="ShelveChangesManager" show_recycled="false">
<option name="remove_strategy" value="false" />
</component>
<component name="TaskManager">
<task active="true" id="Default" summary="Default task">
<changelist id="461e106d-3c4e-4fb8-9b3c-9450194fc39e" name="Default" comment="" />
<created>1503715063029</created>
<option name="number" value="Default" />
<option name="presentableId" value="Default" />
<updated>1503715063029</updated>
<workItem from="1503715066073" duration="5359000" />
<workItem from="1503956102193" duration="1230000" />
<workItem from="1504492856226" duration="614000" />
<workItem from="1505471419360" duration="15000" />
</task>
<servers />
</component>
<component name="TimeTrackingManager">
<option name="totallyTimeSpent" value="7218000" />
</component>
<component name="ToolWindowManager">
<frame x="-8" y="-8" width="1936" height="1096" extended-state="6" />
<editor active="true" />
<layout>
<window_info id="Palette" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="3" side_tool="false" content_ui="tabs" />
<window_info id="TODO" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="6" side_tool="false" content_ui="tabs" />
<window_info id="Palette	" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="3" side_tool="false" content_ui="tabs" />
<window_info id="Image Layers" active="false" anchor="left" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="2" side_tool="false" content_ui="tabs" />
<window_info id="Capture Analysis" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="3" side_tool="false" content_ui="tabs" />
<window_info id="Event Log" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="7" side_tool="true" content_ui="tabs" />
<window_info id="Maven Projects" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="3" side_tool="false" content_ui="tabs" />
<window_info id="Run" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="2" side_tool="false" content_ui="tabs" />
<window_info id="Version Control" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="false" weight="0.33" sideWeight="0.5" order="7" side_tool="false" content_ui="tabs" />
<window_info id="Terminal" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="7" side_tool="false" content_ui="tabs" />
<window_info id="Capture Tool" active="false" anchor="left" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="2" side_tool="false" content_ui="tabs" />
<window_info id="Designer" active="false" anchor="left" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="2" side_tool="false" content_ui="tabs" />
<window_info id="Project" active="false" anchor="left" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="true" show_stripe_button="true" weight="0.25" sideWeight="0.5" order="0" side_tool="false" content_ui="combo" />
<window_info id="Database" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="3" side_tool="false" content_ui="tabs" />
<window_info id="Structure" active="false" anchor="left" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.25" sideWeight="0.5" order="1" side_tool="false" content_ui="tabs" />
<window_info id="Ant Build" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.25" sideWeight="0.5" order="1" side_tool="false" content_ui="tabs" />
<window_info id="UI Designer" active="false" anchor="left" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="2" side_tool="false" content_ui="tabs" />
<window_info id="Theme Preview" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="3" side_tool="false" content_ui="tabs" />
<window_info id="Debug" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.39979655" sideWeight="0.5" order="3" side_tool="false" content_ui="tabs" />
<window_info id="Favorites" active="false" anchor="left" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="2" side_tool="true" content_ui="tabs" />
<window_info id="Cvs" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.25" sideWeight="0.5" order="4" side_tool="false" content_ui="tabs" />
<window_info id="Message" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="0" side_tool="false" content_ui="tabs" />
<window_info id="Commander" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.4" sideWeight="0.5" order="0" side_tool="false" content_ui="tabs" />
<window_info id="Hierarchy" active="false" anchor="right" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.25" sideWeight="0.5" order="2" side_tool="false" content_ui="combo" />
<window_info id="Messages" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.32960325" sideWeight="0.5" order="7" side_tool="false" content_ui="tabs" />
<window_info id="Inspection" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.4" sideWeight="0.5" order="5" side_tool="false" content_ui="tabs" />
<window_info id="Find" active="false" anchor="bottom" auto_hide="false" internal_type="DOCKED" type="DOCKED" visible="false" show_stripe_button="true" weight="0.33" sideWeight="0.5" order="1" side_tool="false" content_ui="tabs" />
</layout>
</component>
<component name="TypeScriptGeneratedFilesManager">
<option name="version" value="1" />
</component>
<component name="VcsContentAnnotationSettings">
<option name="myLimit" value="2678400000" />
</component>
<component name="XDebuggerManager">
<breakpoint-manager>
<option name="time" value="12" />
</breakpoint-manager>
<watches-manager>
<configuration name="Application">
<watch expression="value.getClass()" language="JAVA" />
<watch expression="connection.getURL().toString()" language="JAVA" />
</configuration>
</watches-manager>
</component>
<component name="editorHistoryManager">
<entry file="file://$PROJECT_DIR$/src/io/airbrake/Main.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="0">
<caret line="0" column="0" lean-forward="false" selection-start-line="0" selection-start-column="0" selection-end-line="0" selection-end-column="0" />
<folding>
<element signature="imports" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/jre/lib/rt.jar!/javax/net/ssl/HttpsURLConnection.class">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="102">
<caret line="13" column="22" lean-forward="false" selection-start-line="13" selection-start-column="22" selection-end-line="13" selection-end-column="22" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/text/MessageFormat.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="5083">
<caret line="343" column="13" lean-forward="false" selection-start-line="343" selection-start-column="13" selection-end-line="343" selection-end-column="13" />
<folding />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/../../../../lib/java/src/io/airbrake/utility/Logging.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="187">
<caret line="14" column="33" lean-forward="false" selection-start-line="14" selection-start-column="33" selection-end-line="14" selection-end-column="33" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URL.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="15079">
<caret line="944" column="15" lean-forward="false" selection-start-line="944" selection-start-column="15" selection-end-line="944" selection-end-column="15" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/HttpURLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="8568">
<caret line="544" column="18" lean-forward="false" selection-start-line="544" selection-start-column="18" selection-end-line="544" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="11373">
<caret line="734" column="18" lean-forward="false" selection-start-line="734" selection-start-column="18" selection-end-line="734" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/src/io/airbrake/Main.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="0">
<caret line="0" column="0" lean-forward="false" selection-start-line="0" selection-start-column="0" selection-end-line="0" selection-end-column="0" />
<folding>
<element signature="imports" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/jre/lib/rt.jar!/javax/net/ssl/HttpsURLConnection.class">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="102">
<caret line="13" column="22" lean-forward="false" selection-start-line="13" selection-start-column="22" selection-end-line="13" selection-end-column="22" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/text/MessageFormat.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="5831">
<caret line="343" column="13" lean-forward="false" selection-start-line="343" selection-start-column="13" selection-end-line="343" selection-end-column="13" />
<folding />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/../../../../lib/java/src/io/airbrake/utility/Logging.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="187">
<caret line="14" column="33" lean-forward="true" selection-start-line="14" selection-start-column="33" selection-end-line="14" selection-end-column="33" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URL.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="15079">
<caret line="944" column="15" lean-forward="false" selection-start-line="944" selection-start-column="15" selection-end-line="944" selection-end-column="15" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/HttpURLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="8568">
<caret line="544" column="18" lean-forward="false" selection-start-line="544" selection-start-column="18" selection-end-line="544" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="11373">
<caret line="734" column="18" lean-forward="false" selection-start-line="734" selection-start-column="18" selection-end-line="734" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/src/io/airbrake/Main.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="0">
<caret line="0" column="0" lean-forward="false" selection-start-line="0" selection-start-column="0" selection-end-line="0" selection-end-column="0" />
<folding>
<element signature="imports" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/jre/lib/rt.jar!/javax/net/ssl/HttpsURLConnection.class">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="102">
<caret line="13" column="22" lean-forward="false" selection-start-line="13" selection-start-column="22" selection-end-line="13" selection-end-column="22" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/text/MessageFormat.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="5083">
<caret line="343" column="13" lean-forward="false" selection-start-line="343" selection-start-column="13" selection-end-line="343" selection-end-column="13" />
<folding />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/../../../../lib/java/src/io/airbrake/utility/Logging.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="952">
<caret line="59" column="34" lean-forward="true" selection-start-line="59" selection-start-column="34" selection-end-line="59" selection-end-column="34" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URL.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="15079">
<caret line="944" column="15" lean-forward="false" selection-start-line="944" selection-start-column="15" selection-end-line="944" selection-end-column="15" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/HttpURLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="8568">
<caret line="544" column="18" lean-forward="false" selection-start-line="544" selection-start-column="18" selection-end-line="544" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="11373">
<caret line="734" column="18" lean-forward="false" selection-start-line="734" selection-start-column="18" selection-end-line="734" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/HttpURLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="8568">
<caret line="544" column="18" lean-forward="false" selection-start-line="544" selection-start-column="18" selection-end-line="544" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URLConnection.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="11373">
<caret line="734" column="18" lean-forward="false" selection-start-line="734" selection-start-column="18" selection-end-line="734" selection-end-column="18" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/URL.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="15079">
<caret line="944" column="15" lean-forward="false" selection-start-line="944" selection-start-column="15" selection-end-line="944" selection-end-column="15" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/text/MessageFormat.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="5083">
<caret line="343" column="13" lean-forward="false" selection-start-line="343" selection-start-column="13" selection-end-line="343" selection-end-column="13" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/jre/lib/rt.jar!/sun/net/www/protocol/https/AbstractDelegateHttpsURLConnection.class">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="1122">
<caret line="86" column="0" lean-forward="false" selection-start-line="86" selection-start-column="0" selection-end-line="86" selection-end-column="0" />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/src.zip!/java/net/ConnectException.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="344">
<caret line="45" column="11" lean-forward="false" selection-start-line="45" selection-start-column="11" selection-end-line="45" selection-end-column="11" />
<folding>
<element signature="e#917#918#0" expanded="false" />
<element signature="e#943#944#0" expanded="false" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/../../../../lib/java/src/io/airbrake/utility/Logging.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="187">
<caret line="14" column="33" lean-forward="false" selection-start-line="14" selection-start-column="33" selection-end-line="14" selection-end-column="33" />
<folding />
</state>
</provider>
</entry>
<entry file="jar://C:/Program Files/Java/jdk1.8.0_141/jre/lib/rt.jar!/javax/net/ssl/HttpsURLConnection.class">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="102">
<caret line="13" column="22" lean-forward="false" selection-start-line="13" selection-start-column="22" selection-end-line="13" selection-end-column="22" />
<folding />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/src/io/airbrake/Main.java">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="187">
<caret line="11" column="47" lean-forward="true" selection-start-line="11" selection-start-column="47" selection-end-line="11" selection-end-column="47" />
<folding>
<element signature="imports" expanded="true" />
</folding>
</state>
</provider>
</entry>
</component>
<component name="masterDetails">
<states>
<state key="ArtifactsStructureConfigurable.UI">
<settings>
<artifact-editor />
<splitter-proportions>
<option name="proportions">
<list>
<option value="0.2" />
</list>
</option>
</splitter-proportions>
</settings>
</state>
<state key="FacetStructureConfigurable.UI">
<settings>
<last-edited>No facets are configured</last-edited>
<splitter-proportions>
<option name="proportions">
<list>
<option value="0.2" />
</list>
</option>
</splitter-proportions>
</settings>
</state>
<state key="GlobalLibrariesConfigurable.UI">
<settings>
<splitter-proportions>
<option name="proportions">
<list>
<option value="0.2" />
</list>
</option>
</splitter-proportions>
</settings>
</state>
<state key="JdkListConfigurable.UI">
<settings>
<last-edited>1.8</last-edited>
<splitter-proportions>
<option name="proportions">
<list>
<option value="0.2" />
</list>
</option>
</splitter-proportions>
</settings>
</state>
<state key="ModuleStructureConfigurable.UI">
<settings>
<last-edited>lib</last-edited>
<splitter-proportions>
<option name="proportions">
<list>
<option value="0.2" />
</list>
</option>
</splitter-proportions>
</settings>
</state>
<state key="ProjectLibrariesConfigurable.UI">
<settings>
<last-edited>src</last-edited>
<splitter-proportions>
<option name="proportions">
<list>
<option value="0.2" />
</list>
</option>
</splitter-proportions>
</settings>
</state>
</states>
</component>
</project> | 55.973154 | 248 | 0.640138 |
994d36c6a14dd62da2594bc763e4f75d37ed6826 | 3,890 | xml | XML | ide/spi.palette/src/org/netbeans/modules/palette/resources/layer.xml | Antholoj/netbeans | ecdbe7fb25cfd1a5bb01bd04ed9159906ff01cef | [
"Apache-2.0"
] | 1,056 | 2019-04-25T20:00:35.000Z | 2022-03-30T04:46:14.000Z | ide/spi.palette/src/org/netbeans/modules/palette/resources/layer.xml | Antholoj/netbeans | ecdbe7fb25cfd1a5bb01bd04ed9159906ff01cef | [
"Apache-2.0"
] | 1,846 | 2019-04-25T20:50:05.000Z | 2022-03-31T23:40:41.000Z | ide/spi.palette/src/org/netbeans/modules/palette/resources/layer.xml | Antholoj/netbeans | ecdbe7fb25cfd1a5bb01bd04ed9159906ff01cef | [
"Apache-2.0"
] | 550 | 2019-04-25T20:04:33.000Z | 2022-03-25T17:43:01.000Z |
<!--
Licensed to the Apache Software Foundation (ASF) under one
or more contributor license agreements. See the NOTICE file
distributed with this work for additional information
regarding copyright ownership. The ASF licenses this file
to you under the Apache License, Version 2.0 (the
"License"); you may not use this file except in compliance
with the License. You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing,
software distributed under the License is distributed on an
"AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY
KIND, either express or implied. See the License for the
specific language governing permissions and limitations
under the License.
-->
<!DOCTYPE filesystem PUBLIC "-//NetBeans//DTD Filesystem 1.2//EN" "http://www.netbeans.org/dtds/filesystem-1_2.dtd">
<filesystem>
<folder name="Menu">
<folder name="Tools">
<folder name="PaletteManager">
<attr name="SystemFileSystem.localizingBundle" stringvalue="org.netbeans.modules.palette.resources.Bundle"/>
<attr name="position" intvalue="1200"/>
</folder>
</folder>
</folder>
<!-- default workspaces, frames and their layout defined by core -->
<folder name="Windows2">
<folder name="Modes">
<file name="commonpalette.wsmode" url="commonpalette.wsmode"/>
<folder name="commonpalette">
<file name="CommonPalette.wstcref" url="CommonPalette.wstcref">
<attr name="position" intvalue="100"/>
</file>
</folder>
</folder>
<folder name="Components">
<file name="CommonPalette.settings" url="CommonPalette.settings"/>
</folder>
<folder name="Groups">
<file name="commonpalette.wsgrp" url="commonpalette.wsgrp"/>
<folder name="commonpalette">
<file name="CommonPalette.wstcgrp" url="CommonPalette.wstcgrp"/>
</folder>
</folder>
</folder>
<folder name="PaletteSettings">
<!-- Palette stores its non-public settings here -->
</folder>
<folder name="xml">
<folder name="entities">
<folder name="NetBeans">
<file name="Editor_Palette_Item_1_0" url="editor-palette-item-1_0.dtd">
<attr name="hint.originalPublicID" stringvalue="-//NetBeans//Editor Palette Item 1.0//EN"/>
</file>
<file name="Editor_Palette_Item_1_1" url="editor-palette-item-1_1.dtd">
<attr name="hint.originalPublicID" stringvalue="-//NetBeans//Editor Palette Item 1.1//EN"/>
</file>
</folder>
</folder>
<folder name="lookups">
<folder name="NetBeans">
<file name="Editor_Palette_Item_1_0.instance">
<attr name="instanceClass" stringvalue="org.netbeans.modules.palette.PaletteEnvironmentProvider"/>
<attr name="instanceOf" stringvalue="org.openide.loaders.Environment$Provider"/>
<attr name="instanceCreate" methodvalue="org.netbeans.modules.palette.PaletteEnvironmentProvider.createProvider"/>
</file>
<file name="Editor_Palette_Item_1_1.instance">
<attr name="instanceClass" stringvalue="org.netbeans.modules.palette.PaletteEnvironmentProvider"/>
<attr name="instanceOf" stringvalue="org.openide.loaders.Environment$Provider"/>
<attr name="instanceCreate" methodvalue="org.netbeans.modules.palette.PaletteEnvironmentProvider.createProvider"/>
</file>
</folder>
</folder>
</folder>
</filesystem>
| 42.747253 | 134 | 0.617995 |
eff7db6c7dbe7d0666978b600455c895e01ff39b | 2,165 | xml | XML | app/src/main/res/xml/pref_settings.xml | Yuijam/droidfan | 0b8c45288f954ad0748c8827474cfa9319a237fe | [
"Apache-2.0"
] | 1 | 2016-09-14T01:01:14.000Z | 2016-09-14T01:01:14.000Z | app/src/main/res/xml/pref_settings.xml | Yuijam/droidfan | 0b8c45288f954ad0748c8827474cfa9319a237fe | [
"Apache-2.0"
] | null | null | null | app/src/main/res/xml/pref_settings.xml | Yuijam/droidfan | 0b8c45288f954ad0748c8827474cfa9319a237fe | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<PreferenceScreen xmlns:android="http://schemas.android.com/apk/res/android">
<PreferenceCategory
android:title="提醒"
>
<SwitchPreference
android:title="消息提醒"
android:summary="当有新私信和@消息时提醒"
android:defaultValue="true"
android:key="notification"
/>
<SwitchPreference
android:title="夜间免打扰"
android:summary="23点~7点时间段不提醒"
android:dependency="notification"
android:defaultValue="true"
android:key="do_not_notify_at_night"
/>
<SwitchPreference
android:defaultValue="true"
android:dependency="notification"
android:key="notifications_new_message"
android:title="@string/pref_title_new_message_notifications" />
<SwitchPreference
android:defaultValue="true"
android:dependency="notifications_new_message"
android:key="notifications_new_message_vibrate"
android:title="@string/pref_title_vibrate" />
<RingtonePreference
android:defaultValue="content://settings/system/notification_sound"
android:dependency="notifications_new_message"
android:key="notifications_new_message_ringtone"
android:ringtoneType="notification"
android:title="@string/pref_title_ringtone" />
</PreferenceCategory>
<PreferenceCategory
android:title="@string/about"
>
<Preference
android:title="版本"
android:key="version_code"
/>
</PreferenceCategory>
<Preference
android:title="@string/feedback"
>
<intent
android:action="com.arenas.droidfan.main.update.UpdateActivity">
<extra android:name="extra_action_type"
android:value="3"/>
</intent>
</Preference>
<Preference
android:title="清除缓存"
android:key="clear_data"
/>
<Preference
android:title="登出"
android:key="login_out"
/>
</PreferenceScreen> | 29.256757 | 79 | 0.598152 |
227f654f4031d5ac38a4682de2393234a39e98c4 | 1,007 | xml | XML | external/barnabywalters/mf-cleaner/phpunit.xml | kylewm/KnownReactions | a0c6cce18e1128bc18c146d59b0781666be80c8c | [
"CC0-1.0"
] | 11 | 2016-02-15T01:54:19.000Z | 2021-03-07T19:21:14.000Z | external/barnabywalters/mf-cleaner/phpunit.xml | kylewm/KnownIndieReactions | a0c6cce18e1128bc18c146d59b0781666be80c8c | [
"CC0-1.0"
] | 22 | 2016-02-02T15:15:54.000Z | 2021-03-20T04:48:56.000Z | external/barnabywalters/mf-cleaner/phpunit.xml | kylewm/KnownIndieReactions | a0c6cce18e1128bc18c146d59b0781666be80c8c | [
"CC0-1.0"
] | 10 | 2016-02-29T20:17:34.000Z | 2019-07-10T09:34:26.000Z | <phpunit backupGlobals="true"
bootstrap="test/bootstrap.php"
backupStaticAttributes="false"
cacheTokens="false"
colors="false"
convertErrorsToExceptions="true"
convertNoticesToExceptions="true"
convertWarningsToExceptions="true"
forceCoversAnnotation="false"
mapTestClassNameToCoveredClassName="false"
printerClass="PHPUnit_TextUI_ResultPrinter"
processIsolation="false"
stopOnError="false"
stopOnFailure="false"
stopOnIncomplete="false"
stopOnSkipped="false"
strict="false"
verbose="false">
<testsuites>
<testsuite name="Test Suite">
<directory suffix="Test.php">test/</directory>
</testsuite>
</testsuites>
<logging>
<log type="coverage-html" target="tmp/report" charset="UTF-8"
highlight="true"/>
<log type="testdox-html" target="tmp/index.html"/>
</logging>
</phpunit>
| 33.566667 | 69 | 0.611718 |
1c5901d0af023ae3c2554b6ca4b3e45994b81b08 | 20,552 | xml | XML | XML/TwaHon4.xml | JohannGillium/modern_english_ed | 038beae731c31685a22a995d41a8d6b21b7d2dda | [
"MIT"
] | 2 | 2016-04-21T20:36:46.000Z | 2016-04-22T18:45:04.000Z | XML/TwaHon4.xml | JohannGillium/modern_english_ed | 038beae731c31685a22a995d41a8d6b21b7d2dda | [
"MIT"
] | 10 | 2016-04-25T15:29:38.000Z | 2016-04-27T20:04:21.000Z | XML/TwaHon4.xml | JohannGillium/modern_english_ed | 038beae731c31685a22a995d41a8d6b21b7d2dda | [
"MIT"
] | null | null | null | <?xml version="1.0"?>
<?dlps id="TwaHon4"?>
<?dlps page-images="none" figure-images="no"?>
<?dlps transcription="other"?>
<!DOCTYPE TEI.2 SYSTEM "http://text.lib.virginia.edu/dtd/tei/tei-p4/tei2.dtd" [
<!ENTITY % POSTKB "INCLUDE">
<!ENTITY % TEI.extensions.ent SYSTEM "http://text.lib.virginia.edu/dtd/tei/uva-dl-tei/uva-dl-tei.ent">
<!ENTITY % TEI.extensions.dtd SYSTEM "http://text.lib.virginia.edu/dtd/tei/uva-dl-tei/uva-dl-tei.dtd">
<!ENTITY % ISOnum SYSTEM "http://text.lib.virginia.edu/charent/iso-num.ent"> %ISOnum;
<!ENTITY % ISOpub SYSTEM "http://text.lib.virginia.edu/charent/iso-pub.ent"> %ISOpub;
]>
<TEI.2 id="TwaHon4">
<teiHeader type="migrated" creator="Etext">
<fileDesc>
<titleStmt>
<title type="main">Scenes in Honolulu — No. 4</title>
<title type="sort">scenes in honolulu — no 4</title>
<author>Twain, Mark, 1835-1910</author>
<respStmt>
<resp>Creation of machine-readable version:</resp>
<name>Steve Railton</name>
<resp>Conversion to TEI.2-conformant markup:</resp>
<name>J. Nathaniel Goldsmith, University of Virginia Library Electronic Text Center.</name>
</respStmt>
</titleStmt>
<extent>ca. <num type="kilobytes">19</num> kilobytes</extent>
<publicationStmt>
<publisher>University of Virginia Library</publisher>
<pubPlace>Charlottesville, Virginia</pubPlace>
<idno type="ETC">TwaHon4</idno>
<date value="2001">2001</date>
<availability status="public">
<p n="copyright">Copyright © 2001 by the Rector and Visitors of the University of Virginia</p>
<p n="access">Publicly accessible</p>
</availability>
<idno type="uva-pid">uva-lib:476420</idno>
</publicationStmt>
<seriesStmt>
<title>University of Virginia Library, Text collection</title>
<idno type="uva-set">UVA-LIB-Text</idno>
</seriesStmt>
<sourceDesc>
<biblFull>
<titleStmt>
<title type="main">Scenes in Honolulu — No. 4</title>
<title type="sort">scenes in honolulu — no 4</title>
<author>Mark Twain, pseud. Samuel Langhorne Clemens</author>
</titleStmt>
<publicationStmt>
<publisher>Sacramento Union</publisher>
<pubPlace>Sacramento</pubPlace>
<date value="1866-04-19">19 April 1866</date>
<idno type="callNo">Source copy consulted:</idno>
</publicationStmt>
</biblFull>
</sourceDesc>
</fileDesc>
<encodingDesc>
<projectDesc>
<p>Prepared for the University of Virginia Library Electronic Text Center.</p>
</projectDesc>
<editorialDecl>
<p>All unambiguous end-of-line hyphens have been removed, and the trailing part of a word has been joined to the preceding line.</p>
<p id="ETC">Some keywords in the header are a local Electronic Text Center scheme to aid in establishing analytical groupings.</p>
</editorialDecl>
</encodingDesc>
<profileDesc>
<langUsage>
<language id="eng" usage="main">English</language>
</langUsage>
<textClass>
<keywords>
<term>non-fiction</term>
<term>prose</term>
<term>masculine</term>
<term>Mark Twain</term>
</keywords>
</textClass>
</profileDesc>
<revisionDesc>
<change>
<date value="2001-07">July, 2001</date>
<respStmt>
<resp>corrector</resp>
<name/>
</respStmt>
<item/>
</change>
<change>
<date value="2007-09">September 2007</date>
<respStmt>
<resp>Migration</resp>
<name>Ethan Gruber, University of Virginia Library</name>
</respStmt>
<item>Converted XML markup from TEI Lite to uva-dl-tei (TEI P4 with local customizations).</item>
</change>
<change>
<date value="2008-01">January 2008</date>
<respStmt>
<resp>Migration</resp>
<name>Greg Murray, University of Virginia Library</name>
</respStmt>
<item>Programmatically updated TEI header markup (but not header content) for minimal compliance with current QA requirements.</item>
</change>
</revisionDesc>
</teiHeader>
<text id="d1">
<body id="d2">
<div1 type="letter" id="d3">
<head>19 April 1866<lb/>
HONOLULU, MARCH, 1866.
</head>
<div2 type="section" n="1" id="d4">
<head>OUR ARRIVAL ELABORATED A LITTLE MORE</head>
<p>We came in sight of two of this group of islands, Oahu and Molokai (pronounced
O-waw-hoo and Mollo-<hi rend="italic">ki</hi>), on the morning of the 18th, and soon exchanged the
dark blue waters of the deep sea for the brilliant light blue of "sounding." The fat, ugly
birds (said to be a species of albatross) which had skimmed after us on tireless wings
clear across the ocean, left us, and an occasional flying fish went skimming over the
water in their stead. Oahu loomed high, rugged, treeless, barren, black and dreary, out of
the sea, and in the distance Molokai lay like a homely swaybacked whale on the water.</p>
</div2>
<div2 type="section" n="2" id="d5">
<head>THE HAWAIIAN FLAG</head>
<p> As we rounded the promontory of Diamond Head (bringing into view a grove of
coconut trees, first ocular proof that we were in the tropics), we ran up the Stars and
Stripes at the main spencer gaff, and the Hawaiian flag at the fore. The latter is suggestive
of the prominent political elements of the Islands. It is part French, part English, part
American, and is Hawaiian in general. The union is the English cross; the remainder of
the flag (horizontal stripes) looks American, but has a blue French stripe in addition to
our red and white ones. The flag was gotten up by foreign legations in council with the
Hawaiian Government. The eight stripes refer to the eight islands which are inhabited;
the other four are barren rocks incapable of supporting a population.</p>
</div2>
<div2 type="section" n="3" id="d6">
<head>REFLECTIONS</head>
<p> As we came in sight we fired a gun, and a good part of Honolulu turned out to
welcome the steamer. It was Sunday morning, and about church time, and we steamed
through the narrow channel to the music of six different church bells, which sent their
mellow tones far and wide, over hills and valleys, which were peopled by naked, savage,
thundering barbarians only fifty years ago! Six Christian churches within five miles of
the ruins of a pagan temple, where human sacrifices were daily offered up to hideous
idols in the last century! We were within pistol shot of one of a group of islands whose
ferocious inhabitants closed in upon the doomed and helpless Captain Cook and
murdered him, eighty-seven years ago; and lo! their descendants were at church! Behold
what the missionaries have wrought!</p>
</div2>
<div2 type="section" n="4" id="d7">
<head>THE CROWD ON THE PIER</head>
<p> By the time we had worked our slow way up to the wharf, under the guidance of
McIntyre, the pilot, a mixed crowd of four or five hundred people had assembled:
Chinamen, in the costume of their country; foreigners and the better class of natives, and
"half whites" in carriages and dressed in Sacramento summer fashion; other native men
on foot, some in the cast-off clothing of white folks, and a few wearing a battered hat, an
old ragged vest, and nothing else—at least nothing but an unnecessarily slender rag passed
between the legs; native women clad in a single garment—a bright colored robe or
wrapper as voluminous as a balloon, with full sleeves. This robe is "gathered" from
shoulder to shoulder, before and behind, and then descends in ample folds to the feet—seldom a chemise or any other undergarment—fits like a circus tent fits the tent pole, and
no hoops. These robes were bright yellow, or bright crimson, or pure black occasionally,
or gleaming white; but "solid colors" and "stunning" ones were the rule. They wore little
hats such as the sex wear in your cities, and some of the younger women had very pretty
faces and splendid black eyes and heavy masses of long black hair, occasionally put up in
a "net"; some of these dark, gingerbread colored beauties were on foot—generally on bare
foot, I may add—and others were on horseback—astraddle; they never ride any other way,
and they ought to know which way is best, for there are no more accomplished
horsewomen in the world, it is said. The balance of the crowd consisted chiefly of little
half-naked native boys and girls. All were chattering in the catchy, chopped-up Kanaka
language; but what they were chattering about will always remain a mystery to me.</p>
</div2>
<div2 type="section" n="5" id="d8">
<head>THE KING</head>
<p> Captain Fitch said, "There's the King! that's him in the buggy! I know him far as I
can see him."</p>
<p> I had never seen a king in my life, and I naturally took out my notebook and put
him down: "Tall, slender, dark; full-bearded; green frock coat, with lapels and collar
bordered with gold band an inch wide; plug hat—broad gold band around it; royal
costume looks too much like a livery; this man isn't as fleshy as I thought he was."</p>
<p> I had just got these notes entered when Captain Fitch discovered that he had got
hold of the wrong King—or, rather, that he had got hold of the King's driver or a carriage—driver of one of the nobility. The King was not present at all. It was a great
disappointment to me. I heard afterward that the comfortable, easy-going King
Kamehameha (pronounced Ka-may-ah-may-ah) V had been seen sitting on a barrel on
the wharf, the day before, fishing; but there was no consolation in that; that did not
restore to me my lost King. </p>
</div2>
<div2 type="section" n="6" id="d9">
<head>HONOLULU</head>
<p>The town of Honolulu (said to contain between twelve thousand and fifteen
thousand inhabitants) is spread over a dead level; has streets from twenty to thirty feet
wide, solid and level as a floor, most of them straight as a line and a few as crooked as a
corkscrew; houses one and two stories high, built of wood, straw, 'dobes, and dull cream-colored
pebble-and-shell-conglomerated coral cut into oblong square blocks and laid in
cement, but no brick houses; there are great yards, more like plazas, about a large number
of the dwelling houses, and these are carpeted with bright green grass, into which your
foot sinks out of sight; and they are ornamented by a hundred species of beautiful flowers
and blossoming shrubs, and shaded by noble tamarind trees and the "Pride of India," with
its fragrant flower, and by the "Umbrella Tree," and I do not know how many more. I had
rather smell Honolulu at sunset than the old police courtroom in San Francisco. </p>
</div2>
<div2 type="section" n="7" id="d10">
<head>ALMOST A KING</head>
<p> I had not shaved since I left San Francisco—ten days. As soon as I got ashore, I
hunted for a striped pole, and shortly found one. I always had a yearning to be a king.
This may never be, I suppose. But at any rate it will always be a satisfaction to me to
know that if I am not a king, I am the next thing to it—I have been shaved by the King's
barber. </p>
</div2>
<div2 type="section" n="8" id="d11">
<head>LANDSMEN ON "SEA LEGS"</head>
<p> Walking about on shore was very uncomfortable at first; there was no spring to
the solid ground, and I missed the heaving and rolling of the ship's deck; it was
unpleasant to lean unconsciously to an anticipated lurch of the world and find that the
world did not lurch, as it should have done. And there was something else missed—something gone something wanting, I could not tell what—a dismal vacuum of some kind
or other—a sense of emptiness. But I found out what it was presently. It was the absence
of the ceaseless dull hum of beating waves and whipping sails and fluttering of the
propeller, and creaking of the ship—sounds I had become so accustomed to that I had
ceased to notice them and had become unaware of their existence until the deep Sunday
stillness on shore made me vaguely conscious that a familiar spirit of some kind or other
was gone from me. Walking on the solid earth with legs used to the "giving" of the decks
under his tread made Brown sick, and he went off to bed and left me to wander alone
about this odd-looking city of the tropics.</p>
</div2>
<div2 type="section" n="9" id="d12">
<head>NEW SCENES AND STRONG CONTRASTS</head>
<p>The further I traveled through the town the better I liked it. Every step revealed a
new contrast—disclosed something I was unaccustomed to. In place of the grand mud-colored brown stone fronts of San Francisco, I saw neat white cottages, with green
window shutters; in place of front yards like billiard tables with iron fences around them,
I saw those cottages surrounded by ample yards, about like Portsmouth Square (as to
size), thickly clad with green grass, and shaded by tall trees, through whose dense foliage
the sun could scarcely penetrate; in place of the customary infernal geranium languishing
in dust and general debility on tin-roofed rear additions or in bedroom windows, I saw
luxurious banks and thickets of flowers, fresh as a meadow after a rain, and glowing with
the richest dyes; in place of the dingy horrors of the "Willows," and the painful sharp-pointed shrubbery of that funny caricature of nature which they call "South Park," I saw
huge-bodied, wide-spreading forest trees, with strange names and stranger appearance—trees that cast a shadow like a thundercloud, and were able to stand alone without being
tied to green poles; in place of those vile, tiresome, stupid, everlasting goldfish, wiggling
around in glass globes and assuming all shades and degrees of distortion through the
magnifying and diminishing qualities of their transparent prison houses, I saw cats—Tom
cats, Mary Ann cats, long-tailed cats, bobtail cats, blind cats, one-eyed cats, walleyed
cats, cross-eyed cats, gray cats, black cats, white cats, yellow cats, striped cats, spotted
cats, tame cats, wild cats, singed cats, individual cats, groups of cats, platoons of cats,
companies of cats, regiments of cats, armies of cats, multitudes of cats, millions of cats,
and all of them sleek, fat, lazy, and sound asleep; in place of roughs and rowdies staring
and blackguarding on the corners, I saw long-haired, saddle-colored Sandwich Island
maidens sitting on the ground in the shade of corner houses, gazing indolently at
whatever or whoever happened along; instead of that wretched cobblestone pavement
nuisance, I walked on a firm foundation of coral, built up from the bottom of the sea by
the absurd but persevering insect of that name, with a light layer of lava and cinders
overlying the coral, belched up out of fathomless hell long ago through the seared and
blackened crater that stands dead and cold and harmless yonder in the distance now;
instead of cramped and crowded streetcars, I met dusky native women sweeping by, free
as the wind, on fleet horses and astraddle, with gaudy riding sashes streaming like
banners behind them; instead of the combined stenches of Sacramento Street, Chinadom,
and Brannan Street slaughterhouses, I breathed the balmy fragrance of jessamine,
oleander, and the Pride of India; in place of the hurry and bustle and noisy confusion of
San Francisco, I moved in the midst of a summer calm as tranquil as dawn in the Garden
of Eden; in place of our familiar skirting sand hills and the placid bay, I saw on the one
side a framework of tall, precipitous mountains close at hand, clad in refreshing green,
and cleft by deep, cool, chasmlike valleys—and in front the grand sweep of the ocean; a
brilliant, transparent green near the shore, bound and bordered by a long white line of
foamy spray dashing against the reef, and further out the dead blue water of the deep sea,
flecked with "white caps," and in the far horizon a single, lonely sail—</p>
<p> At this moment, this man Brown, who has no better manners than to read over
one's shoulder, observes: </p>
<p> "Yes, and hot. Oh, I reckon not (only 82 in the shade)! Go on, now, and put it all
down, now that you've begun; just say, 'And more "santipedes," and cockroaches, and
fleas, and lizards, and red ants, and scorpions, and spiders, and mosquitoes and
missionaries'—oh, blame my cats if I'd live here two months, not if I was High-You-Muck-a-Muck and King of Wawhoo, and had a harem full of hyenas!" (Wahine, most
generally pronounced Wyheeny, seems to answer for wife, woman, and female of
questionable character, indifferently. I never can get this man Brown to understand that
"hyena" is not the proper pronunciation. He says "It ain't any odds; it describes some of
'em, anyway.") </p>
<p> I remarked: "But, Mr. Brown, these are trifles."</p>
<p>"Trifles be—blowed! You get nipped by one of them scorpions once, and see how
you like it! There was Mrs. Jones, swabbing her face with a sponge; she felt something
grab her cheek; she dropped the sponge and out popped a scorpion an inch and a half
long! Well, she just got up and danced the Highland fling for two hours and a half—and
yell!—why, you could have heard her from Lu-wow to Hoolahoola, with the wind fair!
and for three days she soaked her cheek in brandy and salt, and it swelled up as big as
your two fists. And you want to know what made me light out of bed so sudden last
night? Only a 'santipede'—nothing, only a 'santipede,' with forty-two legs on a side, and
every foot hot enough to burn a hole through a rawhide. Don't you know one of them
things grabbed Miss Boone's foot when she was riding one day? He was hid in the
stirrup, and just clamped himself around her foot and sunk his fangs plum through her
shoe; and she just throwed her whole soul into one war whoop and then fainted. And she
didn't get out of bed nor set that foot on the floor again for three weeks. And how did
Captain Godfrey always get off so easy? Why, because he always carried a bottle full of
scorpions and santipedes soaked in alcohol, and whenever he got bit he bathed the place
with that devilish mixture or took a drink out of it, I don't recollect which. And how did
he have to do once, when he hadn't his bottle along? He had to cut out the bite with his
knife and fill up the hole with arnica, and then prop his mouth open with the bootjack to
keep from getting the lockjaw. Oh, fill me up about this lovely country! You can go on
writing that slop about balmy breezes and fragrant flowers, and all that sort of truck, but
you're not going to leave out them santipedes and things for want of being reminded of it,
you know." </p>
<p> I said mildly: "But, Mr. Brown, these are the mere—" </p>
<p> "Mere—your grandmother! they ain't the mere anything! What's the use of you
telling me they're the mere—mere—whatever it was you was going to call it? You look at
them raw splotches all over my face—all over my arms—all over my body! Mosquito
bites! Don't tell me about mere—mere things! You can't get around them mosquito bites. I
took and brushed out my bar [mosquito net] good night before last, and tucked it in all
around, and before morning I was eternally thawed up, anyhow. And the night before I
fastened her up all right, and got in bed and smoked that old strong pipe until I got
strangled and smothered and couldn't get out, and then they swarmed in there and
jammed their bills through my shirt and sucked me as dry as a life preserver before I got
my breath again. And how did that deadfall work? I was two days making it, and sweated
two buckets full of brine, and blame the mosquito even went under it; and sloshing
around in my sleep I ketched my foot in it and got it flattened out so that it wouldn't go
into a green turtle shell forty-four inches across the back. Jim Ayers grinding out seven
double verses of poetry about Waw-<hi rend="italic">hoo</hi>! and crying about leaving the blasted
place in the two last verses; and you slobbering here about—there you are! Now—<hi rend="italic">now</hi>, what do you say? That yellow spider could straddle over a saucer just like
nothing—and if I hadn't been here to set that spittoon on him, he would have been between
your sheets in a minute—he was traveling straight for your bed—he had his eye on it. Just
pull at that web that he's been stringing after him—pretty near as hard to break as sewing
silk; and look at his feet sticking out all round the spittoon. Oh, confound Waw-<hi rend="italic">hoo</hi>!" </p>
<p> I am glad Brown has got disgusted at that murdered spider and gone; I don't like to be
interrupted when I am writing—especially by Brown, who is one of those men who
always looks at the unpleasant side of every thing, and I seldom do. </p>
</div2>
<closer>
<signed>MARK TWAIN</signed>
</closer>
</div1>
</body>
</text>
</TEI.2>
| 58.386364 | 195 | 0.761483 |
1c592dc754e724a2b39888b5b02b7e9da7def1a3 | 275 | xml | XML | _/com.packtpub.e4.advanced/com.packtpub.e4.advanced.p2.touchpoints/plugin.xml | paullewallencom/eclipse-978-1-7832-8779-6 | ecafd8df8148319d9438f5852d9632385ff2eba7 | [
"Apache-2.0"
] | null | null | null | _/com.packtpub.e4.advanced/com.packtpub.e4.advanced.p2.touchpoints/plugin.xml | paullewallencom/eclipse-978-1-7832-8779-6 | ecafd8df8148319d9438f5852d9632385ff2eba7 | [
"Apache-2.0"
] | null | null | null | _/com.packtpub.e4.advanced/com.packtpub.e4.advanced.p2.touchpoints/plugin.xml | paullewallencom/eclipse-978-1-7832-8779-6 | ecafd8df8148319d9438f5852d9632385ff2eba7 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<?eclipse version="3.4"?>
<plugin>
<extension point="org.eclipse.equinox.p2.engine.actions">
<action name="licenseCheck" version="1.0.0"
class="com.packtpub.e4.advanced.p2.touchpoints.LicenseCheck"/>
</extension>
</plugin>
| 30.555556 | 67 | 0.690909 |
e31c56929a65bd29df4200f3269fbf192b7be4e9 | 31,877 | xml | XML | OCR-files/Moreno_346/Moreno_346_1.xml | DesenrollandoElCordel/Moreno-OCR-files | 5d711a01d8b17c8e2848e82eda810b9fac28f441 | [
"CC0-1.0"
] | null | null | null | OCR-files/Moreno_346/Moreno_346_1.xml | DesenrollandoElCordel/Moreno-OCR-files | 5d711a01d8b17c8e2848e82eda810b9fac28f441 | [
"CC0-1.0"
] | null | null | null | OCR-files/Moreno_346/Moreno_346_1.xml | DesenrollandoElCordel/Moreno-OCR-files | 5d711a01d8b17c8e2848e82eda810b9fac28f441 | [
"CC0-1.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8" standalone="yes"?>
<PcGts xmlns="http://schema.primaresearch.org/PAGE/gts/pagecontent/2013-07-15" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://schema.primaresearch.org/PAGE/gts/pagecontent/2013-07-15 http://schema.primaresearch.org/PAGE/gts/pagecontent/2013-07-15/pagecontent.xsd">
<Metadata>
<Creator>prov=University of Rostock/Institute of Mathematics/CITlab|PLANET AI GmbH/Gundram Leifert/gundram.leifert@planet-ai.de:name=Pliegos de Cordel (XIXe) - v4(htr_id=27283)::::v=2.6.7
prov=University of Rostock/Institute of Mathematics/CITlab|PLANET AI GmbH/Tobias Gruening/tobias.gruening@planet-ai.de:name=de.uros.citlab.module.baseline2polygon.B2PSeamMultiOriented:v=2.6.7
prov=University of Rostock/Institute of Mathematics/CITlab|PLANET AI GmbH/Tobias Gruening/tobias.gruening@planet-ai.de:name=/net_tf/LA73_249_0mod360.pb:de.uros.citlab.segmentation.CITlab_LA_ML:v=2.6.7
Transkribus</Creator>
<Created>2020-11-04T17:40:17.318+01:00</Created>
<LastChange>2020-11-05T15:59:55.018+01:00</LastChange>
<Comments>
Measurement unit: pixel
PrimaryLanguage:
Producer: Transkribus
</Comments>
<TranskribusMetadata docId="525395" pageId="22319803" pageNr="83" tsid="47762830" status="DONE" userId="66244" imgUrl="https://files.transkribus.eu/Get?id=CRQDYPOTLPYSEJBSHVEJJVUN&fileType=view" xmlUrl="https://files.transkribus.eu/Get?id=IKIGASFJJEWCNSDPYEPHTECH" imageId="17389312"/>
</Metadata>
<Page imageFilename="Moreno_346_1.jpeg" imageWidth="1752" imageHeight="2480">
<PrintSpace>
<Coords points="138,191 1580,191 1580,2317 138,2317"/>
</PrintSpace>
<ReadingOrder>
<OrderedGroup id="ro_1607004610685" caption="Regions reading order">
<RegionRefIndexed index="0" regionRef="region_1604508297695_808"/>
<RegionRefIndexed index="2" regionRef="r_2_1"/>
<RegionRefIndexed index="3" regionRef="r_3_1"/>
<RegionRefIndexed index="4" regionRef="r_4_1"/>
</OrderedGroup>
</ReadingOrder>
<TextRegion orientation="0.0" type="paragraph" id="region_1604508297695_808" custom="readingOrder {index:0;} structure {type:paragraph;}">
<Coords points="1161,198 1421,198 1421,285 1161,285"/>
<TextLine id="region_1604508297695_808l1" custom="readingOrder {index:0;}">
<Coords points="1166,305 1191,305 1216,305 1241,305 1266,305 1292,306 1317,306 1342,307 1367,308 1392,308 1418,309 1418,159 1392,158 1367,158 1342,157 1317,156 1292,156 1266,155 1241,155 1216,155 1191,155 1166,155"/>
<Baseline points="1166,255 1191,255 1216,255 1241,255 1266,255 1292,256 1317,256 1342,257 1367,258 1392,258 1418,259"/>
<TextEquiv>
<Unicode>Núm. 222.</Unicode>
</TextEquiv>
</TextLine>
<TextEquiv>
<Unicode>Núm. 222.</Unicode>
</TextEquiv>
</TextRegion>
<GraphicRegion id="r_1" custom="readingOrder {index:1;}">
<Coords points="578,241 1150,246 1150,1075 578,1070"/>
</GraphicRegion>
<TextRegion orientation="0.0" type="paragraph" id="r_2_1" custom="readingOrder {index:2;}">
<Coords points="264,1145 1456,1145 1456,1346 264,1346"/>
<TextLine id="r_2_1l1" custom="readingOrder {index:0;}">
<Coords points="269,1243 331,1244 393,1245 455,1245 517,1246 579,1246 641,1247 703,1247 765,1247 827,1247 889,1248 951,1248 1013,1248 1075,1248 1137,1249 1199,1249 1261,1250 1323,1250 1385,1250 1448,1251 1448,1164 1385,1163 1323,1163 1261,1163 1199,1162 1137,1162 1075,1161 1013,1161 951,1161 889,1161 827,1160 765,1160 703,1160 641,1160 579,1159 517,1159 455,1158 393,1158 331,1157 269,1156"/>
<Baseline points="269,1214 331,1215 393,1216 455,1216 517,1217 579,1217 641,1218 703,1218 765,1218 827,1218 889,1219 951,1219 1013,1219 1075,1219 1137,1220 1199,1220 1261,1221 1323,1221 1385,1221 1448,1222"/>
<TextEquiv>
<Unicode>TROVOS DISCRETOS DE CONSEJOS,</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_2_1l2" custom="readingOrder {index:1;}">
<Coords points="467,1365 505,1365 544,1365 583,1365 622,1365 661,1365 699,1365 738,1365 777,1366 816,1366 855,1366 893,1366 932,1366 971,1367 1010,1367 1049,1367 1087,1367 1126,1367 1165,1367 1204,1367 1243,1367 1243,1280 1204,1280 1165,1280 1126,1280 1087,1280 1049,1280 1010,1280 971,1280 932,1279 893,1279 855,1279 816,1279 777,1279 738,1278 699,1278 661,1278 622,1278 583,1278 544,1278 505,1278 467,1278"/>
<Baseline points="467,1336 505,1336 544,1336 583,1336 622,1336 661,1336 699,1336 738,1336 777,1337 816,1337 855,1337 893,1337 932,1337 971,1338 1010,1338 1049,1338 1087,1338 1126,1338 1165,1338 1204,1338 1243,1338"/>
<TextEquiv>
<Unicode>PARA CANTAR A LA GUITARRA.</Unicode>
</TextEquiv>
</TextLine>
<TextEquiv>
<Unicode>TROVOS DISCRETOS DE CONSEJOS,
PARA CANTAR A LA GUITARRA.</Unicode>
</TextEquiv>
</TextRegion>
<TextRegion orientation="0.0" type="paragraph" id="r_3_1" custom="readingOrder {index:3;}">
<Coords points="138,1526 780,1526 780,2317 138,2317"/>
<TextLine id="r_3_1l1" custom="readingOrder {index:0;}">
<Coords points="482,1574 492,1576 492,1542 482,1540"/>
<Baseline points="482,1563 492,1565"/>
<TextEquiv>
<Unicode>I.</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l2" custom="readingOrder {index:1;}">
<Coords points="203,1623 228,1622 254,1622 279,1622 305,1622 331,1622 356,1622 382,1622 408,1622 433,1622 459,1622 484,1623 510,1623 536,1623 561,1623 587,1623 613,1624 613,1590 587,1589 561,1589 536,1589 510,1589 484,1589 459,1588 433,1588 408,1588 382,1588 356,1588 331,1588 305,1588 279,1588 254,1588 228,1588 203,1589"/>
<Baseline points="203,1612 228,1611 254,1611 279,1611 305,1611 331,1611 356,1611 382,1611 408,1611 433,1611 459,1611 484,1612 510,1612 536,1612 561,1612 587,1612 613,1613"/>
<TextEquiv>
<Unicode>Nadie fie á la muger</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l3" custom="readingOrder {index:2;}">
<Coords points="164,1672 189,1672 214,1672 239,1672 264,1672 290,1672 315,1671 340,1671 365,1671 391,1671 416,1672 441,1672 466,1672 491,1672 517,1673 542,1673 567,1674 592,1675 618,1675 618,1642 592,1642 567,1641 542,1640 517,1640 491,1639 466,1639 441,1639 416,1639 391,1638 365,1638 340,1638 315,1638 290,1639 264,1639 239,1639 214,1639 189,1639 164,1639"/>
<Baseline points="164,1661 189,1661 214,1661 239,1661 264,1661 290,1661 315,1660 340,1660 365,1660 391,1660 416,1661 441,1661 466,1661 491,1661 517,1662 542,1662 567,1663 592,1664 618,1664"/>
<TextEquiv>
<Unicode>sus tesoros y riquezas,</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l4" custom="readingOrder {index:3;}">
<Coords points="157,1721 184,1721 211,1721 238,1721 266,1720 293,1720 320,1720 348,1720 375,1720 402,1720 430,1720 457,1720 484,1721 512,1721 539,1721 566,1721 594,1721 621,1721 648,1721 676,1721 676,1688 648,1688 621,1688 594,1688 566,1688 539,1688 512,1688 484,1688 457,1687 430,1687 402,1687 375,1687 348,1687 320,1687 293,1687 266,1687 238,1688 211,1688 184,1688 157,1688"/>
<Baseline points="157,1710 184,1710 211,1710 238,1710 266,1709 293,1709 320,1709 348,1709 375,1709 402,1709 430,1709 457,1709 484,1710 512,1710 539,1710 566,1710 594,1710 621,1710 648,1710 676,1710"/>
<TextEquiv>
<Unicode>porque si no es, puede ser</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l5" custom="readingOrder {index:4;}">
<Coords points="155,1770 181,1770 207,1769 233,1769 259,1769 285,1769 311,1769 337,1769 363,1769 389,1769 415,1769 441,1769 467,1769 493,1769 519,1769 545,1770 571,1770 597,1770 623,1771 650,1772 650,1738 623,1737 597,1736 571,1736 545,1736 519,1735 493,1735 467,1735 441,1735 415,1735 389,1735 363,1735 337,1735 311,1735 285,1735 259,1735 233,1735 207,1735 181,1736 155,1736"/>
<Baseline points="155,1759 181,1759 207,1758 233,1758 259,1758 285,1758 311,1758 337,1758 363,1758 389,1758 415,1758 441,1758 467,1758 493,1758 519,1758 545,1759 571,1759 597,1759 623,1760 650,1761"/>
<TextEquiv>
<Unicode>que lo lleve á la pobreza</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l6" custom="readingOrder {index:5;}">
<Coords points="152,1817 177,1818 202,1818 227,1818 252,1818 277,1818 302,1818 327,1818 352,1818 377,1818 403,1818 428,1818 453,1818 478,1818 503,1818 528,1818 553,1819 578,1819 603,1819 628,1820 654,1821 654,1787 628,1786 603,1785 578,1785 553,1785 528,1784 503,1784 478,1784 453,1784 428,1784 403,1784 377,1784 352,1784 327,1784 302,1784 277,1784 252,1784 227,1784 202,1784 177,1784 152,1783"/>
<Baseline points="152,1806 177,1807 202,1807 227,1807 252,1807 277,1807 302,1807 327,1807 352,1807 377,1807 403,1807 428,1807 453,1807 478,1807 503,1807 528,1807 553,1808 578,1808 603,1808 628,1809 654,1810"/>
<TextEquiv>
<Unicode>si comienza á envanecer.</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l7" custom="readingOrder {index:6;}">
<Coords points="203,1914 229,1915 255,1915 281,1915 308,1915 334,1915 360,1915 386,1915 413,1915 439,1915 465,1915 492,1915 518,1915 544,1915 570,1915 597,1916 623,1917 649,1918 676,1919 676,1885 649,1884 623,1883 597,1882 570,1881 544,1881 518,1881 492,1881 465,1881 439,1881 413,1881 386,1881 360,1881 334,1881 308,1881 281,1881 255,1881 229,1881 203,1880"/>
<Baseline points="203,1903 229,1904 255,1904 281,1904 308,1904 334,1904 360,1904 386,1904 413,1904 439,1904 465,1904 492,1904 518,1904 544,1904 570,1904 597,1905 623,1906 649,1907 676,1908"/>
<TextEquiv>
<Unicode>Aunque llegue á poseer</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l8" custom="readingOrder {index:7;}">
<Coords points="155,1963 180,1963 206,1964 232,1964 257,1964 283,1964 309,1965 334,1965 360,1965 386,1965 412,1965 437,1965 463,1965 489,1965 514,1965 540,1965 566,1966 592,1966 592,1932 566,1932 540,1931 514,1931 489,1931 463,1931 437,1931 412,1931 386,1931 360,1931 334,1931 309,1931 283,1930 257,1930 232,1930 206,1930 180,1929 155,1929"/>
<Baseline points="155,1952 180,1952 206,1953 232,1953 257,1953 283,1953 309,1954 334,1954 360,1954 386,1954 412,1954 437,1954 463,1954 489,1954 514,1954 540,1954 566,1955 592,1955"/>
<TextEquiv>
<Unicode>el amor mas singular</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l9" custom="readingOrder {index:8;}">
<Coords points="160,2012 186,2013 213,2013 239,2014 266,2014 292,2014 319,2014 345,2014 372,2014 398,2013 425,2013 452,2013 478,2013 505,2013 531,2013 558,2013 584,2013 611,2014 637,2014 664,2015 691,2017 691,1983 664,1981 637,1980 611,1980 584,1979 558,1979 531,1979 505,1979 478,1979 452,1979 425,1979 398,1979 372,1980 345,1980 319,1980 292,1980 266,1980 239,1980 213,1979 186,1979 160,1978"/>
<Baseline points="160,2001 186,2002 213,2002 239,2003 266,2003 292,2003 319,2003 345,2003 372,2003 398,2002 425,2002 452,2002 478,2002 505,2002 531,2002 558,2002 584,2002 611,2003 637,2003 664,2004 691,2006"/>
<TextEquiv>
<Unicode>que el amante llegó á ver,</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l10" custom="readingOrder {index:9;}">
<Coords points="155,2061 182,2061 209,2061 236,2062 264,2062 291,2062 318,2062 346,2062 373,2062 400,2062 428,2062 455,2062 482,2062 509,2062 537,2063 564,2063 591,2063 619,2063 646,2064 673,2065 701,2065 701,2031 673,2031 646,2030 619,2029 591,2029 564,2029 537,2029 509,2028 482,2028 455,2028 428,2028 400,2028 373,2028 346,2028 318,2028 291,2028 264,2028 236,2028 209,2027 182,2027 155,2027"/>
<Baseline points="155,2050 182,2050 209,2050 236,2051 264,2051 291,2051 318,2051 346,2051 373,2051 400,2051 428,2051 455,2051 482,2051 509,2051 537,2052 564,2052 591,2052 619,2052 646,2053 673,2054 701,2054"/>
<TextEquiv>
<Unicode>cosa que llegue á importar</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l11" custom="readingOrder {index:10;}">
<Coords points="150,2110 176,2111 202,2111 228,2111 254,2112 280,2111 306,2111 332,2111 358,2111 384,2111 410,2110 436,2110 462,2111 488,2111 514,2111 540,2113 566,2114 566,2080 540,2079 514,2077 488,2077 462,2077 436,2076 410,2076 384,2077 358,2077 332,2077 306,2077 280,2077 254,2078 228,2077 202,2077 176,2077 150,2076"/>
<Baseline points="150,2099 176,2100 202,2100 228,2100 254,2101 280,2100 306,2100 332,2100 358,2100 384,2100 410,2099 436,2099 462,2100 488,2100 514,2100 540,2102 566,2103"/>
<TextEquiv>
<Unicode>nadie fie á la muger.</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l12" custom="readingOrder {index:11;}">
<Coords points="193,2158 218,2159 244,2160 269,2160 295,2160 321,2161 346,2161 372,2161 397,2161 423,2161 449,2161 474,2161 500,2161 525,2161 551,2162 577,2162 577,2128 551,2128 525,2127 500,2127 474,2127 449,2127 423,2127 397,2127 372,2127 346,2127 321,2127 295,2126 269,2126 244,2126 218,2125 193,2124"/>
<Baseline points="193,2147 218,2148 244,2149 269,2149 295,2149 321,2150 346,2150 372,2150 397,2150 423,2150 449,2150 474,2150 500,2150 525,2150 551,2151 577,2151"/>
<TextEquiv>
<Unicode>El ardor y sutileza</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l13" custom="readingOrder {index:12;}">
<Coords points="150,2206 175,2207 201,2208 227,2209 253,2209 279,2210 305,2210 331,2210 357,2209 383,2209 409,2209 434,2209 460,2209 486,2209 512,2209 538,2209 564,2210 590,2211 616,2212 642,2213 668,2215 668,2181 642,2179 616,2178 590,2177 564,2176 538,2175 512,2175 486,2175 460,2175 434,2175 409,2175 383,2175 357,2175 331,2176 305,2176 279,2176 253,2175 227,2175 201,2174 175,2173 150,2172"/>
<Baseline points="150,2195 175,2196 201,2197 227,2198 253,2198 279,2199 305,2199 331,2199 357,2198 383,2198 409,2198 434,2198 460,2198 486,2198 512,2198 538,2198 564,2199 590,2200 616,2201 642,2202 668,2204"/>
<TextEquiv>
<Unicode>de la mujer bien querida,</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l14" custom="readingOrder {index:13;}">
<Coords points="143,2257 169,2257 195,2258 221,2258 247,2258 273,2258 299,2258 325,2258 351,2258 377,2257 403,2257 429,2257 455,2257 481,2257 507,2258 533,2258 559,2259 585,2260 611,2262 637,2263 637,2229 611,2228 585,2226 559,2225 533,2224 507,2224 481,2223 455,2223 429,2223 403,2223 377,2223 351,2224 325,2224 299,2224 273,2224 247,2224 221,2224 195,2224 169,2223 143,2223"/>
<Baseline points="143,2246 169,2246 195,2247 221,2247 247,2247 273,2247 299,2247 325,2247 351,2247 377,2246 403,2246 429,2246 455,2246 481,2246 507,2247 533,2247 559,2248 585,2249 611,2251 637,2252"/>
<TextEquiv>
<Unicode>ácia el interés endereza,</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_3_1l15" custom="readingOrder {index:14;}">
<Coords points="138,2309 168,2309 198,2308 228,2308 258,2308 288,2308 318,2308 348,2308 378,2308 408,2308 439,2308 469,2309 499,2309 529,2309 559,2309 589,2310 619,2310 649,2311 679,2311 709,2312 740,2313 740,2279 709,2278 679,2277 649,2277 619,2276 589,2276 559,2275 529,2275 499,2275 469,2275 439,2274 408,2274 378,2274 348,2274 318,2274 288,2274 258,2274 228,2274 198,2274 168,2275 138,2275"/>
<Baseline points="138,2298 168,2298 198,2297 228,2297 258,2297 288,2297 318,2297 348,2297 378,2297 408,2297 439,2297 469,2298 499,2298 529,2298 559,2298 589,2299 619,2299 649,2300 679,2300 709,2301 740,2302"/>
<TextEquiv>
<Unicode>y del hombre anhela erguida,</Unicode>
</TextEquiv>
</TextLine>
<TextEquiv>
<Unicode>I.
Nadie fie á la muger
sus tesoros y riquezas,
porque si no es, puede ser
que lo lleve á la pobreza
si comienza á envanecer.
Aunque llegue á poseer
el amor mas singular
que el amante llegó á ver,
cosa que llegue á importar
nadie fie á la muger.
El ardor y sutileza
de la mujer bien querida,
ácia el interés endereza,
y del hombre anhela erguida,</Unicode>
</TextEquiv>
</TextRegion>
<TextRegion orientation="0.0" type="paragraph" id="r_4_1" custom="readingOrder {index:4;}">
<Coords points="862,1527 1485,1527 1485,2312 862,2312"/>
<TextLine id="r_4_1l1" custom="readingOrder {index:0;}">
<Coords points="872,1574 897,1574 923,1574 948,1574 974,1574 999,1574 1025,1574 1050,1574 1076,1574 1102,1574 1127,1575 1153,1575 1178,1575 1204,1575 1229,1575 1255,1576 1280,1576 1306,1576 1332,1576 1332,1542 1306,1542 1280,1542 1255,1542 1229,1541 1204,1541 1178,1541 1153,1541 1127,1541 1102,1540 1076,1540 1050,1540 1025,1540 999,1540 974,1540 948,1540 923,1540 897,1540 872,1540"/>
<Baseline points="872,1563 897,1563 923,1563 948,1563 974,1563 999,1563 1025,1563 1050,1563 1076,1563 1102,1563 1127,1564 1153,1564 1178,1564 1204,1564 1229,1564 1255,1565 1280,1565 1306,1565 1332,1565"/>
<TextEquiv>
<Unicode>sus tesoros y riquezas.</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l2" custom="readingOrder {index:1;}">
<Coords points="923,1623 949,1623 975,1622 1001,1622 1027,1622 1053,1622 1079,1622 1105,1622 1131,1622 1158,1623 1184,1623 1210,1624 1236,1624 1262,1624 1288,1625 1314,1625 1340,1625 1367,1625 1367,1591 1340,1591 1314,1591 1288,1591 1262,1590 1236,1590 1210,1590 1184,1589 1158,1589 1131,1588 1105,1588 1079,1588 1053,1588 1027,1588 1001,1588 975,1588 949,1589 923,1589"/>
<Baseline points="923,1612 949,1612 975,1611 1001,1611 1027,1611 1053,1611 1079,1611 1105,1611 1131,1611 1158,1612 1184,1612 1210,1613 1236,1613 1262,1613 1288,1614 1314,1614 1340,1614 1367,1614"/>
<TextEquiv>
<Unicode>Suele una dama tener</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l3" custom="readingOrder {index:2;}">
<Coords points="873,1672 898,1672 923,1672 948,1671 973,1671 999,1671 1024,1671 1049,1671 1074,1671 1099,1671 1125,1672 1150,1672 1175,1672 1200,1672 1225,1673 1251,1673 1251,1639 1225,1639 1200,1638 1175,1638 1150,1638 1125,1638 1099,1637 1074,1637 1049,1637 1024,1637 999,1637 973,1637 948,1637 923,1638 898,1638 873,1638"/>
<Baseline points="873,1661 898,1661 923,1661 948,1660 973,1660 999,1660 1024,1660 1049,1660 1074,1660 1099,1660 1125,1661 1150,1661 1175,1661 1200,1661 1225,1662 1251,1662"/>
<TextEquiv>
<Unicode>firmeza y fidelidad:</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l4" custom="readingOrder {index:3;}">
<Coords points="875,1721 903,1721 931,1721 960,1721 988,1721 1016,1721 1045,1721 1073,1721 1101,1721 1130,1721 1158,1721 1186,1721 1215,1721 1243,1721 1271,1721 1300,1721 1328,1722 1356,1722 1385,1722 1413,1723 1442,1724 1442,1690 1413,1689 1385,1688 1356,1688 1328,1688 1300,1687 1271,1687 1243,1687 1215,1687 1186,1687 1158,1687 1130,1687 1101,1687 1073,1687 1045,1687 1016,1687 988,1687 960,1687 931,1687 903,1687 875,1687"/>
<Baseline points="875,1710 903,1710 931,1710 960,1710 988,1710 1016,1710 1045,1710 1073,1710 1101,1710 1130,1710 1158,1710 1186,1710 1215,1710 1243,1710 1271,1710 1300,1710 1328,1711 1356,1711 1385,1711 1413,1712 1442,1713"/>
<TextEquiv>
<Unicode>mas por eso no ha de haber</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l5" custom="readingOrder {index:4;}">
<Coords points="870,1769 896,1769 922,1769 948,1769 974,1769 1000,1769 1026,1769 1052,1769 1078,1769 1104,1769 1130,1769 1156,1770 1182,1770 1208,1771 1234,1771 1260,1772 1287,1773 1287,1739 1260,1738 1234,1737 1208,1737 1182,1736 1156,1736 1130,1735 1104,1735 1078,1735 1052,1735 1026,1735 1000,1735 974,1735 948,1735 922,1735 896,1735 870,1735"/>
<Baseline points="870,1758 896,1758 922,1758 948,1758 974,1758 1000,1758 1026,1758 1052,1758 1078,1758 1104,1758 1130,1758 1156,1759 1182,1759 1208,1760 1234,1760 1260,1761 1287,1762"/>
<TextEquiv>
<Unicode>constante seguridad,</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l6" custom="readingOrder {index:5;}">
<Coords points="873,1819 899,1819 926,1818 952,1818 979,1818 1005,1818 1032,1818 1058,1819 1085,1819 1111,1819 1138,1819 1165,1819 1191,1820 1218,1820 1244,1820 1271,1820 1297,1820 1324,1820 1350,1819 1377,1819 1404,1819 1404,1785 1377,1785 1350,1785 1324,1786 1297,1786 1271,1786 1244,1786 1218,1786 1191,1786 1165,1785 1138,1785 1111,1785 1085,1785 1058,1785 1032,1784 1005,1784 979,1784 952,1784 926,1784 899,1785 873,1785"/>
<Baseline points="873,1808 899,1808 926,1807 952,1807 979,1807 1005,1807 1032,1807 1058,1808 1085,1808 1111,1808 1138,1808 1165,1808 1191,1809 1218,1809 1244,1809 1271,1809 1297,1809 1324,1809 1350,1808 1377,1808 1404,1808"/>
<TextEquiv>
<Unicode>porque si no es, puede ser.</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l7" custom="readingOrder {index:6;}">
<Coords points="916,1869 943,1868 970,1867 997,1867 1025,1866 1052,1866 1079,1866 1107,1866 1134,1867 1161,1867 1189,1867 1216,1867 1243,1868 1270,1868 1298,1868 1325,1869 1352,1869 1380,1869 1407,1869 1434,1869 1462,1869 1462,1835 1434,1835 1407,1835 1380,1835 1352,1835 1325,1835 1298,1834 1270,1834 1243,1834 1216,1833 1189,1833 1161,1833 1134,1833 1107,1832 1079,1832 1052,1832 1025,1832 997,1833 970,1833 943,1834 916,1835"/>
<Baseline points="916,1858 943,1857 970,1856 997,1856 1025,1855 1052,1855 1079,1855 1107,1855 1134,1856 1161,1856 1189,1856 1216,1856 1243,1857 1270,1857 1298,1857 1325,1858 1352,1858 1380,1858 1407,1858 1434,1858 1462,1858"/>
<TextEquiv>
<Unicode>Al hombre de mas riqueza</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l8" custom="readingOrder {index:7;}">
<Coords points="875,1918 900,1918 926,1917 951,1917 977,1917 1003,1916 1028,1916 1054,1916 1080,1916 1105,1916 1131,1916 1157,1916 1182,1916 1208,1917 1234,1917 1259,1917 1285,1917 1311,1917 1311,1883 1285,1883 1259,1883 1234,1883 1208,1883 1182,1882 1157,1882 1131,1882 1105,1882 1080,1882 1054,1882 1028,1882 1003,1882 977,1883 951,1883 926,1883 900,1884 875,1884"/>
<Baseline points="875,1907 900,1907 926,1906 951,1906 977,1906 1003,1905 1028,1905 1054,1905 1080,1905 1105,1905 1131,1905 1157,1905 1182,1905 1208,1906 1234,1906 1259,1906 1285,1906 1311,1906"/>
<TextEquiv>
<Unicode>puede suceder el caso</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l9" custom="readingOrder {index:8;}">
<Coords points="875,1965 901,1965 927,1965 954,1965 980,1965 1007,1965 1033,1965 1060,1965 1086,1965 1113,1965 1139,1965 1165,1965 1192,1965 1218,1966 1245,1966 1271,1966 1298,1966 1324,1966 1351,1967 1377,1967 1404,1967 1404,1933 1377,1933 1351,1933 1324,1932 1298,1932 1271,1932 1245,1932 1218,1932 1192,1931 1165,1931 1139,1931 1113,1931 1086,1931 1060,1931 1033,1931 1007,1931 980,1931 954,1931 927,1931 901,1931 875,1931"/>
<Baseline points="875,1954 901,1954 927,1954 954,1954 980,1954 1007,1954 1033,1954 1060,1954 1086,1954 1113,1954 1139,1954 1165,1954 1192,1954 1218,1955 1245,1955 1271,1955 1298,1955 1324,1955 1351,1956 1377,1956 1404,1956"/>
<TextEquiv>
<Unicode>que la muger con destreza</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l10" custom="readingOrder {index:9;}">
<Coords points="870,2013 895,2013 921,2013 946,2013 972,2013 997,2014 1023,2014 1048,2013 1074,2013 1100,2013 1125,2014 1151,2014 1176,2014 1202,2014 1227,2015 1253,2015 1278,2016 1304,2017 1330,2018 1330,1984 1304,1983 1278,1982 1253,1981 1227,1981 1202,1980 1176,1980 1151,1980 1125,1980 1100,1979 1074,1979 1048,1979 1023,1980 997,1980 972,1979 946,1979 921,1979 895,1979 870,1979"/>
<Baseline points="870,2002 895,2002 921,2002 946,2002 972,2002 997,2003 1023,2003 1048,2002 1074,2002 1100,2002 1125,2003 1151,2003 1176,2003 1202,2003 1227,2004 1253,2004 1278,2005 1304,2006 1330,2007"/>
<TextEquiv>
<Unicode>si no cela paso á paso,</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l11" custom="readingOrder {index:10;}">
<Coords points="873,2064 899,2063 925,2063 951,2063 977,2063 1004,2063 1030,2063 1056,2063 1082,2063 1108,2063 1135,2063 1161,2063 1187,2063 1213,2063 1239,2063 1266,2064 1292,2064 1318,2064 1344,2064 1371,2065 1371,2031 1344,2030 1318,2030 1292,2030 1266,2030 1239,2029 1213,2029 1187,2029 1161,2029 1135,2029 1108,2029 1082,2029 1056,2029 1030,2029 1004,2029 977,2029 951,2029 925,2029 899,2029 873,2030"/>
<Baseline points="873,2053 899,2052 925,2052 951,2052 977,2052 1004,2052 1030,2052 1056,2052 1082,2052 1108,2052 1135,2052 1161,2052 1187,2052 1213,2052 1239,2052 1266,2053 1292,2053 1318,2053 1344,2053 1371,2054"/>
<TextEquiv>
<Unicode>que le lleve á la pobreza.</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l12" custom="readingOrder {index:11;}">
<Coords points="912,2110 940,2110 969,2110 997,2111 1026,2111 1054,2111 1083,2111 1111,2112 1140,2112 1168,2112 1197,2113 1225,2113 1254,2113 1282,2113 1311,2114 1339,2114 1368,2114 1396,2114 1425,2114 1453,2114 1482,2114 1482,2080 1453,2080 1425,2080 1396,2080 1368,2080 1339,2080 1311,2080 1282,2079 1254,2079 1225,2079 1197,2079 1168,2078 1140,2078 1111,2078 1083,2077 1054,2077 1026,2077 997,2077 969,2076 940,2076 912,2076"/>
<Baseline points="912,2099 940,2099 969,2099 997,2100 1026,2100 1054,2100 1083,2100 1111,2101 1140,2101 1168,2101 1197,2102 1225,2102 1254,2102 1282,2102 1311,2103 1339,2103 1368,2103 1396,2103 1425,2103 1453,2103 1482,2103"/>
<TextEquiv>
<Unicode>No hay quien pueda detener</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l13" custom="readingOrder {index:12;}">
<Coords points="866,2160 891,2160 917,2161 943,2161 969,2161 994,2161 1020,2161 1046,2161 1072,2161 1098,2161 1123,2161 1149,2161 1175,2161 1201,2162 1226,2162 1252,2162 1278,2162 1304,2162 1330,2162 1330,2128 1304,2128 1278,2128 1252,2128 1226,2128 1201,2128 1175,2127 1149,2127 1123,2127 1098,2127 1072,2127 1046,2127 1020,2127 994,2127 969,2127 943,2127 917,2127 891,2126 866,2126"/>
<Baseline points="866,2149 891,2149 917,2150 943,2150 969,2150 994,2150 1020,2150 1046,2150 1072,2150 1098,2150 1123,2150 1149,2150 1175,2150 1201,2151 1226,2151 1252,2151 1278,2151 1304,2151 1330,2151"/>
<TextEquiv>
<Unicode>de una muger el ardor</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l14" custom="readingOrder {index:13;}">
<Coords points="863,2211 888,2211 914,2210 940,2210 966,2210 992,2209 1018,2209 1044,2209 1070,2209 1096,2210 1122,2210 1148,2210 1174,2210 1200,2210 1226,2211 1252,2211 1278,2211 1304,2211 1330,2211 1330,2177 1304,2177 1278,2177 1252,2177 1226,2177 1200,2176 1174,2176 1148,2176 1122,2176 1096,2176 1070,2175 1044,2175 1018,2175 992,2175 966,2176 940,2176 914,2176 888,2177 863,2177"/>
<Baseline points="863,2200 888,2200 914,2199 940,2199 966,2199 992,2198 1018,2198 1044,2198 1070,2198 1096,2199 1122,2199 1148,2199 1174,2199 1200,2199 1226,2200 1252,2200 1278,2200 1304,2200 1330,2200"/>
<TextEquiv>
<Unicode>á quien le incita su ser</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l15" custom="readingOrder {index:14;}">
<Coords points="868,2260 893,2259 918,2259 943,2258 968,2258 993,2258 1018,2257 1043,2258 1068,2258 1094,2258 1119,2258 1144,2258 1169,2259 1194,2259 1219,2259 1244,2260 1269,2260 1294,2260 1320,2260 1320,2226 1294,2226 1269,2226 1244,2226 1219,2225 1194,2225 1169,2225 1144,2224 1119,2224 1094,2224 1068,2224 1043,2224 1018,2223 993,2224 968,2224 943,2224 918,2225 893,2225 868,2226"/>
<Baseline points="868,2249 893,2248 918,2248 943,2247 968,2247 993,2247 1018,2246 1043,2247 1068,2247 1094,2247 1119,2247 1144,2247 1169,2248 1194,2248 1219,2248 1244,2249 1269,2249 1294,2249 1320,2249"/>
<TextEquiv>
<Unicode>para vestir con primor</Unicode>
</TextEquiv>
</TextLine>
<TextLine id="r_4_1l16" custom="readingOrder {index:15;}">
<Coords points="868,2308 894,2308 920,2309 946,2309 972,2309 998,2309 1024,2309 1050,2308 1076,2308 1102,2308 1128,2308 1154,2308 1180,2308 1206,2308 1232,2309 1258,2309 1284,2309 1310,2310 1336,2310 1363,2311 1363,2277 1336,2276 1310,2276 1284,2275 1258,2275 1232,2275 1206,2274 1180,2274 1154,2274 1128,2274 1102,2274 1076,2274 1050,2274 1024,2275 998,2275 972,2275 946,2275 920,2275 894,2274 868,2274"/>
<Baseline points="868,2297 894,2297 920,2298 946,2298 972,2298 998,2298 1024,2298 1050,2297 1076,2297 1102,2297 1128,2297 1154,2297 1180,2297 1206,2297 1232,2298 1258,2298 1284,2298 1310,2299 1336,2299 1363,2300"/>
<TextEquiv>
<Unicode>si comienza á envanecer,</Unicode>
</TextEquiv>
</TextLine>
<TextEquiv>
<Unicode>sus tesoros y riquezas.
Suele una dama tener
firmeza y fidelidad:
mas por eso no ha de haber
constante seguridad,
porque si no es, puede ser.
Al hombre de mas riqueza
puede suceder el caso
que la muger con destreza
si no cela paso á paso,
que le lleve á la pobreza.
No hay quien pueda detener
de una muger el ardor
á quien le incita su ser
para vestir con primor
si comienza á envanecer,</Unicode>
</TextEquiv>
</TextRegion>
</Page>
</PcGts>
| 97.782209 | 446 | 0.666939 |
e31e218fa95ec09a3e2707435cba25d9c1eaf0c2 | 3,902 | xml | XML | docs/OpenTK-1.0/en/OpenTK.Graphics/GraphicsBindingsBase.xml | kenanlv/android-api-docs | 4e107f5aa5e1f0232f0b04e04273519015a1a93d | [
"CC-BY-4.0",
"MIT"
] | 20 | 2019-05-10T03:23:40.000Z | 2022-02-24T04:04:26.000Z | docs/OpenTK-1.0/en/OpenTK.Graphics/GraphicsBindingsBase.xml | kenanlv/android-api-docs | 4e107f5aa5e1f0232f0b04e04273519015a1a93d | [
"CC-BY-4.0",
"MIT"
] | 20 | 2019-06-19T23:30:45.000Z | 2022-02-08T16:51:37.000Z | docs/OpenTK-1.0/en/OpenTK.Graphics/GraphicsBindingsBase.xml | kenanlv/android-api-docs | 4e107f5aa5e1f0232f0b04e04273519015a1a93d | [
"CC-BY-4.0",
"MIT"
] | 6 | 2019-05-13T01:18:09.000Z | 2021-11-10T14:51:21.000Z | <Type Name="GraphicsBindingsBase" FullName="OpenTK.Graphics.GraphicsBindingsBase">
<TypeSignature Language="C#" Value="public abstract class GraphicsBindingsBase : OpenTK.BindingsBase" />
<TypeSignature Language="ILAsm" Value=".class public auto ansi abstract beforefieldinit GraphicsBindingsBase extends OpenTK.BindingsBase" />
<AssemblyInfo>
<AssemblyName>OpenTK-1.0</AssemblyName>
<AssemblyVersion>1.0.0.0</AssemblyVersion>
</AssemblyInfo>
<Base>
<BaseTypeName>OpenTK.BindingsBase</BaseTypeName>
</Base>
<Interfaces />
<Docs>
<summary>
Implements BindingsBase for the OpenTK.Graphics namespace (OpenGL and OpenGL|ES).
</summary>
<remarks>
<para>Portions of this page are modifications based on work created and shared by the <format type="text/html"><a href="https://developers.google.com/terms/site-policies" title="Android Open Source Project">Android Open Source Project</a></format> and used according to terms described in the <format type="text/html"><a href="https://creativecommons.org/licenses/by/2.5/" title="Creative Commons 2.5 Attribution License">Creative Commons 2.5 Attribution License.</a></format></para>
</remarks>
</Docs>
<Members>
<Member MemberName=".ctor">
<MemberSignature Language="C#" Value="protected GraphicsBindingsBase ();" />
<MemberSignature Language="ILAsm" Value=".method familyhidebysig specialname rtspecialname instance void .ctor() cil managed" />
<MemberType>Constructor</MemberType>
<AssemblyInfo>
<AssemblyVersion>1.0.0.0</AssemblyVersion>
</AssemblyInfo>
<Parameters />
<Docs>
<summary>To be added.</summary>
<remarks>
<para>Portions of this page are modifications based on work created and shared by the <format type="text/html"><a href="https://developers.google.com/terms/site-policies" title="Android Open Source Project">Android Open Source Project</a></format> and used according to terms described in the <format type="text/html"><a href="https://creativecommons.org/licenses/by/2.5/" title="Creative Commons 2.5 Attribution License">Creative Commons 2.5 Attribution License.</a></format></para>
</remarks>
</Docs>
</Member>
<Member MemberName="GetAddress">
<MemberSignature Language="C#" Value="protected override IntPtr GetAddress (string funcname);" />
<MemberSignature Language="ILAsm" Value=".method familyhidebysig virtual instance native int GetAddress(string funcname) cil managed" />
<MemberType>Method</MemberType>
<AssemblyInfo>
<AssemblyVersion>1.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.IntPtr</ReturnType>
</ReturnValue>
<Parameters>
<Parameter Name="funcname" Type="System.String" />
</Parameters>
<Docs>
<param name="funcname">
A <see cref="T:System.String" /> that defines the name of the function.
</param>
<summary>
Retrieves an unmanaged function pointer to the specified function.
</summary>
<returns>
A <see cref="T:System.IntPtr" /> that contains the address of funcname or IntPtr.Zero,
if the function is not supported by the drivers.
</returns>
<remarks>
<para>Portions of this page are modifications based on work created and shared by the <format type="text/html"><a href="https://developers.google.com/terms/site-policies" title="Android Open Source Project">Android Open Source Project</a></format> and used according to terms described in the <format type="text/html"><a href="https://creativecommons.org/licenses/by/2.5/" title="Creative Commons 2.5 Attribution License">Creative Commons 2.5 Attribution License.</a></format></para>
</remarks>
</Docs>
</Member>
</Members>
</Type>
| 58.238806 | 493 | 0.692209 |
41ca864eaebb69409008beaca28e7bcbf6a7ce6e | 80,605 | xml | XML | N21862.xml | textcreationpartnership/N21862 | bc22899ad50a0b609f9fb0d04fc931f37ab4041c | [
"CC0-1.0"
] | null | null | null | N21862.xml | textcreationpartnership/N21862 | bc22899ad50a0b609f9fb0d04fc931f37ab4041c | [
"CC0-1.0"
] | null | null | null | N21862.xml | textcreationpartnership/N21862 | bc22899ad50a0b609f9fb0d04fc931f37ab4041c | [
"CC0-1.0"
] | null | null | null | <TEI xmlns="http://www.tei-c.org/ns/1.0">
<teiHeader>
<fileDesc>
<titleStmt>
<title>Testimony of the authenticity of the prophecies of Richard Brothers, and of his mission to recall the Jews, / by Nathaniel Brassy [i.e., Brassey] Halhed, M.P. ; [One line of Scripture text]</title>
<author>Halhed, Nathaniel Brassey, 1751-1830.</author>
</titleStmt>
<extent>Approx. 68 KB of XML-encoded text transcribed from 32 1-bit group-IV TIFF page images.</extent>
<publicationStmt>
<publisher>Text Creation Partnership,</publisher>
<pubPlace>Ann Arbor, MI :</pubPlace>
<date when="2012-01">2012-01.</date>
<idno type="DLPS">N21862</idno>
<idno type="TCP">N21862</idno>
<idno type="STC">Evans 28790</idno>
<idno type="NOTIS">APY1215</idno>
<idno type="IMAGE-SET">28790</idno>
<idno type="EVANS-CITATION">99028281</idno>
<availability>
<p>This keyboarded and encoded edition of the
work described above is co-owned by the institutions
providing financial support to the Early English Books
Online Text Creation Partnership. This Phase I text is
available for reuse, according to the terms of <ref target="https://creativecommons.org/publicdomain/zero/1.0/">Creative
Commons 0 1.0 Universal</ref>. The text can be copied,
modified, distributed and performed, even for
commercial purposes, all without asking permission.</p>
</availability>
</publicationStmt>
<seriesStmt>
<title>Early American Imprints, 1639-1800 ; no. 28790.</title>
</seriesStmt>
<notesStmt>
<note>(Evans-TCP ; no. N21862)</note>
<note>Transcribed from: (Readex Archive of Americana ; Early American Imprints, series I ; image set 28790)</note>
<note>Images scanned from Readex microprint and microform: (Early American imprints. First series ; no. 28790)</note>
</notesStmt>
<sourceDesc>
<biblFull>
<titleStmt>
<title>Testimony of the authenticity of the prophecies of Richard Brothers, and of his mission to recall the Jews, / by Nathaniel Brassy [i.e., Brassey] Halhed, M.P. ; [One line of Scripture text]</title>
<author>Halhed, Nathaniel Brassey, 1751-1830.</author>
</titleStmt>
<extent>iv, [1], 6-32 p. ; 22 cm. (8vo) </extent>
<publicationStmt>
<publisher>Printed by Francis & Robert Bailey, at Yorick's Head, no. 116, High Street.,</publisher>
<pubPlace>Philadelphia: :</pubPlace>
<date>M.DCC.XCV. [1795]</date>
</publicationStmt>
<notesStmt>
<note>Apparently issued with: A revealed knowledge of the prophecies and times ... Book the first. Philadelphia: Printed by Francis & Robert Bailey ..., MDCCXCV (Evans 28355).</note>
</notesStmt>
</biblFull>
</sourceDesc>
</fileDesc>
<encodingDesc>
<projectDesc>
<p>Created by converting TCP files to TEI P5 using tcp2tei.xsl,
TEI @ Oxford.
</p>
</projectDesc>
<editorialDecl>
<p>EEBO-TCP is a partnership between the Universities of Michigan and Oxford and the publisher ProQuest to create accurately transcribed and encoded texts based on the image sets published by ProQuest via their Early English Books Online (EEBO) database (http://eebo.chadwyck.com). The general aim of EEBO-TCP is to encode one copy (usually the first edition) of every monographic English-language title published between 1473 and 1700 available in EEBO.</p>
<p>EEBO-TCP aimed to produce large quantities of textual data within the usual project restraints of time and funding, and therefore chose to create diplomatic transcriptions (as opposed to critical editions) with light-touch, mainly structural encoding based on the Text Encoding Initiative (http://www.tei-c.org).</p>
<p>The EEBO-TCP project was divided into two phases. The 25,363 texts created during Phase 1 of the project have been released into the public domain as of 1 January 2015. Anyone can now take and use these texts for their own purposes, but we respectfully request that due credit and attribution is given to their original source.</p>
<p>Users should be aware of the process of creating the TCP texts, and therefore of any assumptions that can be made about the data.</p>
<p>Text selection was based on the New Cambridge Bibliography of English Literature (NCBEL). If an author (or for an anonymous work, the title) appears in NCBEL, then their works are eligible for inclusion. Selection was intended to range over a wide variety of subject areas, to reflect the true nature of the print record of the period. In general, first editions of a works in English were prioritized, although there are a number of works in other languages, notably Latin and Welsh, included and sometimes a second or later edition of a work was chosen if there was a compelling reason to do so.</p>
<p>Image sets were sent to external keying companies for transcription and basic encoding. Quality assurance was then carried out by editorial teams in Oxford and Michigan. 5% (or 5 pages, whichever is the greater) of each text was proofread for accuracy and those which did not meet QA standards were returned to the keyers to be redone. After proofreading, the encoding was enhanced and/or corrected and characters marked as illegible were corrected where possible up to a limit of 100 instances per text. Any remaining illegibles were encoded as <gap>s. Understanding these processes should make clear that, while the overall quality of TCP data is very good, some errors will remain and some readable characters will be marked as illegible. Users should bear in mind that in all likelihood such instances will never have been looked at by a TCP editor.</p>
<p>The texts were encoded and linked to page images in accordance with level 4 of the TEI in Libraries guidelines.</p>
<p>Copies of the texts have been issued variously as SGML (TCP schema; ASCII text with mnemonic sdata character entities); displayable XML (TCP schema; characters represented either as UTF-8 Unicode or text strings within braces); or lossless XML (TEI P5, characters represented either as UTF-8 Unicode or TEI g elements).</p>
<p>Keying and markup guidelines are available at the <ref target="http://www.textcreationpartnership.org/docs/.">Text Creation Partnership web site</ref>.</p>
</editorialDecl>
<listPrefixDef>
<prefixDef ident="tcp"
matchPattern="([0-9\-]+):([0-9IVX]+)"
replacementPattern="http://eebo.chadwyck.com/downloadtiff?vid=$1&page=$2"/>
<prefixDef ident="char"
matchPattern="(.+)"
replacementPattern="https://raw.githubusercontent.com/textcreationpartnership/Texts/master/tcpchars.xml#$1"/>
</listPrefixDef>
</encodingDesc>
<profileDesc>
<langUsage>
<language ident="eng">eng</language>
</langUsage>
<textClass>
<keywords scheme="http://authorities.loc.gov/">
<term>Brothers, Richard, 1757-1824.</term>
<term>Prophecies.</term>
<term>Jews -- Restoration.</term>
</keywords>
</textClass>
</profileDesc>
<revisionDesc>
<change>
<date>2009-02</date>
<label>TCP</label>Assigned for keying and markup</change>
<change>
<date>2009-03</date>
<label>SPi Global (Manila)</label>Keyed and coded from Readex/Newsbank page images</change>
<change>
<date>2010-04</date>
<label>Olivia Bottum</label>Sampled and proofread</change>
<change>
<date>2010-04</date>
<label>Olivia Bottum</label>Text and markup reviewed and edited</change>
<change>
<date>2011-06</date>
<label>pfs.</label>Batch review (QC) and XML conversion</change>
</revisionDesc>
</teiHeader>
<text xml:lang="eng">
<front>
<div type="title_page">
<pb facs="unknown:028790_0000_0FDD4656B6DB5D90"/>
<pb facs="unknown:028790_0001_0FDD1C8B1A1DDE08"/>
<p>OF THE AUTHENTICITY OF THE PROPHECIES OF <hi>RICHARD BROTHERS,</hi> AND OF HIS MISSION TO RECALL THE JEWS, <hi>By Nathaniel Braſſy Halhed, M. P.</hi>
</p>
<q>AND GOD SAID, <hi>"LET THERE BE LIGHT."</hi>
</q>
<p>
<hi>PHILADELPHIA:</hi> PRINTED BY FRANCIS <hi>&</hi> ROBERT BAILEY, AT YORICK'S HEAD, N<hi rend="sup">o</hi>. 116, HIGH STREET. M.DCC.XCV.</p>
</div>
<div type="letter">
<pb facs="unknown:028790_0002_0FDD45BDD752F668"/>
<head>To Nathaniel Braſſy Halhed, Eſq. MEMBER OF PARLIAMENT, PALL-MALL.</head>
<p>IN obedience to the ſacred command of the Lord God, whoſe Servant and Prophet I am, I inform you, that you are deſcended from his ancient people the Hebrews, of the tribe of Judah, and of the family of David, King of Iſrael. His ſacred commands delivered to me by revelation for you, are, That you publiſh and declare to the world in writing, without the leaſt fear of any human power what<g ref="char:EOLhyphen"/>ever, that the revealed knowledge of his judgments given to me, and publiſhed by his ſacred command in two books (called a Revealed Knowledge of the Prophecies and Times,) for the information, warning, and benefit of all Nations, is from Him the Lord God, and is true.</p>
<p>I am likewiſe commanded to ſay to you, Write and pub<g ref="char:EOLhyphen"/>liſh, according to the light, wiſdom, and underſtanding, which the Lord my God gives you by his bleſſed ſpirit; by the mighty power of which you was converted to the full knowledge of his Word, and convinced that I am his Prophet.</p>
<p>I am likewiſe commanded to ſay to you, when your Teſ<g ref="char:EOLhyphen"/>timony of the Judgments of God, and of me the Prince of his People, is wrote and publiſhed, you are directed by his ſacred command to ſend printed copies to the King of England, his Queen, and Family; all the Members of both Houſes of Parliament; the Judges, and all the fo<g ref="char:EOLhyphen"/>reign Ambaſſadors; the Mayor, and all the Aldermen of London.</p>
<p>
<pb n="iv" facs="unknown:028790_0003_0FDD45C1AAFAB368"/>I am likewiſe directed by the Lord my God to inform you, that his command to you is, that you publiſh this Letter, containing his directions, with your own Teſti<g ref="char:EOLhyphen"/>mony.</p>
<closer>
<signed>Richard Brothers, The Man that will be revealed to the Hebrews as their Prince, to all Nations as their Governor, according to the Covenant to King David, immediately under God.</signed>
<dateline>
<hi>LONDON, No. 57, Paddington-ſtreet,</hi>
<date>
<hi>28th of the Month called January, 1795.</hi>
</date>
</dateline>
</closer>
</div>
</front>
<body>
<div type="text">
<pb facs="unknown:028790_0004_0FDD45C30F64A4B0"/>
<head>TESTIMONY, &c.</head>
<p>THE queſtion of "Peace or War," has now been twice agitated in the Senate, ſince the commence<g ref="char:EOLhyphen"/>ment of the preſent ſeſſion: and whatever may have been the deciſion in thoſe aſſemblies, the diſcuſſion is ſtill open before the tribunal of the Public. It was undoubtedly my duty, if I thought I could throw any new light on the ſubject, to have delivered my ſentiments in Parlia<g ref="char:EOLhyphen"/>ment. I was prepared to do ſo, and very anxious to obtain a hearing —Gentlemen who ſaw me repeatedly riſe for that purpoſe; and ſtill more, the Speaker, to whom I verbally communicated my wiſhes, cannot but bear witneſs, of my intention.—Compelled however, by circumſtances, to involuntary ſilence in that quarter, I muſt now diſcharge my conſcience through my pen.— Here therefore I moſt unreſervedly publiſh my opinion, That <hi>reſolutely to perſiſt in offenſive War, is not the beſt method of procuring Peace.</hi>—</p>
<p>Our objections to treating with the preſent French Government are ſtated to be, becauſe it is too diſcor<g ref="char:EOLhyphen"/>dant not to be ſuſpected of inſtability, and too recent to afford any aſſurance of permanency. In all other re<g ref="char:EOLhyphen"/>ſpects, the arguments in favour of Peace are clearly on the ſide of Oppoſition; and it only remains to decide, whether for the bare chance of unſteadineſs or verſality in the actual adminiſtration of France we are content to ſee almoſt the whole world peopled with nothing but ſoldiers; and every eſtabliſhed form of government in Europe, not excepting our own, go to wreck in the conteſt. That this muſt inevitably happen, unleſs the French be induced by general pacification to lay down their arms, no man who coolly conſiders the nature of
<pb n="6" facs="unknown:028790_0005_0FDD45C489EBA858"/>
their revolutionary ſyſtem can well venture to deny. I ſhall ſay nothing of the arguments founded on the pro<g ref="char:EOLhyphen"/>priety of our retaining the French colonies in caſe of a peace, as a neceſſary indemnification for our enormous expences; becauſe I think they have not a ſhadow of juſtice or good faith to ſupport them. Had we ſtood a<g ref="char:EOLhyphen"/>lone in the conflict, the doctrine would have been plau<g ref="char:EOLhyphen"/>ſible enough; but connected as we are and have been with various allies, each ſtriving with all his ſtrength, <hi>as we are told,</hi> and many beyond their ſtrength, in the common cauſe, the conqueſts made by any individual member of the alliance cannot poſſibly be viewed in any other light than as prizes taken by a ſingle ſhip at<g ref="char:EOLhyphen"/>tached to a fleet. The whole of the capture muſt be thrown into the general maſs, and ſhould ſerve, as far as it will go, to balance the partnerſhip-account of pro<g ref="char:EOLhyphen"/>fit and loſs. If politics and good faith do not always go hand in hand, I am heartily ſorry for the country where they are ſeparated. But that conduct which, in my private ſituation, I hold to be eſſentially wrong, I ſhall not henceforth, in my public capacity, ſupport as conditionally right; for that we ſhould at all times, and under all circumſtances, profeſs a readineſs to <hi>treat with all our enemies whomſoever,</hi> I deem to be an indiſpen<g ref="char:EOLhyphen"/>ſable obligation of the religion to which we have all ſworn obedience at our baptiſm. Whatever opinions men might have formed of the juſtice and neceſſity of this war at its commencement, the ground has been ſo completely ſhifted ſince that period, as to authoriſe dif<g ref="char:EOLhyphen"/>ferent ſentiments of the propriety of its farther continu<g ref="char:EOLhyphen"/>ance, and to require new modes of conduct for its ter<g ref="char:EOLhyphen"/>mination. The ſituation and circumſtances of all the great powers of Europe are entirely changed from what they were only two years ago; and if this be the caſe already, it behoves us ſeriouſly to conſider, not merely the effect of this change at the preſent moment, but what progreſs it may be likely to make, up to any fu<g ref="char:EOLhyphen"/>ture given period: and at what time, or by what means, we may flatter ourſelves with a more favourable oppor<g ref="char:EOLhyphen"/>tunity
<pb n="7" facs="unknown:028790_0006_0FDD45C7F9436C80"/>
for concluding hoſtilities. If we reaſon from paſt experience, the advantages in ſtore for us are not very inviting; and it is incumbent on miniſterial logic to demonſtrate how the uniform ſucceſſes of the French Republic ſhould augment our expectations of its ſpeedy overthrow. But in the courſe of the preſent conteſt, France has not only beaten our allies, ſhe ſeems alſo to have made converts of them to her cauſe; for I believe there is not a man well informed of what is paſſing on the Continent, who will not readily agree that the French are leſs obnoxious to the ſubjects of every one of the Belligerent Powers than their own haughty purſe-proud confederates the Engliſh. The conſequences of this general diſeſteem under which we labour, I leave to be computed by ſuperior adepts in political arithmetic: to my underſtanding, their groſs amount is diſaſter, ſub<g ref="char:EOLhyphen"/>jugation, and ruin. It is not a little extraordinary to obſerve the very ſame grounds of argument preſſed in<g ref="char:EOLhyphen"/>to the ſervice of two oppoſite parties, to ſupport two contrary concluſions—Adminiſtration contends, from the very victories of the French, that they are too ex<g ref="char:EOLhyphen"/>travagant to laſt: Oppoſition maintains, from the rei<g ref="char:EOLhyphen"/>terated defeats of the allies, that they are too much re<g ref="char:EOLhyphen"/>duced to recover. Here then we come directly to the point at iſſue. Does the preſent political ſtate of Eu<g ref="char:EOLhyphen"/>rope authoriſe our perſeverance in hoſtilities, or warrant the neceſſity of immediate pacification.</p>
<p>O for a peep into futurity! may the plain obſerver allowably exclaim,—A peep into futurity? Pictures, indeed of the period to come, are exhibited to us by both ſides of the queſtion; but who ſhall certify the ability of the painter, and who ſhall vouch for the fidelity of the portrait?</p>
<p>It has always been obſerved, that times of calamity are peculiarly fertile in viſions and prognoſtications, predictions and prophecies. When the minds of men are ſoftened by the preſſure or the apprehenſion of ac<g ref="char:EOLhyphen"/>cumulating evils, then is the moment for the ſalutary warnings of the internal monitor, and the cautionary
<pb n="8" facs="unknown:028790_0007_0FDD45C9D9B469F0"/>
voice of the ſpiritual guide. The great maſs of the people, too ſore with their ſufferings not to graſp at any offer of conſolation, and too credulous to form ac<g ref="char:EOLhyphen"/>curate notions of the divinity of its origin, is eaſily worked upon by every ſpecies of oracular pretenſion: and we all know, that when men are once ſteadily per<g ref="char:EOLhyphen"/>ſuaded of the authenticity of a prophecy, they are al<g ref="char:EOLhyphen"/>moſt involuntarily led to perform their part towards its completion. The preſent moment teems with theſe an<g ref="char:EOLhyphen"/>ticipations of futurity, beyond the example of every former period. Unfortunately, whatever be the deſigns or merits of the various diſſeminators of theſe oracles, they are at leaſt uniform in the melancholy ſtrain of their predictions: and it behoves every well-regulated government to attend minutely to the irritation theſe forbodings may produce on the public mind. For if their doctrines be well founded, we have not an inſtant to loſe in adopting a complete reverſion both of our moral and political ſyſtem: if they be fallacious, no pains ſhould be ſpared to undeceive the victims of their impoſition, and no puniſhment can be too ſevere for the atrocious criminality of their propagators.</p>
<p>Among the productions to which I allude, there is not one ſo general in its circulation, nor a thouſandth part ſo forcible in its delineations of approaching miſe<g ref="char:EOLhyphen"/>ry, as the two pamphlets intitled <q>A revealed Know<g ref="char:EOLhyphen"/>ledge of the Prophecies and Times, and particularly of the preſent Time, the preſent War, and the Prophecy now fulfilling, wrote by the command of Almighty God, and publiſhed by Richard Brothers</q>— an author whoſe tremendous threats and unqualified anathemas fulminate dethronement and ſpeedy death on almoſt every one of the Sovereigns of Europe by name, and particularly on our own beloved monarch. Nor is he leſs liberal of his violent menaces againſt both our hou<g ref="char:EOLhyphen"/>ſes of parliament, our civil and eccleſiaſtical eſtabliſh<g ref="char:EOLhyphen"/>ment, the city of London, and the whole Britiſh nation: and all this, too, in terms preciſely ſuited to the com<g ref="char:EOLhyphen"/>prehenſion of the moſt ordinary capacity: replete with
<pb n="9" facs="unknown:028790_0008_0FDD45CE3AF1A538"/>
grammatical faults; deſtitute alike of harmony of ar<g ref="char:EOLhyphen"/>rangement, and elegance of diction; in the ſtyle of a peaſant, exalting himſelf above the mightieſt of princes: affirming, that he is utterly invulnerable to all human power; and braving, with the moſt unruffled indiffer<g ref="char:EOLhyphen"/>ence, that government, whoſe authority his doctrines and deſtination are by himſelf declared to counteract, and whoſe eſtabliſhment the completion of his miſſion muſt neceſſarily ſubvert.</p>
<p>What ſhall we ſay or think of a man who has been in the habit of writing letters to the King, the Queen, and the Miniſters of State, ever ſince the beginning of 1792; foretelling many events that would afterwards, ſome of which have actually already come to paſs; ad<g ref="char:EOLhyphen"/>viſing or reproving them as occaſion ſeemed to him to require, in peremptory and dictatorial meſſages, ſaid to proceed from God himſelf; and perſiſting, though in the moſt unaffected mediocrity of private life, to reite<g ref="char:EOLhyphen"/>rate his intruſions, and reinforce his remonſtrances, on each new viciſſitude of public events: nay more, who ſteps forth to the world, in a ſturdy publication, avow<g ref="char:EOLhyphen"/>ing all he has done, and telling to whom, on what ſub<g ref="char:EOLhyphen"/>ject, in what manner, and how often he has repeated this extraordinary correſpondence: and makes the whole Engliſh nation a ſort of umpire between the conſtituted power of the State, and one obſcure Individual?</p>
<p>The policy of Government, however, has, I believe, hitherto left himſelf and his publications, to riſe or fall by their own merits; and he has been brought to trial, only by a very ſubordinate tribunal indeed: only a ſix-penny ſpouting club! which ſome time ago, propoſed, as a topic for debate, Whether Richard Brothers, who calls himſelf God Almighty's Nephew, be an impoſtor or a madman?—overlooking, probably, as is often the caſe with very eager diſputants, a third poſſibility in the ſubject, namely, that he was neither the one, nor the other.</p>
<p>The books which I have here brought forward, con<g ref="char:EOLhyphen"/>tain ſumething more than that mere <hi>peep into futurity</hi>
<pb n="10" facs="unknown:028790_0009_0FDD45D28D976E60"/>
for which I lately expreſſed ſo anxious a deſire. They pretend to be, particularly the ſecond, an abſtract of the brief chronicle of the future fortunes of all Europe. But an abſtract, no doubt, may be incorrect; and a chronicle can be conceived totally wanting in authenti<g ref="char:EOLhyphen"/>city. To fix theſe imputations on the preſent work, nothing more is neceſſary than to adopt the pithy deci<g ref="char:EOLhyphen"/>ſion of the ſpouting club, that Richard Brothers muſt be either impoſtor or madman. To ſupport the firſt propoſition, we muſt neceſſarily diſcover ſome private intereſt, ſome perſonal gratification, ſome premeditated deception, lurking under the plauſible pretenſions of philanthropy and piety: the ſecond can only be fully made out by ſome proof of glaring inconſiſtency in his profeſſions: and in both theſe particulars I hold him in<g ref="char:EOLhyphen"/>finitely ſuperior to all imputation. Uprightneſs of in<g ref="char:EOLhyphen"/>tention, and candour of ſoul, breathe through every line of his compoſition. But in vouching for his ho<g ref="char:EOLhyphen"/>neſty, I do not, <hi>à priori,</hi> conclude his infallibility. I can only ſay, that if it were poſſible he ſhould deceive others, I am morally certain, from the internal evidence of his whole work, that he is himſelf the firſt victim of the deception. On what criterion then ſhall we decide his merits? to what authority ſhall we appeal? His own anſwer is, <q>
<hi>Search the Scriptures yourſelves.</hi> As Chriſti<g ref="char:EOLhyphen"/>ans, You <hi>muſt</hi> acknowledge them to be the perfect ſources of all veracity, <hi>and let them be the touchſtone of my aſſertions.</hi>
</q>
</p>
<p>Here let us pauſe for a moment, and reflect, that if we take him at his word, we are once more conſigned to the myſterious depths of Daniel, Eſdras, and of the Revelations, where ſo many ingenious interpreters, and athletic commentators, have been already ſhipwrecked. How ſhall we ſcape a ſimilar calamity? If it be poſſi<g ref="char:EOLhyphen"/>ble on this ſea ever to make a ſafe harbour, we muſt certainly ſtrike out ſome new courſe, and take for our compaſs the following conſiderations on the nature and properties of prophetic writing.</p>
<p>
<pb n="11" facs="unknown:028790_0010_0FDD45D397271020"/>All prophecies are neither more nor leſs than true genuine aenigmas, in which the meaning is ſo nicely and artificially enveloped by ambiguity of ſenſe and of expreſſion, that until we be furniſhed by the inventor himſelf with the proper clue to unravel them, they are calculated to appear as a tiſſue of the moſt incongruent abſurdities. Of theſe prophetical compoſitions, ſome are compact and cloſe, like the greater part of the Pa<g ref="char:EOLhyphen"/>gan oracles, and others more copious and diffuſe. In the former caſe, every word, I had almoſt ſaid every letter, comes in for its ſhare of meaning; and the key that does not preciſely fit every one of them is good for nothing. No allowance is to be admitted for any thing ſuperabundant or extraneous. In the longer compoſi<g ref="char:EOLhyphen"/>tions a greater latitude prevails: among ſeveral ſentences, or diſtinct members of one ſentence, the meaning is all contained in a ſingle phraſe only, which is to be con<g ref="char:EOLhyphen"/>ſtrued with all the minute preciſion and undeviating conſiſtency required in the former caſe, while the other parts are only thrown in to miſlead the obſerver. Juſt as if the real objects to be repreſented in a picture were ſoftened down, melted away, and obſcured in the diſ<g ref="char:EOLhyphen"/>tances of the back ground, while the prominent features of the deſign, that occupy the front of the canvas, ſhould be formed of adventitious or frivolous repreſentations, of no conſequence or neceſſity to the piece. Inſtances of both kinds will occur as we proceed; and frequent ſpecimens of each may be found in the different prophe<g ref="char:EOLhyphen"/>cies of the Old Teſtament, which are acknowledged by all ſound critics and expoſitors to allude to the coming and ſufferings of the Meſſiah.</p>
<p>In this place it may not be ſuperfluous to mention, that in the occupation of decyphering myſterious and allegorical modes of compoſition, I am far from being undiſciplined. If I have been rather negligent of our own ſacred writings, I have at leaſt been in the habit of beſtowing unwearied attention on thoſe of the old Hindús; writings not widely diſſimilar in ſtyle and manner from the prophetical treatiſes in our own Bible.
<pb n="12" facs="unknown:028790_0011_0FDD45D8DF8AD828"/>
Nor have my reſearches been altogether fruitleſs, ſince I have been fortunate enough to diſcover the true mean<g ref="char:EOLhyphen"/>ing couched under the Hindú triad of Energies or pow<g ref="char:EOLhyphen"/>ers, called Brahma, Viſhnu, and Shiva, which I affirm to be nothing more than poetical perſonifications of <hi>matter, ſpace,</hi> and <hi>time,</hi> and I ſay, that by the proper application of theſe three terms, all the ſurviving re<g ref="char:EOLhyphen"/>mains of genuine Brachmanical mythology may be truly elucidated.</p>
<p>Fortified therefore with this pre-acquired aptitude for ſuch ſtudies, I ſat down with pleaſure to the taſk re<g ref="char:EOLhyphen"/>commended by Mr. Brothers, namely, to read the mo<g ref="char:EOLhyphen"/>dern hiſtory of Europe in the prophetic records of the Old and New Teſtament.</p>
<p>For this purpoſe, nothing was requiſite, but to ex<g ref="char:EOLhyphen"/>amine, by the teſt of human ſagacity, whether the clue furniſhed by him were in groſs and in all its parts per<g ref="char:EOLhyphen"/>fectly commenſurate to the whole tenor and purport of the myſteries to be unraveled; for if it failed in any one particular, or were found too long or too ſhort in its application to any one inſtance—<hi>actum eſſet de toto</hi>— The works of God are all without flaw; and for this clue to poſſeſs that degree of perfection, it muſt neceſ<g ref="char:EOLhyphen"/>ſarily have proceeded from God himſelf, who conſtruct<g ref="char:EOLhyphen"/>ed the viſions of the prophecies at firſt, to the very in<g ref="char:EOLhyphen"/>tent that they never ſhould become intelligible, until, at the time deſtined by his holy will and pleaſure, the true <hi>mot de l'aenigme</hi> ſhould be revealed to his creatures; and when once this clue ſhould come to be known, any man whatever, with a competent ſhare of learning and induſtry, might comprehend and expound all the ſecrets to which it applies, as well as the very man to whom it was originally imparted.</p>
<p>To make this point more intelligible, I ſhall obſerve, that with reſpect to the four beaſts in the viſion of Da<g ref="char:EOLhyphen"/>niel (and the ſame in any other caſe) it might happen, and probably has happened, that ſome man or other ſhould form a very probable gueſs as to the meaning of a ſingle beaſt, or even two. But what has never been
<pb n="13" facs="unknown:028790_0012_0FDD45DA3B9AA6D8"/>
done, and what never could have been done, but by direct revelation from God, is to find a key, one and indiviſible, that ſhould apply perfectly and equally well to all the four: ſo that taking each of them ſeverally, or the whole in a maſs, the true meaning ſhould be no leſs perſpicuous aad palpable in their union than in their ſeparation. And ſo with regard to the Babylon mentioned in the Revelations. The Portrait of Rome is ſo evident in that part where Rome is really meant, that not a ſingle commentator of the hundreds who have handled the paſſage has ever once miſtaken it. But they have all erred in ſuppoſing that Babylon univerſally, and in all caſes, ſignified the ſame Rome: and I have no doubt, but that very clear and intelligible deſcription of Rome in one place, was expreſsly inſerted for the ſole purpoſe of miſguiding, and putting to fault, their conjectures on other parts of the prophecy, where a different city is alluded to under the ſame title. And this is agreeable to the ordinary conduct of God's providence towards mankind. He has not totally denied them light; but the ray which he has graciouſly imparted to them, only ſerves to lead them aſtray, if they for a moment give looſe to the wanderings of their own imaginations.</p>
<p>This then is the queſtion:—Has Richard Brothers poſſeſſion of this clue, and has he declared it in his book? I anſwer, Yes; becauſe I am ſure I found it there. But at the ſame time, I affirm, he makes very little uſe of it, becauſe he comes at his knowledge a ſhorter way.</p>
<p>He indeed pretends to an immediate and direct in<g ref="char:EOLhyphen"/>ſpiration from God. And I take upon myſelf to prove, by the ordinary exertion of human ſagacity, that he is really inſpired. And I ſhall prove it in this manner.</p>
<p>He tells us in a dry, conciſe, unqualified aſſertion, that ſuch a thing is ſo and ſo—as he has it from God; but he gives us no reaſon why it ſhould be ſo; and we ſee at once that he repeats his leſſon by hear-ſay. I will take <hi>his</hi> clue, and lead you on ſtep by ſtep through the different degrees of analyſis, till you come at the very
<pb n="14" facs="unknown:028790_0013_0FDD45DEC7C05830"/>
concluſion with which he ſets out:—ſhewing you by ſcientifical proceſs, and almoſt ocular demonſtration, all the predicaments which he has totally omitted:—and ſo connect my arguments with his affirmations, that they ſhall mutually ſupport, corroborate, and confirm each other. The analyſis, on my part, ſhall give evi<g ref="char:EOLhyphen"/>dence to the authenticity of his inſpiration; and the aſ<g ref="char:EOLhyphen"/>ſertion, on his part, ſhall <hi>è converſo</hi> bear witneſs to the fidelity of my expoſition.</p>
<p>And now, to give ſome previous teſtimonial of my own pretenſions in this mode of inveſtigation, conform<g ref="char:EOLhyphen"/>able indeed to the general line of Mr. Brothers's decla<g ref="char:EOLhyphen"/>rations, but not explicitly mentioned in any part of them—I affirm from my own diſcoveries, that the pro<g ref="char:EOLhyphen"/>phet Daniel poſitively and particularly denounces anni<g ref="char:EOLhyphen"/>hilation to the Britiſh navy in this war. And on proof of this propoſition, in the courſe of my Eſſay I am con<g ref="char:EOLhyphen"/>tent to reſt my whole pretenſions to penetration.</p>
<p>If we conſult the map of Europe, it will be found to comprehend little more than the dominions of the following ſovereigns—</p>
<p>The Emperor of Germany, and the Princes of the Empire.</p>
<p>The Empreſs of Ruſſia.</p>
<p>The Pope.</p>
<p>The Kings of England, France, Spain, Pruſſia, and Sardinia.</p>
<p>To every one of theſe has Mr. Brothers prognoſti<g ref="char:EOLhyphen"/>cated a fatal cataſtrophe; and I aſſert that of myſelf, without any aſſiſtance from him, (for, when I called upon him expreſsly to beg explanation and ſatisfaction, he had no other anſwer for me, than that I muſt exa<g ref="char:EOLhyphen"/>mine the ſcriptures) I have diſcovered the fate of every one of theſe to be unequivocally announced in the pro<g ref="char:EOLhyphen"/>phecies of Daniel and Eſdras. If I ſucceed in fully eſtabliſhing theſe points only, and I ſhall do more, there is an end of altercation: we very fairly may, <hi>nay,</hi> we ought, and by the moſt rigid rules of ſound criti<g ref="char:EOLhyphen"/>ciſm
<pb n="15" facs="unknown:028790_0014_0FDD45DF5F4F7508"/>
and logic we muſt, give him credit for all the reſt of his predictions—<hi>ex pede Herculem.</hi>
</p>
<p>Now for the diſcuſſion. It muſt neceſſarily be dry; and what it wants in entertainment muſt be made up, if poſſible, by conciſeneſs on my part, taking care at the ſame time to omit nothing of importance.</p>
<p>Daniel, in one of his viſions, tells us that he ſaw four beaſts<note n="*" place="bottom">
<p>And four great beaſts came from the ſea, different from one another.</p>
<p>The firſt was like a lion, and it had eagle's wings; I beheld till the wings were plucked, when it was lifted up on the earth, and made ſtand no the earth as a man: and a man's heart was given to it.</p>
</note>; theſe were interpreted to him to be four kings. All the commentators on this chapter have ſought theſe kings in four ſucceſſive monarchies, and they have all laboured in vain to fix any one of them with accuracy and preciſion.</p>
<p>Mr. Brothers gives us the clue to the whole myſtery in a ſingle word—he ſays, "they are four kings <hi>now.</hi>"</p>
<p>For very obvious reaſons, I omit to ſpeak of the firſt beaſt, which we are told means the king of England; and ſhall uſe ſo much the leſs ceremony with the ſecond.</p>
<p>"And behold another beaſt, a ſecond like to a bear: and it raiſed up itſelf on one ſide; and it had three ribs in the mouth of it, between the teeth of it: and they ſaid thus unto it: "Ariſe, devour much fleſh."</p>
<p>Mr. Brothers with moſt laconic preciſion ſays <q>This verſe means the preſent Empreſs of Ruſſia.</q>
</p>
<p>Now for the proof. It will hardly be contended me, that the bear is not a juſt, apt, and congenial ſymbol for the Ruſſian territory and empire; for, as we ſay the <hi>Roman eagle,</hi> the <hi>Britiſh lion,</hi> or the <hi>Chineſe dragon,</hi> ſo we ſay the <hi>"Ruſſian bear."</hi> In the famous little trea<g ref="char:EOLhyphen"/>tiſe of John Bull's Law-ſuit, England is called <hi>John Bull,</hi> France <hi>Lewis Baboon,</hi> Holland <hi>Nic Frog,</hi> and Ruſſia <hi>Peter Bear.</hi> Nor is it poſſible that any other monarchy in Europe ſhould be typified by this animal. Beſides, as, in a complete well-written prophecy, every part muſt mutually bear upon and ſupport all the reſt,
<pb n="16" facs="unknown:028790_0015_0FDD45E0C72AABC8"/>
to make one compact whole, we muſt preſently ſee, by the remainder of the context, than this bear can be no other than the preſent Empreſs of Ruſſia. <q>It raiſ<g ref="char:EOLhyphen"/>ed up itſelf on one ſide;</q> that is, it extended its do<g ref="char:EOLhyphen"/>minion, it exalted its power all on one ſide. And how could Ruſſia do otherwiſe? What is there worthy of her ambition to the weſt? and to the eaſt and north all is already her own! all her exertions muſt neceſſarily be, as we all know they have been, directed towards the ſouth, and aiming pointedly at Conſtantinople. <hi>"And it had three ribs in the mouth of it between the teeth of it."</hi> This is the true <hi>crux criticorum.</hi> If I can ſurmount this obſtacle, all other impediments will dwindle to nothing. Firſt, then, let us conſider the poſition of theſe ribs: they are in the mouth, but not within the teeth, for they are between them; therefore they are exactly in the place, and performing the functions of files or whetſtones, to ſharpen the teeth: and indeed the words they utter, figuratively mark out their office, ſaying, "Ariſe, devour much fleſh." What then is it that we can properly denominote a file or whetſtone for the teeth? Appetite: appetite, and nothing elſe. And where is appetite or hunger properly ſituated? What is its local habitation?—The ſtomach:—and the ſtomach is encloſ<g ref="char:EOLhyphen"/>ed within the ribs. Now we muſt all agree, that the ſtomach could not be viſibly repreſented in a viſion as lying between the teeth; but that the ribs (the caſe of the ſtomach) having a form not very unlike that of the hone to file, may be put inſtead of the ſtomach, in the office of giving an edge to the teeth, to mark the voracity of appetite. But why then <hi>three</hi> ribs?—Here we come to the grand deciſive maſter-ſtroke of the character of the preſent Empreſs? becauſe her appetites are three, and they are all inſatiable to devour human fleſh: inſatiable luſt, inſatiable ambition, and inſatiable cruelty. Now for the preciſe <hi>time,</hi> I had almoſt ſaid the very day and hour, to which the Prophet alludes. <q>And they ſaid thus unto it: Ariſe, devour much fleſh.</q>—<hi>Ariſe?</hi> So then the teeth were dormant, quieſcent, immove<g ref="char:EOLhyphen"/>able:
<pb n="17" facs="unknown:028790_0016_0FDD45E514EAD3F0"/>
they required a ſtimulus, a whetting, a prey ſuit<g ref="char:EOLhyphen"/>ed to their taſte, to rouſe them, and ſet them to work. I now aſk the whole country, and more particularly his Majeſty's Miniſters, whether we have not been em<g ref="char:EOLhyphen"/>ployed for above theſe two years in endeavouring to whet, ſtir up, and animate the great Catherine, who is one of the high contracting parties, and a principal in this moſt deſtructive war, without being able to move her one inch: nor have we yet obtained from her a ſin<g ref="char:EOLhyphen"/>gle ſhip, or even a ſingle man, to aid in the overthrow of this enormous Republic of France. But when her own predominating paſſions get between her teeth, and ſharpen her appetite; <hi>then</hi> ſhe can <hi>ariſe</hi> faſt enough, and devour the fleſh of thirty or forty miſerable Poles in a fortnight, and almoſt in cold blood, juſt as ſhe had be<g ref="char:EOLhyphen"/>fore ſerved the ſame number of Turks at Iſmael.</p>
<p>And now, if I have not triumphantly proved this bear to be the preſent Empreſs of Ruſſia, as Mr. Brothers ſays ſhe is, then there is neither meaning in language, nor concluſion in logic.</p>
<p>Let us next try if we can equally well tame and fa<g ref="char:EOLhyphen"/>miliariſe the third beaſt:</p>
<p>
<q>After this I beheld, and lo! another like a leopard, which had upon the back of it four wings of a fowl. The beaſt had four heads, and dominion was given to it.</q>
</p>
<p>Mr. Brothers informs us, this means Louis XVI. the late King of France.</p>
<p>Now of all the beaſts of the earth, Why is the king or nation of France moſt like a leopard?</p>
<p>Naturaliſts have obſerved the leopard to have all the malicious playfulneſs of the cat or monkey united with all the ferocity of the tyger; and Voltaire's deſcription of his own countrymen exactly tallies with this idea; for he ſays they are a compound of the monkey and ty<g ref="char:EOLhyphen"/>ger. Nor is this all: for the delicate variegation of the leopard's ſpots, and the beautiful ſleekneſs of his fur, exactly mark out the Pariſian petit-maître. I might have added, that, as the leopard's ſpots are
<pb n="18" facs="unknown:028790_0017_0FDD45E659E3C308"/>
ſprinkled in regular confuſion, and of nearly equal ſize, over his whole body, ſo were the royal robes of the kings of France ſprinkled all over with fleurs-de-lis of gold. But this leopard of Daniel's had four heads; and one of theſe, which St. John in the Revelations (though omitted by Daniel) ſays he ſaw cut off, and afterwards healed, Mr. Brothers tells us, means the death of Charles I. <hi>of England,</hi> and the reſtoration of monarchy in the perſon of his ſon Charles II. This very circumſtance, which ſeems at firſt to throw an inexplicable difficulty in the way of interpreting the whole beaſt as repreſen<g ref="char:EOLhyphen"/>tative of the king of France, is the very clue which muſt lead us to the juſt and infallible ſenſe of the aenig<g ref="char:EOLhyphen"/>ma; and is of itſelf quite ſufficient to evince that the explication comes from a power more than human.</p>
<p>Every body knows that our Charles I. was betrothed to the Infanta of Spain; but that on going incognito to Madrid to ſee her, he broke off the match, and returned home through Paris, where he fell in love with Henrietta of France; to his marriage with whom all his ſubſequent misfortunes and premature death are to be attributed. His two ſons Charles and James, who both reigned in England, were avowed or concealed penſioners of the court of France, and the latter died in that country, a refugee, and wretched dependant on the oſtentatious hoſpitality of Lewis XIV. It is impoſſible then to deny for a moment, that the Stuart family were a ſupernumery head on the body of the French monarchy; but dying before it. Louis XVI. is the ſecond head; and he pe<g ref="char:EOLhyphen"/>riſhed, like the firſt, by decollation, ſome time ſubſe<g ref="char:EOLhyphen"/>quent to the loſs of his throne. The third head is the preſent king of Spain, a lineal deſcendant of Lewis XIV. of France, who placed the Spaniſh crown on his grand<g ref="char:EOLhyphen"/>ſon's head: but a deciduous crown it is, and ſure to fall; for, as the main head and heart of the beaſt are gone with Louis XVI. it is certain that none of its members, much leſs any one of its heads, can long ſurvive the cataſtrophe. Conſanguineal and political alliances co<g ref="char:EOLhyphen"/>operate to point out the king of Sardinia as the fourth
<pb n="19" facs="unknown:028790_0018_0FDD45E7CE4F6038"/>
head, whoſe dominions we have guarantied to him. He has two daughters married to the two brothers of Lewis XVI. and Mr. Brothers is thus perfectly warranted by Daniel in ſaying, that <q>it is not all the navy of England nor the armies of Europe united, can prevent the king of Sardinia from being dethroned.</q>
</p>
<p>Now we ſee to demonſtration how well the four heads of this leopard tally with the actual ſtate of Europe.— Had the prophet meant to deſcribe four ſucceſſive ſove<g ref="char:EOLhyphen"/>reigns of the ſame kingdom, or four ſeparate kingdoms united under the ſame ſovereign, the beaſt in prophetic language could not poſſibly have had more than one body, and one head. But as he alluded to four diſtinct and nearly independent monarchs, bound together by the cloſeſt ties of alliance and intereſt, he beautifully repreſented one body as the common centre of union to four diſtinct heads.</p>
<p>I had almoſt forgotten that this French leopard had four wings of a fowl.—Well, theſe <hi>wings</hi> are nothing but <hi>ſails:</hi> they both belong to the ſame element. Who does not know that <hi>ſail</hi> and <hi>wing</hi> are, in all languages, convertible terms? And when Daedalus is ſaid to have made wings for himſelf and his ſon Icarus to fly from Crete, does any man doubt that they ſailed away in ſhips? The wings are the fleets of France, and their number is <hi>four,</hi> becauſe thoſe fleets pervade all the quarters of the globe. But why then the wings of a <hi>fowl?</hi> Here I muſt neceſſarily let out the diſcovery, to which I have already appealed as the teſt of my own in<g ref="char:EOLhyphen"/>dividual ſkill in prophetic phraſe. Though <hi>fowls</hi> may traverſe the atmoſphere on their wings, from one end of the world to the other, the eagle alone is queen of the air; and to her all the feathered creation muſt ne<g ref="char:EOLhyphen"/>ceſſarily ſtrike ſail. Now Daniel has expreſsly ſaid that the eagle's wings were attached to the body of the Bri<g ref="char:EOLhyphen"/>tiſh lion (the firſt beaſt); and he adds, alas! <q>
<hi>I beheld,</hi> until the wings thereof were plucked.</q>
</p>
<p>The final diſſolution of theſe three firſt beaſts is thus ſummarily ſet forth by the Prophet:</p>
<p>
<pb n="20" facs="unknown:028790_0019_0FDD45EBB740C680"/>
<q>As concerning the reſt of the beaſts, they had their dominion taken away, yet their lives were prolonged for a ſeaſon and time.</q>
</p>
<p>That is, in plain Engliſh, they muſt all loſe their crowns, as Lewis XVI. did, (who was one of three,) a<g ref="char:EOLhyphen"/>bout two years previous to the loſs of their lives. Now I do poſitively affirm, that in theſe inſtances, as far as they go, we muſt either reject the prophecies of Daniel as abſurd, aprocryphal, forged, and falſe, or admit that Mr. Brothers, who has ſo completely unlocked their myſterious alluſions, has received directly from God himſelf the key <hi>for that purpoſe.</hi>
</p>
<p>Our Author has entered much more into detail reſpect<g ref="char:EOLhyphen"/>ing the fourth beaſt, than any of the former, for which reaſon I ſhall take ſo much the leſs notice of him. But it is impoſſible not to feel the full force of his applica<g ref="char:EOLhyphen"/>tion of the prophecy to the King of Pruſſia, in that little horn that grew up after the former, "in which <hi>were eyes as the eyes of a man,</hi>" viz. perpetually on the watch, and looking ſharp out after every proſpect of additional territory, or immediate profit, without regard to the means:—whether in France, or in England, or in Po<g ref="char:EOLhyphen"/>land, or any other where elſe—neither an acre nor a dol<g ref="char:EOLhyphen"/>lar comes amiſs to him. "And I <hi>beheld!</hi>" ſays Daniel, "becauſe of the great words which the horn ſpake."— The prophet himſelf ſeems here to ſympathiſe with the aſtoniſhment of all Europe, at the monſtrous atrocities and intolerable blaſphemies of the Duke of Brunſwick's famous manifeſto, which I am ſorry I have not here by me, to inſert as a comment on the divine text. The ruin and death of this deteſtable horn I ſhall preſently ſhew from Eſdras: Daniel gives it us in the 26th verſe: <q>But the judgment ſhall ſit, and they ſhall take away his dominion, to conſume and to deſtroy it, unto the end:</q>—as well as in the lump with that of the beaſt.</p>
<p>
<q>I beheld even till the beaſt was ſlain, and his body deſtroyed, <hi>and given to the burning flame.</hi>
</q>
</p>
<p>Mr. Brothers moſt truly interprets this paſſage, as relating to the death of the Emperor of Germany, (p. 33)
<pb n="21" facs="unknown:028790_0020_0FDD45ECFABAD9E0"/>
"It is," ſays he, "certain, and all the armies in Europe cannot ſave him. The judgment of God is alſo, that he ſhall ſuffer the puniſhment of everlaſting fire." He enters minutely into particulars in another part of his book, where he tells us, <q>the Imperial family will all be cut off, and no ſucceſſor will for ever after ariſe.</q> And again, <q>This is Francis II. the preſent Emperor of Germany. To be related to him now, will be con<g ref="char:EOLhyphen"/>ſidered hereafter as a capital crime.</q>—To come at this moſt tremendous curſe, and alſo to find the parti<g ref="char:EOLhyphen"/>cular deſignation of the death of the King of Pruſſia, and the utter downfall of the Popedom, we muſt have recourſe to the 2d Book of Eſdras.—Now this 2d Book of Eſ<g ref="char:EOLhyphen"/>dras has hitherto been eſteemed an apocryphal compo<g ref="char:EOLhyphen"/>ſition of the loweſt order, and ſo it is termed in our church Bibles; where it is ſaid to have been written about the time of Domitian by ſome learned Hebrew, to be extant only in the Latin, and to be ſtuffed full of Jewiſh fables and Rabbinical rhapſodies. But I have always conſidered this ſame book of Eſdras as one of the moſt ſublime, the moſt comprehenſive, and the moſt explicit of all the ancient prophecies. And when we ſhall have heard his beautiful allegory of the whole Ro<g ref="char:EOLhyphen"/>man empire, from its firſt republican form to its actual ſtate at this moment, I am ſure we ſhall agree that, whether Eſdras lived in the time of Domitian, in that of Daniel, or in that of Adam, there never was a more truly wonderful and ſuper-human epitome of a long and eventful hiſtory revealed from the pen of man. It is in the xith chapter.</p>
<p>
<q>Then I ſaw a dream, and behold there came up from the ſea an eagle, which had twelve feathered wings, and three heads. And I ſaw, and behold ſhe ſpread her wings over all the earth, and all the winds of the air blew on her and were gathered together. And I beheld, and out of her feathers there grew other con<g ref="char:EOLhyphen"/>trary feathers, and they became little feathers, and ſmall. But her heads "were at reſt: the head in the midſt was greater than the other, yet reſted it
<pb n="22" facs="unknown:028790_0021_0FDD45EE9BCE7438"/>
with the reſidue. Moreover, I beheld, and lo! the eagle flew with her feathers, and reigned upon earth, and over them that dwelt therein. And I ſaw that all things under heaven were ſubject unto her, and no man ſpake againſt her, no, not one creature upon earth. And I beheld, and lo! the eagle roſe upon her talons, and ſpoke to her feathers, ſaying, Watch not all at once; ſleep every one in his own place, and watch by courſe. But let the heads be preſerved unto the laſt. And I beheld, and lo! the voice went not out of her heads, but from the midſt of her bo<g ref="char:EOLhyphen"/>dy.</q>
</p>
<p>Here in theſe firſt ten verſes we have an Iliad, and more than an Iliad, in a nutſhell.—The <hi>eagle</hi> is the type of Rome. In this at leaſt I ſhall not be in danger of contradiction.</p>
<p>But what is the meaning, in this and ſeveral other paſſages of the Prophet, of the word <hi>ſea?</hi>—It cannot be taken literally; for Rome is an inland city.—It muſt therefore be obſerved, as a general rule, that in allego<g ref="char:EOLhyphen"/>rical writings, every word is a portion of the allegory; and thus if the eagle be allegorical, the ſea from whence it ariſes is allegorical alſo. We have the direct expla<g ref="char:EOLhyphen"/>nation of it in the Revelations, where mention is made of the great Whore that ſitteth upon many waters.— And in the 15th verſe of the ſame chapter, the angel ſays, <q>The waters which thou ſaweſt, where the Whore ſitteth, are <hi>peoples,</hi> and <hi>multitudes,</hi> and <hi>nations,</hi> and <hi>tongues.</hi>
</q> This eagle, therefore, coming up from the ſea, is the city of Rome gradually riſing among the na<g ref="char:EOLhyphen"/>tions of Italy.</p>
<p>The Prophet firſt is made to behold all the ſucceſſive viciſſitudes of her fate, wrought up into one compact aſſemblage. Her extent of dominion is marked by her wings over the whole earth. Her twelve feathered wings are the twelve Caeſars, and her three heads are, the Pope, the Emperor of Germany, and King of Pruſ<g ref="char:EOLhyphen"/>ſia. Well indeed might it be ſaid, that the heads <hi>reſted;</hi> for as yet they were nothing but embryos in the womb
<pb n="23" facs="unknown:028790_0022_0FDD45F2431DA738"/>
of futurity. "And I beheld," ſays the Prophet, "and lo! the voice went not out of her heads, but <hi>from the midſt of her body."</hi>—This is the true ſpirit of prophetic lore, this is the genuine ſpark of Promethean fire! How was it poſſible in ſuch few words, and yet with ſuch aſtoniſhing accuracy, to delineate the focus from whence emanate all the rays of republican authority?</p>
<p>Ver. 12. <q>And I looked, and behold! on the right ſide there aroſe one feather, and reigned over all the earth: and ſo it was, that when it reigned, the end of it came, and the <hi>place</hi> thereof appeared no more.</q>
</p>
<p>The feather that now roſe up on the right ſide was Julius Caeſar; and the Prophet's expreſſion is very re<g ref="char:EOLhyphen"/>markable—<q>And ſo it was, that when it reigned, the end of it came, and the <hi>place</hi> thereof appeared no more.</q>—We ſee clearly that this reign expired ſud<g ref="char:EOLhyphen"/>denly, almoſt at its very commencement, and was fol<g ref="char:EOLhyphen"/>lowed by a certain period of interregnum.</p>
<p>
<q>So the next following ſtood up, and reigned, and had a great time; and it happened, that when it reigned the end of <hi>it</hi> came alſo, like as the firſt, ſo that it appeared no more. Then there came a voice unto it, and ſaid: Hear thou, that haſt borne rule over the earth ſo long: this I ſay unto thee, before thou beginneſt to appear no more, There ſhall none af<g ref="char:EOLhyphen"/>ter thee attain unto thy time, neither unto the half thereof.</q>
</p>
<p>The next feather after this interval is Auguſtus. To put the matter out of all doubt, the inſpired writer takes particular care to inform us of the great length of his reign: a circumſtance remarkable enough of it it<g ref="char:EOLhyphen"/>ſelf, but rendered much more ſo, by his being ſo mi<g ref="char:EOLhyphen"/>nutely accurate as to ſtate with preciſion, that the reign of no other prince who ſhould ever after govern that coun<g ref="char:EOLhyphen"/>try ſhould attain even to half the duration of that of Auguſtus. And therefore it is impoſſible this verſe ſhould be interpreted of any other emperor but him.</p>
<p>I ſhall not here follow the Prophet through the next ten verſes from the 17th to the 27th—(They deſcribe
<pb n="24" facs="unknown:028790_0023_0FDD1C898C686058"/>
the reſt of the Caeſars, and the ſubſequent commotions in the ſtate)—but ſhall go on to the 28th verſe.</p>
<p>
<q>And I beheld, and lo! the two that remained thought alſo in themſelves to reign: and when they ſo thought, behold! there awaked one of the heads that were at reſt, namely, it that was in the midſt for that was, greater than the two other heads, and then I ſaw that the two other heads were joined with it. And behold! the head was turned with them that were with it, and did <hi>eat up</hi> the two feathers under the wing that would have reigned. But this head put the whole earth in fear, and bear rule in it over all thoſe that dwelt upon the earth, with much oppreſſion; and it had the governance of the world <hi>more than all the wings</hi> that had been.</q>
</p>
<p>Now we come to the Papacy, to that great head in the midſt, to which were joined the two other heads; namely, the States which were thereafter to form the dominions of the Empire and the King of Pruſſia. The gradual encroachments of that ſpiritual predominance over all the temporal authorities of the time are admira<g ref="char:EOLhyphen"/>bly deſcribed by the head <hi>eating up</hi> the two feathers that would have reigned. And <hi>this head put the whole earth in fear.</hi> How? By launching its moſt blaſphemous thunders in interdictions, excommunications, and every ſpecies of eccleſiaſtical artillery, <hi>with much,</hi> very much <hi>oppreſſion,</hi> as ſays the Prophet. Now for the cloſe of the prophetical drama:</p>
<p>
<q>And after this, I beheld, and lo! the head that was in the midſt ſuddenly appeared no more, like as the wings; but there remained the two heads, which alſo in like ſort ruled upon the earth, and over thoſe that dwelt therein.</q>
</p>
<p>The reformation, and revolt of ſo many nations from the Pope's power, both temporal and ſpiritual, are de<g ref="char:EOLhyphen"/>ſcribed in theſe verſes; and his downfall is expreſsly mentioned to precede that of the other two heads, namely, the Emperor and the King of Pruſſia, who
<pb n="25" facs="unknown:028790_0024_0FDD45F3C2429918"/>
continue to reign now, <hi>in like ſort as the wings</hi> (or twelve feathers) formerly did.</p>
<p>
<q>And I beheld, and lo! the head upon the right ſide devoured it that was on the left ſide.</q>
</p>
<p>Words cannot more expreſsly pronounce that the King of Pruſſia is deſtined to fall principally by the means of the Emperor of Germany. I ſay <hi>principally,</hi> becauſe Mr. Brothers mentions that the Empreſs of Ruſſia will aſſiſt in his deſtruction. But, from this verſe, I have not a particle of doubt, but that ſhe will in this caſe act only as an auxiliary in the Emperor's quarrel, even though ſhe may contribute more than an equal ſhare to his victory.</p>
<p>After this comes the great cataclyſm, the moſt dread<g ref="char:EOLhyphen"/>ful tremendous judgment upon the Emperor:</p>
<p>Verſe 36.—<q>Then I heard a voice which ſaid unto me, Look before thee, and conſider the thing that thou ſeeſt. And I beheld, and lo! as it were, a roaring lion chaſed out of the wood; and I ſaw that he ſent out a man's voice unto the eagle, and ſaid, Hear thou; I will talk with thee; and the Higheſt ſhall ſay unto thee, Art not thou it that remaineſt of the four beaſts whom I made to reign in my world?</q>
</p>
<p>Before we go any farther, it may be neceſſary to re<g ref="char:EOLhyphen"/>mark, that the Prophet, without any one circumſtance alluding to the connection between him and Daniel, comes here all at once into the hiſtory of the four beaſts, and expreſsly declares that his eagle is the very ſame with that fourth beaſt which Daniel ſaw, but did not de<g ref="char:EOLhyphen"/>lineate; only we are certain that it could not much have reſembled an eagle, from the partial account he has given of him. If, however, Daniel's fourth beaſt be the Emperor of Germany, this muſt alſo be the ſame Emperor. And <hi>vice verſâ;</hi> if <hi>this</hi> be the Emperor, as the whole preceding narrative does not leave the ſmall<g ref="char:EOLhyphen"/>eſt poſſibility of a doubt, Daniel's beaſt muſt be the Emperor alſo. I ſhall omit the preliminary articles of accuſation againſt his conduct, and come at once to the judgment pronounced upon him, and all the members of his family, by God, in the 45th verſe:</p>
<p>
<pb n="26" facs="unknown:028790_0025_0FDD45F53A6A29A0"/>
<q>And therefore appear no more, thou eagle, nor thy horrible wings, nor thy wicked feathers, nor thy ma<g ref="char:EOLhyphen"/>licious heads, nor thy hurtful claws, nor all thy vain body.</q>
</p>
<p>Every member, limb, joint, and articulation of the whole eagle, is here put in requiſition, and ſeparately enumerated, to take in every ſcion and branch of that devoted generation. Mr. Brothers might therefore well ſay, <q>That to be related to the Emperor now, would hereafter be deemed a capital crime.</q>
</p>
<p>The ſame cataſtrophe of the Papacy, the King of Pruſſia, and the Emperor, is alſo clearly pointed out in the next chapter of Eſdras, which contains an interpre<g ref="char:EOLhyphen"/>tation, after the prophetic mode, of the viſion which I have juſt gone through. I ſhall only here make uſe of the 26th, 27th, and 28th verſes of that xiith chapter, which run thus:</p>
<p>
<q>And whereas thou ſaweſt that the great head ap<g ref="char:EOLhyphen"/>peared no more, it ſignifies that one of them ſhall die upon his bed, and yet with pain.</q>
</p>
<p>This is incontrovertibly the Papacy, as I have before explained it. We have long ſeen it waſting with a grievous ſickneſs, and it is now on its death-bed ex<g ref="char:EOLhyphen"/>piring in great agony. Mr. Brothers tells us in his book, that the Emperor will ſoon give it the <hi>coup de grace.</hi>
</p>
<p>
<q>For the two that remain ſhall be ſlain with the ſword.</q>
</p>
<p>The Emperor's authority, and that of the King of Pruſſia, are now in apparent health: their downfall, therefore, being deſtined to be ſudden, will have no appearance of a natural decay, but may be likened to a violent death by a ſword.</p>
<p>
<q>For the ſword of the one ſhall devour the other; but at laſt ſhall he fall through the ſword himſelf.</q>
</p>
<p>When theſe two great potentates ſhall quarrel, we cannot poſſibly doubt but that the Emperor will pre<g ref="char:EOLhyphen"/>ſently demoliſh his Pruſſian Majeſty; and therefore we are at no loſs to aſcertain their different perſons in this place. And now, having ſeen all theſe heroes fairly brought to the grave, I ſhall here take my leave of
<pb n="27" facs="unknown:028790_0026_0FDD45F9D588B200"/>
them, and proceed to a new ſubject; for which purpoſe we muſt open the Revelations.</p>
<p>Mr. Brothers tells us, that the Babylon mentioned in the xviiith chapter Apocalypſe, does not mean Rome, but London—contrary to the expreſs ſentiment of all former expoſitors; and he proves his poſition in a very ſatisfactory manner, by ſhewing, that the various and multiplied alluſions to navigation and commerce, in the deſcription of this Babylon, cannot poſſibly be ſtrained, with any propriety, to indicate an inland city, totally incapable of ſhipping, and remarkably deſtitute of trade. His remarks are perfectly juſt and appoſite; all I have therefore to do, is, to corroborate and confirm his proofs, by others drawn from the nature of the articles of mer<g ref="char:EOLhyphen"/>chandize ſaid to have been dealt in there. Verſes 11, 12, 13.</p>
<p>
<q>And the merchants of the earth ſhall weep and mourn over her; for no man buyeth her merchandize any more: the merchandize of gold, and of ſilver, and precious ſtones, and of pearls, and fine linen, and purple, and ſilk, and ſcarlet, and all thyine wood, and all manner of veſſels of ivory, and all manner of veſſels of precious wood, and of braſs, and iron, and marble, and cinnamon, and odours, and ointments, and frankincenſe, and wine, and oil, and fine flour, and wheat, and beaſts, and ſheep, and horſes, and chariots, and ſlaves, and ſouls of men.</q>
</p>
<p>Here we have an inſtance of the prophetic art I for<g ref="char:EOLhyphen"/>merly mentioned, by which the prominent features of the repreſentation or viſion are ſuch as are put on pur<g ref="char:EOLhyphen"/>poſe to miſlead the obſerver; and the key to the myſte<g ref="char:EOLhyphen"/>ry lies quite in the ſhade and obſcurity of the back ground. For all this long and tedious enumeration of wares and commodities is really nothing at all to the buſineſs of the prophecy, whoſe real explication lies wholly in the laſt five words, <hi>"ſlaves and ſouls of men."</hi> What nation is notorious for its extenſive and abomina<g ref="char:EOLhyphen"/>ble traffic in ſlaves? Surely no part of Italy. I would aſk an honorable gentleman, whoſe unparalleled exer<g ref="char:EOLhyphen"/>tions and perſeverance in the cauſe of his oppreſſed fel<g ref="char:EOLhyphen"/>low-creatures do him ſo much honor in the ſight of God and man, whether <hi>he</hi> cannot in an inſtant put his finger
<pb n="28" facs="unknown:028790_0027_0FDD45FB3AA9F990"/>
on the city rendered particularly infamous <hi>by dealing in human fleſh!</hi> We all know it is the <hi>Aſſiento</hi> wholeſale trader; it is the <hi>City of London.</hi>—But ſouls of men are alſo ſold there—<hi>Souls of men?</hi> And where can ſouls of men be properly deemed an article of trade? Certainly not in Rome, where ignorance and prieſtcraft bind up the ſouls of all their deluded ſubjects in chains of ever<g ref="char:EOLhyphen"/>laſting adamant. Still leſs in the <hi>ci-devant</hi> Paris, or Vienna, or Madrid, or any other city under a deſpotic government, where tyranny, whoſe eſſence it is to ex<g ref="char:EOLhyphen"/>tinguiſh and utterly annihilate the human mind itſelf, leaves not a ſingle man who can truly and properly <hi>call his ſoul his own.</hi> It is here, in England, it is in this and of liberty, where every man <hi>has a ſoul</hi> which he can keep or ſell as he pleaſes, that this article can alone be called a merchandize; and Parliament is the grand em<g ref="char:EOLhyphen"/>porium for the commodity.</p>
<p>Muſt I ſpeak out? Muſt I produce an inſtance? Well, then, I <hi>have</hi> an inſtance: I myſelf am that inſtance, and the Speaker is a living witneſs to the truth of my aſſertion. There as he ſat in his chair, day after day, for three years together, beholding me crouched behind the Treaſury Bench, with my ſoul in my hand, like a country girl in the market with her butter and eggs be<g ref="char:EOLhyphen"/>fore her, anxiouſly waiting for the lucky moment when the Tellers would come and rid me of my burthen, that I might run home and hide myſelf. And while I <hi>did</hi> ſell my ſoul, it was all in the true ſpirit of commercial credit <hi>that ſo peculiarly diſtinguiſhes this country:</hi> I ſold it purely upon truſt: I never have received one ſhilling; and now I am taught by experience to apprehend that the purchaſer will never pay me one farthing for it. But though I ſold my ſoul, I could never ſell my tongue. While the one loitered an abandoned proſtitute in the market, the other remained ſullenly immovable at home. The emancipation of the former would have opened the priſon doors of the latter—could I have caught the Speaker's eye. But it is of no conſequence now—<hi>Libe<g ref="char:EOLhyphen"/>ravi animam meam</hi>—and both my ſoul and tongue are from henceforrh at liberty.</p>
<p>
<hi>London,</hi> as Mr. Brothers ſays, is known alſo in the Revelations by the name of <hi>Sodom:</hi> for which he quotes this paſſage of the xith chapter:</p>
<p>
<pb n="29" facs="unknown:028790_0028_0FDD45FCDD5CBD28"/>
<q>And their dead bodies" (viz. thoſe of the two wit<g ref="char:EOLhyphen"/>neſſes) "ſhall lie in the great city, which ſpiritually is called Sodom in Egypt, <hi>where alſo our Lord was cru<g ref="char:EOLhyphen"/>cified.</hi>
</q>
</p>
<p>And in what city can our Lord be ſaid to have been crucified except at Jeruſalem, which ſurely was not in Egypt?—Why there, <hi>and there only,</hi> where the bleſſed ſacrament of redemption is proſtituted to the purpoſes of venality and ambition: where the benefits of ſalva<g ref="char:EOLhyphen"/>tion are bartered for filthy lucre: where the holy com<g ref="char:EOLhyphen"/>memoration of Chriſt's death is degraded to a teſt and qualification for holding civil employments: and con<g ref="char:EOLhyphen"/>ſequently, where the two witneſſes of the Goſpel are trampled under foot by authority of the State?—In no nation under heaven but in England, in no church in the world but that by law eſtabliſhed here, does ſuch a profanation exiſt: in that very church too which ex<g ref="char:EOLhyphen"/>preſsly ſays in one part of her own ritual, that <hi>taking the ſacrament unworthily is crucifying Chriſt's body afreſh, and eating and drinking our own damnation.</hi>
<q>Out of thine own mouth will I condemn thee</q>—thou wicked church!—Here then we have in St. John both Babylon and Sodom to ſignify one and the ſame city, juſt as we have the two cities of London and Weſtminſter within the ſame boundary; but which of the two be Sodom, and which Babylon, I leave to be decided by that ſa<g ref="char:EOLhyphen"/>gacious aſſembly which has no doubt moſt oracularly pronounced whether Richard Brothers be an impoſtor or a madman.</p>
<p>And here let me aſk, whether I have not, in the moſt clear and ſatisfactory manner, and upon full proof, eſ<g ref="char:EOLhyphen"/>tabliſhed every one of thoſe poſitions which I at firſt pledged myſelf to maintain: as well in ſupport of Mr. Brothers's well-founded pretenſions to divine inſpira<g ref="char:EOLhyphen"/>tion, as of my own qualifications and abilities for exe<g ref="char:EOLhyphen"/>cuting the taſk I had undertaken? And I hope thoſe perſons of the better conditions of life, whom I know to have ſaid that this book was calculated to make an impreſſion on none but the moſt illiterate vulgar, will be now inclined to admit that it <hi>may</hi> have weight even with a man not much leſs inſtructed or experienced than themſelves, nor very greatly their inferior in un<g ref="char:EOLhyphen"/>derſtanding,
<pb n="30" facs="unknown:028790_0029_0FDD460163420040"/>
literature, or ſituation. Moſt of all, I hope that every one will at leaſt think it worth while to examine the Scriptures calmly and attentively, to com<g ref="char:EOLhyphen"/>pare them with Mr. Brothers's aſſertions, and then judge for himſelf; for I can aſſure my readers, that I could never obtain the ſmalleſt explanation of any part of his book from Mr. Brothers, whom I called upon expreſsly for that purpoſe. He drily referred me to my Bible, obſerving that he could neither ſubtract from, nor add a ſingle word to, what God had expreſsly dictated to him. The field is ſtill open for freſh labourers; I have occupied but a ſmall part of it; as well becauſe it is fit this work ſhould be compriſed within moderate limits, as becauſe I am ſatisfied that I have heaped proof upon proof beyond all reaſonable neceſſity for full conviction. And here I ſhall cloſe the ſubject as far as relates to politics, and employ a few words with regard to Mr. Brothers himſelf.</p>
<p>He ſays he is come to recall the Jews to their native country; and for the proof of his divine miſſion he refers us to the mira<g ref="char:EOLhyphen"/>culous diſcoveries contained in his books, from a perſuaſion that, if we admit the prophecy, we cannot reject the prophet. Now that all Scripture as well as all Tradition bears teſtimony to the certainty of the recall of the Jews in the latter ages of the world, no man who has but a ſmattering of acquaintance with either can for a moment pretend to deny. The main deſign of Mr. Brothers, as far as he is perſonally concerned, is to ſhew us that the life and conduct of the firſt Moſes was a ſort of type or pre<g ref="char:EOLhyphen"/>determined pattern for that of the ſecond; and for this purpoſe he quotes a text of Scripture, which can neither be eluded nor ex<g ref="char:EOLhyphen"/>plained away, that the man deſtined to lead the Jews a ſecond time to Paleſtine ſhould be <hi>like to Moſes himſelf.</hi> The Parallel between the two perſonages Mr. Brothers ſtates to have tallied hitherto, and he aſſerts that it will continue to do ſo; for, as Moſes aſcended from the ark of bull-ruſhes, ſo did Mr. Brothers riſe from a ſhip, having been bred to the navy. This coincidence of charac<g ref="char:EOLhyphen"/>ters might be evident at firſt ſight, Mr. Brothers aſſerts, that by the command of God himſelf, he cut a wand in 1792, which is to perform preciſely the ſame miracle with the former wand of Moſes. Nor need we now be aſtoniſhed or ſcandalized, when we hear Mr. Brothers affirm that God ſpeaks to him in plain di<g ref="char:EOLhyphen"/>rect words, as one man would ſpeak to another, ſince we kwow that in this reſpect Moſes was favoured with a communication ex<g ref="char:EOLhyphen"/>actly ſimilar. Moſes, born in Egypt, led the Iſraelites from E<g ref="char:EOLhyphen"/>gypt through the Red Sea into Paleſtine. The birth-place there<g ref="char:EOLhyphen"/>fore of the ſecond Moſes, and the country from whence he is to
<pb n="31" facs="unknown:028790_0030_0FDD4602C6C99450"/>
ſummon the modern Hebrews, muſt ſpiritually at leaſt have at one time or other been alſo denominated Egypt, to make the parallel between two events move an all fours: and I have already proved, from St. John in the Revelations, that the great city (viz. <hi>Lon<g ref="char:EOLhyphen"/>don</hi>) was ſpiritually called Sodom <hi>in Egypt.</hi>
</p>
<p>In the ſpirit of this parallel Mr. Brothers remarks in his ſecond book—<q>Pharaoh is appointed to die, and his government to be de<g ref="char:EOLhyphen"/>ſtroyed the prieſts and all the abominable idolatries of Egypt ſhall periſh, never to be found any more.</q>
</p>
<p>I ſhall now ſlightly mention a few expreſſions to be found in Mr. Brothers's books, which have operated as ſtumbling-blocks to weak minds. And firſt, for the phraſe which has cauſed ſo much offence, where he calls himſelf <hi>God Almighty's Nephew.</hi> I ſincerely hope there is no man in this country who will openly deny that Jeſus Chriſt is God Almighty. If there be, I ſpeak not to him: I am ſure no member of the eſtabliſhed Trinitarian church can ſafely ſay otherwiſe. Now if Jeſus Chriſt had brothers and ſiſters, as is expreſsly proved from the Goſpel, the ſon of any one of thoſe muſt neceſſarily have been <hi>his</hi> nephew. Extend the line of filiation as far as we pleaſe, through 50, 100, or 1000 de<g ref="char:EOLhyphen"/>ſcents, the laſt is ſtill a nephew, lineally deſcended from the firſt, in the ſame manner as every Jew to this day is a ſon of Abraham, and as we are all of us beyond all doubt ſons of Adam.</p>
<p>Next, Mr. Brothers ſays, he was in a viſion taken up to hea<g ref="char:EOLhyphen"/>ven, where he ſaw the Holy Ghoſt under the figure of a ſilver-coloured dove. As a ſpirit truly the Holy Ghoſt may have no ſhape; but that he actually appeared <hi>as a dove</hi> when Jeſus Chriſt was baptized by John in Jordan, I preſume no believer in the Goſpel will think fit to conteſt with me. Again, Mr. Brothers ſaw Satan entering London <hi>in a human ſhape.</hi> Why what ſhape ſhould he be in? Perhaps, indeed, if he had repreſented him with ſaucer eyes, cloven hoofs, and a tail a fathom and a half long, all the old women of both ſexes in this great city would have been mightily tempted to believe him. But after all, what other ſhape can we more conſiſtently ſuppoſe him to have worn in his triumphal entry into a city inhabited by men? I am only ſorry, that, deſcribed as he is in robes of white and ſcarlet, he muſt have been hardly diſtinguiſhable at firſt ſight from any of the Peers of Great Britain, whom I have ſeen in the ſame dreſs come into and go out of Weſtminſter Hall at the diabolical Im<g ref="char:EOLhyphen"/>peachment.</p>
<p>Objections, but thoſe perfectly groundleſs, and founded in groſs ignorance of the general courſe of God's judgments, have been ſtarted againſt Mr. Brothers's aſſertion in his firſt book, <q>that God would have deſtroyed the city of London in 1791— but for his interceſſions.</q>
</p>
<p>To ſhew that this doctrine is not unprecedented we might inſtance Abraham's repeated ſolicitations for the preſervation of
<pb n="32" facs="unknown:028790_0031_0FDD4604A1F9B548"/>
Sodom, and God's anſwers in the xviiith chapter of Geneſis: as well as ſeveral other ſimiliar circumſtances in Scripture. But there is a paſſage in Ezekiel which comes, if poſſible, ſtill more exactly to the point; it is in the xxiid chapter, the title of which runs thus—<q>V. 1. A catalogue of ſins in Jeruſalem.—17. God will burn them as droſs in his furnace.—23. The gener<g ref="char:EOLhyphen"/>al corruption of prophets, prieſts, princes and people.</q>—</p>
<p>Now let us attend to the 30th and 31ſt verſes. It is God that ſpeaks.</p>
<p>
<q>And I ſought for a man among them, that ſhould make up the hedge, and ſtand in the gap before me for the land, that I ſhould not deſtroy it; but I found none. Therefore have I poured out mine indignation upon them, &c.</q>
</p>
<p>Words cannot be found more inconteſtably applicable to Mr. Brothers's deſcription of himſelf <q>ſtanding in the gap before the Lord for the city, that he ſhould not deſtroy it.</q> To controvert this principal, is not to want conviction, but to repel it.</p>
<p>Now to conclude: If any man, calmly attending to what I have adduced, can ſtill conſider Mr. Brothers as an impoſtor or a madman, I wiſh him little joy of his feelings or his proſpects. But whatever judgment be pronounced on him, let it at leaſt be after a fair trial and ſufficient hearing. Let us firſt reflect, whe<g ref="char:EOLhyphen"/>ther it be poſſible that a madam ſhould ſo ably and conſiſtently preſs into his ſervice the whole body of prophecy both in the Old and New Teſtament, all tending to one and the ſame diſtinct end; or whether an impoſtor ſhould ſo honeſtly and diſintereſted<g ref="char:EOLhyphen"/>ly entreat us only to take ſerious care of ourſelves and our own moſt important concerns, leaving himſelf and all poſſible perſonal advantage totally out of the queſtion. And what then is the point he ſo arduouſly labours? Nothing more than that we would, before it be utterly too late, relinquiſh this <hi>juſt and neceſſary war;</hi> juſt, only becauſe it juſtifies God's vengeance—and neceſſary on<g ref="char:EOLhyphen"/>ly becauſe neceſſary for our puniſhment. And I doubt not but it is his opinion, as it is moſt aſſuredly mine, and my advice alſo, that the <hi>Faſt</hi> which is appointed for the 25th of Feb. to implore ſucceſs on our arms, ſhould be converted, by Addreſs to his Majeſty, from both Houſes of Parliament to that effect, to the purpoſe of a ſolemn and ſincere humiliation for our crimes, and a moſt ear<g ref="char:EOLhyphen"/>neſt ſupplication to God for the reſtoration of peace; and that we may take warning by the fate of our abandoned and ſubjuga<g ref="char:EOLhyphen"/>ted ally, not to poſtpone our offers for a negotiation to the very laſt moment, when the ſword ſhall already be at our throats, and all hopes of obtaining moderate terms muſt be totally relinquſh<g ref="char:EOLhyphen"/>ed. Let us, while it is yet poſſible, adopt that moſt divine ſen<g ref="char:EOLhyphen"/>tence of the Goſpel, <hi>"on earth peace, good will towards men."</hi>
</p>
<closer>
<signed>Nathaniel Braſſey Halhed.</signed>
<dateline>PALL-MALL,
<date>29th January, 1795.</date>
</dateline>
</closer>
</div>
</body>
</text>
</TEI>
| 228.342776 | 2,417 | 0.739061 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.