hexsha stringlengths 40 40 | size int64 5 1.05M | ext stringclasses 588
values | lang stringclasses 305
values | max_stars_repo_path stringlengths 3 363 | max_stars_repo_name stringlengths 5 118 | max_stars_repo_head_hexsha stringlengths 40 40 | max_stars_repo_licenses listlengths 1 10 | max_stars_count float64 1 191k ⌀ | max_stars_repo_stars_event_min_datetime stringdate 2015-01-01 00:00:35 2022-03-31 23:43:49 ⌀ | max_stars_repo_stars_event_max_datetime stringdate 2015-01-01 12:37:38 2022-03-31 23:59:52 ⌀ | max_issues_repo_path stringlengths 3 363 | max_issues_repo_name stringlengths 5 118 | max_issues_repo_head_hexsha stringlengths 40 40 | max_issues_repo_licenses listlengths 1 10 | max_issues_count float64 1 134k ⌀ | max_issues_repo_issues_event_min_datetime stringlengths 24 24 ⌀ | max_issues_repo_issues_event_max_datetime stringlengths 24 24 ⌀ | max_forks_repo_path stringlengths 3 363 | max_forks_repo_name stringlengths 5 135 | max_forks_repo_head_hexsha stringlengths 40 40 | max_forks_repo_licenses listlengths 1 10 | max_forks_count float64 1 105k ⌀ | max_forks_repo_forks_event_min_datetime stringdate 2015-01-01 00:01:02 2022-03-31 23:27:27 ⌀ | max_forks_repo_forks_event_max_datetime stringdate 2015-01-03 08:55:07 2022-03-31 23:59:24 ⌀ | content stringlengths 5 1.05M | avg_line_length float64 1.13 1.04M | max_line_length int64 1 1.05M | alphanum_fraction float64 0 1 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
5ea67c64d6f76d5aba1e4f1a4798de63dd08b2fc | 2,226 | xml | XML | data/1867/11/11/DDD_ddd_010138318_mpeg21/DDD_010138318_0004_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | data/1867/11/11/DDD_ddd_010138318_mpeg21/DDD_010138318_0004_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | data/1867/11/11/DDD_ddd_010138318_mpeg21/DDD_010138318_0004_articletext.xml | KBNLresearch/mcc | 25a9db197103e9c67fbe866a61944ab3cf421100 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<text>
<title>Fondsen en Beurstijdingen.</title>
<p>LONDEN, 7 Nov. De beurs scbynt voor een gedeelte hare vrees voor staatkundige verwikkelingen te hebben laten varen, althans voor zoo veel de Italiaansche aangelegenheden betreft. De handel was echter van weinig beteekenis, daar de hoofdaandacht gevestigd is op de rescontre in Geconsolideerden. Het publiek blijft zich van geldbeleggingen onthouden en het scbynt dat dit nog het overige gedeelte van dit jaar het geval zal zijn, ondanks de groote kapitalen, welke onbelegd zijn. De vraag naar geld is matig tot 11/2 pCt. voor dnemaandsch napier. De bank van Engeland heeft £ 101,000 goud in baren afgeleverd, makende een totaal voor de week van ƒ288,000. De City of London heeft slechts £ 1500 in specie van New-York aangebragt. De beurs opende minder vast voor Engslscne fondsen, omdat de de groote verzendingen van goud aanleiding gaven tot verkoopen, zoodat de koers van Geconsolideerden i/_ pCt. lager was dan het hoogste standpunt van gisteren. Sedert heeft de stemming zich evenwel verbeterd. Gecons. zijn gedaan tot 94% a 94Vs contant en 93.. ex d. op tijd; Ge.____. en Nieuwe 3 puts. 923>4 a 93; Bank-Actien 246a247; Indian .Stock 221a223; Schatkistbilletten 2.a'3osh. premie. "ViJe pryzen der Buitenlandsche fondsen hebben zich over het algeal*!. 'V 0 .. gehandhaafd ; ltaliaansclie 453/. a 7/g; Turksche 5 pCts. £Hl(Ba32y_; Spaan Scha Passiva 19; Dito Certificaten 163/.; Dito N. 3 pCt. SU/s a S/g; (deze laatste zullen waarschijnlijk offioieel worden genoteerd); Egyptische van 1864 84V_ ; Mexicaansche 147/ s a 15Vs. De houders van niet geconverteerde Passiven hebben gisteren aan lord Stanley een protest overhandigd tegen de conversiewet van 1867, met verzoek dit door tusschenkomst van den Britschen gezant te Madrid aan het Spaansche kabinet te doen toekomen. Vau Amerikaansche zijn V. S. 5-20rs onveranderd op 70% a 71 ; Erie-spoorweg en Illinois Centraal beido i/„ pCt. lager; de eerstgenoemden zijn gedaan tot 46 a 47 en de laatstgenoemden tot 811/3 aB2V_. Consolidated Bank £ 4 ._ a 7/i_ (gefourneerd £ 4.) Spoorweg Antwerpen-Rotterdam £ 7% a Bi/s; Rijn-Spoorweg £ 191/ a a 20.</p>
</text>
| 371 | 2,124 | 0.780773 |
5954c34001ec2ccaa4579805411f326535ed6652 | 1,978 | xml | XML | data/images/train/bottle/3118-wba-15196-000-c025-1573547471-shelf3.xml | kratiknayak/obj_model | 7f00f89157c83c8a4e2413cce70358e3dccf92e0 | [
"MIT"
] | null | null | null | data/images/train/bottle/3118-wba-15196-000-c025-1573547471-shelf3.xml | kratiknayak/obj_model | 7f00f89157c83c8a4e2413cce70358e3dccf92e0 | [
"MIT"
] | null | null | null | data/images/train/bottle/3118-wba-15196-000-c025-1573547471-shelf3.xml | kratiknayak/obj_model | 7f00f89157c83c8a4e2413cce70358e3dccf92e0 | [
"MIT"
] | null | null | null | <annotation>
<folder>wba-15196-000-c025</folder>
<filename>3118-wba-15196-000-c025-1573547471-shelf3.jpg</filename>
<path>/home/qwinix/Documents/15196/wba-15196-000-c025/3118-wba-15196-000-c025-1573547471-shelf3.jpg</path>
<source>
<database>Unknown</database>
</source>
<size>
<width>900</width>
<height>400</height>
<depth>3</depth>
</size>
<segmented>0</segmented>
<object>
<name>bottle</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>8</xmin>
<ymin>57</ymin>
<xmax>67</xmax>
<ymax>352</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>72</xmin>
<ymin>54</ymin>
<xmax>141</xmax>
<ymax>355</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>143</xmin>
<ymin>140</ymin>
<xmax>319</xmax>
<ymax>360</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>329</xmin>
<ymin>74</ymin>
<xmax>459</xmax>
<ymax>357</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>453</xmin>
<ymin>24</ymin>
<xmax>607</xmax>
<ymax>355</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>615</xmin>
<ymin>108</ymin>
<xmax>774</xmax>
<ymax>352</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<pose>Unspecified</pose>
<truncated>1</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>772</xmin>
<ymin>110</ymin>
<xmax>900</xmax>
<ymax>353</ymax>
</bndbox>
</object>
</annotation> | 20.183673 | 107 | 0.632963 |
f612272e45b20905dd345e8f16497d6907a5b053 | 30,501 | xml | XML | app/src/main/res/layout/fragment_reimbursement_list.xml | DebashisINT/RubyFood | 0e6e238161578d786ae13adba43ab1c958095684 | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layout/fragment_reimbursement_list.xml | DebashisINT/RubyFood | 0e6e238161578d786ae13adba43ab1c958095684 | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layout/fragment_reimbursement_list.xml | DebashisINT/RubyFood | 0e6e238161578d786ae13adba43ab1c958095684 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:app="http://schemas.android.com/apk/res-auto"
xmlns:wheel="http://schemas.android.com/apk/res-auto"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:background="@color/color_silver">
<LinearLayout
android:layout_width="match_parent"
android:layout_height="match_parent"
android:orientation="vertical">
<RelativeLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:background="@color/color_silver"
android:padding="@dimen/_10sdp">
<LinearLayout
android:id="@+id/ll_month"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_centerVertical="true"
android:gravity="center_vertical">
<ImageView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:contentDescription="@null"
android:src="@drawable/ic_calender" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_month"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:text="January"
android:textColor="@color/black" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_year"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:text="2019"
android:textColor="@color/black" />
<ImageView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:contentDescription="@null"
android:src="@drawable/ic_down_arrow" />
</LinearLayout>
<LinearLayout
android:id="@+id/ll_conveyence"
android:layout_width="@dimen/_95sdp"
android:layout_height="wrap_content"
android:layout_alignParentRight="true"
android:background="@drawable/rounded_corner_gray_boarder_trans_bg"
android:gravity="center_vertical"
android:paddingBottom="@dimen/_7sdp"
android:paddingLeft="@dimen/_5sdp"
android:paddingRight="@dimen/_5sdp"
android:paddingTop="@dimen/_7sdp">
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_conveyence"
android:layout_width="0dp"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:layout_weight="0.8"
android:gravity="center"
android:textColor="@color/black"
android:textSize="@dimen/_10sdp" />
<ImageView
android:layout_width="0dp"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:layout_marginRight="@dimen/_5sdp"
android:layout_weight="0.2"
android:contentDescription="@null"
android:src="@drawable/ic_down_arrow" />
</LinearLayout>
</RelativeLayout>
<RelativeLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:background="@drawable/custom_toolbar_back">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_centerVertical="true"
android:orientation="vertical"
android:padding="@dimen/_10sdp">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:gravity="center_vertical">
<ImageView
android:layout_width="@dimen/_15sdp"
android:layout_height="@dimen/_15sdp"
android:contentDescription="@null"
android:src="@drawable/ic_white_rupee_icon" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_approved_amount"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:text="0"
android:textColor="@color/white"
android:textSize="@dimen/_15sdp"
android:textStyle="bold" />
<com.rubyfood.widgets.AppCustomTextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:text="@string/approved"
android:textColor="@color/white"
android:textSize="@dimen/_11sdp" />
</LinearLayout>
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:gravity="center_vertical">
<com.rubyfood.widgets.AppCustomTextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:text="@string/total_claim_amount"
android:textColor="@color/white"
android:textSize="@dimen/_11sdp"
android:textStyle="bold" />
<ImageView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_5sdp"
android:contentDescription="@null"
android:src="@drawable/ic_white_rupee_small_icon" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_total_claim_amount"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_2sdp"
android:text="0"
android:textColor="@color/white"
android:textSize="@dimen/_12sdp" />
</LinearLayout>
</LinearLayout>
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_alignParentRight="true"
android:visibility="gone">
<ProgressBar
android:id="@+id/progressBar_timer"
style="?android:attr/progressBarStyleHorizontal"
android:layout_width="@dimen/_83sdp"
android:layout_height="@dimen/_83sdp"
android:layout_centerHorizontal="true"
android:layout_centerInParent="true"
android:indeterminate="false"
android:max="100"
android:progress="0"
android:progressDrawable="@drawable/progress_bar_wo_timer" />
<RelativeLayout
android:layout_width="@dimen/_55sdp"
android:layout_height="@dimen/_55sdp"
android:layout_centerInParent="true"
android:background="@drawable/smoke_white_circle">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_centerInParent="true"
android:orientation="vertical">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:gravity="center_vertical">
<com.rubyfood.widgets.AppCustomTextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_2sdp"
android:text="@string/accept"
android:textColor="@color/white"
android:textSize="@dimen/_7sdp" />
<ImageView
android:layout_width="@dimen/_7sdp"
android:layout_height="@dimen/_7sdp"
android:layout_marginLeft="@dimen/_3sdp"
android:contentDescription="@null"
android:src="@drawable/ic_white_rupee_small_icon" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_approve_amount"
android:layout_width="wrap_content"
android:layout_height="match_parent"
android:layout_marginLeft="@dimen/_2sdp"
android:layout_marginRight="@dimen/_3sdp"
android:text="0"
android:textColor="@color/white"
android:textSize="@dimen/_6sdp" />
</LinearLayout>
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:gravity="center_vertical">
<com.rubyfood.widgets.AppCustomTextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_2sdp"
android:text="@string/claim"
android:textColor="@color/white"
android:textSize="@dimen/_7sdp" />
<ImageView
android:layout_width="@dimen/_7sdp"
android:layout_height="@dimen/_7sdp"
android:layout_marginLeft="@dimen/_3sdp"
android:contentDescription="@null"
android:src="@drawable/ic_white_rupee_small_icon" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_claim_amount"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="@dimen/_2sdp"
android:layout_marginRight="@dimen/_3sdp"
android:text="0"
android:textColor="@color/white"
android:textSize="@dimen/_6sdp" />
</LinearLayout>
</LinearLayout>
</RelativeLayout>
</RelativeLayout>
</RelativeLayout>
<LinearLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:visibility="gone">
<RelativeLayout
android:layout_width="0dp"
android:layout_height="wrap_content"
android:layout_weight="1">
<FrameLayout
android:id="@+id/fl_travel"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_centerInParent="true">
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content">
<androidx.cardview.widget.CardView
android:id="@+id/cv_travel"
android:layout_width="@dimen/_70sdp"
android:layout_height="@dimen/_70sdp"
android:layout_margin="@dimen/_5sdp"
android:shape="ring"
app:cardBackgroundColor="@color/white"
app:cardCornerRadius="@dimen/_35sdp"
app:cardElevation="@dimen/_5sdp">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center"
android:layout_marginTop="@dimen/_minus5sdp"
android:orientation="vertical">
<ImageView
android:layout_width="@dimen/_35sdp"
android:layout_height="@dimen/_35sdp"
android:contentDescription="@null"
android:src="@drawable/ic_travel_icon" />
<com.rubyfood.widgets.AppCustomTextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_horizontal"
android:layout_marginTop="@dimen/_minus2sdp"
android:text="@string/travel"
android:textColor="@color/black"
android:textSize="@dimen/_9sdp" />
</LinearLayout>
</androidx.cardview.widget.CardView>
</RelativeLayout>
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="bottom"
android:layout_marginTop="@dimen/_57sdp">
<androidx.cardview.widget.CardView
android:id="@+id/cv_travel_price"
android:layout_width="@dimen/_70sdp"
android:layout_height="@dimen/_20sdp"
android:layout_margin="@dimen/_5sdp"
android:shape="ring"
app:cardBackgroundColor="@color/reimbursement_layout_selector"
app:cardCornerRadius="@dimen/_10sdp"
app:cardElevation="@dimen/_5sdp">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center">
<ImageView
android:id="@+id/iv_tavel_rupee"
android:layout_width="@dimen/_15sdp"
android:layout_height="@dimen/_15sdp"
android:layout_gravity="center_vertical"
android:contentDescription="@null"
android:src="@drawable/reimbursement_rupee_sign_selector" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_travel_amount"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:text="4000"
android:textColor="@color/reimbursement_text_color_selector"
android:textSize="@dimen/_11sdp" />
</LinearLayout>
</androidx.cardview.widget.CardView>
</RelativeLayout>
</FrameLayout>
</RelativeLayout>
<RelativeLayout
android:layout_width="0dp"
android:layout_height="wrap_content"
android:layout_weight="1">
<FrameLayout
android:id="@+id/fl_hotel"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_centerInParent="true">
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content">
<androidx.cardview.widget.CardView
android:id="@+id/cv_hotel"
android:layout_width="@dimen/_70sdp"
android:layout_height="@dimen/_70sdp"
android:layout_margin="@dimen/_5sdp"
android:shape="ring"
app:cardBackgroundColor="@color/white"
app:cardCornerRadius="@dimen/_35sdp"
app:cardElevation="@dimen/_5sdp">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center"
android:layout_marginTop="@dimen/_minus5sdp"
android:orientation="vertical">
<ImageView
android:layout_width="@dimen/_35sdp"
android:layout_height="@dimen/_35sdp"
android:contentDescription="@null"
android:src="@drawable/ic_hotell_icon" />
<com.rubyfood.widgets.AppCustomTextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_horizontal"
android:layout_marginTop="@dimen/_minus2sdp"
android:text="@string/hotel"
android:textColor="@color/black"
android:textSize="@dimen/_9sdp" />
</LinearLayout>
</androidx.cardview.widget.CardView>
</RelativeLayout>
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="bottom"
android:layout_marginTop="@dimen/_57sdp">
<androidx.cardview.widget.CardView
android:id="@+id/cv_hotel_price"
android:layout_width="@dimen/_70sdp"
android:layout_height="@dimen/_20sdp"
android:layout_margin="@dimen/_5sdp"
android:shape="ring"
app:cardBackgroundColor="@color/reimbursement_layout_selector"
app:cardCornerRadius="@dimen/_10sdp"
app:cardElevation="@dimen/_5sdp">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center">
<ImageView
android:id="@+id/iv_hotel_rupee"
android:layout_width="@dimen/_15sdp"
android:layout_height="@dimen/_15sdp"
android:layout_gravity="center_vertical"
android:contentDescription="@null"
android:src="@drawable/reimbursement_rupee_sign_selector" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_hotel_amount"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:text="1,500"
android:textColor="@color/reimbursement_text_color_selector"
android:textSize="@dimen/_11sdp" />
</LinearLayout>
</androidx.cardview.widget.CardView>
</RelativeLayout>
</FrameLayout>
</RelativeLayout>
<RelativeLayout
android:layout_width="0dp"
android:layout_height="wrap_content"
android:layout_weight="1">
<FrameLayout
android:id="@+id/fl_food"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_centerInParent="true">
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content">
<androidx.cardview.widget.CardView
android:id="@+id/cv_food"
android:layout_width="@dimen/_70sdp"
android:layout_height="@dimen/_70sdp"
android:layout_margin="@dimen/_5sdp"
android:shape="ring"
app:cardBackgroundColor="@color/white"
app:cardCornerRadius="@dimen/_35sdp"
app:cardElevation="@dimen/_5sdp">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center"
android:layout_marginTop="@dimen/_minus5sdp"
android:orientation="vertical">
<ImageView
android:layout_width="@dimen/_35sdp"
android:layout_height="@dimen/_35sdp"
android:contentDescription="@null"
android:src="@drawable/ic_food_icon" />
<com.rubyfood.widgets.AppCustomTextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_horizontal"
android:layout_marginTop="@dimen/_minus2sdp"
android:text="@string/food"
android:textColor="@color/black"
android:textSize="@dimen/_9sdp" />
</LinearLayout>
</androidx.cardview.widget.CardView>
</RelativeLayout>
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="bottom"
android:layout_marginTop="@dimen/_57sdp">
<androidx.cardview.widget.CardView
android:id="@+id/cv_food_price"
android:layout_width="@dimen/_70sdp"
android:layout_height="@dimen/_20sdp"
android:layout_margin="@dimen/_5sdp"
android:shape="ring"
app:cardBackgroundColor="@color/reimbursement_layout_selector"
app:cardCornerRadius="@dimen/_10sdp"
app:cardElevation="@dimen/_5sdp">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center">
<ImageView
android:id="@+id/iv_food_rupee"
android:layout_width="@dimen/_15sdp"
android:layout_height="@dimen/_15sdp"
android:layout_gravity="center_vertical"
android:contentDescription="@null"
android:src="@drawable/reimbursement_rupee_sign_selector" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_food_amount"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:text="400"
android:textColor="@color/reimbursement_text_color_selector"
android:textSize="@dimen/_11sdp" />
</LinearLayout>
</androidx.cardview.widget.CardView>
</RelativeLayout>
</FrameLayout>
</RelativeLayout>
</LinearLayout>
<RelativeLayout
android:layout_width="match_parent"
android:layout_height="wrap_content">
<RelativeLayout
android:id="@+id/rl_expense_list"
android:layout_width="match_parent"
android:layout_height="wrap_content">
<androidx.recyclerview.widget.RecyclerView
android:id="@+id/rv_expense_list"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_marginTop="@dimen/_5sdp" />
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_no_data"
android:layout_width="match_parent"
android:layout_height="@dimen/_100sdp"
android:layout_centerInParent="true"
android:gravity="center"
android:text="@string/no_data_available"
android:textColor="@color/colorPrimary"
android:textSize="@dimen/_13sdp"
android:textStyle="normal"
android:visibility="gone" />
</RelativeLayout>
<RelativeLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_below="@+id/rl_expense_list">
<androidx.recyclerview.widget.RecyclerView
android:id="@+id/rv_reimbursment_list"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:layout_marginTop="@dimen/_5sdp"
android:paddingBottom="@dimen/_10sdp"/>
</RelativeLayout>
<com.rubyfood.widgets.AppCustomTextView
android:id="@+id/tv_no_ta"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:layout_centerInParent="true"
android:gravity="center"
android:text="@string/no_data_available"
android:textColor="@color/colorPrimary"
android:textSize="@dimen/_13sdp"
android:textStyle="normal"
android:visibility="gone"/>
</RelativeLayout>
</LinearLayout>
<com.google.android.material.floatingactionbutton.FloatingActionButton
android:id="@+id/fab"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_alignParentBottom="true"
android:layout_alignParentRight="true"
android:layout_gravity="bottom|end"
android:layout_margin="@dimen/_20sdp"
android:src="@drawable/ic_add"
app:fabSize="normal" />
<com.pnikosis.materialishprogress.ProgressWheel
android:id="@+id/progress_wheel"
android:layout_width="80dp"
android:layout_height="80dp"
android:layout_centerHorizontal="true"
android:layout_centerVertical="true"
wheel:matProg_barColor="@color/default_text_color"
wheel:matProg_progressIndeterminate="true" />
</RelativeLayout> | 49.115942 | 96 | 0.481853 |
a84c7d426a489c2de23cf2a08ad3076baa4320c4 | 1,066 | xml | XML | SampleFresh/app/src/main/res/layout/horizontal_item_layout.xml | moblarry/ShareSDK-for-Android | 2cd987b829ff4e5f6223487a41a0815001dffa23 | [
"MIT"
] | 300 | 2015-12-18T08:47:56.000Z | 2022-03-29T03:59:29.000Z | SampleFresh/app/src/main/res/layout/horizontal_item_layout.xml | moblarry/ShareSDK-for-Android | 2cd987b829ff4e5f6223487a41a0815001dffa23 | [
"MIT"
] | 43 | 2016-02-03T10:39:18.000Z | 2022-03-23T06:39:02.000Z | SampleFresh/app/src/main/res/layout/horizontal_item_layout.xml | moblarry/ShareSDK-for-Android | 2cd987b829ff4e5f6223487a41a0815001dffa23 | [
"MIT"
] | 135 | 2015-12-14T03:47:32.000Z | 2022-03-14T00:11:10.000Z | <?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:id="@+id/itemLayout"
android:orientation="vertical"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:paddingTop = "@dimen/main_activity_top_margin_width"
android:paddingLeft = "@dimen/main_activity_top_margin_width"
android:paddingRight = "@dimen/main_activity_top_margin_width"
android:paddingBottom = "@dimen/main_activity_bottom_margin_width">
<TextView
android:id="@+id/titleName"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:textSize="@dimen/main_activity_top_margin_color_size"/>
<ImageView
android:id="@+id/titleImg"
android:layout_width="match_parent"
android:layout_height="2dp"
android:layout_marginTop="@dimen/main_activity_top_margin_img_txt"
android:background="@color/main_activity_top_img_bg"/>
</LinearLayout> | 46.347826 | 74 | 0.708255 |
ec68a74b7a697b56d60050ea957482cffbcf0cdd | 2,790 | xml | XML | app/src/main/res/layout/slide_images_layout.xml | aannisagita/Template_dpr_now | 40796094149885d260f273d16446494d744b5d8d | [
"MIT"
] | null | null | null | app/src/main/res/layout/slide_images_layout.xml | aannisagita/Template_dpr_now | 40796094149885d260f273d16446494d744b5d8d | [
"MIT"
] | null | null | null | app/src/main/res/layout/slide_images_layout.xml | aannisagita/Template_dpr_now | 40796094149885d260f273d16446494d744b5d8d | [
"MIT"
] | 1 | 2020-11-23T15:06:35.000Z | 2020-11-23T15:06:35.000Z | <?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:app="http://schemas.android.com/apk/res-auto"
xmlns:tools="http://schemas.android.com/tools"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:orientation="vertical"
android:background="@drawable/background"
tools:context=".MulaiActivity">
<ScrollView
android:id="@+id/scrollView1"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:layout_centerVertical="true">
<LinearLayout
android:layout_width="match_parent"
android:layout_height="match_parent"
android:orientation="vertical"
>
<ViewFlipper
android:id="@+id/v_flipper"
android:layout_width="match_parent"
android:layout_height="225dp"
android:layout_centerHorizontal="true"
android:layout_margin="10dp"/>
<RelativeLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center"
android:layout_marginTop="150dp">
<Button
android:id="@+id/menu1"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_margin="10dp"
android:gravity="center"
android:padding="5dp"
android:text="@string/nama_judul"
android:background="@drawable/button_border" />
<Button
android:id="@+id/menu2"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_margin="10dp"
android:gravity="center"
android:padding="5dp"
android:text="@string/nama_judul"
android:background="@drawable/button_border"
android:layout_below="@+id/menu1"/>
<Button
android:id="@+id/menu3"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_margin="10dp"
android:gravity="center"
android:padding="5dp"
android:text="@string/nama_judul"
android:background="@drawable/button_border"
android:layout_below="@id/menu2"/>
</RelativeLayout>
</LinearLayout>
</ScrollView>
</LinearLayout> | 37.702703 | 72 | 0.553405 |
d344f49cd3ccc61fef307511a89a66d715b81375 | 4,889 | xml | XML | src/zform_fpm_file_attach 00.wdcc.comp_config.xml | boy0korea/ZFPM_FILE_ATTACH | 2864180665d3dbfe4e042f6dfe2b45ebed99a774 | [
"MIT"
] | null | null | null | src/zform_fpm_file_attach 00.wdcc.comp_config.xml | boy0korea/ZFPM_FILE_ATTACH | 2864180665d3dbfe4e042f6dfe2b45ebed99a774 | [
"MIT"
] | null | null | null | src/zform_fpm_file_attach 00.wdcc.comp_config.xml | boy0korea/ZFPM_FILE_ATTACH | 2864180665d3dbfe4e042f6dfe2b45ebed99a774 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<Component Name="FPM_FORM_UIBB_GL2" ConfId="ZFORM_FPM_FILE_ATTACH" ConfType="00" ConfVar="">
<Node Name="CONFIGURATION_CONTEXT" SimpleFormat="true">
<Item Index="000001" SimpleFormat="true">
<Node Name="FORM" SimpleFormat="true">
<Item Index="000001" SimpleFormat="true">
<FEEDER>ZCL_FORM_FPM_FILE_ATTACH</FEEDER>
<CHECK_MANDATORY>X</CHECK_MANDATORY>
<Node Name="ACTION" SimpleFormat="true">
<Item Index="000001" SimpleFormat="true">
<ID Final="5 ">FGL2_42010A02B0231EDC90D65778FA89DD40</ID>
<TYPE/>
<EVENT_ID>FPM_LEAVE_INITIAL_SCREEN</EVENT_ID>
<EVENT_PARAMETERS/>
</Item>
</Node>
<Node Name="BUTTON" SimpleFormat="true"/>
<Node Name="BUTTON_ROW" SimpleFormat="true"/>
<Node Name="CTXT_MENU" SimpleFormat="true"/>
<Node Name="DROP_TARGET" SimpleFormat="true"/>
<Node Name="FORM_GROUP" SimpleFormat="true"/>
<Node Name="PARAMETER" SimpleFormat="true"/>
<Node Name="PERSONALIZATION" SimpleFormat="true"/>
<Node Name="POSITION" SimpleFormat="true">
<Item Index="000001" SimpleFormat="true">
<ID Final="5 ">_GENP_42010A02B0231EDC90D3F59FDC3D9D40</ID>
<START_ROW>1</START_ROW>
<START_COLUMN>D</START_COLUMN>
<END_ROW>1</END_ROW>
<END_COLUMN>P</END_COLUMN>
<LABEL_START_ROW>1</LABEL_START_ROW>
<LABEL_START_COLUMN>A</LABEL_START_COLUMN>
<LABEL_END_ROW>1</LABEL_END_ROW>
<LABEL_END_COLUMN>C</LABEL_END_COLUMN>
<FORM_ELEMENT_TYPE>SE</FORM_ELEMENT_TYPE>
<FORM_ELEMENT_ID>FGL2_42010A02B0231EDC90D3F59FDC3D7D40</FORM_ELEMENT_ID>
</Item>
</Node>
<Node Name="QUICKVIEW" SimpleFormat="true"/>
<Node Name="STANDARD_ELEMENT" SimpleFormat="true">
<Item Index="000001" SimpleFormat="true">
<ID Final="5 ">FGL2_42010A02B0231EDC90D3F59FDC3D7D40</ID>
<NAME>KEY1</NAME>
<TYPE>IN</TYPE>
<EXPLANATION Transl="true"/>
<TEXT Transl="true"/>
<TOOLTIP Transl="true"/>
<INPUT_PROMPT Transl="true"/>
<INSTANCE_STYLE/>
<SPECIAL_PROPERTIES><?xml version="1.0" encoding="utf-16"?><asx:abap xmlns:asx="http://www.sap.com/abapxml" version="1.0"><asx:values><BN1><ACTION_MENU_ID/><ALIGNMENT>03</ALIGNMENT><ALT_DDIC_SHLP_NAME/><BORDER>0</BORDER><COL_COUNT>1</COL_COUNT><DDIC_SHLP_TEXT_FIELD_NAME/><DISPLAY_AS_TEXT/><ELEM_DDIC_SHLP_NAME/><ENFORCE_FIELD_MERGING/><HEIGHT/><HIDE_FORMATTING_OPTIONS/><HIDE_TEXT/><HIDE_VALUE/><HOTKEY>00</HOTKEY><IMAGE_SOURCE/><IMAGE_IS_DECORATIVE/><INPUT_HELP>00</INPUT_HELP><KEEP_ORIGINAL_SIZE/><KEY_VISIBLE/><LINK_DESIGN>00</LINK_DESIGN><LINK_TYPE>02</LINK_TYPE><MAX_RATING>5</MAX_RATING><MAX_TICK_MARKS>0</MAX_TICK_MARKS><MIME_TYPE/><NO_INPUT_HISTORY/><PASSWORD_FIELD/><QUICKVIEW_ID/><QUICKVIEW_IMAGE_REF/><ROW_COUNT>0</ROW_COUNT><SECTION_HEADER_DESIGN/><SECTION_HEADER_LEVEL>00</SECTION_HEADER_LEVEL><SEMANTIC_OBJECT/><SHOW_TICK_MARKS/><SUGGEST_FILTER_METHOD>00</SUGGEST_FILTER_METHOD><SUGGEST_HISTORY/><SUGGEST_VALUES>X</SUGGEST_VALUES><SUPPRESS_FIELD_MERGING/><TARGET/><TEXT_DOCUMENT_NAME/><TEXT_EDIT_DESIGN>09</TEXT_EDIT_DESIGN><TEXT_EDIT_HEIGHT_MODE>00</TEXT_EDIT_HEIGHT_MODE><TEXT_VIEW_DESIGN>09</TEXT_VIEW_DESIGN><TEXT_VIEW_LAYOUT>01</TEXT_VIEW_LAYOUT><TEXTVIEW_SEM_COL>00</TEXTVIEW_SEM_COL><TEXT_WRAPPING>02</TEXT_WRAPPING><THRESHOLDS/><TICK_MARK_SPACING>0</TICK_MARK_SPACING><TOKEN_FORMAT>00</TOKEN_FORMAT><UNIT_WIDTH>0</UNIT_WIDTH><VIRUS_SCAN_PROFILE/><WIDTH/><WRAPPING/></BN1></asx:values></asx:abap></SPECIAL_PROPERTIES>
<SPECIAL_ACTIONS><?xml version="1.0" encoding="utf-16"?><asx:abap xmlns:asx="http://www.sap.com/abapxml" version="1.0"><asx:values><BN1><ACTION_ID_ON_ACTION/><ACTION_ID_ON_CHANGE/><ACTION_ID_ON_DELETE/><ACTION_ID_ON_EDIT/><ACTION_ID_ON_ENTER>FGL2_42010A02B0231EDC90D65778FA89DD40</ACTION_ID_ON_ENTER><ACTION_ID_ON_RATE/><ACTION_ID_ON_SELECT/><ACTION_ID_ON_TOGGLE/></BN1></asx:values></asx:abap></SPECIAL_ACTIONS>
<LABEL_TEXT Transl="true"/>
<LABEL_VISIBILITY>02</LABEL_VISIBILITY>
<LABEL_INSTANCE_STYLE/>
<TAG_ACTIVE/>
<TAG/>
<CTXT_MENU_ID/>
</Item>
</Node>
</Item>
</Node>
</Item>
</Node>
</Component>
| 75.215385 | 1,973 | 0.71712 |
bc775f0441aed4d72436b9667f7b256be9efd5e5 | 2,362 | xml | XML | LYM_Android/activity_add_record.xml | BerangereB/PST_LYM | 22c980708499c1e2ec6bcf230f56174228be028b | [
"Apache-2.0"
] | null | null | null | LYM_Android/activity_add_record.xml | BerangereB/PST_LYM | 22c980708499c1e2ec6bcf230f56174228be028b | [
"Apache-2.0"
] | null | null | null | LYM_Android/activity_add_record.xml | BerangereB/PST_LYM | 22c980708499c1e2ec6bcf230f56174228be028b | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<android.support.constraint.ConstraintLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:app="http://schemas.android.com/apk/res-auto"
xmlns:tools="http://schemas.android.com/tools"
android:layout_width="match_parent"
android:layout_height="match_parent"
tools:context="fr.lym.addRecordActivity">
<android.support.design.widget.FloatingActionButton
android:id="@+id/launchRecorder"
android:layout_width="56dp"
android:layout_height="56dp"
android:layout_marginBottom="48dp"
android:clickable="true"
app:fabSize="normal"
app:backgroundTint="#f2f2f2"
app:layout_constraintBottom_toBottomOf="parent"
app:layout_constraintEnd_toEndOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:srcCompat="@drawable/record"
android:focusable="true" />
<android.support.design.widget.FloatingActionButton
android:id="@+id/deleteButton"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginBottom="48dp"
android:layout_marginLeft="100dp"
android:clickable="true"
app:backgroundTint="#999999"
app:fabSize="normal"
app:layout_constraintBottom_toBottomOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:srcCompat="@android:drawable/ic_menu_delete"
android:focusable="true"
android:layout_marginStart="100dp" />
<android.support.design.widget.FloatingActionButton
android:id="@+id/checkButton"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginBottom="48dp"
android:layout_marginRight="100dp"
android:clickable="true"
android:focusable="true"
app:fabSize="normal"
android:tint="@color/ic_launcher_background"
app:backgroundTint="@color/colorCheck"
app:layout_constraintBottom_toBottomOf="parent"
app:layout_constraintEnd_toEndOf="parent"
app:rippleColor="@android:color/background_light"
app:srcCompat="@drawable/checkmark"
android:layout_marginEnd="100dp" />
</android.support.constraint.ConstraintLayout>
| 42.178571 | 104 | 0.684589 |
1f4d8bb59fe80bb48ef70e361ba6e04eb622a2ea | 4,249 | csproj | XML | src/Foundation/PushNotifications/console/SF.Foundation.PushNotifications.ModelGenerator/SF.Foundation.PushNotifications.ModelGenerator.csproj | mtelligent/SitecoreWebPushNotifications | f791f69a35cc8d90db937ded1c82e6877e4a004a | [
"MIT"
] | 2 | 2020-08-16T15:23:52.000Z | 2021-04-15T13:15:21.000Z | src/Foundation/PushNotifications/console/SF.Foundation.PushNotifications.ModelGenerator/SF.Foundation.PushNotifications.ModelGenerator.csproj | mtelligent/SitecoreWebPushNotifications | f791f69a35cc8d90db937ded1c82e6877e4a004a | [
"MIT"
] | 2 | 2020-10-22T04:22:17.000Z | 2020-11-03T20:37:21.000Z | src/Foundation/PushNotifications/console/SF.Foundation.PushNotifications.ModelGenerator/SF.Foundation.PushNotifications.ModelGenerator.csproj | mtelligent/SitecoreWebPushNotifications | f791f69a35cc8d90db937ded1c82e6877e4a004a | [
"MIT"
] | 1 | 2020-10-23T03:55:16.000Z | 2020-10-23T03:55:16.000Z | <?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="15.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<Import Project="$(MSBuildExtensionsPath)\$(MSBuildToolsVersion)\Microsoft.Common.props" Condition="Exists('$(MSBuildExtensionsPath)\$(MSBuildToolsVersion)\Microsoft.Common.props')" />
<PropertyGroup>
<Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
<Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
<ProjectGuid>{42EEFABD-5A46-490F-B5F4-37158F7ACC21}</ProjectGuid>
<OutputType>Exe</OutputType>
<RootNamespace>SF.Foundation.PushNotifications.ModelGenerator</RootNamespace>
<AssemblyName>SF.Foundation.PushNotifications.ModelGenerator</AssemblyName>
<TargetFrameworkVersion>v4.8</TargetFrameworkVersion>
<FileAlignment>512</FileAlignment>
<AutoGenerateBindingRedirects>true</AutoGenerateBindingRedirects>
<Deterministic>true</Deterministic>
<TargetFrameworkProfile />
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
<PlatformTarget>AnyCPU</PlatformTarget>
<DebugSymbols>true</DebugSymbols>
<DebugType>full</DebugType>
<Optimize>false</Optimize>
<OutputPath>bin\Debug\</OutputPath>
<DefineConstants>DEBUG;TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
<PlatformTarget>AnyCPU</PlatformTarget>
<DebugType>pdbonly</DebugType>
<Optimize>true</Optimize>
<OutputPath>bin\Release\</OutputPath>
<DefineConstants>TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<ItemGroup>
<Reference Include="Newtonsoft.Json, Version=11.0.0.0, Culture=neutral, PublicKeyToken=30ad4fe6b2a6aeed, processorArchitecture=MSIL">
<HintPath>..\..\..\..\..\packages\Newtonsoft.Json.11.0.1\lib\net45\Newtonsoft.Json.dll</HintPath>
</Reference>
<Reference Include="Sitecore.XConnect, Version=5.0.0.0, Culture=neutral, processorArchitecture=MSIL">
<HintPath>..\..\..\..\..\packages\Sitecore.XConnect.10.0.0\lib\netstandard2.0\Sitecore.XConnect.dll</HintPath>
</Reference>
<Reference Include="Sitecore.XConnect.Core, Version=3.1.0.0, Culture=neutral, processorArchitecture=MSIL">
<HintPath>..\..\..\..\..\packages\Sitecore.XConnect.Core.10.0.0\lib\netstandard2.0\Sitecore.XConnect.Core.dll</HintPath>
</Reference>
<Reference Include="Sitecore.XConnect.Search, Version=2.3.0.0, Culture=neutral, processorArchitecture=MSIL">
<HintPath>..\..\..\..\..\packages\Sitecore.XConnect.Search.10.0.0\lib\netstandard2.0\Sitecore.XConnect.Search.dll</HintPath>
</Reference>
<Reference Include="System" />
<Reference Include="System.Core" />
<Reference Include="System.Xml.Linq" />
<Reference Include="System.Data.DataSetExtensions" />
<Reference Include="Microsoft.CSharp" />
<Reference Include="System.Data" />
<Reference Include="System.Net.Http" />
<Reference Include="System.Xml" />
</ItemGroup>
<ItemGroup>
<Compile Include="Program.cs" />
<Compile Include="Properties\AssemblyInfo.cs" />
</ItemGroup>
<ItemGroup>
<Content Include="PushNotification.sc.MarketingAutomation.ActivityType.xml" />
<Content Include="PushNotification.sc.MarketingAutomation.Services.xml" />
<Content Include="sc.MarketingAutomation.ContactLoader.xml" />
<Content Include="sc.PushNotifications.Model.xml" />
<None Include="App.config" />
<Content Include="Foundation.PushNotifications.config" />
<None Include="packages.config" />
<None Include="PushNotifications.Model.json" />
</ItemGroup>
<ItemGroup>
<ProjectReference Include="..\..\website\SF.Foundation.PushNotifications.csproj">
<Project>{fe697dbe-a672-4813-a221-7b42f423bf8a}</Project>
<Name>SF.Foundation.PushNotifications</Name>
</ProjectReference>
</ItemGroup>
<ItemGroup>
<Content Include="Readme.txt" />
<Content Include="sc.PushNotifications.Plugin.xml" />
</ItemGroup>
<Import Project="$(MSBuildToolsPath)\Microsoft.CSharp.targets" />
</Project> | 51.192771 | 186 | 0.721346 |
ce0f94c5d18f38d1ae19686a7811584891430cd8 | 305 | xml | XML | HcSK-HK/Mods/SeedsPlease_SK/Defs/ThingCategoryDefs/ThingCategories_Custom.xml | hunt3rkill3r/HcSK-HK | 449fa2c67144a6ff3583a528336aac38db3c44a7 | [
"Unlicense"
] | 2 | 2017-03-01T10:24:46.000Z | 2017-03-09T17:08:36.000Z | HcSK-HK/Mods/SeedsPlease_SK/Defs/ThingCategoryDefs/ThingCategories_Custom.xml | hunt3rkill3r/HcSK-HK | 449fa2c67144a6ff3583a528336aac38db3c44a7 | [
"Unlicense"
] | 1 | 2017-03-17T14:59:36.000Z | 2017-03-17T14:59:36.000Z | HcSK-HK/Mods/SeedsPlease_SK/Defs/ThingCategoryDefs/ThingCategories_Custom.xml | hunt3rkill3r/HcSK-HK | 449fa2c67144a6ff3583a528336aac38db3c44a7 | [
"Unlicense"
] | null | null | null | <?xml version="1.0" encoding="utf-8" ?>
<ThingCategoryDefs>
<ThingCategoryDef>
<defName>SeedsCategory</defName>
<label>Seeds</label>
<parent>PlantMatter</parent>
<iconPath>Ui/Icons/ThingCategories/PlantFoodRaw</iconPath>
</ThingCategoryDef>
</ThingCategoryDefs>
| 25.416667 | 66 | 0.672131 |
73e7870858d943454f472c5dbabdd2920345693f | 61,656 | xml | XML | data/TEI/mscodex1300_TEI.xml | leoba/VisColl | 40b895e308006197a586724cd46d0f5279e7b510 | [
"MIT"
] | 43 | 2015-04-13T17:56:54.000Z | 2019-12-23T00:56:36.000Z | data/TEI/mscodex1300_TEI.xml | leoba/VisColl | 40b895e308006197a586724cd46d0f5279e7b510 | [
"MIT"
] | 3 | 2021-07-20T13:12:47.000Z | 2022-02-22T14:27:30.000Z | data/TEI/mscodex1300_TEI.xml | leoba/VisColl | 40b895e308006197a586724cd46d0f5279e7b510 | [
"MIT"
] | 7 | 2015-06-04T00:24:01.000Z | 2019-12-05T01:11:13.000Z | <?xml version='1.0' encoding='UTF-8'?>
<TEI xmlns="http://www.tei-c.org/ns/1.0">
<teiHeader>
<fileDesc>
<titleStmt>
<title>Description of University of Pennsylvania Oversize Ms. Codex 1300: Ledger of accounts</title>
</titleStmt>
<publicationStmt>
<publisher>University of Pennsylvania</publisher>
<availability>
<licence target="http://creativecommons.org/publicdomain/mark/1.0/">These images and the content of Kislak Center for Special Collections, Rare Books and Manuscripts Oversize Ms. Codex 1300: Ledger of accounts are free of known copyright restrictions and in the public domain. See the Creative Commons Public Domain Mark page for usage details, http://creativecommons.org/publicdomain/mark/1.0/.</licence>
<licence target="https://creativecommons.org/licenses/by/4.0/legalcode">Metadata is © and licensed under a Creative Commons Attribution License version 4.0 (CC-BY-4.0 https://creativecommons.org/licenses/by/4.0/legalcode. For a description of the terms of use see the Creative Commons Deed https://creativecommons.org/licenses/by/4.0/.</licence>
</availability>
</publicationStmt>
<notesStmt>
<note>Ms. codex.</note>
<note>Title supplied by cataloger.</note>
<note>Forms part of: Gondi-Medici Business Records.</note>
</notesStmt>
<sourceDesc>
<msDesc>
<msIdentifier>
<settlement>3420 Walnut Street, Philadelphia, Pennsylvania 19104-6206.</settlement>
<institution>University of Pennsylvania</institution>
<repository>Kislak Center for Special Collections, Rare Books and Manuscripts</repository>
<idno type="call-number">Oversize Ms. Codex 1300</idno>
<altIdentifier type="bibid">
<idno>9944330023503681</idno>
</altIdentifier>
<altIdentifier type="oclc">
<idno>http://www.worldcat.org/oclc/297452845</idno>
</altIdentifier>
<altIdentifier type="resource">
<idno>http://hdl.library.upenn.edu/1017/d/medren/4433002</idno>
</altIdentifier>
</msIdentifier>
<msContents>
<summary>Ledger of accounts of Vincenzo de' Medici, son of Carlo de' Medici, for the years 1583-1592. Often includes the nature of a given transaction and its amount, as well as listing the names of the individuals that act as counterparts in the transaction. In certain cases the transactions are in kind (examples of the produce used for these payments are chestnuts, grains, cattle feed, cattle, swine) but cash transactions are not uncommon. In spite of the upper cover, which presents the word Possesione, this is not a property ledger, but rather a ledger of accounts regarding the Valdenievole estate, located between Florence and Pistoia. The counterparts in the transactions are often employees or tenants of Vincenzo de' Medici, and as such can pay in kind, or receive in kind payments. Other expenses are related to the management of the properties for the purchase of fertilizers and manure, or cattle, grains, feed and other produce.</summary>
<textLang mainLang="ita">Italian</textLang>
<msItem>
<title>Ledger of accounts</title>
</msItem>
</msContents>
<physDesc>
<objectDesc>
<supportDesc material="mixed">
<support>
<p>paper</p>
<watermark>Similar to Briquet, Fleur-de-lis 7105 (Rome, 1565), but with rounder petals.</watermark>
</support>
<extent>64 leaves : 331 x 233 mm. bound to 347 x 235 mm</extent>
<foliation>Paper, 64; rectos numbered [i], i-xxxxiii, [xxxxiiii-lxiii], contemporary pagination in ink, modern pagination in pencil, upper right recto; versos numbered 1-43, [44-64], upper left verso (leaves 44-64 are blank).</foliation>
</supportDesc>
<layoutDesc>
<layout>Written in 3 columns with vertical bounding lines in lead; the smaller column on the left with the transaction number or the year in which the transaction took place, the large central column with the transaction and a brief description of it, and the smaller one on the right with its amount in Arabic numerals. In certain cases the large central column contains itemized accounts of a transaction within one entry. In the occurrence of both a debt and a credit with a specific counterpart, credits are usually listed on the left page and debts on the right page of an opening, with the same individuals appearing as debtors or creditors on facing pages.</layout>
</layoutDesc>
</objectDesc>
<scriptDesc>
<scriptNote>Written in a cursive script, perhaps by multiple hands.</scriptNote>
</scriptDesc>
<bindingDesc>
<binding>
<p>Contemporary vellum, no. 98 on spine; the heading Giornale della poss[esio]ne di Valdenievole, and letter C with decorative penwork on upper cover; lower cover with remnants of leather ties wraps around upper cover; decorative leatherwork on spine.</p>
</binding>
</bindingDesc>
</physDesc>
<history>
<origin>
<p>Written in Italy between 1583 (p. 1) and 1592 (p. 42).</p>
<origDate>1583-1592</origDate>
<origPlace>Italy</origPlace>
</origin>
<provenance>Sold by Bernard M. Rosenthal, 1961.</provenance>
</history>
</msDesc>
</sourceDesc>
</fileDesc>
<encodingDesc>
<classDecl>
<taxonomy xml:id="keywords">
<category xml:id="keyword_1">
<catDesc>Book Type</catDesc>
<category xml:id="keyword_1.2">
<catDesc>Accounts</catDesc>
</category>
<category xml:id="keyword_1.3">
<catDesc>Antiphonary</catDesc>
</category>
<category xml:id="keyword_1.4">
<catDesc>Armorial</catDesc>
</category>
<category xml:id="keyword_1.5">
<catDesc>Bible</catDesc>
</category>
<category xml:id="keyword_1.6">
<catDesc>Biography</catDesc>
</category>
<category xml:id="keyword_1.7">
<catDesc>Book of Hours</catDesc>
</category>
<category xml:id="keyword_1.8">
<catDesc>Breviary</catDesc>
</category>
<category xml:id="keyword_1.9">
<catDesc>Chronicle</catDesc>
</category>
<category xml:id="keyword_1.10">
<catDesc>Collection of Sermons</catDesc>
</category>
<category xml:id="keyword_1.11">
<catDesc>Commentary</catDesc>
</category>
<category xml:id="keyword_1.12">
<catDesc>Dictionary</catDesc>
</category>
<category xml:id="keyword_1.13">
<catDesc>Document</catDesc>
</category>
<category xml:id="keyword_1.14">
<catDesc>Dogale</catDesc>
</category>
<category xml:id="keyword_1.15">
<catDesc>Friendship book</catDesc>
</category>
<category xml:id="keyword_1.16">
<catDesc>Genealogy</catDesc>
</category>
<category xml:id="keyword_1.17">
<catDesc>Glossary</catDesc>
</category>
<category xml:id="keyword_1.18">
<catDesc>Gospel Lectionary</catDesc>
</category>
<category xml:id="keyword_1.19">
<catDesc>Gospels</catDesc>
</category>
<category xml:id="keyword_1.20">
<catDesc>Gradual</catDesc>
</category>
<category xml:id="keyword_1.22">
<catDesc>Haggadah</catDesc>
</category>
<category xml:id="keyword_1.23">
<catDesc>Homilary</catDesc>
</category>
<category xml:id="keyword_1.24">
<catDesc>Horologion</catDesc>
</category>
<category xml:id="keyword_1.25">
<catDesc>Hymnal</catDesc>
</category>
<category xml:id="keyword_1.26">
<catDesc>Koran</catDesc>
</category>
<category xml:id="keyword_1.27">
<catDesc>Lectionary</catDesc>
</category>
<category xml:id="keyword_1.28">
<catDesc>Mass book</catDesc>
</category>
<category xml:id="keyword_1.29">
<catDesc>Miscellany</catDesc>
</category>
<category xml:id="keyword_1.30">
<catDesc>Missal</catDesc>
</category>
<category xml:id="keyword_1.31">
<catDesc>Pontifical</catDesc>
</category>
<category xml:id="keyword_1.32">
<catDesc>Portolan chart</catDesc>
</category>
<category xml:id="keyword_1.33">
<catDesc>Prayer book</catDesc>
</category>
<category xml:id="keyword_1.34">
<catDesc>Private devotional text</catDesc>
</category>
<category xml:id="keyword_1.35">
<catDesc>Processional</catDesc>
</category>
<category xml:id="keyword_1.36">
<catDesc>Protective scroll</catDesc>
</category>
<category xml:id="keyword_1.37">
<catDesc>Psalter</catDesc>
</category>
<category xml:id="keyword_1.38">
<catDesc>Psalter-Hours</catDesc>
</category>
<category xml:id="keyword_1.39">
<catDesc>Qur`an</catDesc>
</category>
<category xml:id="keyword_1.40">
<catDesc>Recipe book</catDesc>
</category>
<category xml:id="keyword_1.41">
<catDesc>Saint's Life</catDesc>
</category>
<category xml:id="keyword_1.42">
<catDesc>Scribal manual</catDesc>
</category>
<category xml:id="keyword_1.43">
<catDesc>Song book</catDesc>
</category>
<category xml:id="keyword_1.44">
<catDesc>Torah</catDesc>
</category>
<category xml:id="keyword_1.45">
<catDesc>Treatise</catDesc>
</category>
</category>
<category xml:id="keyword_2">
<catDesc>Century</catDesc>
<category xml:id="keyword_2.2">
<catDesc>6th century</catDesc>
</category>
<category xml:id="keyword_2.3">
<catDesc>7th century</catDesc>
</category>
<category xml:id="keyword_2.4">
<catDesc>8th century</catDesc>
</category>
<category xml:id="keyword_2.5">
<catDesc>9th century</catDesc>
</category>
<category xml:id="keyword_2.6">
<catDesc>10th century</catDesc>
</category>
<category xml:id="keyword_2.7">
<catDesc>11th century</catDesc>
</category>
<category xml:id="keyword_2.8">
<catDesc>12th century</catDesc>
</category>
<category xml:id="keyword_2.9">
<catDesc>13th century</catDesc>
</category>
<category xml:id="keyword_2.10">
<catDesc>14th century</catDesc>
</category>
<category xml:id="keyword_2.11">
<catDesc>15th century</catDesc>
</category>
<category xml:id="keyword_2.12">
<catDesc>16th century</catDesc>
</category>
<category xml:id="keyword_2.13">
<catDesc>17th century</catDesc>
</category>
<category xml:id="keyword_2.14">
<catDesc>18th century</catDesc>
</category>
<category xml:id="keyword_2.15">
<catDesc>19th century</catDesc>
</category>
<category xml:id="keyword_2.16">
<catDesc>20th century</catDesc>
</category>
</category>
<category xml:id="keyword_3">
<catDesc>Culture</catDesc>
<category xml:id="keyword_3.2">
<catDesc>Abbasid</catDesc>
</category>
<category xml:id="keyword_3.3">
<catDesc>Arabic</catDesc>
</category>
<category xml:id="keyword_3.4">
<catDesc>Armenian</catDesc>
</category>
<category xml:id="keyword_3.5">
<catDesc>Ashkenazi</catDesc>
</category>
<category xml:id="keyword_3.6">
<catDesc>Austrian</catDesc>
</category>
<category xml:id="keyword_3.7">
<catDesc>Byzantine</catDesc>
</category>
<category xml:id="keyword_3.8">
<catDesc>Carolingian</catDesc>
</category>
<category xml:id="keyword_3.9">
<catDesc>Chinese</catDesc>
</category>
<category xml:id="keyword_3.10">
<catDesc>Christian</catDesc>
</category>
<category xml:id="keyword_3.11">
<catDesc>Coptic</catDesc>
</category>
<category xml:id="keyword_3.12">
<catDesc>Dutch</catDesc>
</category>
<category xml:id="keyword_3.13">
<catDesc>Egyptian</catDesc>
</category>
<category xml:id="keyword_3.14">
<catDesc>English</catDesc>
</category>
<category xml:id="keyword_3.15">
<catDesc>Ethiopian</catDesc>
</category>
<category xml:id="keyword_3.16">
<catDesc>Fatimid</catDesc>
</category>
<category xml:id="keyword_3.17">
<catDesc>Flemish</catDesc>
</category>
<category xml:id="keyword_3.18">
<catDesc>French</catDesc>
</category>
<category xml:id="keyword_3.19">
<catDesc>German</catDesc>
</category>
<category xml:id="keyword_3.20">
<catDesc>Indian</catDesc>
</category>
<category xml:id="keyword_3.21">
<catDesc>Islamic</catDesc>
</category>
<category xml:id="keyword_3.22">
<catDesc>Italian</catDesc>
</category>
<category xml:id="keyword_3.23">
<catDesc>Jewish</catDesc>
</category>
<category xml:id="keyword_3.25">
<catDesc>Mamluk</catDesc>
</category>
<category xml:id="keyword_3.26">
<catDesc>Mughal</catDesc>
</category>
<category xml:id="keyword_3.27">
<catDesc>Ottoman</catDesc>
</category>
<category xml:id="keyword_3.28">
<catDesc>Ottonian</catDesc>
</category>
<category xml:id="keyword_3.29">
<catDesc>Persian</catDesc>
</category>
<category xml:id="keyword_3.30">
<catDesc>Portuguese</catDesc>
</category>
<category xml:id="keyword_3.31">
<catDesc>Qajar</catDesc>
</category>
<category xml:id="keyword_3.32">
<catDesc>Rajput</catDesc>
</category>
<category xml:id="keyword_3.33">
<catDesc>Russian</catDesc>
</category>
<category xml:id="keyword_3.34">
<catDesc>Safavid</catDesc>
</category>
<category xml:id="keyword_3.35">
<catDesc>Sephardi</catDesc>
</category>
<category xml:id="keyword_3.36">
<catDesc>Spanish</catDesc>
</category>
<category xml:id="keyword_3.37">
<catDesc>Timurid</catDesc>
</category>
<category xml:id="keyword_3.38">
<catDesc>Turkish</catDesc>
</category>
<category xml:id="keyword_3.39">
<catDesc>Yemenite</catDesc>
</category>
</category>
<category xml:id="keyword_4">
<catDesc>Descriptive term</catDesc>
<category xml:id="keyword_4.2">
<catDesc>Accordion book</catDesc>
</category>
<category xml:id="keyword_4.3">
<catDesc>Album</catDesc>
</category>
<category xml:id="keyword_4.4">
<catDesc>Annotated</catDesc>
</category>
<category xml:id="keyword_4.5">
<catDesc>Binding</catDesc>
</category>
<category xml:id="keyword_4.6">
<catDesc>Calligraphy</catDesc>
</category>
<category xml:id="keyword_4.7">
<catDesc>Caroline minuscule</catDesc>
</category>
<category xml:id="keyword_4.8">
<catDesc>Chart</catDesc>
</category>
<category xml:id="keyword_4.9">
<catDesc>Charter</catDesc>
</category>
<category xml:id="keyword_4.10">
<catDesc>Colophon</catDesc>
</category>
<category xml:id="keyword_4.11">
<catDesc>Damage</catDesc>
</category>
<category xml:id="keyword_4.12">
<catDesc>Diagrams</catDesc>
</category>
<category xml:id="keyword_4.13">
<catDesc>Drawing</catDesc>
</category>
<category xml:id="keyword_4.14">
<catDesc>Early Abbasid script</catDesc>
</category>
<category xml:id="keyword_4.15">
<catDesc>Fragment</catDesc>
</category>
<category xml:id="keyword_4.16">
<catDesc>Gloss</catDesc>
</category>
<category xml:id="keyword_4.17">
<catDesc>Gothic</catDesc>
</category>
<category xml:id="keyword_4.18">
<catDesc>Gothic book hand</catDesc>
</category>
<category xml:id="keyword_4.19">
<catDesc>Grisaille</catDesc>
</category>
<category xml:id="keyword_4.20">
<catDesc>Grotesques</catDesc>
</category>
<category xml:id="keyword_4.21">
<catDesc>Headpiece</catDesc>
</category>
<category xml:id="keyword_4.22">
<catDesc>Heraldry</catDesc>
</category>
<category xml:id="keyword_4.23">
<catDesc>Historiated initial</catDesc>
</category>
<category xml:id="keyword_4.24">
<catDesc>Humanistic</catDesc>
</category>
<category xml:id="keyword_4.25">
<catDesc>Illumination</catDesc>
</category>
<category xml:id="keyword_4.26">
<catDesc>Illustration</catDesc>
</category>
<category xml:id="keyword_4.27">
<catDesc>Inhabited initial</catDesc>
</category>
<category xml:id="keyword_4.28">
<catDesc>Kufic</catDesc>
</category>
<category xml:id="keyword_4.29">
<catDesc>Manicules</catDesc>
</category>
<category xml:id="keyword_4.30">
<catDesc>Medallion</catDesc>
</category>
<category xml:id="keyword_4.31">
<catDesc>Micrography</catDesc>
</category>
<category xml:id="keyword_4.32">
<catDesc>Miniature</catDesc>
</category>
<category xml:id="keyword_4.33">
<catDesc>Missing leaves</catDesc>
</category>
<category xml:id="keyword_4.34">
<catDesc>Musical notation</catDesc>
</category>
<category xml:id="keyword_4.35">
<catDesc>New Abbasid style</catDesc>
</category>
<category xml:id="keyword_4.36">
<catDesc>Notable binding</catDesc>
</category>
<category xml:id="keyword_4.37">
<catDesc>Original binding</catDesc>
</category>
<category xml:id="keyword_4.38">
<catDesc>Ornament</catDesc>
</category>
<category xml:id="keyword_4.39">
<catDesc>Painting</catDesc>
</category>
<category xml:id="keyword_4.40">
<catDesc>Palimpsest</catDesc>
</category>
<category xml:id="keyword_4.41">
<catDesc>Paper</catDesc>
</category>
<category xml:id="keyword_4.42">
<catDesc>Penwork initial</catDesc>
</category>
<category xml:id="keyword_4.43">
<catDesc>Puzzle initial</catDesc>
</category>
<category xml:id="keyword_4.44">
<catDesc>Ragini</catDesc>
</category>
<category xml:id="keyword_4.45">
<catDesc>Romanesque</catDesc>
</category>
<category xml:id="keyword_4.46">
<catDesc>Scrapbook</catDesc>
</category>
<category xml:id="keyword_4.47">
<catDesc>Scroll</catDesc>
</category>
<category xml:id="keyword_4.48">
<catDesc>Scroll-work initial</catDesc>
</category>
<category xml:id="keyword_4.49">
<catDesc>Seals</catDesc>
</category>
<category xml:id="keyword_4.50">
<catDesc>Tables</catDesc>
</category>
<category xml:id="keyword_4.51">
<catDesc>Textura</catDesc>
</category>
<category xml:id="keyword_4.52">
<catDesc>Treasure binding</catDesc>
</category>
<category xml:id="keyword_4.53">
<catDesc>Watermark</catDesc>
</category>
<category xml:id="keyword_4.54">
<catDesc>White-vine lettering</catDesc>
</category>
<category xml:id="keyword_4.55">
<catDesc>Woodcuts</catDesc>
</category>
</category>
<category xml:id="keyword_5">
<catDesc>Geography</catDesc>
<category xml:id="keyword_5.2">
<catDesc>Afghanistan</catDesc>
</category>
<category xml:id="keyword_5.3">
<catDesc>Armenia</catDesc>
</category>
<category xml:id="keyword_5.4">
<catDesc>Austria</catDesc>
</category>
<category xml:id="keyword_5.5">
<catDesc>Belgium</catDesc>
</category>
<category xml:id="keyword_5.6">
<catDesc>Central Arab lands (Near East)</catDesc>
</category>
<category xml:id="keyword_5.7">
<catDesc>Central Asia</catDesc>
</category>
<category xml:id="keyword_5.8">
<catDesc>China</catDesc>
</category>
<category xml:id="keyword_5.9">
<catDesc>Egypt</catDesc>
</category>
<category xml:id="keyword_5.10">
<catDesc>England</catDesc>
</category>
<category xml:id="keyword_5.11">
<catDesc>Ethiopia</catDesc>
</category>
<category xml:id="keyword_5.12">
<catDesc>Flanders</catDesc>
</category>
<category xml:id="keyword_5.13">
<catDesc>France</catDesc>
</category>
<category xml:id="keyword_5.14">
<catDesc>Germany</catDesc>
</category>
<category xml:id="keyword_5.15">
<catDesc>Greece</catDesc>
</category>
<category xml:id="keyword_5.16">
<catDesc>India</catDesc>
</category>
<category xml:id="keyword_5.17">
<catDesc>Iran</catDesc>
</category>
<category xml:id="keyword_5.18">
<catDesc>Iraq</catDesc>
</category>
<category xml:id="keyword_5.19">
<catDesc>Israel</catDesc>
</category>
<category xml:id="keyword_5.20">
<catDesc>Italy</catDesc>
</category>
<category xml:id="keyword_5.21">
<catDesc>Maghreb</catDesc>
</category>
<category xml:id="keyword_5.22">
<catDesc>Morocco</catDesc>
</category>
<category xml:id="keyword_5.23">
<catDesc>Netherlands</catDesc>
</category>
<category xml:id="keyword_5.24">
<catDesc>Pakistan</catDesc>
</category>
<category xml:id="keyword_5.25">
<catDesc>Portugal</catDesc>
</category>
<category xml:id="keyword_5.26">
<catDesc>Romania</catDesc>
</category>
<category xml:id="keyword_5.27">
<catDesc>Russia</catDesc>
</category>
<category xml:id="keyword_5.28">
<catDesc>Spain</catDesc>
</category>
<category xml:id="keyword_5.29">
<catDesc>Sub-Saharan (West) Africa</catDesc>
</category>
<category xml:id="keyword_5.30">
<catDesc>Turkey</catDesc>
</category>
<category xml:id="keyword_5.31">
<catDesc>Wales</catDesc>
</category>
<category xml:id="keyword_5.32">
<catDesc>Yemen</catDesc>
</category>
</category>
<category xml:id="keyword_6">
<catDesc>Other</catDesc>
<category xml:id="keyword_6.2">
<catDesc>Alchemy</catDesc>
</category>
<category xml:id="keyword_6.3">
<catDesc>Allegory</catDesc>
</category>
<category xml:id="keyword_6.4">
<catDesc>Astrology</catDesc>
</category>
<category xml:id="keyword_6.5">
<catDesc>Astronomy</catDesc>
</category>
<category xml:id="keyword_6.6">
<catDesc>Biblical</catDesc>
</category>
<category xml:id="keyword_6.7">
<catDesc>Binding waste</catDesc>
</category>
<category xml:id="keyword_6.8">
<catDesc>Cartography</catDesc>
</category>
<category xml:id="keyword_6.9">
<catDesc>Church Fathers</catDesc>
</category>
<category xml:id="keyword_6.10">
<catDesc>Cosmology</catDesc>
</category>
<category xml:id="keyword_6.11">
<catDesc>Devotion</catDesc>
</category>
<category xml:id="keyword_6.12">
<catDesc>Financial records</catDesc>
</category>
<category xml:id="keyword_6.13">
<catDesc>Fortune-telling</catDesc>
</category>
<category xml:id="keyword_6.14">
<catDesc>Friendship</catDesc>
</category>
<category xml:id="keyword_6.15">
<catDesc>Games</catDesc>
</category>
<category xml:id="keyword_6.16">
<catDesc>Geography</catDesc>
</category>
<category xml:id="keyword_6.17">
<catDesc>Geomancy</catDesc>
</category>
<category xml:id="keyword_6.18">
<catDesc>Grammar</catDesc>
</category>
<category xml:id="keyword_6.19">
<catDesc>History</catDesc>
</category>
<category xml:id="keyword_6.20">
<catDesc>Kabbalah</catDesc>
</category>
<category xml:id="keyword_6.21">
<catDesc>Legal</catDesc>
</category>
<category xml:id="keyword_6.22">
<catDesc>Literature -- Poetry</catDesc>
</category>
<category xml:id="keyword_6.23">
<catDesc>Literature -- Prose</catDesc>
</category>
<category xml:id="keyword_6.24">
<catDesc>Liturgy</catDesc>
</category>
<category xml:id="keyword_6.25">
<catDesc>Logic</catDesc>
</category>
<category xml:id="keyword_6.26">
<catDesc>Magic</catDesc>
</category>
<category xml:id="keyword_6.27">
<catDesc>Maritime</catDesc>
</category>
<category xml:id="keyword_6.28">
<catDesc>Mathematics</catDesc>
</category>
<category xml:id="keyword_6.29">
<catDesc>Mineralogy</catDesc>
</category>
<category xml:id="keyword_6.30">
<catDesc>Philosophy</catDesc>
</category>
<category xml:id="keyword_6.31">
<catDesc>Piyutim</catDesc>
</category>
<category xml:id="keyword_6.32">
<catDesc>Responsa</catDesc>
</category>
<category xml:id="keyword_6.33">
<catDesc>Science</catDesc>
</category>
<category xml:id="keyword_6.34">
<catDesc>Science -- Medicine</catDesc>
</category>
<category xml:id="keyword_6.35">
<catDesc>Scripture</catDesc>
</category>
<category xml:id="keyword_6.36">
<catDesc>Sufism</catDesc>
</category>
<category xml:id="keyword_6.37">
<catDesc>Theology</catDesc>
</category>
</category>
<category xml:id="keyword_7">
<catDesc/>
<category xml:id="keyword_7.1">
<catDesc> </catDesc>
</category>
</category>
</taxonomy>
</classDecl>
</encodingDesc>
<profileDesc>
<textClass>
<keywords n="subjects">
<term>Accounting--Italy--16th century</term>
</keywords>
<keywords n="form/genre">
<term>Codices</term>
<term>Accounts</term>
<term>Credit records</term>
<term>Ledgers (account books)</term>
<term>Manuscripts, Italian--16th century</term>
<term>Manuscripts, Renaissance</term>
</keywords>
<keywords n="keywords">
<term>16th century</term>
<term>Italian</term>
<term>Italy</term>
<term>Accounts</term>
<term>Financial records</term>
<term>Paper</term>
</keywords>
</textClass>
</profileDesc>
</teiHeader>
<facsimile>
<surface n="Front cover" xml:id="surface-oversize-ms-codex-1300-1">
<graphic height="6064px" url="master/1176_0000.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0000_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0000_web.jpg" width="1286px"/>
</surface>
<surface n="Inside front cover" xml:id="surface-oversize-ms-codex-1300-2">
<graphic height="6064px" url="master/1176_0001.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0001_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0001_web.jpg" width="1286px"/>
</surface>
<surface n="1r" xml:id="surface-oversize-ms-codex-1300-3">
<graphic height="6064px" url="master/1176_0002.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0002_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0002_web.jpg" width="1286px"/>
</surface>
<surface n="1v" xml:id="surface-oversize-ms-codex-1300-4">
<graphic height="6064px" url="master/1176_0003.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0003_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0003_web.jpg" width="1286px"/>
</surface>
<surface n="2r" xml:id="surface-oversize-ms-codex-1300-5">
<graphic height="6064px" url="master/1176_0004.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0004_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0004_web.jpg" width="1286px"/>
</surface>
<surface n="2v" xml:id="surface-oversize-ms-codex-1300-6">
<graphic height="6064px" url="master/1176_0005.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0005_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0005_web.jpg" width="1286px"/>
</surface>
<surface n="3r" xml:id="surface-oversize-ms-codex-1300-7">
<graphic height="6064px" url="master/1176_0006.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0006_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0006_web.jpg" width="1286px"/>
</surface>
<surface n="3v" xml:id="surface-oversize-ms-codex-1300-8">
<graphic height="6064px" url="master/1176_0007.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0007_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0007_web.jpg" width="1286px"/>
</surface>
<surface n="4r" xml:id="surface-oversize-ms-codex-1300-9">
<graphic height="6064px" url="master/1176_0008.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0008_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0008_web.jpg" width="1286px"/>
</surface>
<surface n="4v" xml:id="surface-oversize-ms-codex-1300-10">
<graphic height="6064px" url="master/1176_0009.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0009_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0009_web.jpg" width="1286px"/>
</surface>
<surface n="5r" xml:id="surface-oversize-ms-codex-1300-11">
<graphic height="6064px" url="master/1176_0010.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0010_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0010_web.jpg" width="1286px"/>
</surface>
<surface n="5v" xml:id="surface-oversize-ms-codex-1300-12">
<graphic height="6064px" url="master/1176_0011.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0011_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0011_web.jpg" width="1286px"/>
</surface>
<surface n="6r" xml:id="surface-oversize-ms-codex-1300-13">
<graphic height="6064px" url="master/1176_0012.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0012_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0012_web.jpg" width="1286px"/>
</surface>
<surface n="6v" xml:id="surface-oversize-ms-codex-1300-14">
<graphic height="6064px" url="master/1176_0013.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0013_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0013_web.jpg" width="1286px"/>
</surface>
<surface n="7r" xml:id="surface-oversize-ms-codex-1300-15">
<graphic height="6064px" url="master/1176_0014.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0014_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0014_web.jpg" width="1286px"/>
</surface>
<surface n="7v" xml:id="surface-oversize-ms-codex-1300-16">
<graphic height="6064px" url="master/1176_0015.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0015_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0015_web.jpg" width="1286px"/>
</surface>
<surface n="8r" xml:id="surface-oversize-ms-codex-1300-17">
<graphic height="6064px" url="master/1176_0016.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0016_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0016_web.jpg" width="1286px"/>
</surface>
<surface n="8v" xml:id="surface-oversize-ms-codex-1300-18">
<graphic height="6064px" url="master/1176_0017.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0017_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0017_web.jpg" width="1286px"/>
</surface>
<surface n="9r" xml:id="surface-oversize-ms-codex-1300-19">
<graphic height="6064px" url="master/1176_0018.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0018_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0018_web.jpg" width="1286px"/>
</surface>
<surface n="9v" xml:id="surface-oversize-ms-codex-1300-20">
<graphic height="6064px" url="master/1176_0019.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0019_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0019_web.jpg" width="1286px"/>
</surface>
<surface n="10r" xml:id="surface-oversize-ms-codex-1300-21">
<graphic height="6064px" url="master/1176_0020.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0020_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0020_web.jpg" width="1286px"/>
</surface>
<surface n="10v" xml:id="surface-oversize-ms-codex-1300-22">
<graphic height="6064px" url="master/1176_0021.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0021_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0021_web.jpg" width="1286px"/>
</surface>
<surface n="11r" xml:id="surface-oversize-ms-codex-1300-23">
<graphic height="6064px" url="master/1176_0022.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0022_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0022_web.jpg" width="1286px"/>
</surface>
<surface n="11v" xml:id="surface-oversize-ms-codex-1300-24">
<graphic height="6064px" url="master/1176_0023.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0023_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0023_web.jpg" width="1286px"/>
</surface>
<surface n="12r" xml:id="surface-oversize-ms-codex-1300-25">
<graphic height="6064px" url="master/1176_0024.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0024_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0024_web.jpg" width="1286px"/>
</surface>
<surface n="12v" xml:id="surface-oversize-ms-codex-1300-26">
<graphic height="6064px" url="master/1176_0025.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0025_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0025_web.jpg" width="1286px"/>
</surface>
<surface n="13r" xml:id="surface-oversize-ms-codex-1300-27">
<graphic height="6064px" url="master/1176_0026.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0026_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0026_web.jpg" width="1286px"/>
</surface>
<surface n="13v" xml:id="surface-oversize-ms-codex-1300-28">
<graphic height="6064px" url="master/1176_0027.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0027_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0027_web.jpg" width="1286px"/>
</surface>
<surface n="14r" xml:id="surface-oversize-ms-codex-1300-29">
<graphic height="6064px" url="master/1176_0028.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0028_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0028_web.jpg" width="1286px"/>
</surface>
<surface n="14v" xml:id="surface-oversize-ms-codex-1300-30">
<graphic height="6064px" url="master/1176_0029.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0029_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0029_web.jpg" width="1286px"/>
</surface>
<surface n="15r" xml:id="surface-oversize-ms-codex-1300-31">
<graphic height="6064px" url="master/1176_0030.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0030_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0030_web.jpg" width="1286px"/>
</surface>
<surface n="15v" xml:id="surface-oversize-ms-codex-1300-32">
<graphic height="6064px" url="master/1176_0031.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0031_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0031_web.jpg" width="1286px"/>
</surface>
<surface n="16r" xml:id="surface-oversize-ms-codex-1300-33">
<graphic height="6064px" url="master/1176_0032.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0032_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0032_web.jpg" width="1286px"/>
</surface>
<surface n="16v" xml:id="surface-oversize-ms-codex-1300-34">
<graphic height="6064px" url="master/1176_0033.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0033_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0033_web.jpg" width="1286px"/>
</surface>
<surface n="17r" xml:id="surface-oversize-ms-codex-1300-35">
<graphic height="6064px" url="master/1176_0034.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0034_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0034_web.jpg" width="1286px"/>
</surface>
<surface n="17v" xml:id="surface-oversize-ms-codex-1300-36">
<graphic height="6064px" url="master/1176_0035.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0035_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0035_web.jpg" width="1286px"/>
</surface>
<surface n="18r" xml:id="surface-oversize-ms-codex-1300-37">
<graphic height="6064px" url="master/1176_0036.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0036_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0036_web.jpg" width="1286px"/>
</surface>
<surface n="18v" xml:id="surface-oversize-ms-codex-1300-38">
<graphic height="6064px" url="master/1176_0037.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0037_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0037_web.jpg" width="1286px"/>
</surface>
<surface n="19r" xml:id="surface-oversize-ms-codex-1300-39">
<graphic height="6064px" url="master/1176_0038.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0038_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0038_web.jpg" width="1286px"/>
</surface>
<surface n="19v" xml:id="surface-oversize-ms-codex-1300-40">
<graphic height="6064px" url="master/1176_0039.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0039_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0039_web.jpg" width="1286px"/>
</surface>
<surface n="20r" xml:id="surface-oversize-ms-codex-1300-41">
<graphic height="6064px" url="master/1176_0040.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0040_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0040_web.jpg" width="1286px"/>
</surface>
<surface n="20v" xml:id="surface-oversize-ms-codex-1300-42">
<graphic height="6064px" url="master/1176_0041.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0041_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0041_web.jpg" width="1286px"/>
</surface>
<surface n="21r" xml:id="surface-oversize-ms-codex-1300-43">
<graphic height="6064px" url="master/1176_0042.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0042_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0042_web.jpg" width="1286px"/>
</surface>
<surface n="21v" xml:id="surface-oversize-ms-codex-1300-44">
<graphic height="6064px" url="master/1176_0043.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0043_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0043_web.jpg" width="1286px"/>
</surface>
<surface n="22r" xml:id="surface-oversize-ms-codex-1300-45">
<graphic height="6064px" url="master/1176_0044.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0044_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0044_web.jpg" width="1286px"/>
</surface>
<surface n="22v" xml:id="surface-oversize-ms-codex-1300-46">
<graphic height="6064px" url="master/1176_0045.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0045_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0045_web.jpg" width="1286px"/>
</surface>
<surface n="23r" xml:id="surface-oversize-ms-codex-1300-47">
<graphic height="6064px" url="master/1176_0046.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0046_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0046_web.jpg" width="1286px"/>
</surface>
<surface n="23v" xml:id="surface-oversize-ms-codex-1300-48">
<graphic height="6064px" url="master/1176_0047.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0047_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0047_web.jpg" width="1286px"/>
</surface>
<surface n="24r" xml:id="surface-oversize-ms-codex-1300-49">
<graphic height="6064px" url="master/1176_0048.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0048_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0048_web.jpg" width="1286px"/>
</surface>
<surface n="24v" xml:id="surface-oversize-ms-codex-1300-50">
<graphic height="6064px" url="master/1176_0049.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0049_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0049_web.jpg" width="1286px"/>
</surface>
<surface n="25r" xml:id="surface-oversize-ms-codex-1300-51">
<graphic height="6064px" url="master/1176_0050.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0050_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0050_web.jpg" width="1286px"/>
</surface>
<surface n="25v" xml:id="surface-oversize-ms-codex-1300-52">
<graphic height="6064px" url="master/1176_0051.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0051_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0051_web.jpg" width="1286px"/>
</surface>
<surface n="26r" xml:id="surface-oversize-ms-codex-1300-53">
<graphic height="6064px" url="master/1176_0052.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0052_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0052_web.jpg" width="1286px"/>
</surface>
<surface n="26v" xml:id="surface-oversize-ms-codex-1300-54">
<graphic height="6064px" url="master/1176_0053.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0053_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0053_web.jpg" width="1286px"/>
</surface>
<surface n="27r" xml:id="surface-oversize-ms-codex-1300-55">
<graphic height="6064px" url="master/1176_0054.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0054_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0054_web.jpg" width="1286px"/>
</surface>
<surface n="27v" xml:id="surface-oversize-ms-codex-1300-56">
<graphic height="6064px" url="master/1176_0055.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0055_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0055_web.jpg" width="1286px"/>
</surface>
<surface n="28r" xml:id="surface-oversize-ms-codex-1300-57">
<graphic height="6064px" url="master/1176_0056.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0056_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0056_web.jpg" width="1286px"/>
</surface>
<surface n="28v" xml:id="surface-oversize-ms-codex-1300-58">
<graphic height="6064px" url="master/1176_0057.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0057_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0057_web.jpg" width="1286px"/>
</surface>
<surface n="29r" xml:id="surface-oversize-ms-codex-1300-59">
<graphic height="6064px" url="master/1176_0058.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0058_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0058_web.jpg" width="1286px"/>
</surface>
<surface n="29v" xml:id="surface-oversize-ms-codex-1300-60">
<graphic height="6064px" url="master/1176_0059.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0059_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0059_web.jpg" width="1286px"/>
</surface>
<surface n="30r" xml:id="surface-oversize-ms-codex-1300-61">
<graphic height="6064px" url="master/1176_0060.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0060_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0060_web.jpg" width="1286px"/>
</surface>
<surface n="30v" xml:id="surface-oversize-ms-codex-1300-62">
<graphic height="6064px" url="master/1176_0061.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0061_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0061_web.jpg" width="1286px"/>
</surface>
<surface n="31r" xml:id="surface-oversize-ms-codex-1300-63">
<graphic height="6064px" url="master/1176_0062.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0062_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0062_web.jpg" width="1286px"/>
</surface>
<surface n="31v" xml:id="surface-oversize-ms-codex-1300-64">
<graphic height="6064px" url="master/1176_0063.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0063_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0063_web.jpg" width="1286px"/>
</surface>
<surface n="32r" xml:id="surface-oversize-ms-codex-1300-65">
<graphic height="6064px" url="master/1176_0064.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0064_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0064_web.jpg" width="1286px"/>
</surface>
<surface n="32v" xml:id="surface-oversize-ms-codex-1300-66">
<graphic height="6064px" url="master/1176_0065.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0065_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0065_web.jpg" width="1286px"/>
</surface>
<surface n="33r" xml:id="surface-oversize-ms-codex-1300-67">
<graphic height="6064px" url="master/1176_0066.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0066_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0066_web.jpg" width="1286px"/>
</surface>
<surface n="33v" xml:id="surface-oversize-ms-codex-1300-68">
<graphic height="6064px" url="master/1176_0067.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0067_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0067_web.jpg" width="1286px"/>
</surface>
<surface n="34r" xml:id="surface-oversize-ms-codex-1300-69">
<graphic height="6064px" url="master/1176_0068.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0068_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0068_web.jpg" width="1286px"/>
</surface>
<surface n="34v" xml:id="surface-oversize-ms-codex-1300-70">
<graphic height="6064px" url="master/1176_0069.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0069_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0069_web.jpg" width="1286px"/>
</surface>
<surface n="35r" xml:id="surface-oversize-ms-codex-1300-71">
<graphic height="6064px" url="master/1176_0070.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0070_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0070_web.jpg" width="1286px"/>
</surface>
<surface n="35v" xml:id="surface-oversize-ms-codex-1300-72">
<graphic height="6064px" url="master/1176_0071.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0071_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0071_web.jpg" width="1286px"/>
</surface>
<surface n="36r" xml:id="surface-oversize-ms-codex-1300-73">
<graphic height="6064px" url="master/1176_0072.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0072_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0072_web.jpg" width="1286px"/>
</surface>
<surface n="36v" xml:id="surface-oversize-ms-codex-1300-74">
<graphic height="6064px" url="master/1176_0073.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0073_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0073_web.jpg" width="1286px"/>
</surface>
<surface n="37r" xml:id="surface-oversize-ms-codex-1300-75">
<graphic height="6064px" url="master/1176_0074.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0074_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0074_web.jpg" width="1286px"/>
</surface>
<surface n="37v" xml:id="surface-oversize-ms-codex-1300-76">
<graphic height="6064px" url="master/1176_0075.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0075_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0075_web.jpg" width="1286px"/>
</surface>
<surface n="38r" xml:id="surface-oversize-ms-codex-1300-77">
<graphic height="6064px" url="master/1176_0076.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0076_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0076_web.jpg" width="1286px"/>
</surface>
<surface n="38v" xml:id="surface-oversize-ms-codex-1300-78">
<graphic height="6064px" url="master/1176_0077.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0077_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0077_web.jpg" width="1286px"/>
</surface>
<surface n="39r" xml:id="surface-oversize-ms-codex-1300-79">
<graphic height="6064px" url="master/1176_0078.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0078_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0078_web.jpg" width="1286px"/>
</surface>
<surface n="39v" xml:id="surface-oversize-ms-codex-1300-80">
<graphic height="6064px" url="master/1176_0079.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0079_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0079_web.jpg" width="1286px"/>
</surface>
<surface n="40r" xml:id="surface-oversize-ms-codex-1300-81">
<graphic height="6064px" url="master/1176_0080.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0080_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0080_web.jpg" width="1286px"/>
</surface>
<surface n="40v" xml:id="surface-oversize-ms-codex-1300-82">
<graphic height="6064px" url="master/1176_0081.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0081_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0081_web.jpg" width="1286px"/>
</surface>
<surface n="41r" xml:id="surface-oversize-ms-codex-1300-83">
<graphic height="6064px" url="master/1176_0082.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0082_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0082_web.jpg" width="1286px"/>
</surface>
<surface n="41v" xml:id="surface-oversize-ms-codex-1300-84">
<graphic height="6064px" url="master/1176_0083.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0083_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0083_web.jpg" width="1286px"/>
</surface>
<surface n="42r" xml:id="surface-oversize-ms-codex-1300-85">
<graphic height="6064px" url="master/1176_0084.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0084_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0084_web.jpg" width="1286px"/>
</surface>
<surface n="42v" xml:id="surface-oversize-ms-codex-1300-86">
<graphic height="6064px" url="master/1176_0085.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0085_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0085_web.jpg" width="1286px"/>
</surface>
<surface n="43r" xml:id="surface-oversize-ms-codex-1300-87">
<graphic height="6064px" url="master/1176_0086.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0086_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0086_web.jpg" width="1286px"/>
</surface>
<surface n="43v" xml:id="surface-oversize-ms-codex-1300-88">
<graphic height="6064px" url="master/1176_0087.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0087_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0087_web.jpg" width="1286px"/>
</surface>
<surface n="44r" xml:id="surface-oversize-ms-codex-1300-89">
<graphic height="6064px" url="master/1176_0088.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0088_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0088_web.jpg" width="1286px"/>
</surface>
<surface n="44v" xml:id="surface-oversize-ms-codex-1300-90">
<graphic height="6064px" url="master/1176_0089.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0089_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0089_web.jpg" width="1286px"/>
</surface>
<surface n="45r" xml:id="surface-oversize-ms-codex-1300-91">
<graphic height="6064px" url="master/1176_0090.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0090_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0090_web.jpg" width="1286px"/>
</surface>
<surface n="63v" xml:id="surface-oversize-ms-codex-1300-92">
<graphic height="6064px" url="master/1176_0091.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0091_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0091_web.jpg" width="1286px"/>
</surface>
<surface n="64r" xml:id="surface-oversize-ms-codex-1300-93">
<graphic height="6064px" url="master/1176_0092.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0092_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0092_web.jpg" width="1286px"/>
</surface>
<surface n="64v" xml:id="surface-oversize-ms-codex-1300-94">
<graphic height="6064px" url="master/1176_0093.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0093_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0093_web.jpg" width="1286px"/>
</surface>
<surface n="Inside back cover" xml:id="surface-oversize-ms-codex-1300-95">
<graphic height="6064px" url="master/1176_0094.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0094_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0094_web.jpg" width="1286px"/>
</surface>
<surface n="Back cover" xml:id="surface-oversize-ms-codex-1300-96">
<graphic height="6064px" url="master/1176_0095.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0095_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0095_web.jpg" width="1286px"/>
</surface>
<surface n="Spine" xml:id="surface-oversize-ms-codex-1300-97">
<graphic height="6064px" url="master/1176_0096.tif" width="4333px"/>
<graphic height="190px" url="thumb/1176_0096_thumb.jpg" width="136px"/>
<graphic height="1800px" url="web/1176_0096_web.jpg" width="1286px"/>
</surface>
</facsimile>
</TEI>
| 48.624606 | 968 | 0.595595 |
b97909e88191bbc9289c78edc74483505ed323bd | 2,590 | xaml | XML | Wpf Core/Contoso.UI.Wpf/Presentation/Modules/LayoutView/Views/ToolBar/ToolBarsView.xaml | aksl2019/Aksl-3.0 | 12ec6fcf8d76e63acebaeee6d6325fed7f47c902 | [
"MIT"
] | null | null | null | Wpf Core/Contoso.UI.Wpf/Presentation/Modules/LayoutView/Views/ToolBar/ToolBarsView.xaml | aksl2019/Aksl-3.0 | 12ec6fcf8d76e63acebaeee6d6325fed7f47c902 | [
"MIT"
] | null | null | null | Wpf Core/Contoso.UI.Wpf/Presentation/Modules/LayoutView/Views/ToolBar/ToolBarsView.xaml | aksl2019/Aksl-3.0 | 12ec6fcf8d76e63acebaeee6d6325fed7f47c902 | [
"MIT"
] | null | null | null | <UserControl x:Class="Tree.UI.Modules.LayoutUI.Views.ToolBarsView"
xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"
xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"
xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"
xmlns:d="http://schemas.microsoft.com/expression/blend/2008"
xmlns:dts="clr-namespace:Tree.UI.Modules.LayoutUI.DataTemplateSelectors"
xmlns:views="clr-namespace:Tree.UI.Modules.LayoutUI.Views"
mc:Ignorable="d">
<UserControl.Resources>
<CollectionViewSource x:Key="toolBarSource"
Source="{Binding Path=ToolBarItems}" />
<ItemsPanelTemplate x:Key="ToolBarBoxStyle">
<StackPanel Orientation="Horizontal"
HorizontalAlignment="Left"
VerticalAlignment="Center" />
</ItemsPanelTemplate>
<Style x:Key="ToolBarListBoxItemStyle"
TargetType="{x:Type ListBoxItem}">
<Style.Setters>
</Style.Setters>
</Style>
<DataTemplate x:Key="toolBarSeparatorDataTemplate">
<views:ToolBarItemSeparatorView />
</DataTemplate>
<DataTemplate x:Key="toolBarCommandDataTemplate">
<views:ToolBarItemCommandView />
</DataTemplate>
<dts:ToolBarDataTemplateSelector x:Key="toolBarDataTemplateSelector"
CommandTemplate="{StaticResource toolBarCommandDataTemplate}"
SeparatorTemplate="{StaticResource toolBarSeparatorDataTemplate}" />
</UserControl.Resources>
<ListBox Name="ToolBarListBox"
HorizontalAlignment="Left"
VerticalAlignment="Stretch"
ItemsSource="{Binding Source={StaticResource toolBarSource}}"
ItemsPanel="{Binding Source={StaticResource ToolBarBoxStyle}}"
ItemContainerStyle="{StaticResource ToolBarListBoxItemStyle}"
ItemTemplateSelector="{Binding Source={StaticResource toolBarDataTemplateSelector}}"
SelectedItem="{Binding Path=SelectedToolBarItem}"
SelectionMode="Single"
Margin="10"
SelectedIndex="0">
<!--<ListBox.ItemTemplate>
<DataTemplate>
<TextBlock Text="{Binding Path=Title}"
Width="80"
Height="20" />
</DataTemplate>
</ListBox.ItemTemplate>-->
</ListBox>
</UserControl>
| 43.898305 | 109 | 0.600386 |
bee00e46e02c02e57673b26e3438b20a506ab044 | 3,758 | xsd | XML | src/main/resources/reg.xsd | bencampion/regxmllib | 8a3aea994bafa49730019acdecd1dfb759ae0030 | [
"BSD-2-Clause"
] | 40 | 2015-06-22T21:35:54.000Z | 2021-03-24T16:46:35.000Z | src/main/resources/reg.xsd | bencampion/regxmllib | 8a3aea994bafa49730019acdecd1dfb759ae0030 | [
"BSD-2-Clause"
] | 105 | 2015-01-15T05:41:46.000Z | 2021-11-18T00:44:32.000Z | src/main/resources/reg.xsd | bencampion/regxmllib | 8a3aea994bafa49730019acdecd1dfb759ae0030 | [
"BSD-2-Clause"
] | 19 | 2015-06-16T16:21:49.000Z | 2021-11-12T20:51:42.000Z | <?xml version='1.0' encoding='UTF-8'?>
<xs:schema xmlns:xs='http://www.w3.org/2001/XMLSchema'
elementFormDefault='qualified' attributeFormDefault='unqualified' targetNamespace="http://sandflow.com/ns/SMPTEST2001-1/baseline" xmlns:reg="http://sandflow.com/ns/SMPTEST2001-1/baseline">
<xs:import namespace='http://www.w3.org/1999/xlink' schemaLocation='http://www.w3.org/1999/xlink.xsd'/>
<xs:simpleType name='TargetType'>
<xs:union memberTypes='xs:token'>
<xs:simpleType>
<xs:restriction base='reg:AUID'/>
</xs:simpleType>
<xs:simpleType>
<xs:restriction base='reg:PackageIDType'/>
</xs:simpleType>
<xs:simpleType>
<xs:restriction base='xs:string'>
<xs:pattern value='([^\s]+\s)?[^\s]+'/>
</xs:restriction>
</xs:simpleType>
</xs:union>
</xs:simpleType>
<xs:simpleType name='ByteOrderType'>
<xs:restriction base='xs:string'>
<xs:enumeration value='BigEndian'/>
<xs:enumeration value='LittleEndian'/>
</xs:restriction>
</xs:simpleType>
<xs:simpleType name='HexByteArrayType'>
<xs:restriction base='xs:string'>
<xs:pattern value='(\s*[0-9a-fA-F][0-9a-fA-F])*\s*'/>
</xs:restriction>
</xs:simpleType>
<xs:attribute name='uid' type='reg:TargetType'/>
<xs:attribute name='byteOrder' type='reg:ByteOrderType'/>
<xs:attribute name='stream' type='xs:ENTITY'/>
<xs:attribute name='actualType' type='reg:TargetType'/>
<xs:attribute name='escaped' type='xs:boolean'/>
<xs:attribute name='path' type='xs:string'/>
<xs:simpleType name='AUID'>
<xs:restriction base='xs:anyURI'>
<xs:pattern
value='urn:smpte:ul:([0-9a-fA-F]{8}\.){3}[0-9a-fA-F]{8}'/>
<xs:pattern
value='urn:uuid:[0-9a-fA-F]{8}-([0-9a-fA-F]{4}-){3}[0-9a-fA-F]{12}'/>
</xs:restriction>
</xs:simpleType>
<xs:simpleType name='DateStruct'>
<xs:union>
<xs:simpleType>
<xs:restriction base='xs:date'>
<xs:pattern value='.+(((\+|\-)\d\d:\d\d)|Z)'/>
</xs:restriction>
</xs:simpleType>
<xs:simpleType>
<xs:restriction base='xs:string'>
<xs:enumeration value='0000-00-00Z'/>
</xs:restriction>
</xs:simpleType>
</xs:union>
</xs:simpleType>
<xs:simpleType name='PackageIDType'>
<xs:restriction base='xs:string'>
<xs:pattern value=' urn:smpte:umid:([0-9a-fA-F]{8}\.){7}[0-9a-fA-F]{8}'/>
</xs:restriction>
</xs:simpleType>
<xs:simpleType name='Rational'>
<xs:restriction base='xs:string'>
<xs:pattern value='\-?\d{1,10}(/\-?\d{1,10})?'/>
</xs:restriction>
</xs:simpleType>
<xs:simpleType name='TimeStruct'>
<xs:union>
<xs:simpleType>
<xs:restriction base='xs:time'>
<xs:pattern value='.+(((\+|\-)\d\d:\d\d)|Z)'/>
</xs:restriction>
</xs:simpleType>
<xs:simpleType>
<xs:restriction base='xs:string'>
<xs:enumeration value='00:00:00Z'/>
</xs:restriction>
</xs:simpleType>
</xs:union>
</xs:simpleType>
<xs:simpleType name='TimeStamp'>
<xs:union>
<xs:simpleType>
<xs:restriction base='xs:dateTime'>
<xs:pattern value='.+(((\+|\-)\d\d:\d\d)|Z)'/>
</xs:restriction>
</xs:simpleType>
<xs:simpleType>
<xs:restriction base='xs:string'>
<xs:enumeration value='0000-00-00T00:00:00Z'/>
</xs:restriction>
</xs:simpleType>
</xs:union>
</xs:simpleType>
<xs:simpleType name='VersionType'>
<xs:restriction base='xs:string'>
<xs:pattern value='\-?\d{1,3}\.\-?\d{1,3}'/>
</xs:restriction>
</xs:simpleType>
</xs:schema> | 36.843137 | 190 | 0.573976 |
f7429fdf4c831b3539a9d4faae5631ed8b04f80e | 352 | xml | XML | documentation/src/main/asciidoc/topics/config_examples/xsite_state_transfer.xml | t-gergely/infinispan | 06861fff29be2c08a7e59e773aef54804d741074 | [
"Apache-2.0"
] | 713 | 2015-01-06T02:14:17.000Z | 2022-03-29T10:22:07.000Z | documentation/src/main/asciidoc/topics/config_examples/xsite_state_transfer.xml | t-gergely/infinispan | 06861fff29be2c08a7e59e773aef54804d741074 | [
"Apache-2.0"
] | 5,732 | 2015-01-01T19:13:35.000Z | 2022-03-31T16:31:11.000Z | documentation/src/main/asciidoc/topics/config_examples/xsite_state_transfer.xml | t-gergely/infinispan | 06861fff29be2c08a7e59e773aef54804d741074 | [
"Apache-2.0"
] | 402 | 2015-01-05T23:23:42.000Z | 2022-03-25T08:14:32.000Z | <distributed-cache name="eu-customers">
<backups>
<backup site="LON" strategy="ASYNC">
<state-transfer chunk-size="64"
timeout="30000"
max-retries="30"
wait-time="2000"
mode="AUTO"/>
</backup>
</backups>
</distributed-cache>
| 29.333333 | 42 | 0.457386 |
decea2afe0560c067b757b6ef246f8222b0a7837 | 2,377 | xml | XML | app/src/main/res/values/attrs.xml | lincollincol/AlarmClock-for-programmers | 46e469f71658c2b987b818b6535e6a7a32e4e45c | [
"Apache-2.0"
] | 11 | 2020-02-28T10:28:44.000Z | 2022-03-04T01:55:41.000Z | app/src/main/res/values/attrs.xml | lincollincol/AlarmClock-for-programmers | 46e469f71658c2b987b818b6535e6a7a32e4e45c | [
"Apache-2.0"
] | null | null | null | app/src/main/res/values/attrs.xml | lincollincol/AlarmClock-for-programmers | 46e469f71658c2b987b818b6535e6a7a32e4e45c | [
"Apache-2.0"
] | 4 | 2019-08-19T07:42:52.000Z | 2021-09-03T19:24:41.000Z | <?xml version="1.0" encoding="utf-8"?>
<resources>
<declare-styleable name="theme" >
<!--Buttons-->
<attr name="button_disable_color" format="color" />
<attr name="button_default_color" format="color"/>
<!--Text-->
<attr name="text_default_color" format="color"/>
<attr name="text_secondary_color" format="color"/>
<attr name="text_achieve_color" format="color"/>
<!--Icons-->
<attr name="icon_default_color" format="color"/>
<!--Card background-->
<attr name="background_card_color" format="color"/>
<attr name="background_card_alarm_enable" format="color"/>
<!--Alert dialog days picker-->
<attr name="dialog_background_color" format="color" />
<attr name="dialog_positive_color" format="color" />
<attr name="dialog_negative_color" format="color" />
<attr name="dialog_checked_color" format="color" />
<attr name="dialog_unchecked_color" format="color" />
<!--Nav menu item color-->
<attr name="menu_selected_shape_color" format="color" />
<attr name="menu_shape_translucent_color" format="color" />
<attr name="menu_item_color" format="color" />
<attr name="menu_item_selected_color" format="color" />
<!--Switch toggles color-->
<attr name="switch_thumb_color" format="color" />
<attr name="switch_track_enable_color" format="color" />
<attr name="switch_track_disable_color" format="color" />
<!--Progress bar-->
<attr name="progress_track_color" format="color" />
<attr name="progress_gradient_start_color" format="color" />
<attr name="progress_gradient_center_color" format="color" />
<attr name="progress_gradient_end_color" format="color" />
<!--App background gradient-->
<attr name="app_gradient_start_color" format="color"/>
<attr name="app_gradient_end_color" format="color"/>
<!--Wake activity-->
<attr name="dismiss_shape_color" format="color" />
<attr name="correct_color" format="color" />
<attr name="incorrect_color" format="color" />
<!--Achievements-->
<attr name="view_completed_color" format="color" />
<attr name="icon_completed_color" format="color" />
</declare-styleable>
</resources> | 40.288136 | 69 | 0.623896 |
ded66ac133917932a47345e6b051858a00c2c8b7 | 4,241 | xml | XML | src/main/res/values/strings.xml | EnrieJohn31/Android_Apps | 2b66e67707e87c8fac81ea8735862c02d15dc45b | [
"MIT"
] | null | null | null | src/main/res/values/strings.xml | EnrieJohn31/Android_Apps | 2b66e67707e87c8fac81ea8735862c02d15dc45b | [
"MIT"
] | null | null | null | src/main/res/values/strings.xml | EnrieJohn31/Android_Apps | 2b66e67707e87c8fac81ea8735862c02d15dc45b | [
"MIT"
] | null | null | null | <resources>
//Profile
<string name="app_name">EdemAppActivity</string>
<string name="usename">Enrie John B. Edem</string>
<string name="account">enriejohnedem@gmail.com</string>
<string name="toolbar_title">Edem App</string>
<string name="course">Bachelor of Science in Information Technology</string>
<string name="h1">Contact</string>
<string name="email">Emails</string>
<string name="e1">enriejohnedem@gmail.com</string>
<string name="e2">enriejohn.edem@bisu.edu.ph</string>
<string name="number">Numbers</string>
<string name="num1">0950-465-6709</string>
<string name="num2">0910-235-8542</string>
<string name="objective">OBJECTIVE</string>
<string name="objectives">To experience working in a company wherein my skills in the field of Programming and Software Development can be used for growth and development of my personal skills as well as the company</string>
<string name="personalinf">PERSONAL INFORMATION </string>
<string name="inf1">Age: 20</string>
<string name="inf2">Gender: Male</string>
<string name="inf3">Civil Status: Single</string>
<string name="inf4">Birthdate: March 31, 2000</string>
<string name="inf5">Birthplace: Tagbilaran City</string>
<string name="inf6">Nationality: Filipino</string>
<string name="inf7">Religion: Roman Catholic</string>
<string name="inf8">Height: 5’7” </string>
<string name="inf9">Weight: 48 kg.</string>
<string name="educ">EDUCATIONAL ATTAINMENT</string>
<string name="educ1">SENIOR HIGH: ICT- COMPUTER SYSTEM SERVICING
Carmel Academy
Del Carmen Norte, Bohol
2017-18
</string>
<string name="educ2">JUNIOR HIGH: Cong. Pablo Malasarte National High School
Cabad, Balilihan, Bohol
2015-16
</string>
<string name="educ3">ELEMENTARY: Cabad-Candasig Elementary School
Cabad, Balilihan, Bohol
2011-12
</string>
<string name="educ4">College: Bohol Island State University - Bachelor of Science in Information Technology
Magsija, Balilihan, Bohol
2018-current
</string>
<string name="skl">SKILLS</string>
<string name="skl1">Java Development</string>
<string name="skl2">Web Development</string>
<string name="skl3">C++ Development</string>
<string name="skl4">C Development</string>
//Navigation
<string name="navigation_drawer_open">Open Navigation Drawer</string>
<string name="navigation_drawer_close">Close Navigation Drawer</string>
//Fragment
<string name="item0">Home</string>
<string name="item1">Profile</string>
<string name="item2">Button Demo</string>
<string name="item3">Chip Demo</string>
<string name="item4">Checkbox Demo</string>
<string name="item5">RadioButton Demo</string>
<string name="item6">Toggle Demo</string>
<string name="item7">CRUD Demo</string>
<string name="item8">Dark Mode</string>
//Button
<string name="Note">Enter Name Here</string>
<string name="sub">Submit</string>
//Chip / Chip Group
<string name="question">Which of These Languages you Know?</string>
<string name="result">Result</string>
<string name="a1">Java</string>
<string name="a2">Python</string>
<string name="a3">C++</string>
<string name="a4">Visual Basic</string>
<string name="a5">JavaScript</string>
//Check Box
<string name="question1">State your Gender</string>
<string name="gen1">Male</string>
<string name="gen2">Female</string>
//Radio Button
<string name="def">Click Radio Button for Audio Setting in your phone</string>
<string name="r1">Silent</string>
<string name="r2">Ringer</string>
<string name="r3">Vibrate</string>
//Toggle Button
<string name="b1">Bluetooth</string>
//CRUD DEMO
<string name="CRUD_TITLE">CRUD DEMO</string>
<string name="Input_Name">Enter Name Below</string>
<string name="btnAdd">Add</string>
<string name="btnUpdate">Update</string>
<string name="btnClear">Clear</string>
</resources> | 42.838384 | 229 | 0.654091 |
ce7efa32109d8fb6f5bdb9da94e1916d5fd34911 | 832 | xml | XML | training_data/images/Annotation/img1740.xml | kevinyx2/FYPagain | 1efffcbfdd66be93318276bb183485100ea754cc | [
"MIT"
] | null | null | null | training_data/images/Annotation/img1740.xml | kevinyx2/FYPagain | 1efffcbfdd66be93318276bb183485100ea754cc | [
"MIT"
] | null | null | null | training_data/images/Annotation/img1740.xml | kevinyx2/FYPagain | 1efffcbfdd66be93318276bb183485100ea754cc | [
"MIT"
] | null | null | null | <annotation>
<folder>JPEGImages</folder>
<filename>img1740.JPG</filename>
<path>C:\Users\user\Downloads\tensorflow_yolo_v3-master\tensorflow_yolo_v3-master\training_data\images\JPEGImages\img1740.JPG</path>
<source>
<database>Unknown</database>
</source>
<size>
<width>1498</width>
<height>428</height>
<depth>3</depth>
</size>
<segmented>0</segmented>
<object>
<name>buy</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>520</xmin>
<ymin>261</ymin>
<xmax>600</xmax>
<ymax>363</ymax>
</bndbox>
</object>
<object>
<name>buy</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>700</xmin>
<ymin>192</ymin>
<xmax>1299</xmax>
<ymax>331</ymax>
</bndbox>
</object>
</annotation>
| 21.333333 | 133 | 0.669471 |
fa32de018230c15454f398aaf1b4983a4e5bc405 | 5,256 | xml | XML | app/src/main/res/layout/activity_about_me.xml | yizhuoyan/android-project-guguanjia | 2da275d7374176d79e665d5054ba5b0067b32dbd | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layout/activity_about_me.xml | yizhuoyan/android-project-guguanjia | 2da275d7374176d79e665d5054ba5b0067b32dbd | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layout/activity_about_me.xml | yizhuoyan/android-project-guguanjia | 2da275d7374176d79e665d5054ba5b0067b32dbd | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:tools="http://schemas.android.com/tools"
android:id="@+id/activity_about_me"
android:layout_width="match_parent"
android:layout_height="match_parent"
tools:context="com.chinasofti.guguanjia.ui.AboutMeActivity">
<com.chinasofti.guguanjia.views.TitleView
android:id="@+id/aboutme_head"
android:layout_width="match_parent"
android:layout_height="wrap_content"></com.chinasofti.guguanjia.views.TitleView>
<LinearLayout
android:layout_width="match_parent"
android:layout_height="match_parent"
android:layout_alignParentLeft="true"
android:layout_alignParentStart="true"
android:layout_alignParentTop="true"
android:orientation="vertical">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="300dp"
android:layout_gravity="center_horizontal"
android:orientation="vertical"
>
<ImageView
android:layout_width="150dp"
android:layout_height="150dp"
android:layout_gravity="center_horizontal"
android:layout_marginTop="100dp"
android:src="@mipmap/img_logo"
/>
<TextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_horizontal"
android:text="V1.0.1"
android:textSize="20dp" />
</LinearLayout>
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_horizontal"
android:layout_marginTop="7dp"
android:orientation="horizontal">
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:orientation="vertical">
<ImageView
android:layout_width="75dp"
android:layout_height="wrap_content"
android:layout_gravity="center_vertical"
android:src="@mipmap/head_left" />
<TextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_vertical"
android:text="微信公众号"
android:textSize="17dp" />
</LinearLayout>
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="22dp"
android:orientation="vertical">
<ImageView
android:layout_width="75dp"
android:layout_height="wrap_content"
android:layout_gravity="center_vertical"
android:src="@mipmap/head_center" />
<TextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_vertical"
android:layout_marginLeft="5dp"
android:text="管理平台"
android:textSize="17dp" />
</LinearLayout>
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginLeft="22dp"
android:orientation="vertical">
<ImageView
android:layout_width="75dp"
android:layout_height="wrap_content"
android:layout_gravity="center_vertical"
android:src="@mipmap/head_right" />
<TextView
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_vertical"
android:layout_marginLeft="5dp"
android:text="官方网站"
android:textSize="17dp" />
</LinearLayout>
</LinearLayout>
<LinearLayout
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_gravity="center_horizontal"
android:layout_marginTop="50dp"
android:orientation="vertical">
<TextView
android:id="@+id/tiaokuan"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:text="《固管家服务条款》"
android:textColor="@color/greenColor"/>
<TextView
android:id="@+id/ysxy"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:text="《固管家隐私协议》"
android:textColor="@color/greenColor"/>
</LinearLayout>
</LinearLayout>
</RelativeLayout>
| 36.248276 | 88 | 0.563737 |
c5b4aaf4e5fcc781797bc4104a988885730e7d01 | 780 | xml | XML | Public/install2/langs/qc/data/supply_order_state.xml | kbylin0531/presta_srg | 49f63141c7c8164fe08aa9b4e904c6fc080a4032 | [
"MIT"
] | 18 | 2015-01-14T12:54:18.000Z | 2019-06-02T01:19:58.000Z | Public/install2/langs/qc/data/supply_order_state.xml | kbylin0531/presta_srg | 49f63141c7c8164fe08aa9b4e904c6fc080a4032 | [
"MIT"
] | 1 | 2019-01-31T19:53:34.000Z | 2019-01-31T19:53:34.000Z | Public/install2/langs/qc/data/supply_order_state.xml | kbylin0531/presta_srg | 49f63141c7c8164fe08aa9b4e904c6fc080a4032 | [
"MIT"
] | 8 | 2015-02-20T16:05:52.000Z | 2021-09-05T22:14:42.000Z | <?xml version='1.0'?>
<entity_supply_order_state>
<supply_order_state id='supply_order_state_1'>
<name>1 - En cours de création</name>
</supply_order_state>
<supply_order_state id='supply_order_state_2'>
<name>2 - Commande validée</name>
</supply_order_state>
<supply_order_state id='supply_order_state_3'>
<name>3 - En attente de réception</name>
</supply_order_state>
<supply_order_state id='supply_order_state_4'>
<name>4 - Commande reçue partiellement</name>
</supply_order_state>
<supply_order_state id='supply_order_state_5'>
<name>5 - Commande reçue intégralement</name>
</supply_order_state>
<supply_order_state id='supply_order_state_6'>
<name>6 - Commande annulée</name>
</supply_order_state>
</entity_supply_order_state>
| 35.454545 | 49 | 0.747436 |
d1c592518abe14471ce55b67afdfeae826ce4de6 | 31,235 | xml | XML | A94005.xml | textcreationpartnership/A94005 | 98deaff1877d0cc4b9b005253cabfec96ad74403 | [
"CC0-1.0"
] | null | null | null | A94005.xml | textcreationpartnership/A94005 | 98deaff1877d0cc4b9b005253cabfec96ad74403 | [
"CC0-1.0"
] | null | null | null | A94005.xml | textcreationpartnership/A94005 | 98deaff1877d0cc4b9b005253cabfec96ad74403 | [
"CC0-1.0"
] | null | null | null | <TEI xmlns="http://www.tei-c.org/ns/1.0">
<teiHeader>
<fileDesc>
<titleStmt>
<title>Strange nevves from Campania a province in Italy: being a true relation of one who slept at noon-time of day, how his spirit was transported into the province of Campania in Italy, by chance, near unto the lake Avernus, also his discourse with an old man of that province, concerning the present distempers in those parts, not unlike these in England, who after his recovery out of an extasie (by reason of the cruelties and bloud-sucking oppressions in that province) writ these ensuing lines:.</title>
</titleStmt>
<editionStmt>
<edition>
<date>1647</date>
</edition>
</editionStmt>
<extent>Approx. 17 KB of XML-encoded text transcribed from 6 1-bit group-IV TIFF page images.</extent>
<publicationStmt>
<publisher>Text Creation Partnership,</publisher>
<pubPlace>Ann Arbor, MI ; Oxford (UK) :</pubPlace>
<date when="2011-04">2011-04 (EEBO-TCP Phase 2).</date>
<idno type="DLPS">A94005</idno>
<idno type="STC">Wing S5889</idno>
<idno type="STC">Thomason E399_3</idno>
<idno type="STC">ESTC R201709</idno>
<idno type="EEBO-CITATION">99862209</idno>
<idno type="PROQUEST">99862209</idno>
<idno type="VID">114360</idno>
<availability>
<p>To the extent possible under law, the Text Creation Partnership has waived all copyright and related or neighboring rights to this keyboarded and encoded edition of the work described above, according to the terms of the CC0 1.0 Public Domain Dedication (http://creativecommons.org/publicdomain/zero/1.0/). This waiver does not extend to any page images or other supplementary files associated with this work, which may be protected by copyright or other license restrictions. Please go to https://www.textcreationpartnership.org/ for more information about the project.</p>
</availability>
</publicationStmt>
<seriesStmt>
<title>Early English books online.</title>
</seriesStmt>
<notesStmt>
<note>(EEBO-TCP ; phase 2, no. A94005)</note>
<note>Transcribed from: (Early English Books Online ; image set 114360)</note>
<note>Images scanned from microfilm: (Thomason Tracts ; 63:E399[3])</note>
</notesStmt>
<sourceDesc>
<biblFull>
<titleStmt>
<title>Strange nevves from Campania a province in Italy: being a true relation of one who slept at noon-time of day, how his spirit was transported into the province of Campania in Italy, by chance, near unto the lake Avernus, also his discourse with an old man of that province, concerning the present distempers in those parts, not unlike these in England, who after his recovery out of an extasie (by reason of the cruelties and bloud-sucking oppressions in that province) writ these ensuing lines:.</title>
</titleStmt>
<extent>[8] p. </extent>
<publicationStmt>
<publisher>s.n.],</publisher>
<pubPlace>Imprinted at Attalia, [i.e. London :</pubPlace>
<date>in the yeare MDCXLVII. [1647]</date>
</publicationStmt>
<notesStmt>
<note>The imprint is false; actual place of publication from Wing.</note>
<note>An anti-Parliamentary allegory in verse.</note>
<note>Annotation on Thomason copy: "July 17th".</note>
<note>Trimmed at foot, affecting catchwords and signatures.</note>
<note>Reproduction of the original in the British Library.</note>
</notesStmt>
</biblFull>
</sourceDesc>
</fileDesc>
<encodingDesc>
<projectDesc>
<p>Created by converting TCP files to TEI P5 using tcp2tei.xsl,
TEI @ Oxford.
</p>
</projectDesc>
<editorialDecl>
<p>EEBO-TCP is a partnership between the Universities of Michigan and Oxford and the publisher ProQuest to create accurately transcribed and encoded texts based on the image sets published by ProQuest via their Early English Books Online (EEBO) database (http://eebo.chadwyck.com). The general aim of EEBO-TCP is to encode one copy (usually the first edition) of every monographic English-language title published between 1473 and 1700 available in EEBO.</p>
<p>EEBO-TCP aimed to produce large quantities of textual data within the usual project restraints of time and funding, and therefore chose to create diplomatic transcriptions (as opposed to critical editions) with light-touch, mainly structural encoding based on the Text Encoding Initiative (http://www.tei-c.org).</p>
<p>The EEBO-TCP project was divided into two phases. The 25,368 texts created during Phase 1 of the project (2000-2009), initially available only to institutions that contributed to their creation, were released into the public domain on 1 January 2015. The approximately 40,000 texts produced during Phase 2 (2009- ), of which 34,963 had been released as of 2020, originally similarly restricted, were similarly freed from all restrictions on 1 August 2020. As of that date anyone is free to take and use these texts for any purpose (modify them, annotate them, distribute them, etc.). But we do respectfully request that due credit and attribution be given to their original source.</p>
<p>Users should be aware of the process of creating the TCP texts, and therefore of any assumptions that can be made about the data.</p>
<p>Text selection was based on the New Cambridge Bibliography of English Literature (NCBEL). If an author (or for an anonymous work, the title) appears in NCBEL, then their works are eligible for inclusion. Selection was intended to range over a wide variety of subject areas, to reflect the true nature of the print record of the period. In general, first editions of a works in English were prioritized, although there are a number of works in other languages, notably Latin and Welsh, included and sometimes a second or later edition of a work was chosen if there was a compelling reason to do so.</p>
<p>Image sets were sent to external keying companies for transcription and basic encoding. Quality assurance was then carried out by editorial teams in Oxford and Michigan. 5% (or 5 pages, whichever is the greater) of each text was proofread for accuracy and those which did not meet QA standards were returned to the keyers to be redone. After proofreading, the encoding was enhanced and/or corrected and characters marked as illegible were corrected where possible up to a limit of 100 instances per text. Any remaining illegibles were encoded as <gap>s. Understanding these processes should make clear that, while the overall quality of TCP data is very good, some errors will remain and some readable characters will be marked as illegible. Users should bear in mind that in all likelihood such instances will never have been looked at by a TCP editor.</p>
<p>The texts were encoded and linked to page images in accordance with level 4 of the TEI in Libraries guidelines.</p>
<p>Copies of the texts have been issued variously as SGML (TCP schema; ASCII text with mnemonic sdata character entities); displayable XML (TCP schema; characters represented either as UTF-8 Unicode or text strings within braces); or lossless XML (TEI P5, characters represented either as UTF-8 Unicode or TEI g elements).</p>
<p>Keying and markup guidelines are available at the <ref target="http://www.textcreationpartnership.org/docs/.">Text Creation Partnership web site</ref>.</p>
</editorialDecl>
<listPrefixDef>
<prefixDef ident="tcp"
matchPattern="([0-9\-]+):([0-9IVX]+)"
replacementPattern="http://eebo.chadwyck.com/downloadtiff?vid=$1&page=$2"/>
<prefixDef ident="char"
matchPattern="(.+)"
replacementPattern="https://raw.githubusercontent.com/textcreationpartnership/Texts/master/tcpchars.xml#$1"/>
</listPrefixDef>
</encodingDesc>
<profileDesc>
<langUsage>
<language ident="eng">eng</language>
</langUsage>
<textClass>
<keywords scheme="http://authorities.loc.gov/">
<term>England and Wales. -- Parliament -- Poetry -- Early works to 1800.</term>
<term>Great Britain -- History -- Civil War, 1642-1649 -- Poetry -- Early works to 1800.</term>
</keywords>
</textClass>
</profileDesc>
<revisionDesc>
<change>
<date>2009-09</date>
<label>TCP</label>Assigned for keying and markup</change>
<change>
<date>2009-10</date>
<label>SPi Global</label>Keyed and coded from ProQuest page images</change>
<change>
<date>2009-12</date>
<label>Mona Logarbo</label>Sampled and proofread</change>
<change>
<date>2009-12</date>
<label>Mona Logarbo</label>Text and markup reviewed and edited</change>
<change>
<date>2010-04</date>
<label>pfs</label>Batch review (QC) and XML conversion</change>
</revisionDesc>
</teiHeader>
<text xml:lang="eng">
<front>
<div type="title_page">
<pb facs="tcp:114360:1" rendition="simple:additions"/>
<!-- PDF PAGE 13 -->
<p>STRANGE NEVVES FROM CAMPANIA <hi>A Province in</hi> ITALY: BEING A true Relation of one who ſlept at noon<g ref="char:EOLhyphen"/>time of day, how his ſpirit was tranſported into the Pro<g ref="char:EOLhyphen"/>vince of <hi>Campania</hi> in <hi>Italy,</hi> by chance, near unto the Lake <hi>Avernus,</hi> alſo his diſcourſe with an old man of that <hi>Pro<g ref="char:EOLhyphen"/>vince,</hi> concerning the preſent diſtempers in thoſe parts, not unlike theſe in <hi>England,</hi> who after his recovery out of an extaſie (by reaſon of the Cruelties, and bloud-ſucking oppreſſions in that <hi>Province</hi>) writ theſe enſuing Lines:</p>
<q>
<bibl>Pſal. 1.1.</bibl>
<l>Faelix ille animum qu<gap reason="illegible" extent="1 letter">
<desc>•</desc>
</gap>m non de Tramite recte,</l>
<l>Impia ſacrilega flexit contagio turba.</l>
</q>
<p>Imprinted at ATTALIA, in the Yeare MDCXLVII.</p>
</div>
</front>
<body>
<div type="poem">
<pb facs="tcp:114360:2"/>
<!-- PDF PAGE 14 -->
<lg>
<l>
<hi>Plutoes</hi> dark Dungeon, <hi>Dedalus</hi> Labyrinth,</l>
<l>Great <hi>Lucifers</hi> night-ſtar, and the <hi>Berecinth,</hi>
</l>
<l>Which theſe three-headed <hi>Hydraes</hi> worſhip more</l>
<l>Then Chriſt their Saviour; and that Devill adore,</l>
<l>Becauſe of Profit it on them beſtowes,</l>
<l>Greater then horne mad Votes, and forſworne Vowes.</l>
<l>It is bewitching to their eares that itch</l>
<l>For Reformation, it goes thorow ſtitch:</l>
<l>The devills Plot, for ſure in hell 'twas hatch't,</l>
<l>And ſome Scotch <hi>Calvin</hi> thence this Monſter fetcht;</l>
<l>Whereby the Devills agents worke their feat,</l>
<l>And caſt <hi>Campania</hi> in a bloudy ſweat.</l>
<l>
<hi>Cerberus</hi> ſtrong Coller for't doth tye men faſt,</l>
<l>If once they tak't, they never more can gaſpe</l>
<l>One blaſt of Loyall breath; it ſuffocates</l>
<l>The wideſt Winde-pipe, and conſumes their pates.</l>
<l>Its <hi>Charons</hi> Moat indeed, no bottom's found</l>
<l>Of its illegall, impious, wicked ground.</l>
<l>Its <hi>Plutoes</hi> Dungeon; for who enters there,</l>
<l>Before his eyes hath never ſet Gods feare.</l>
<l>'Tis <hi>Dedalus</hi> Labyrinth guided by a Threed,</l>
<l>(And fitter 'tis to barne then for to read)</l>
<l>Who enters into't, he perhaps may prov't</l>
<l>Worſe then that Labyrinth; e're he can remov't</l>
<l>He muſt lye with the <hi>Minotaure,</hi> and beget</l>
<l>A monſtrous birth withall, and worſhip it.</l>
<l>Its <hi>Lucifers</hi> night-ſtar, that great Devills guide,</l>
<l>Which doth a theeving through the Kingdome ride,</l>
<l>And both the King and People hath undone,</l>
<l>Clad with falſe coloured Reformation.</l>
<l>Its <hi>Sybills</hi> Image; they ſo much adore't,</l>
<l>Becaus't hath better'd downe the Royall Fort.</l>
<l>Exciſe, Sequeſtration, Plunder, Loanes,</l>
<l>It gain'd, to gnaw our fleſh, and bruiſe our bones.</l>
<l>So all old things are growne to a new faſhion,</l>
<l>By Covenant-ingaging Reformation.</l>
<l>And yet this Hell-Hound hunting up and downe,</l>
<l>Purſues each loyall heart from Towne to Towne,</l>
<l>With yelping, yelling, and a hideous roare,</l>
<l>Till it have left them never a Mite in ſtore.</l>
</lg>
<lg>
<l>Whilſt yet he ſpoke, behold another ſight</l>
<l>(With great amazement) did my ghoſt afright:</l>
<l>
<pb facs="tcp:114360:2"/>
<!-- PDF PAGE 14 -->
Whole multitudes were gathered on a knot,</l>
<l>And cloſe unto a ſtately Pallace got,</l>
<l>Neare to the Luke <hi>Avernus</hi> ſituated,</l>
<l>Where (he told me) their buſineſſe was ſtated:</l>
<l>If you be pleas'd (quoth he) wee'll goe along,</l>
<l>And heare what's to be done in yonder throng:</l>
<l>Agreed (queth I) and thence we went away,</l>
<l>To ſee what would betide the State that day.</l>
</lg>
<lg>
<l>When to the Pallace we approached neare,</l>
<l>The groanes and cries of widowes we did heare,</l>
<l>Lamenting for their husbands who were ſlaine</l>
<l>The Cauſes of the wicked to maintaine.</l>
<l>Sighing ſayes one, let us goe to the State,</l>
<l>And know if they our ſorrowes will abate;</l>
<l>Agreed, ſaid all, and ſtraight they thither went,</l>
<l>And how they ſped, to you Ile repreſent.</l>
</lg>
<lg>
<l>What is the matter here (quoth <hi>L.</hi>) with theſe</l>
<l>Perverſe ungodly women? ſeek to pleaſe</l>
<l>
<hi>A</hi> womans minde? let's rather ſeek to ſell</l>
<l>Or halfe ſequeſter all the devills in hell.</l>
<l>Quoth <hi>H.</hi> that ſuits well with a new tranſlation,</l>
<l>And ballances our bleſſed Reformation:</l>
<l>If we ſhould give the Publick coyne away,</l>
<l>Our Souldiers (as they doe) would want their pay.</l>
<l>Its well (quoth <hi>S.</hi>) O 'tis a curious Plot,</l>
<l>If we ſhould do't, how ſhould we pay the <hi>Scot,</hi>
</l>
<l>For if he be not paid, an alteration</l>
<l>May hinder our unheard of Reformation;</l>
<l>And on a ſuddaine ſinke that in a ſtreame,</l>
<l>Which for this ſix yeares ſpace hath ſwom ith' Maine.</l>
<l>Be cautious then (quoth <hi>V</hi>) what you doe ſpare,</l>
<l>Our Grand-Committees muſt be paid their ſhare;</l>
<l>And let our Sub-Committees have their due,</l>
<l>Becauſe they faithfull were to us, and true;</l>
<l>And added to each private Pocket more</l>
<l>Then ever our great Grandſires had in ſtore.</l>
<l>What muſt th' Exciſe men doe, ſaid <hi>P.</hi> muſt they</l>
<l>(For all the paines th' have taken) want their pay?</l>
<l>They have themſelves like honeſt men demean'd,</l>
<l>And much oth' Kingdomes Treaſure they have gain'd</l>
<l>For thee and me: The hungry they Excis'd,</l>
<l>And like the Devill himſelfe have tyranniz'd.</l>
<l>
<pb facs="tcp:114360:3"/>
<!-- PDF PAGE 15 -->
<hi>A</hi> Member muſt not be forgotten ſaies <hi>M:</hi>
</l>
<l>For if we Members want, we are not men,</l>
<l>Our Sequeſtrators muſt rewarded be,</l>
<l>And every Petty-fogger have his fee:</l>
<l>Then when to thee, and me all's paid that's due,</l>
<l>We will againe begin our Trades anew.</l>
<l>Like <hi>Tytius</hi> Vulture we will knaw the hearts</l>
<l>O'th' Common-people; we will act our parts</l>
<l>In higheſt nature, and in every thing</l>
<l>That may our profit, and our pleaſure bring.</l>
<l>Wee'l heape up Treaſure, wee'l enrich our ſtore,</l>
<l>Wee'l ſerve the devill for wealth (that) if not more.</l>
<l>They all agreed with acclamation, vow'd</l>
<l>What <hi>M.</hi> had ſpoke they every one allow'd.</l>
<l>so every one ſhat'd of the Publique Coyne,</l>
<l>And ſent their ſervants out more to purloyne:</l>
<l>But all this while the harmeleſſe women gain'd</l>
<l>No reſtitution for their ſlaine or main'd.</l>
</lg>
<lg>
<l>Forth with I ask't my guide what all this meant;</l>
<l>It is (quoth he) our bleſſed Parliament,</l>
<l>Which hath ſlaine guiltleſſe bloud, and murthered many,</l>
<l>And never pittied the complaints of any:</l>
<l>The Widdowes teares, and eke the Fatherleſſe</l>
<l>Could never find of them a juſt redreſſe.</l>
<l>Let him declare (if there be any one)</l>
<l>To whom one act of juſtice they have done;</l>
<l>Survey the Land (who will) from Eaſt to Weſt,</l>
<l>From North to South, and let him do his beſt,</l>
<l>For all his travell he ſhall never find</l>
<l>
<hi>A</hi> graine of mercy in their perverſe mind:</l>
<l>One drop of Balſom will not be apply'd</l>
<l>By our grave Senate to the putrifi'd.</l>
</lg>
<lg>
<l>O God (quoth I) what wretched men are ye,</l>
<l>Ty'd with a boundleſſe chaine of ſlavery!</l>
<l>Have you no way your ſelves for to redreſſe?</l>
<l>Have you no meanes th'oppreſſors to ſuppreſſe?</l>
<l>Seeke all the world throughout; never be ty'd</l>
<l>To a perpetuall bondage, by their pride;</l>
<l>Whoſe thoughts are never fixt on that is good,</l>
<l>Whoſe feet are ſwift to ſhed the guiltleſſe bloud;</l>
<l>Their tongues ſpeake lies, their lips are full of guile,</l>
<l>Their Councels Treaſon hatch, by ever wile.</l>
<l>
<pb facs="tcp:114360:3"/>
<!-- PDF PAGE 15 -->
Let all your Conſcript Fathers be transform'd,</l>
<l>And let them be by every Peaſant ſcorn'd<g ref="char:punc">▪</g>
</l>
<l>Let all your <hi>Deeij</hi> Chriſtian Perſecutors</l>
<l>Be rendered to the Seſſions Executors.</l>
<l>Then ſhall your ancient Liberties be ſhowne,</l>
<l>And every honeſt man enjoy his owne.</l>
</lg>
<lg>
<l>The good old Man deep ſighing thus replied,</l>
<l>I'm fraid (quoth he) this will not ſoone betide,</l>
<l>My heart could wiſh to morrow was the day</l>
<l>They were all hid, or elſe would run away;</l>
<l>If it ſhould happen ſo (even for their ſake)</l>
<l>I'le drinke their health of ſtrong <hi>Avernus</hi> Lake;</l>
<l>I would (in memory of them) keepe that day</l>
<l>A joyfull feaſt; and will for ever pray</l>
<l>That all thoſe Traytors who their King withſtood,</l>
<l>May dye (like <hi>Pilate</hi>) voyding guts, and bloud;</l>
<l>And after that, they <hi>Ixions</hi> paines may feele,</l>
<l>By turning a perpetuall burning wheele;</l>
<l>Or keepe a Senat with their Grandſire Nick,</l>
<l>And in his Kingdome play him ſuch a tricke</l>
<l>(As they have lately in <hi>Campania</hi> done)</l>
<l>And become heires of his eternall throne;</l>
<l>There's worke enough for them, and all their rable,</l>
<l>Their Clearks may be made Knights of his round table.</l>
<l>His Kingdom's large, employments they may have,</l>
<l>And every thing he gives, if they can crave.</l>
</lg>
<lg>
<l>Whileſt yet he ſpake, behold within our view</l>
<l>Came trooping o're the banke another crew</l>
<l>Of warlike Souldiers; but their cloathes were thin,</l>
<l>The State turn'd Shearemen, and had pincht their <gap reason="illegible" extent="1 letter">
<desc>•</desc>
</gap>kin.</l>
</lg>
<lg>
<l>What meane theſe men (quoth I) that they repaire</l>
<l>Unto this place? what buſineſſe have they here?</l>
</lg>
<lg>
<l>Theſe are the States old beaten Souldiers, who</l>
<l>Want their Arrears, dew many months ago:</l>
<l>They come to aske them; I am full perſwaded,</l>
<l>With States high looks, they ſcarce will be out-Jaded.</l>
<l>They are ſtout men, they have a reſolution</l>
<l>To bring to try all each States mans tranſgreſſion,</l>
<l>And in a weeke redreſſe our grievance more</l>
<l>Than our brave State hath done ſixty before.</l>
<l>Well then (quoth I) let's heare their full diſcourſe,</l>
<l>And ſee which of them's Maſter of the Purſe.</l>
</lg>
<lg>
<pb facs="tcp:114360:4"/>
<!-- PDF PAGE 16 -->
<l>Out comes the Speaker with his hat in hand,</l>
<l>And briefly thus begins; What's your demands?</l>
<l>What ſervice have you done for what you crave?</l>
<l>Or how can you account for what you have?</l>
<l>Your ſervice muſt unto the world be knowne,</l>
<l>And what you've had muſt unto us be ſhowne,</l>
<l>Before we can diſpence upon Areares,</l>
<l>Or any thing be done, but what appeares</l>
<l>For th' publique good, and not for private ends:</l>
<l>I am in haſt, adieu my honeſt friends.</l>
</lg>
<lg>
<l>Well ſaid brave Speaker, thou haſt uttered more</l>
<l>Then all thy fellow Senators before</l>
<l>Have ever done; when thou doſt us confound,</l>
<l>Thy Pay ſhall be one hundred thouſand Pound.</l>
<l>Firſt we demand all our Arreares that's due,</l>
<l>For what we crave our ſervice is in view</l>
<l>To all the world: we ventured have our ſelves</l>
<l>T' enrich a crew of all devouring Elves.</l>
<l>We have been Traytors. Tyrants to maintaine;</l>
<l>And ſtill we Traytored are if we do claime</l>
<l>That is our due from you; O bleſſed State!</l>
<l>Yet to your Country moſt inveterate.</l>
<l>Forty Millions you have already had</l>
<l>O'th' Publique ſtocke: muſt not account be made?</l>
<l>You have diſpoſ'd of it amongſt your friends,</l>
<l>Not for the Publique, but to private ends.</l>
<l>Thouſands of harmleſſe men for you have dy'd.</l>
<l>Maintain'd your Treaſon, Tyranny, and Pride.</l>
<l>But now your cheating is found out and croſt,</l>
<l>And if you looke not to't all will be loſt.</l>
<l>As we are Souldiers, wee'l be very faire,</l>
<l>You ſhall not what's our due amongſt you ſhare.</l>
<l>Be wiſe in time, conſider what you doe,</l>
<l>Beware your after-wits prove not your woe.</l>
<l>So we departed and the State adjourn'd</l>
<l>Untill the morning, and my Spirit return'd</l>
<l>Unto its former Priſtine habitation</l>
<l>When it had view'd <hi>Campanias</hi> deſolation.</l>
</lg>
<epigraph>
<q>Quis talia fando temperat a Lacrymis<g ref="char:punc">▪</g>
</q>
</epigraph>
<trailer>FINIS.</trailer>
</div>
<div type="text">
<pb facs="tcp:114360:5"/>
<!-- PDF PAGE 17 -->
<gap reason="missing" extent="1+ pages">
<desc>〈1… pages missing〉</desc>
</gap>
<p>in the Nation ought to preſerve the Nation as much as in him lyes; It is a univerſall principle, <hi>non nobis ſolum nati ſumus, &c.</hi> We are not born for our ſelves alone; but the <hi>Country</hi> in which we live challenges an inte<g ref="char:EOLhyphen"/>reſt in us, this principle made many rejoyce in dying, eſteeming it, <hi>dulce & decorum pro patria mori.</hi>
</p>
<p n="3">3. <hi>The Law of this Kingdome</hi> (by which we may expect to ſtand or fall) ſecures us in this Kingdome, we have this <hi>Maxime,</hi> that <hi>ſolus populi is ſuprema lex,</hi> The ſafety of the people is the ſupremeſt law; this was the hinge we moved upon, the Kingdomes ſafe<g ref="char:EOLhyphen"/>ty was endangered, and withent a ſpeedy application of a timely preſervative was likely to be conſumed: the beſt preſerva<g ref="char:EOLhyphen"/>tive we could ſee, was the ſecurity of his Ma<g ref="char:EOLhyphen"/>jeſties perſon, which our act hath effected. Whoſe enemies are ſo dull, and whoſe un<g ref="char:EOLhyphen"/>derſtanding is ſo ſtupified & ſottiſhly blind, but may remember and know what a ſad diſaſter hath befallen the Kingdome, in the expence of ſo much blood and treaſure, by the ſurpriſing of his Majeſties Perſon in the
<pb facs="tcp:114360:5"/>
<!-- PDF PAGE 17 -->late warres<g ref="char:punc">▪</g> who can but know, had they not had his perſon for their deſignes had proved abortive: We well know there was a deſigne to ſeize on his Majeſty, to raiſe a new Army, and unnaturally to involve this Kingdome in its own blood, and ſo to ren<g ref="char:EOLhyphen"/>der our latter end miſerably worſe then our beginning, but this we thought our ſelves bound to prevent if poſſible, which we ſtill judge and doubt not to prove it, and is yet lawfull for us to doe. As the King is by the law of this Kindome bound to govern and ſecure us according to the Law, ſo are wee engaged to ſecure his Perſon againſt the vio<g ref="char:EOLhyphen"/>laters of the Law, which we have, through the bleſſing of God accompliſhed, Our end was not his enthrallment, bondage and ru<g ref="char:EOLhyphen"/>ine, as by our actions may appear, but his ſafety, and the Kingdoms preſervation, which otherwi<gap reason="illegible" extent="1 letter">
<desc>•</desc>
</gap>e we juſtly fear, had both been en<g ref="char:EOLhyphen"/>dange<gap reason="illegible" extent="1 letter">
<desc>•</desc>
</gap>ed; ſuppoſe the King through igno<g ref="char:EOLhyphen"/>rance of traitors intention to deſtroy His Perſon or His Kingdome ſhould expoſe him<g ref="char:EOLhyphen"/>ſelf to the mercy of him that ſought his life, do you imagine it would be treaſonable for
<pb facs="tcp:114360:6"/>
<!-- PDF PAGE 18 -->any one to remove his Majeſtie though without hi<gap reason="illegible" extent="1 letter">
<desc>•</desc>
</gap> conſent from the place the traytor ſought his life in, and to preſerve him? but the caſe is yet more faire for us, His judgement being ſatisfied, his will w<gap reason="illegible" extent="2 letters">
<desc>••</desc>
</gap> likewiſe concurring to his remove, we hope this our action will be recented in good part by all the Nati<g ref="char:EOLhyphen"/>on for whoſe good it was effected. Had the King been ſurpriſed, another army been under his name raiſed, the Nation once more wallowed in its owne blood; then ſurely but too late, would the people have cryed out, oh that ſome had been ſtirred up to have ſtood in this breach.</p>
<p n="4">IIII. The Commiſſion from the Parliament (whom ſome ſay though with more boldneſſe then judge<g ref="char:EOLhyphen"/>ment, more malice then wiſdome, and more envy then prudence or honeſty, wee have rebelled againſt and acted contrary to in this action) acquits us, for by our Commiſſion we are bound to ſeek the preſerva<g ref="char:EOLhyphen"/>tion of the Kings perſon, whether we have not ſo done let all the Kingdome judge: what hurt to his perſon have we done? what hurt to the Kingdome have we done? we are not conſcions to our ſelves that we have in this done amiſſe, who hath cauſe to complain, ſurely none can nor will, except thoſe who had thought to have made all men dance after their pipes, kiſſe their hands, and reſigne up their birth<g ref="char:EOLhyphen"/>rights, liberties and lives to their <hi>arbitrary</hi> and <hi>tyran<g ref="char:EOLhyphen"/>nicall, lawleſse, boundleſse</hi> wills, theſe <hi>H<gap reason="illegible" extent="1 letter">
<desc>•</desc>
</gap>man</hi>-like are mad to think a poore <hi>Mordecai</hi> will not ſtand cap in hand, bow his knee, and bend unto them.</p>
<trailer>FINIS.</trailer>
</div>
</body>
</text>
</TEI>
| 74.72488 | 991 | 0.600768 |
ed00088ffdd561d4a09070229a3cffbfd8e5072f | 4,586 | xml | XML | adyenv6fulfilmentprocess/resources/adyenv6fulfilmentprocess-spring.xml | TomPalfreyman/adyen-hybris | 46865bad8aee2bbd57cdb2e9c94c806c883173e4 | [
"MIT"
] | 28 | 2017-03-28T12:43:56.000Z | 2021-12-15T04:41:21.000Z | adyenv6fulfilmentprocess/resources/adyenv6fulfilmentprocess-spring.xml | eci99/adyen-hybris | e7672919bd21b8f16d9ef76dc9e6b0fcf5d409d0 | [
"MIT"
] | 62 | 2017-03-16T17:32:23.000Z | 2022-02-23T12:52:44.000Z | adyenv6fulfilmentprocess/resources/adyenv6fulfilmentprocess-spring.xml | eci99/adyen-hybris | e7672919bd21b8f16d9ef76dc9e6b0fcf5d409d0 | [
"MIT"
] | 31 | 2017-02-28T08:08:30.000Z | 2022-02-24T07:47:00.000Z | <?xml version="1.0" encoding="UTF-8"?>
<!--
~ [y] hybris Platform
~
~ Copyright (c) 2000-2016 SAP SE
~ All rights reserved.
~
~ This software is the confidential and proprietary information of SAP
~ Hybris ("Confidential Information"). You shall not disclose such
~ Confidential Information and shall use it only in accordance with the
~ terms of the license agreement you entered into with SAP Hybris.
-->
<beans xmlns="http://www.springframework.org/schema/beans"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xmlns:context="http://www.springframework.org/schema/context"
xsi:schemaLocation="http://www.springframework.org/schema/beans
http://www.springframework.org/schema/beans/spring-beans.xsd
http://www.springframework.org/schema/context
http://www.springframework.org/schema/context/spring-context.xsd">
<!--
The hybris platform provides one single Spring application context for beans located at the jalo layer.
Each extension can add beans to this context by specifying them at this configuration file.
You can use and/or redefine beans defined at configuration files of other extensions as well as
adding new one.
If you want to locate this file at a different location or want to use several files for better,
structuring, please use the '<yourextension>.application-context' property at your project.properties file.
There you can specify a comma separated list of files where first is tried to find a file per classpath and
then per file system.
If you want to configure beans for your web module please have a look at
your web/webroot/WEB-INF/<extname>-web-spring.xml.
-->
<!-- Example how to override a manager -->
<!--
<bean id="core.productManager" class="com.adyen.v6.jalo.Adyenv6fulfilmentprocessProductManager" init-method="init" destroy-method="destroy" />
-->
<!-- Example how to configure the class to use for jalo session creation -->
<!--
<bean id="jalosession" class="de.hybris.platform.jalo.JaloSessionFactory">
<property name="targetClassName" value="com.adyen.v6.jalo.Adyenv6fulfilmentprocessJaloSession"/>
</bean>
-->
<!-- Example how to override an item -->
<!--
<bean id="de.hybris.platform.jalo.product.Product" class="com.adyen.v6.jalo.Adyenv6fulfilmentprocessProduct" scope="prototype" />
-->
<!--
Example how to register and use an AOP aspect
Also see http://static.springframework.org/spring/docs/2.5.x/reference/aop.html
-->
<!--
<bean id="adyenv6fulfilmentprocessProfBean" class="com.adyen.v6.aop.Adyenv6fulfilmentprocessProfilingAspect"/>
<aop:config proxy-target-class="true">
<aop:aspect id="adyenv6fulfilmentprocessProfAspect" ref="adyenv6fulfilmentprocessProfBean" >
<aop:pointcut id="profiledMethods"
expression="execution(* getModificationTime(..))" />
<aop:around pointcut-ref="profiledMethods" method="profile" />
</aop:aspect>
</aop:config>
-->
<!-- some other examples of a pointcut that matches everything:
<aop:pointcut id="profiledMethods"
expression="bean(de.hybris.platform.jalo.user.Customer) &&
!execution(* getPK(..))" />
<aop:pointcut id="profiledMethods" expression="execution(* *(..))" />
-->
<context:annotation-config/>
<!-- Process Definitions -->
<alias name="adyenOrderProcessDefinitionResource" alias="orderProcessDefinitionResource"/>
<bean id="adyenOrderProcessDefinitionResource"
class="de.hybris.platform.processengine.definition.ProcessDefinitionResource">
<property name="resource" value="classpath:/adyenv6fulfilmentprocess/process/order-process.xml"/>
</bean>
<!-- Process Actions -->
<import resource="/adyenv6fulfilmentprocess/process/order-process-spring.xml"/>
<alias name="adyenImmediateCancelRequestExecutor" alias="immediateCancelRequestExecutor"/>
<bean id="adyenImmediateCancelRequestExecutor"
class="de.hybris.platform.ordercancel.impl.executors.ImmediateCancelRequestExecutor"
scope="prototype">
<property name="modelService" ref="modelService"/>
<property name="orderCancelRecordsHandler" ref="orderCancelRecordsHandler"/>
<property name="completeCancelStatusChangeStrategy" ref="setCancellledStrategy"/>
<property name="paymentServiceAdapter" ref="adyenOrderCancelPaymentServiceAdapter"/>
</bean>
</beans>
| 44.524272 | 149 | 0.701047 |
3a31402699257e191a24f6c1eb2ae1c1cb2a68f8 | 1,057 | xml | XML | default/data/ui/views/_refresh.xml | geekusa/search_catalog | 06572ed90e578f12fad576b61803741a9c2bf770 | [
"Apache-2.0",
"MIT"
] | 1 | 2019-01-11T17:30:39.000Z | 2019-01-11T17:30:39.000Z | default/data/ui/views/_refresh.xml | geekusa/search_catalog | 06572ed90e578f12fad576b61803741a9c2bf770 | [
"Apache-2.0",
"MIT"
] | 1 | 2020-05-26T15:38:10.000Z | 2020-06-17T16:52:20.000Z | default/data/ui/views/_refresh.xml | geekusa/search_catalog | 06572ed90e578f12fad576b61803741a9c2bf770 | [
"Apache-2.0",
"MIT"
] | null | null | null | <form hideEdit="true">
<label>Generate Dashboards</label>
<search id="base_search">
<query>|generatedashboards</query>
</search>
<fieldset submitButton="true">
<input type="radio" token="testmode" depends="$hidden$">
<label>testmode</label>
<choice value="false">false</choice>
<default>false</default>
<initialValue>false</initialValue>
</input>
</fieldset>
<row>
<panel>
<html>
<div>Press the <b>Submit</b> button (above) to generate the new dashboards. Then use the <b>Refresh</b> button to open refresh controls for nav and views or alternatively restart Splunk</div><br/>
<div align="left" style="font-size:12px">
<a href="/debug/refresh?entity=/data/ui/views&entity=/data/ui/nav" class="btn btn-primary" target="_blank">Refresh</a>
</div>
</html>
</panel>
</row>
<row>
<panel>
<table>
<search base="base_search">
</search>
<option name="drilldown">none</option>
</table>
</panel>
</row>
</form>
| 31.088235 | 204 | 0.613056 |
31257d7405fb454f44c03c632eb75c4e03b6a4e5 | 617 | xml | XML | phpcs.xml | shapecode/doctrine-session-handler | 092aa44da42a8d2d15626ec785a715b51702ea45 | [
"MIT"
] | null | null | null | phpcs.xml | shapecode/doctrine-session-handler | 092aa44da42a8d2d15626ec785a715b51702ea45 | [
"MIT"
] | null | null | null | phpcs.xml | shapecode/doctrine-session-handler | 092aa44da42a8d2d15626ec785a715b51702ea45 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<ruleset xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="vendor/squizlabs/php_codesniffer/phpcs.xsd">
<arg name="basepath" value="."/>
<arg name="colors"/>
<arg name="extensions" value="php"/>
<arg name="tab-width" value="4"/>
<config name="php_version" value="80106"/>
<file>src/</file>
<file>tests/</file>
<rule ref="./vendor/doctrine/coding-standard/lib/Doctrine/ruleset.xml">
<exclude name="SlevomatCodingStandard.Classes.SuperfluousInterfaceNaming.SuperfluousSuffix"/>
</rule>
</ruleset>
| 34.277778 | 138 | 0.683955 |
95c78481121a86b4d316cf135998ff1ad76303ed | 1,610 | xml | XML | CleanUI/SteamlineIcons/src/main/res/drawable/streamline_interface_help_customer_support_3.xml | JonathandelaSen/CleanUI | b9de3278ce3cac83a7c546bfadc91fe3d40bbf95 | [
"Apache-2.0"
] | 19 | 2020-10-11T08:22:32.000Z | 2021-12-25T18:29:16.000Z | CleanUI/SteamlineIcons/src/main/res/drawable/streamline_interface_help_customer_support_3.xml | JonathandelaSen/CleanUI | b9de3278ce3cac83a7c546bfadc91fe3d40bbf95 | [
"Apache-2.0"
] | null | null | null | CleanUI/SteamlineIcons/src/main/res/drawable/streamline_interface_help_customer_support_3.xml | JonathandelaSen/CleanUI | b9de3278ce3cac83a7c546bfadc91fe3d40bbf95 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<vector xmlns:android="http://schemas.android.com/apk/res/android"
android:width="14dp"
android:height="14dp"
android:viewportWidth="14"
android:viewportHeight="14">
<path
android:strokeColor="#000"
android:strokeWidth="1"
android:strokeLineJoin="round"
android:strokeLineCap="round"
android:pathData="M2.58,6V4.755A4.34,4.34,0,0,1,7,0.5H7a4.34,4.34,0,0,1,4.42,4.255V6" />
<path
android:strokeColor="#000"
android:strokeWidth="1"
android:strokeLineJoin="round"
android:strokeLineCap="round"
android:pathData="M1.5,6H3a0.5 0.5 ,0,0,1,0.5 0.5 V9.25a0.5 0.5 ,0,0,1-0.5 0.5 H1.5a1,1,0,0,1-1-1V7A1,1,0,0,1,1.5,6Z" />
<path
android:strokeColor="#000"
android:strokeWidth="1"
android:strokeLineJoin="round"
android:strokeLineCap="round"
android:pathData="M11.5,6H13a0.5 0.5 ,0,0,1,0.5 0.5 V9.25a0.5 0.5 ,0,0,1-0.5 0.5 H11.5a1,1,0,0,1-1-1V7a1,1,0,0,1,1-1Z" />
<path
android:strokeColor="#000"
android:strokeWidth="1"
android:strokeLineJoin="round"
android:strokeLineCap="round"
android:pathData="M9.34,12.5a2.041,2.041,0,0,0,2.08-2h0V9.75" />
<path
android:strokeColor="#000"
android:strokeWidth="1"
android:strokeLineJoin="round"
android:strokeLineCap="round"
android:pathData="M 7.22 11.5 L 8.34 11.5 Q 9.34 11.5 9.34 12.5 L 9.34 12.5 Q 9.34 13.5 8.34 13.5 L 7.22 13.5 Q 6.22 13.5 6.22 12.5 L 6.22 12.5 Q 6.22 11.5 7.22 11.5 Z" />
</vector> | 42.368421 | 179 | 0.613043 |
6a8d0f1df6da568cb27984386eb007b8fcaa5c58 | 2,536 | xsd | XML | lib-integration-java/src/main/resources/fpml/confirmation/example-extension-5-10.xsd | sullivan-da/lib-message-integration | 2b50eecb29981c4abeb9e949a59374c5935ae020 | [
"Apache-2.0"
] | 1 | 2021-04-16T01:34:27.000Z | 2021-04-16T01:34:27.000Z | confirmation/example-extension-5-10.xsd | accordproject/org.accordproject.fpml.ecore | 89fab9e2bd41e7654e6d6ffcfd5bf29f392c5acc | [
"Apache-2.0"
] | 12 | 2019-04-17T12:36:35.000Z | 2021-09-29T14:07:29.000Z | confirmation/example-extension-5-10.xsd | accordproject/org.accordproject.fpml.ecore | 89fab9e2bd41e7654e6d6ffcfd5bf29f392c5acc | [
"Apache-2.0"
] | 2 | 2020-06-03T08:03:59.000Z | 2021-09-03T22:09:29.000Z | <?xml version="1.0" encoding="utf-8"?>
<!--
== Copyright (c) 2002-2018 All rights reserved.
== Financial Products Markup Language is subject to the FpML public license.
== A copy of this license is available at http://www.fpml.org/license/license.html
-->
<xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:ecore="http://www.eclipse.org/emf/2002/Ecore" xmlns="http://www.abc.com/extension-1-10/confirmation" xmlns:dsig="http://www.w3.org/2000/09/xmldsig#" xmlns:fpml="http://www.fpml.org/FpML-5/confirmation" fpml:dummy="force-prefix" targetNamespace="http://www.abc.com/extension-1-10/confirmation" version="$Revision: 11946 $" elementFormDefault="qualified" attributeFormDefault="unqualified">
<!-- import FpML schema -->
<xsd:import namespace="http://www.fpml.org/FpML-5/confirmation" schemaLocation="fpml-main-5-10.xsd" />
<!-- example product -->
<xsd:complexType name="ForwardSale">
<xsd:annotation>
<xsd:documentation xml:lang="en">A simple example product that is a forward purchase or sale of an underlying asset.</xsd:documentation>
</xsd:annotation>
<xsd:complexContent>
<xsd:extension base="fpml:Product">
<xsd:sequence>
<xsd:group ref="fpml:BuyerSeller.model">
<xsd:annotation>
<xsd:documentation xml:lang="en">References to the buyer and seller of the asset.</xsd:documentation>
</xsd:annotation>
</xsd:group>
<xsd:element ref="fpml:underlyingAsset">
<xsd:annotation>
<xsd:documentation xml:lang="en">This is the underlying asset substitution group, so it can contain any underlying asset in that group.</xsd:documentation>
</xsd:annotation>
</xsd:element>
<xsd:element name="forwardSaleDate" type="xsd:date">
<xsd:annotation>
<xsd:documentation xml:lang="en">The date on which the sale will take place.</xsd:documentation>
</xsd:annotation>
</xsd:element>
<xsd:element name="settlement" type="fpml:Payment">
<xsd:annotation>
<xsd:documentation xml:lang="en">The details of the settlement.</xsd:documentation>
</xsd:annotation>
</xsd:element>
<xsd:element name="price" type="fpml:Price" />
</xsd:sequence>
</xsd:extension>
</xsd:complexContent>
</xsd:complexType>
<xsd:element name="forward" type="ForwardSale" substitutionGroup="fpml:product" />
</xsd:schema>
| 55.130435 | 452 | 0.649054 |
aeeae5d8d74fcba4c820ac3be31f1299671b5bdc | 8,340 | xml | XML | app/src/main/res/layout/activity_details.xml | Iyamu-J/Fanbox | eef9ec2982982c4bc71299e444e87780ec8fb7f0 | [
"MIT"
] | null | null | null | app/src/main/res/layout/activity_details.xml | Iyamu-J/Fanbox | eef9ec2982982c4bc71299e444e87780ec8fb7f0 | [
"MIT"
] | null | null | null | app/src/main/res/layout/activity_details.xml | Iyamu-J/Fanbox | eef9ec2982982c4bc71299e444e87780ec8fb7f0 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<layout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:app="http://schemas.android.com/apk/res-auto"
xmlns:tools="http://schemas.android.com/tools">
<data>
<variable
name="letter"
type="space.fanbox.android.fanbox.model.Letter" />
<variable
name="presenter"
type="space.fanbox.android.fanbox.listenerbindings.DetailsPresenter" />
<import type="android.view.View" />
</data>
<ScrollView
android:layout_width="match_parent"
android:layout_height="match_parent"
android:fillViewport="true"
tools:context=".ui.DetailsActivity">
<LinearLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:orientation="vertical">
<TextView
android:id="@+id/details_date_created"
style="@style/textStyle"
android:drawableStart="@drawable/ic_date"
android:drawablePadding="@dimen/drawable_padding"
android:textAlignment="viewStart"
android:textColor="@color/colorPrimaryText"
android:textSize="@dimen/date_created_text_size"
app:formatDetailsDate="@{letter.date_created}"
tools:text="@tools:sample/date/mmddyy" />
<TextView
android:id="@+id/details_recipient"
style="@style/textStyle"
android:text="@{@string/format_recipient(letter.recipient)}"
android:textColor="@color/colorPrimaryText"
tools:text="@tools:sample/full_names" />
<TextView
android:id="@+id/details_subject"
style="@style/textStyle"
android:text="@{letter.subject}"
android:textAlignment="center"
android:textColor="@color/colorPrimaryText"
android:textSize="@dimen/text_size_20"
android:textStyle="bold"
tools:text="@tools:sample/lorem" />
<TextView
android:id="@+id/details_body"
style="@style/textStyle"
android:text="@{letter.body}"
android:textColor="@color/colorSecondaryText"
android:textSize="@dimen/text_size_16"
android:textStyle="italic"
tools:text="@tools:sample/lorem" />
<androidx.cardview.widget.CardView
android:layout_width="match_parent"
android:layout_height="@dimen/card_height"
android:layout_marginStart="@dimen/layout_margin_16"
android:layout_marginTop="@dimen/layout_margin_8"
android:layout_marginEnd="@dimen/layout_margin_16"
app:cardCornerRadius="@dimen/card_view_corner_radius"
app:cardPreventCornerOverlap="true"
app:cardUseCompatPadding="true"
app:elevation="@dimen/card_elevation"
app:showCard="@{letter.attachment}">
<ImageView
android:id="@+id/details_attachment"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:contentDescription="@string/details_attachment_content_description"
android:scaleType="centerCrop"
app:imageUrl="@{letter.attachment}"
tools:srcCompat="@tools:sample/backgrounds/scenic[15]" />
</androidx.cardview.widget.CardView>
<TextView
android:id="@+id/details_closing"
style="@style/textStyle"
android:text="@{letter.closing}"
android:textAlignment="viewEnd"
android:textColor="@color/colorSecondaryText"
tools:text="Yours Sincerely," />
<TextView
android:id="@+id/details_sender_name"
style="@style/textStyle"
android:text="@{letter.sender_name}"
android:textAlignment="viewEnd"
android:textColor="@color/colorPrimaryText"
android:textStyle="bold"
tools:text="@tools:sample/full_names" />
<LinearLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_marginStart="@dimen/layout_margin_16"
android:layout_marginTop="@dimen/layout_margin_16"
android:layout_marginEnd="@dimen/layout_margin_16"
android:orientation="horizontal">
<com.google.android.material.chip.ChipGroup
android:id="@+id/details_category_chip_group"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
app:chipDetailsCategory="@{letter.category}">
</com.google.android.material.chip.ChipGroup>
<com.google.android.material.chip.ChipGroup
android:id="@+id/details_tags_chip_group"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginStart="@dimen/tags_chip_group_layout_margin_start"
app:chipDetailsTags="@{letter.tags}">
</com.google.android.material.chip.ChipGroup>
</LinearLayout>
<androidx.constraintlayout.widget.ConstraintLayout
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:layout_marginStart="@dimen/layout_margin_16"
android:layout_marginTop="@dimen/layout_margin_16"
android:layout_marginEnd="@dimen/layout_margin_16"
android:layout_marginBottom="@dimen/layout_margin_16">
<ImageButton
android:id="@+id/details_share"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:background="?attr/selectableItemBackgroundBorderless"
android:contentDescription="@string/details_share_content_description"
android:onClick="@{(view) -> presenter.onShareClick(letter)}"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toTopOf="parent"
app:srcCompat="@drawable/ic_share" />
<TextView
android:id="@+id/details_love"
style="@style/constraintTextStyle"
android:drawableStart="@drawable/ic_sentiment_satisfied"
android:text="@{letter.love}"
android:textColor="@color/colorSecondaryText"
app:layout_constraintEnd_toStartOf="@id/details_hate"
app:layout_constraintTop_toTopOf="parent"
tools:text="30" />
<TextView
android:id="@+id/details_hate"
style="@style/constraintTextStyle"
android:drawableStart="@drawable/ic_sentiment_dissatisfied"
android:text="@{letter.hate}"
android:textColor="@color/colorSecondaryText"
app:layout_constraintEnd_toStartOf="@id/details_views"
app:layout_constraintTop_toTopOf="parent"
tools:text="30" />
<TextView
android:id="@+id/details_views"
style="@style/constraintTextStyle"
android:layout_marginEnd="0dp"
android:drawableStart="@drawable/ic_views"
android:text="@{letter.views}"
android:textColor="@color/colorSecondaryText"
app:layout_constraintEnd_toEndOf="parent"
app:layout_constraintTop_toTopOf="parent"
tools:text="30" />
</androidx.constraintlayout.widget.ConstraintLayout>
</LinearLayout>
</ScrollView>
</layout> | 44.126984 | 95 | 0.569544 |
97433e4fa5d7d81fd6c7c30138697a4afdbde206 | 1,965 | xml | XML | src/main/resources/META-INF/plugin.xml | The-Hope/CodingHelper | 8e681332cf38f8d1a273847fc32618e1709a79c2 | [
"Apache-2.0"
] | 2 | 2020-04-14T08:50:49.000Z | 2020-06-30T06:31:29.000Z | src/main/resources/META-INF/plugin.xml | The-Hope/CodingHelper | 8e681332cf38f8d1a273847fc32618e1709a79c2 | [
"Apache-2.0"
] | 2 | 2020-10-23T01:30:15.000Z | 2020-10-23T16:08:24.000Z | src/main/resources/META-INF/plugin.xml | The-Hope/CodingHelper | 8e681332cf38f8d1a273847fc32618e1709a79c2 | [
"Apache-2.0"
] | 2 | 2020-04-14T08:53:42.000Z | 2020-10-23T01:39:37.000Z | <idea-plugin>
<id>cn.xunyard.coding-helper</id>
<name>Coding Helper</name>
<vendor email="xunyard@gmail.com" url="https://github.com/xunyard">xunyard</vendor>
<description><![CDATA[A tool for coding help such as service document building and i18n error code translate found and set]]></description>
<depends>com.intellij.modules.platform</depends>
<depends>com.intellij.modules.java</depends>
<extensions defaultExtensionNs="com.intellij">
<applicationService serviceImplementation="cn.xunyard.idea.coding.doc.DocumentBuilderSettings"/>
<projectService serviceImplementation="cn.xunyard.idea.coding.i18n.I18nInspectionSettings"/>
<localInspection language="JAVA"
displayName="I18n: error code without target translate"
groupPath="Java"
groupBundle="messages.InspectionsBundle"
groupKey="group.names.internationalization.issues"
enabledByDefault="true"
level="WARNING"
implementationClass="cn.xunyard.idea.coding.i18n.inspection.ErrorCodeWithoutTranslateInspection"
/>
</extensions>
<actions>
<group id="cn.xunyard.coding.GroupActions" text="Coding Helper" popup="true">
<add-to-group group-id="ToolsMenu" anchor="first"/>
<action id="cn.xunyard.doc" class="cn.xunyard.idea.coding.doc.action.DocumentBuildingAction"
text="Build Service Document"
description="A simple tool for service document building.">
</action>
<action id="cn.xunyard.i18n" class="cn.xunyard.idea.coding.i18n.action.I18nSettingsAction"
text="I18n Settings"
description="A simple tool for error translate inspection of i18n.">
</action>
</group>
</actions>
</idea-plugin> | 50.384615 | 143 | 0.625954 |
5184a511cceeb57e24d61071657b79204b3bc353 | 17,337 | xml | XML | pointstreak/xml/3343_batting.xml | octonion/baseball-public | 66c406b5855b61d851303069487c8f7e5a885812 | [
"MIT"
] | 41 | 2015-01-04T21:41:10.000Z | 2021-09-22T12:09:57.000Z | pointstreak/xml/3343_batting.xml | octonion/baseball-public | 66c406b5855b61d851303069487c8f7e5a885812 | [
"MIT"
] | 1 | 2015-01-10T08:05:55.000Z | 2015-01-10T08:05:55.000Z | pointstreak/xml/3343_batting.xml | octonion/baseball-public | 66c406b5855b61d851303069487c8f7e5a885812 | [
"MIT"
] | 14 | 2015-01-10T20:15:00.000Z | 2021-09-22T12:09:58.000Z | <?xml version="1.0" encoding="UTF-8"?>
<stats>
<hr>
<batter>
<jersey>7</jersey>
<playername>Russell, T</playername>
<teamname></teamname>
<ab>49</ab>
<ab>49</ab>
<runs>8</runs>
<hits>20</hits>
<bib>5</bib>
<trib>2</trib>
<hr>1</hr>
<rbi>11</rbi>
<bb>12</bb>
<hp>0</hp>
<so>7</so>
<sf>1</sf>
<sb>5</sb>
<dp>1</dp>
<obp>.516</obp>
<slg>.653</slg>
<avg>.408</avg>
</batter>
<batter>
<jersey>20</jersey>
<playername>Hodges, J</playername>
<teamname></teamname>
<ab>37</ab>
<ab>37</ab>
<runs>6</runs>
<hits>8</hits>
<bib>2</bib>
<trib>0</trib>
<hr>1</hr>
<rbi>6</rbi>
<bb>4</bb>
<hp>0</hp>
<so>9</so>
<sf>0</sf>
<sb>4</sb>
<dp>1</dp>
<obp>.293</obp>
<slg>.351</slg>
<avg>.216</avg>
</batter>
<batter>
<jersey>4</jersey>
<playername>Varley, M</playername>
<teamname></teamname>
<ab>46</ab>
<ab>46</ab>
<runs>8</runs>
<hits>9</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>11</rbi>
<bb>11</bb>
<hp>1</hp>
<so>5</so>
<sf>1</sf>
<sb>0</sb>
<dp>3</dp>
<obp>.356</obp>
<slg>.196</slg>
<avg>.196</avg>
</batter>
<batter>
<jersey>10</jersey>
<playername>Warren, D</playername>
<teamname></teamname>
<ab>20</ab>
<ab>20</ab>
<runs>6</runs>
<hits>8</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>2</rbi>
<bb>7</bb>
<hp>1</hp>
<so>5</so>
<sf>0</sf>
<sb>6</sb>
<dp>0</dp>
<obp>.571</obp>
<slg>.400</slg>
<avg>.400</avg>
</batter>
<batter>
<jersey>13</jersey>
<playername>McKinlay, N</playername>
<teamname></teamname>
<ab>0</ab>
<ab>0</ab>
<runs>0</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>0</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
<batter>
<jersey>12</jersey>
<playername>Bryan, M</playername>
<teamname></teamname>
<ab>53</ab>
<ab>53</ab>
<runs>11</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>7</rbi>
<bb>7</bb>
<hp>0</hp>
<so>10</so>
<sf>1</sf>
<sb>8</sb>
<dp>2</dp>
<obp>.311</obp>
<slg>.264</slg>
<avg>.226</avg>
</batter>
<batter>
<jersey>16</jersey>
<playername>Long, J</playername>
<teamname></teamname>
<ab>14</ab>
<ab>14</ab>
<runs>2</runs>
<hits>3</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>1</rbi>
<bb>1</bb>
<hp>0</hp>
<so>5</so>
<sf>0</sf>
<sb>1</sb>
<dp>0</dp>
<obp>.267</obp>
<slg>.214</slg>
<avg>.214</avg>
</batter>
<batter>
<jersey>14</jersey>
<playername>Podmoroff, J</playername>
<teamname></teamname>
<ab>6</ab>
<ab>6</ab>
<runs>1</runs>
<hits>1</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>1</rbi>
<bb>1</bb>
<hp>0</hp>
<so>1</so>
<sf>1</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.250</obp>
<slg>.167</slg>
<avg>.167</avg>
</batter>
<batter>
<jersey>1</jersey>
<playername>Blaskovich, D</playername>
<teamname></teamname>
<ab>53</ab>
<ab>53</ab>
<runs>6</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>5</rbi>
<bb>3</bb>
<hp>1</hp>
<so>3</so>
<sf>0</sf>
<sb>6</sb>
<dp>2</dp>
<obp>.281</obp>
<slg>.264</slg>
<avg>.226</avg>
</batter>
<batter>
<jersey>9</jersey>
<playername>Wellington, M</playername>
<teamname></teamname>
<ab>34</ab>
<ab>34</ab>
<runs>4</runs>
<hits>8</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>4</rbi>
<bb>2</bb>
<hp>2</hp>
<so>10</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.316</obp>
<slg>.294</slg>
<avg>.235</avg>
</batter>
<batter>
<jersey>23</jersey>
<playername>Phillips, E</playername>
<teamname></teamname>
<ab>3</ab>
<ab>3</ab>
<runs>0</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>0</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
<batter>
<jersey>5</jersey>
<playername>Willow, E</playername>
<teamname></teamname>
<ab>19</ab>
<ab>19</ab>
<runs>1</runs>
<hits>4</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>2</rbi>
<bb>5</bb>
<hp>0</hp>
<so>6</so>
<sf>0</sf>
<sb>1</sb>
<dp>1</dp>
<obp>.375</obp>
<slg>.263</slg>
<avg>.211</avg>
</batter>
<batter>
<jersey>8</jersey>
<playername>Lum, D</playername>
<teamname></teamname>
<ab>36</ab>
<ab>36</ab>
<runs>3</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>5</rbi>
<bb>5</bb>
<hp>0</hp>
<so>12</so>
<sf>1</sf>
<sb>4</sb>
<dp>1</dp>
<obp>.405</obp>
<slg>.389</slg>
<avg>.333</avg>
</batter>
<batter>
<jersey>3</jersey>
<playername>Norris-Jones, K</playername>
<teamname></teamname>
<ab>0</ab>
<ab>0</ab>
<runs>1</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>1</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>1.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
<batter>
<jersey>15</jersey>
<playername>Donaldson, N</playername>
<teamname></teamname>
<ab>28</ab>
<ab>28</ab>
<runs>7</runs>
<hits>7</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>3</rbi>
<bb>6</bb>
<hp>0</hp>
<so>8</so>
<sf>0</sf>
<sb>2</sb>
<dp>3</dp>
<obp>.382</obp>
<slg>.286</slg>
<avg>.250</avg>
</batter>
<batter>
<jersey>21</jersey>
<playername>Somers, B</playername>
<teamname></teamname>
<ab>50</ab>
<ab>50</ab>
<runs>6</runs>
<hits>10</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>3</rbi>
<bb>3</bb>
<hp>0</hp>
<so>7</so>
<sf>0</sf>
<sb>1</sb>
<dp>0</dp>
<obp>.245</obp>
<slg>.220</slg>
<avg>.200</avg>
</batter>
</hr>
<avr>
<batter>
<jersey>7</jersey>
<playername>Russell, T</playername>
<teamname></teamname>
<ab>49</ab>
<ab>49</ab>
<runs>8</runs>
<hits>20</hits>
<bib>5</bib>
<trib>2</trib>
<hr>1</hr>
<rbi>11</rbi>
<bb>12</bb>
<hp>0</hp>
<so>7</so>
<sf>1</sf>
<sb>5</sb>
<dp>1</dp>
<obp>.516</obp>
<slg>.653</slg>
<avg>.408</avg>
</batter>
<batter>
<jersey>10</jersey>
<playername>Warren, D</playername>
<teamname></teamname>
<ab>20</ab>
<ab>20</ab>
<runs>6</runs>
<hits>8</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>2</rbi>
<bb>7</bb>
<hp>1</hp>
<so>5</so>
<sf>0</sf>
<sb>6</sb>
<dp>0</dp>
<obp>.571</obp>
<slg>.400</slg>
<avg>.400</avg>
</batter>
<batter>
<jersey>8</jersey>
<playername>Lum, D</playername>
<teamname></teamname>
<ab>36</ab>
<ab>36</ab>
<runs>3</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>5</rbi>
<bb>5</bb>
<hp>0</hp>
<so>12</so>
<sf>1</sf>
<sb>4</sb>
<dp>1</dp>
<obp>.405</obp>
<slg>.389</slg>
<avg>.333</avg>
</batter>
<batter>
<jersey>15</jersey>
<playername>Donaldson, N</playername>
<teamname></teamname>
<ab>28</ab>
<ab>28</ab>
<runs>7</runs>
<hits>7</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>3</rbi>
<bb>6</bb>
<hp>0</hp>
<so>8</so>
<sf>0</sf>
<sb>2</sb>
<dp>3</dp>
<obp>.382</obp>
<slg>.286</slg>
<avg>.250</avg>
</batter>
<batter>
<jersey>9</jersey>
<playername>Wellington, M</playername>
<teamname></teamname>
<ab>34</ab>
<ab>34</ab>
<runs>4</runs>
<hits>8</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>4</rbi>
<bb>2</bb>
<hp>2</hp>
<so>10</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.316</obp>
<slg>.294</slg>
<avg>.235</avg>
</batter>
<batter>
<jersey>1</jersey>
<playername>Blaskovich, D</playername>
<teamname></teamname>
<ab>53</ab>
<ab>53</ab>
<runs>6</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>5</rbi>
<bb>3</bb>
<hp>1</hp>
<so>3</so>
<sf>0</sf>
<sb>6</sb>
<dp>2</dp>
<obp>.281</obp>
<slg>.264</slg>
<avg>.226</avg>
</batter>
<batter>
<jersey>12</jersey>
<playername>Bryan, M</playername>
<teamname></teamname>
<ab>53</ab>
<ab>53</ab>
<runs>11</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>7</rbi>
<bb>7</bb>
<hp>0</hp>
<so>10</so>
<sf>1</sf>
<sb>8</sb>
<dp>2</dp>
<obp>.311</obp>
<slg>.264</slg>
<avg>.226</avg>
</batter>
<batter>
<jersey>20</jersey>
<playername>Hodges, J</playername>
<teamname></teamname>
<ab>37</ab>
<ab>37</ab>
<runs>6</runs>
<hits>8</hits>
<bib>2</bib>
<trib>0</trib>
<hr>1</hr>
<rbi>6</rbi>
<bb>4</bb>
<hp>0</hp>
<so>9</so>
<sf>0</sf>
<sb>4</sb>
<dp>1</dp>
<obp>.293</obp>
<slg>.351</slg>
<avg>.216</avg>
</batter>
<batter>
<jersey>16</jersey>
<playername>Long, J</playername>
<teamname></teamname>
<ab>14</ab>
<ab>14</ab>
<runs>2</runs>
<hits>3</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>1</rbi>
<bb>1</bb>
<hp>0</hp>
<so>5</so>
<sf>0</sf>
<sb>1</sb>
<dp>0</dp>
<obp>.267</obp>
<slg>.214</slg>
<avg>.214</avg>
</batter>
<batter>
<jersey>5</jersey>
<playername>Willow, E</playername>
<teamname></teamname>
<ab>19</ab>
<ab>19</ab>
<runs>1</runs>
<hits>4</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>2</rbi>
<bb>5</bb>
<hp>0</hp>
<so>6</so>
<sf>0</sf>
<sb>1</sb>
<dp>1</dp>
<obp>.375</obp>
<slg>.263</slg>
<avg>.211</avg>
</batter>
<batter>
<jersey>21</jersey>
<playername>Somers, B</playername>
<teamname></teamname>
<ab>50</ab>
<ab>50</ab>
<runs>6</runs>
<hits>10</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>3</rbi>
<bb>3</bb>
<hp>0</hp>
<so>7</so>
<sf>0</sf>
<sb>1</sb>
<dp>0</dp>
<obp>.245</obp>
<slg>.220</slg>
<avg>.200</avg>
</batter>
<batter>
<jersey>4</jersey>
<playername>Varley, M</playername>
<teamname></teamname>
<ab>46</ab>
<ab>46</ab>
<runs>8</runs>
<hits>9</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>11</rbi>
<bb>11</bb>
<hp>1</hp>
<so>5</so>
<sf>1</sf>
<sb>0</sb>
<dp>3</dp>
<obp>.356</obp>
<slg>.196</slg>
<avg>.196</avg>
</batter>
<batter>
<jersey>14</jersey>
<playername>Podmoroff, J</playername>
<teamname></teamname>
<ab>6</ab>
<ab>6</ab>
<runs>1</runs>
<hits>1</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>1</rbi>
<bb>1</bb>
<hp>0</hp>
<so>1</so>
<sf>1</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.250</obp>
<slg>.167</slg>
<avg>.167</avg>
</batter>
<batter>
<jersey>13</jersey>
<playername>McKinlay, N</playername>
<teamname></teamname>
<ab>0</ab>
<ab>0</ab>
<runs>0</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>0</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
<batter>
<jersey>3</jersey>
<playername>Norris-Jones, K</playername>
<teamname></teamname>
<ab>0</ab>
<ab>0</ab>
<runs>1</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>1</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>1.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
<batter>
<jersey>23</jersey>
<playername>Phillips, E</playername>
<teamname></teamname>
<ab>3</ab>
<ab>3</ab>
<runs>0</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>0</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
</avr>
<rbi>
<batter>
<jersey>7</jersey>
<playername>Russell, T</playername>
<teamname></teamname>
<ab>49</ab>
<ab>49</ab>
<runs>8</runs>
<hits>20</hits>
<bib>5</bib>
<trib>2</trib>
<hr>1</hr>
<rbi>11</rbi>
<bb>12</bb>
<hp>0</hp>
<so>7</so>
<sf>1</sf>
<sb>5</sb>
<dp>1</dp>
<obp>.516</obp>
<slg>.653</slg>
<avg>.408</avg>
</batter>
<batter>
<jersey>4</jersey>
<playername>Varley, M</playername>
<teamname></teamname>
<ab>46</ab>
<ab>46</ab>
<runs>8</runs>
<hits>9</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>11</rbi>
<bb>11</bb>
<hp>1</hp>
<so>5</so>
<sf>1</sf>
<sb>0</sb>
<dp>3</dp>
<obp>.356</obp>
<slg>.196</slg>
<avg>.196</avg>
</batter>
<batter>
<jersey>12</jersey>
<playername>Bryan, M</playername>
<teamname></teamname>
<ab>53</ab>
<ab>53</ab>
<runs>11</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>7</rbi>
<bb>7</bb>
<hp>0</hp>
<so>10</so>
<sf>1</sf>
<sb>8</sb>
<dp>2</dp>
<obp>.311</obp>
<slg>.264</slg>
<avg>.226</avg>
</batter>
<batter>
<jersey>20</jersey>
<playername>Hodges, J</playername>
<teamname></teamname>
<ab>37</ab>
<ab>37</ab>
<runs>6</runs>
<hits>8</hits>
<bib>2</bib>
<trib>0</trib>
<hr>1</hr>
<rbi>6</rbi>
<bb>4</bb>
<hp>0</hp>
<so>9</so>
<sf>0</sf>
<sb>4</sb>
<dp>1</dp>
<obp>.293</obp>
<slg>.351</slg>
<avg>.216</avg>
</batter>
<batter>
<jersey>8</jersey>
<playername>Lum, D</playername>
<teamname></teamname>
<ab>36</ab>
<ab>36</ab>
<runs>3</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>5</rbi>
<bb>5</bb>
<hp>0</hp>
<so>12</so>
<sf>1</sf>
<sb>4</sb>
<dp>1</dp>
<obp>.405</obp>
<slg>.389</slg>
<avg>.333</avg>
</batter>
<batter>
<jersey>1</jersey>
<playername>Blaskovich, D</playername>
<teamname></teamname>
<ab>53</ab>
<ab>53</ab>
<runs>6</runs>
<hits>12</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>5</rbi>
<bb>3</bb>
<hp>1</hp>
<so>3</so>
<sf>0</sf>
<sb>6</sb>
<dp>2</dp>
<obp>.281</obp>
<slg>.264</slg>
<avg>.226</avg>
</batter>
<batter>
<jersey>9</jersey>
<playername>Wellington, M</playername>
<teamname></teamname>
<ab>34</ab>
<ab>34</ab>
<runs>4</runs>
<hits>8</hits>
<bib>2</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>4</rbi>
<bb>2</bb>
<hp>2</hp>
<so>10</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.316</obp>
<slg>.294</slg>
<avg>.235</avg>
</batter>
<batter>
<jersey>15</jersey>
<playername>Donaldson, N</playername>
<teamname></teamname>
<ab>28</ab>
<ab>28</ab>
<runs>7</runs>
<hits>7</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>3</rbi>
<bb>6</bb>
<hp>0</hp>
<so>8</so>
<sf>0</sf>
<sb>2</sb>
<dp>3</dp>
<obp>.382</obp>
<slg>.286</slg>
<avg>.250</avg>
</batter>
<batter>
<jersey>21</jersey>
<playername>Somers, B</playername>
<teamname></teamname>
<ab>50</ab>
<ab>50</ab>
<runs>6</runs>
<hits>10</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>3</rbi>
<bb>3</bb>
<hp>0</hp>
<so>7</so>
<sf>0</sf>
<sb>1</sb>
<dp>0</dp>
<obp>.245</obp>
<slg>.220</slg>
<avg>.200</avg>
</batter>
<batter>
<jersey>10</jersey>
<playername>Warren, D</playername>
<teamname></teamname>
<ab>20</ab>
<ab>20</ab>
<runs>6</runs>
<hits>8</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>2</rbi>
<bb>7</bb>
<hp>1</hp>
<so>5</so>
<sf>0</sf>
<sb>6</sb>
<dp>0</dp>
<obp>.571</obp>
<slg>.400</slg>
<avg>.400</avg>
</batter>
<batter>
<jersey>5</jersey>
<playername>Willow, E</playername>
<teamname></teamname>
<ab>19</ab>
<ab>19</ab>
<runs>1</runs>
<hits>4</hits>
<bib>1</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>2</rbi>
<bb>5</bb>
<hp>0</hp>
<so>6</so>
<sf>0</sf>
<sb>1</sb>
<dp>1</dp>
<obp>.375</obp>
<slg>.263</slg>
<avg>.211</avg>
</batter>
<batter>
<jersey>16</jersey>
<playername>Long, J</playername>
<teamname></teamname>
<ab>14</ab>
<ab>14</ab>
<runs>2</runs>
<hits>3</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>1</rbi>
<bb>1</bb>
<hp>0</hp>
<so>5</so>
<sf>0</sf>
<sb>1</sb>
<dp>0</dp>
<obp>.267</obp>
<slg>.214</slg>
<avg>.214</avg>
</batter>
<batter>
<jersey>14</jersey>
<playername>Podmoroff, J</playername>
<teamname></teamname>
<ab>6</ab>
<ab>6</ab>
<runs>1</runs>
<hits>1</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>1</rbi>
<bb>1</bb>
<hp>0</hp>
<so>1</so>
<sf>1</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.250</obp>
<slg>.167</slg>
<avg>.167</avg>
</batter>
<batter>
<jersey>13</jersey>
<playername>McKinlay, N</playername>
<teamname></teamname>
<ab>0</ab>
<ab>0</ab>
<runs>0</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>0</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
<batter>
<jersey>23</jersey>
<playername>Phillips, E</playername>
<teamname></teamname>
<ab>3</ab>
<ab>3</ab>
<runs>0</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>0</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
<batter>
<jersey>3</jersey>
<playername>Norris-Jones, K</playername>
<teamname></teamname>
<ab>0</ab>
<ab>0</ab>
<runs>1</runs>
<hits>0</hits>
<bib>0</bib>
<trib>0</trib>
<hr>0</hr>
<rbi>0</rbi>
<bb>1</bb>
<hp>0</hp>
<so>0</so>
<sf>0</sf>
<sb>0</sb>
<dp>0</dp>
<obp>1.000</obp>
<slg>.000</slg>
<avg>.000</avg>
</batter>
</rbi>
</stats>
| 16.263602 | 42 | 0.515256 |
51d03237738ed219b9f277680ad8b4be538dfcdd | 553 | csproj | XML | src/WebToEpubKindle.ConsoleApp/WebToEpubKindle.ConsoleApp.csproj | jciDoval/WebToEpubKindle | 51b049e2dcfb00e715fa7393285c39425789bf08 | [
"Apache-2.0"
] | 1 | 2021-01-07T18:02:39.000Z | 2021-01-07T18:02:39.000Z | src/WebToEpubKindle.ConsoleApp/WebToEpubKindle.ConsoleApp.csproj | jciDoval/WebToEpubKindle | 51b049e2dcfb00e715fa7393285c39425789bf08 | [
"Apache-2.0"
] | 3 | 2020-12-08T19:46:35.000Z | 2021-01-01T16:08:16.000Z | src/WebToEpubKindle.ConsoleApp/WebToEpubKindle.ConsoleApp.csproj | jciDoval/WebToEpubKindle | 51b049e2dcfb00e715fa7393285c39425789bf08 | [
"Apache-2.0"
] | null | null | null | <Project Sdk="Microsoft.NET.Sdk">
<ItemGroup>
<ProjectReference Include="..\WebToEpubKindle.Core\WebToEpubKindle.Core.csproj" />
</ItemGroup>
<ItemGroup>
<None Update="resources\kindle2.jpg">
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
</None>
<None Update="resources\kindle.jpg">
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
</None>
</ItemGroup>
<PropertyGroup>
<OutputType>Exe</OutputType>
<TargetFramework>net5.0</TargetFramework>
</PropertyGroup>
</Project>
| 25.136364 | 86 | 0.716094 |
34254f1e57676c7ddaec50e9b58fc3ec4e21cd74 | 3,278 | xml | XML | db2te/tableDefinitions/xsrObjectComponents.xml | pribtech/nodete | abf6283a617fc499cdbe7ef98f187aa2380b6a27 | [
"Apache-2.0"
] | null | null | null | db2te/tableDefinitions/xsrObjectComponents.xml | pribtech/nodete | abf6283a617fc499cdbe7ef98f187aa2380b6a27 | [
"Apache-2.0"
] | null | null | null | db2te/tableDefinitions/xsrObjectComponents.xml | pribtech/nodete | abf6283a617fc499cdbe7ef98f187aa2380b6a27 | [
"Apache-2.0"
] | null | null | null | <!--
Author: Peter Prib
Copyright Frygma Pty Ltd (ABN 90 791 388 622 2009) 2010 All rights reserved.
Licensed under the Apache License, Version 2.0 (the "License");
you may not use this file except in compliance with the License.
You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
-->
<table name="xsrObjectComponents">
<sql_name>SYSCAT.XSROBJECTCOMPONENTS</sql_name>
<singular_name>XSR Object Component</singular_name>
<plural_name>XSR Object Components</plural_name>
<disableEdit/>
<output>
<type name="DDL" destination="" title="" generator=""/>
</output>
<order_by_index name="OBJECTID" direction="A"/>
<order_by_index name="COMPONENTID" direction="A"/>
<display_columns>
<col type="column" name="OBJECTID"/>
<col type="column" name="OBJECTSCHEMA"/>
<col type="column" name="OBJECTNAME"/>
<col type="column" name="STATUS"/>
<col type="column" name="COMPONENTID"/>
<col type="column" name="TARGETNAMESPACE"/>
<col type="column" name="SCHEMALOCATION"/>
<col type="column" name="COMPONENT"/>
</display_columns>
<column name="OBJECTID">
<c_sql_name>OBJECTID</c_sql_name>
<c_title>Object Id.</c_title>
<c_presentation>n</c_presentation>
<c_drill>n</c_drill>
</column>
<column name="OBJECTSCHEMA">
<c_sql_name>OBJECTSCHEMA</c_sql_name>
<c_title>Schema</c_title>
<c_presentation></c_presentation>
<c_drill>y</c_drill>
<primary_key/>
<c_prefill>
<table>schema</table>
<column>SCHEMANAME</column>
</c_prefill>
</column>
<column name="OBJECTNAME">
<c_sql_name>OBJECTNAME</c_sql_name>
<c_title>Name</c_title>
<c_presentation></c_presentation>
<primary_key/>
</column>
<column name="COMPONENTID">
<c_sql_name>COMPONENTID</c_sql_name>
<c_title>Component Id.</c_title>
<c_presentation>n</c_presentation>
<c_drill>n</c_drill>
</column>
<column name="TARGETNAMESPACE">
<c_sql_name>TARGETNAMESPACE</c_sql_name>
<c_title>Target Namespace</c_title>
<c_presentation></c_presentation>
<c_drill>y</c_drill>
</column>
<column name="SCHEMALOCATION">
<c_sql_name>SCHEMALOCATION</c_sql_name>
<c_title>Schema Location</c_title>
<c_presentation></c_presentation>
<c_drill>y</c_drill>
</column>
<column name="COMPONENT">
<c_sql_name>COMPONENT</c_sql_name>
<c_title>Component</c_title>
<c_presentation>l</c_presentation>
</column>
<column name="CREATE_TIME">
<c_sql_name>CREATE_TIME</c_sql_name>
<c_title>Created</c_title>
<c_presentation></c_presentation>
<c_drill>n</c_drill>
</column>
<column name="Status">
<c_sql_name>STATUS</c_sql_name>
<c_title>STATUS</c_title>
<c_presentation></c_presentation>
<c_drill>y</c_drill>
<c_column_mask>
<value_mask value="C"><mask>Complete</mask></value_mask>
<value_mask value="I"><mask>Incomplete</mask></value_mask>
</c_column_mask>
</column>
</table>
| 32.137255 | 79 | 0.703783 |
a83bdc24c7053c0b6802a3dada01e602576269e4 | 538 | xml | XML | data_dir/workspaces/oereb-symbols/dummy-daten/ch.Grundwasserschutzzonen/layer.xml | sogis-oereb/oereb-wms-geoserver | 2f72ca5ccc087d402cd2daa303f736482561703f | [
"MIT"
] | null | null | null | data_dir/workspaces/oereb-symbols/dummy-daten/ch.Grundwasserschutzzonen/layer.xml | sogis-oereb/oereb-wms-geoserver | 2f72ca5ccc087d402cd2daa303f736482561703f | [
"MIT"
] | null | null | null | data_dir/workspaces/oereb-symbols/dummy-daten/ch.Grundwasserschutzzonen/layer.xml | sogis-oereb/oereb-wms-geoserver | 2f72ca5ccc087d402cd2daa303f736482561703f | [
"MIT"
] | null | null | null | <layer>
<name>ch.Grundwasserschutzzonen</name>
<id>LayerInfoImpl--3dacc9a4:17eef092fe9:-7ff9</id>
<type>VECTOR</type>
<defaultStyle>
<id>StyleInfoImpl--3dacc9a4:17eef092fe9:-7ff8</id>
</defaultStyle>
<resource class="featureType">
<id>FeatureTypeInfoImpl--3dacc9a4:17eef092fe9:-7ffa</id>
</resource>
<attribution>
<logoWidth>0</logoWidth>
<logoHeight>0</logoHeight>
</attribution>
<dateCreated>2022-02-12 18:06:15.295 UTC</dateCreated>
<dateModified>2022-02-12 18:32:31.14 UTC</dateModified>
</layer> | 31.647059 | 60 | 0.715613 |
1fb6d31c4fd83915d22d1e2a749a9c366ac26416 | 2,396 | xml | XML | dbGap/Variable_XMLS/phs000007.v22.pht000203.v5.laba1_6s.data_dict.xml | NCBI-Hackathons/TCGA_dbGaP | a264596c846dbf0b82827baf4b7d0fd87172b52c | [
"CC0-1.0"
] | 8 | 2016-07-21T13:39:14.000Z | 2022-02-01T21:08:59.000Z | dbGap/Variable_XMLS/phs000007.v22.pht000203.v5.laba1_6s.data_dict.xml | NCBI-Hackathons/TCGA_dbGaP | a264596c846dbf0b82827baf4b7d0fd87172b52c | [
"CC0-1.0"
] | 6 | 2016-09-08T05:39:33.000Z | 2017-09-08T15:42:22.000Z | dbGap/Variable_XMLS/phs000007.v22.pht000203.v5.laba1_6s.data_dict.xml | NCBI-Hackathons/TCGA_dbGaP | a264596c846dbf0b82827baf4b7d0fd87172b52c | [
"CC0-1.0"
] | 5 | 2017-03-27T23:01:03.000Z | 2020-05-02T13:01:20.000Z | <?xml version="1.0" encoding="UTF-8"?>
<?xml-stylesheet type="text/xsl" href="./datadict_v2.xsl"?><data_table id="pht000203.v5" study_id="phs000007.v22" participant_set="8" date_created="Sat Dec 21 22:15:15 2013"><variable id="phv00024670.v4"><name>shareid</name><description>UNIQUE PARTICIPANT ID</description><type/></variable><variable id="phv00024658.v4"><name>CYST1</name><description>CYSTEINE (UMOL/L)</description><type/><unit>UMOL/L</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024659.v4"><name>CYST2</name><description>CYSTEINE POST LOAD (UMOL/L)</description><type/><unit>UMOL/L</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024660.v4"><name>HCYST1</name><description>HOMOCYSTEINE (UMOL/L)</description><type/><unit>UMOL/L</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024661.v4"><name>HCYST2</name><description>HOMOCYSTEINE POST LOAD (UMOL/L)</description><type/><unit>UMOL/L</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024662.v4"><name>PLP</name><description>VITAMIN B6 (PM/ML)</description><type/><unit>PM/ML</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024663.v4"><name>FA_LC</name><description>FOLATE ASSAY WITH L.CASEI (NG/ML)</description><type/><unit>NG/ML</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024664.v4"><name>FA_KIT</name><description>FOLATE ASSAY WITH KIT (NG/ML)</description><type/><unit>NG/ML</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024665.v4"><name>B12_KIT</name><description>VITAMIN B12 WITH KIT (PG/ML)</description><type/><unit>PG/ML</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024666.v4"><name>CREAT</name><description>CREATININE (MG/DL)</description><type/><unit>MG/DL</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024667.v4"><name>RB6</name><description>RIBOFLAVIN (NMOL/L)</description><type/><unit>NMOL/L</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024668.v4"><name>FMN6</name><description>FMN (NMOL/L)</description><type/><unit>NMOL/L</unit><value code=".">UNKNOWN</value></variable><variable id="phv00024669.v4"><name>idtype</name><description>COHORT IDENTIFIER</description><type/><value code="0">ORIGINAL COHORT GROUP</value><value code="1">OFFSPRING GROUP</value><value code="3">GENERATION 3</value></variable></data_table>
| 798.666667 | 2,356 | 0.736644 |
fd4e635d2da63a5c624f10969d89747332afa2f7 | 2,006 | xml | XML | pipeline/src/test/resources/thesaurus/diseaseorsyndrome/restlesslegssyndrome.xml | detnavillus/modular-informatic-designs | 15f5ff2abe1aefe9286daaeb7ac00d68e69d761d | [
"Apache-2.0"
] | 1 | 2020-01-05T04:19:08.000Z | 2020-01-05T04:19:08.000Z | pipeline/src/test/resources/thesaurus/diseaseorsyndrome/restlesslegssyndrome.xml | detnavillus/modular-informatic-designs | 15f5ff2abe1aefe9286daaeb7ac00d68e69d761d | [
"Apache-2.0"
] | null | null | null | pipeline/src/test/resources/thesaurus/diseaseorsyndrome/restlesslegssyndrome.xml | detnavillus/modular-informatic-designs | 15f5ff2abe1aefe9286daaeb7ac00d68e69d761d | [
"Apache-2.0"
] | 6 | 2015-11-13T15:39:06.000Z | 2020-07-09T16:04:43.000Z | <Record>
<Term>Restless Legs Syndrome</Term>
<SemanticType>Disease or Syndrome</SemanticType>
<ParentTerm>Parasomnias</ParentTerm>
<ParentTerm>Sleep Disorders, Intrinsic</ParentTerm>
<ClassificationPath>Nervous System Diseases/Sleep Disorders/Parasomnias/Restless Legs Syndrome</ClassificationPath>
<ClassificationPath>Mental Disorders/Sleep Disorders/Dyssomnias/Sleep Disorders, Intrinsic/Restless Legs Syndrome</ClassificationPath>
<ClassificationPath>Nervous System Diseases/Sleep Disorders/Dyssomnias/Sleep Disorders, Intrinsic/Restless Legs Syndrome</ClassificationPath>
<ClassificationPath>Mental Disorders/Sleep Disorders/Parasomnias/Restless Legs Syndrome</ClassificationPath>
<BroaderTerm>Dyssomnias</BroaderTerm>
<BroaderTerm>Parasomnias</BroaderTerm>
<BroaderTerm>Mental Disorders</BroaderTerm>
<BroaderTerm>Nervous System Diseases</BroaderTerm>
<BroaderTerm>Sleep Disorders, Intrinsic</BroaderTerm>
<BroaderTerm>Restless Legs Syndrome</BroaderTerm>
<BroaderTerm>Sleep Disorders</BroaderTerm>
<Synonym>Ekbom Syndrome</Synonym>
<Synonym>Restless Legs</Synonym>
<Synonym>Ekbom's Syndrome</Synonym>
<Synonym>Ekboms Syndrome</Synonym>
<Synonym>Restless Legs Syndrome</Synonym>
<Description>A disorder characterized by aching or burning sensations in the lower and rarely the upper extremities that occur prior to sleep or may awaken the patient from sleep. Complying with an irresistible urge to move the affected limbs brings temporary relief. Sleep may become disrupted, resulting in excessive daytime hypersomnolence. This condition may be associated with UREMIA; DIABETES MELLITUS; and rheumatoid arthritis. Restless Legs Syndrome differs from NOCTURNAL MYOCLONUS SYNDROME in that in the latter condition the individual does not report adverse sensory stimuli and it is primarily a sleep-associated movement disorder. (Adams et al., Principles of Neurology, 6th ed, p387; Schweiz Rundsch Med Prax 1997 Apr 30;86(18):732-736)</Description>
<Source>MeSH</Source>
</Record>
| 80.24 | 766 | 0.824526 |
286a3737efb4292f2b25a2a14fdcb2dc60b19477 | 3,308 | xib | XML | i2app/i2app/Base.lproj/SmartStree/SmartStreetChooseCell.xib | wl-net/arcusios | 9ab7cfe04555c72212ffb9073c7919d1f910849e | [
"Apache-2.0"
] | null | null | null | i2app/i2app/Base.lproj/SmartStree/SmartStreetChooseCell.xib | wl-net/arcusios | 9ab7cfe04555c72212ffb9073c7919d1f910849e | [
"Apache-2.0"
] | 1 | 2020-07-13T01:02:56.000Z | 2020-07-13T01:02:56.000Z | i2app/i2app/Base.lproj/SmartStree/SmartStreetChooseCell.xib | t1minator/arcus-smart-home-arcusios | 7d432f6911db74d36f7d19a342f81850b414a6c5 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8" standalone="no"?>
<document type="com.apple.InterfaceBuilder3.CocoaTouch.XIB" version="3.0" toolsVersion="7706" systemVersion="14E46" targetRuntime="iOS.CocoaTouch" propertyAccessControl="none" useAutolayout="YES" useTraitCollections="YES">
<dependencies>
<plugIn identifier="com.apple.InterfaceBuilder.IBCocoaTouchPlugin" version="7703"/>
</dependencies>
<objects>
<placeholder placeholderIdentifier="IBFilesOwner" id="-1" userLabel="File's Owner"/>
<placeholder placeholderIdentifier="IBFirstResponder" id="-2" customClass="UIResponder"/>
<tableViewCell contentMode="scaleToFill" selectionStyle="default" indentationWidth="10" rowHeight="55" id="acD-Nr-bdU" customClass="SmartStreetChooseViewCell">
<rect key="frame" x="0.0" y="0.0" width="600" height="55"/>
<autoresizingMask key="autoresizingMask"/>
<tableViewCellContentView key="contentView" opaque="NO" clipsSubviews="YES" multipleTouchEnabled="YES" contentMode="center" tableViewCell="acD-Nr-bdU" id="G6m-kn-Rqr">
<autoresizingMask key="autoresizingMask"/>
<subviews>
<button opaque="NO" contentMode="scaleToFill" contentHorizontalAlignment="left" contentVerticalAlignment="center" lineBreakMode="middleTruncation" translatesAutoresizingMaskIntoConstraints="NO" id="IXn-mh-2VH">
<rect key="frame" x="15" y="8" width="570" height="40"/>
<color key="backgroundColor" red="0.21176470589999999" green="0.21176470589999999" blue="0.21176470589999999" alpha="1" colorSpace="calibratedRGB"/>
<fontDescription key="fontDescription" name="AvenirNext-Medium" family="Avenir Next" pointSize="18"/>
<state key="normal" title=" Button">
<color key="titleShadowColor" white="0.5" alpha="1" colorSpace="calibratedWhite"/>
</state>
<connections>
<action selector="onClickStreetButton:" destination="acD-Nr-bdU" eventType="touchUpInside" id="6ZW-3T-7OX"/>
</connections>
</button>
</subviews>
<constraints>
<constraint firstAttribute="trailing" secondItem="IXn-mh-2VH" secondAttribute="trailing" constant="15" id="e0A-dk-tW0"/>
<constraint firstAttribute="bottom" secondItem="IXn-mh-2VH" secondAttribute="bottom" constant="7" id="eCU-6k-W8A"/>
<constraint firstItem="IXn-mh-2VH" firstAttribute="leading" secondItem="G6m-kn-Rqr" secondAttribute="leading" constant="15" id="g2I-th-R9R"/>
<constraint firstItem="IXn-mh-2VH" firstAttribute="top" secondItem="G6m-kn-Rqr" secondAttribute="top" constant="8" id="xF1-0d-PEm"/>
</constraints>
</tableViewCellContentView>
<color key="backgroundColor" white="0.0" alpha="1" colorSpace="calibratedWhite"/>
<connections>
<outlet property="streetButton" destination="IXn-mh-2VH" id="f5y-RX-Kzy"/>
</connections>
<point key="canvasLocation" x="-226" y="281.5"/>
</tableViewCell>
</objects>
</document>
| 78.761905 | 230 | 0.63029 |
dc41e030cabe852ef082f83a2f82878a929c9826 | 314 | xml | XML | doc/api/toc/Properties_T_PipServices_Azure_Messaging_ServiceBusMessageTopic.xml | tcroxford/pip-services-azure-dotnet | 368c6b2bf48a712dc8bc251e0ee185d71055859c | [
"MIT"
] | null | null | null | doc/api/toc/Properties_T_PipServices_Azure_Messaging_ServiceBusMessageTopic.xml | tcroxford/pip-services-azure-dotnet | 368c6b2bf48a712dc8bc251e0ee185d71055859c | [
"MIT"
] | null | null | null | doc/api/toc/Properties_T_PipServices_Azure_Messaging_ServiceBusMessageTopic.xml | tcroxford/pip-services-azure-dotnet | 368c6b2bf48a712dc8bc251e0ee185d71055859c | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?><HelpTOCNode Title="ServiceBusMessageTopic Properties" Url="html/Properties_T_PipServices_Azure_Messaging_ServiceBusMessageTopic.htm"><HelpTOCNode Title="MessageCount Property " Url="html/P_PipServices_Azure_Messaging_ServiceBusMessageTopic_MessageCount.htm" /></HelpTOCNode> | 314 | 314 | 0.850318 |
ce38cf8ddb9484b87fe252be136221ddf623a7f5 | 4,564 | xml | XML | mcspotlights/Minecraft Blocks & Items Skeletons-eAwFk454lZI.xml | gregnk/AnnotationArchive | 786233cbac2476638e1cbfa4a65aab7fcad6f164 | [
"0BSD"
] | null | null | null | mcspotlights/Minecraft Blocks & Items Skeletons-eAwFk454lZI.xml | gregnk/AnnotationArchive | 786233cbac2476638e1cbfa4a65aab7fcad6f164 | [
"0BSD"
] | null | null | null | mcspotlights/Minecraft Blocks & Items Skeletons-eAwFk454lZI.xml | gregnk/AnnotationArchive | 786233cbac2476638e1cbfa4a65aab7fcad6f164 | [
"0BSD"
] | null | null | null | <?xml version="1.0" encoding="UTF-8" ?><document><annotations itct="CAAQwOYBIhMIv-uE7Njt3wIVxYTCAR28nA79KPgdMgJpdkiSq-LzuLKBhng">
<annotation id="annotation_288042" type="text" style="highlightText" logable="false" itct="">
<segment spaceRelative="annotation_683464">
<movingRegion type="rect">
<rectRegion x="0.00000" y="29.72200" w="25.00000" h="5.55600" t="never"/>
<rectRegion x="0.00000" y="29.72200" w="25.00000" h="5.55600" t="never"/>
</movingRegion>
</segment>
<appearance bgAlpha="0" textSize="3.9116" highlightFontColor="15921906"/>
<trigger>
<condition ref="annotation_683464" state="rollOver"/>
</trigger>
</annotation>
<annotation id="annotation_483650" type="highlight" log_data="xble=1&l-class=1&a-id=annotation_483650&a-type=3&link=http%3A%2F%2Fwww.youtube.com%2Fwatch%3Fv%3DmQZWewLKE4Q&ei=-bg8XP-KL8WJir4PvLm66A8&a-v=eAwFk454lZI" itct="CAEQs-UBGP___________wEiEwi_64Ts2O3fAhXFhMIBHbycDv0o-B0yAml2SJKr4vO4soGGeA">
<segment>
<movingRegion type="rect">
<rectRegion x="51.40600" y="2.77800" w="28.12500" h="33.05600" t="0:01:18.3"/>
<rectRegion x="51.40600" y="2.77800" w="28.12500" h="33.05600" t="0:01:27.8"/>
</movingRegion>
</segment>
<appearance bgColor="16777215" highlightWidth="3" borderAlpha="0.25"/>
<action type="openUrl" trigger="click">
<url target="current" value="https://www.youtube.com/watch?annotation_id=annotation_483650&ei=-bg8XP-KL8WJir4PvLm66A8&feature=iv&src_vid=eAwFk454lZI&v=mQZWewLKE4Q" link_class="1"/>
</action>
</annotation>
<annotation id="annotation_608957" type="text" style="highlightText" logable="false" itct="">
<segment spaceRelative="annotation_483650">
<movingRegion type="rect">
<rectRegion x="0.00000" y="29.72200" w="25.00000" h="5.55600" t="never"/>
<rectRegion x="0.00000" y="29.72200" w="25.00000" h="5.55600" t="never"/>
</movingRegion>
</segment>
<appearance bgAlpha="0" textSize="3.9116" highlightFontColor="15921906"/>
<trigger>
<condition ref="annotation_483650" state="rollOver"/>
</trigger>
</annotation>
<annotation id="annotation_683464" type="highlight" log_data="xble=1&l-class=5&a-id=annotation_683464&a-type=3&link=http%3A%2F%2Fwww.youtube.com%2Fsubscription_center%3Fadd_user%3Dmcspotlights&ei=-bg8XP-KL8WJir4PvLm66A8&a-v=eAwFk454lZI" itct="CAIQs-UBGP___________wEiEwi_64Ts2O3fAhXFhMIBHbycDv0o-B0yAml2SJKr4vO4soGGeA">
<segment>
<movingRegion type="rect">
<rectRegion x="31.25000" y="52.22200" w="37.50000" h="14.44400" t="0:01:18.3"/>
<rectRegion x="31.25000" y="52.22200" w="37.50000" h="14.44400" t="0:01:28.0"/>
</movingRegion>
</segment>
<appearance bgColor="16777215" highlightWidth="3" borderAlpha="0.25"/>
<action type="openUrl" trigger="click">
<url target="new" value="https://www.youtube.com/subscription_center?add_user=mcspotlights&annotation_id=annotation_683464&ei=-bg8XP-KL8WJir4PvLm66A8&feature=iv&src_vid=eAwFk454lZI" link_class="5"/>
</action>
</annotation>
<annotation id="annotation_745040" type="highlight" log_data="xble=1&l-class=1&a-id=annotation_745040&a-type=3&link=http%3A%2F%2Fwww.youtube.com%2Fwatch%3Fv%3DlhE36Eg9Rd4&ei=-bg8XP-KL8WJir4PvLm66A8&a-v=eAwFk454lZI" itct="CAMQs-UBGP___________wEiEwi_64Ts2O3fAhXFhMIBHbycDv0o-B0yAml2SJKr4vO4soGGeA">
<segment>
<movingRegion type="rect">
<rectRegion x="22.65600" y="2.77800" w="27.81300" h="33.05600" t="0:01:18.3"/>
<rectRegion x="22.65600" y="2.77800" w="27.81300" h="33.05600" t="0:01:27.8"/>
</movingRegion>
</segment>
<appearance bgColor="16777215" highlightWidth="3" borderAlpha="0.25"/>
<action type="openUrl" trigger="click">
<url target="current" value="https://www.youtube.com/watch?annotation_id=annotation_745040&ei=-bg8XP-KL8WJir4PvLm66A8&feature=iv&src_vid=eAwFk454lZI&v=lhE36Eg9Rd4" link_class="1"/>
</action>
</annotation>
<annotation id="annotation_829497" type="text" style="highlightText" logable="false" itct="">
<segment spaceRelative="annotation_745040">
<movingRegion type="rect">
<rectRegion x="0.00000" y="29.72200" w="25.00000" h="5.55600" t="never"/>
<rectRegion x="0.00000" y="29.72200" w="25.00000" h="5.55600" t="never"/>
</movingRegion>
</segment>
<appearance bgAlpha="0" textSize="3.9116" highlightFontColor="15921906"/>
<trigger>
<condition ref="annotation_745040" state="rollOver"/>
</trigger>
</annotation>
</annotations></document> | 51.863636 | 343 | 0.71319 |
04b5268b7bbbd96f9bd4f373c509d0eaa5707381 | 9,654 | xml | XML | tei/will_AD78_0068.xml | ArchivesNationalesFR/editionTestamentsDePoilus | 2e568a2913d867e6e41d373c612aae478d9ac4e4 | [
"CC-BY-4.0"
] | 6 | 2021-01-08T17:32:08.000Z | 2022-02-24T17:08:42.000Z | tei/will_AD78_0068.xml | ArchivesNationalesFR/editionTestamentsDePoilus | 2e568a2913d867e6e41d373c612aae478d9ac4e4 | [
"CC-BY-4.0"
] | null | null | null | tei/will_AD78_0068.xml | ArchivesNationalesFR/editionTestamentsDePoilus | 2e568a2913d867e6e41d373c612aae478d9ac4e4 | [
"CC-BY-4.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?><TEI xmlns="http://www.tei-c.org/ns/1.0" xml:lang="fr" xml:id="TestamentsDePoilus_will_AD78_0068">
<teiHeader>
<fileDesc>
<titleStmt><title type="corpusTitle">Édition numérique collaborative de testaments de Poilus de
la Grande Guerre</title><title type="main">[Testament de Edouard Charles Pfitzinger (6 juin 1915)] : édition électronique</title><author><persName ref="#pers-65">Edouard Charles Pfitzinger
(1884-1917)</persName></author><editor ref="#CNougaret">Christine Nougaret</editor><editor ref="#EdChamps">Emmanuelle de Champs</editor><editor ref="#FClavaud">Florence Clavaud</editor><editor ref="#PCharbonnier">Pauline Charbonnier</editor></titleStmt>
<editionStmt>
<edition>Première édition électronique, fondée sur un travail de transcription
collaborative</edition>
<respStmt><resp>Numérisation</resp><orgName ref="#AD78">Archives départementales des Yvelines</orgName></respStmt>
<respStmt><resp>Identification et description du testament</resp><persName ref="#TR">Thierry Rihouey</persName><persName ref="#FAuriau">Françoise Auriau</persName><persName ref="#SBlanchard">Sophie Blanchard</persName><persName ref="#MDeuve">Mathilde Deuve</persName></respStmt>
<respStmt><resp>Transcription</resp><persName ref="#SL.">EG</persName><persName ref="#lelia">Lélia Picabia</persName><persName ref="#EPerrin">EPerrin</persName></respStmt>
<respStmt><resp>Validation</resp><persName ref="#PCharbonnier">Pauline Charbonnier</persName><persName ref="#FClavaud">Florence Clavaud</persName></respStmt>
<respStmt><resp>Corrections hors plate-forme et contrôle de qualité final</resp><persName ref="#FClavaud">Florence Clavaud</persName><persName ref="#PCharbonnier">Pauline Charbonnier</persName></respStmt>
</editionStmt>
<publicationStmt><publisher><orgName ref="#AN">Archives nationales</orgName></publisher><publisher><orgName>Université de Cergy-Pontoise</orgName></publisher><publisher><orgName ref="#AD78">Archives départementales des Yvelines</orgName></publisher><publisher><orgName>École nationale des chartes</orgName></publisher><publisher><orgName ref="#AD95">Archives départementales du Val-d’Oise</orgName></publisher><date when="2020-12">décembre 2020</date><availability><licence target="https://creativecommons.org/licenses/by/4.0/">Licence CC BY 4.0</licence></availability><idno>TestamentsDePoilus_will_AD78_0068</idno><!--ultérieurement ajouter idno fourni par Nakala--></publicationStmt>
<sourceDesc>
<msDesc xml:id="will_AD78_0068_tes">
<msIdentifier>
<country>France</country>
<institution>Archives départementales des Yvelines</institution>
<collection>Archives notariales</collection>
<idno>3E44 1010, minute du 9 janvier 1918 (dépôt du testament de Edouard
Charles Pfitzinger)</idno>
<msName>Testament de Edouard Charles Pfitzinger (6 juin 1915)</msName>
</msIdentifier>
<msContents>
<summary><p><date type="willDate" when="1915-06-06">6 juin 1915</date>.
<placeName type="willPlace" ref="#pl-121">Garches</placeName>.</p><p><term type="willType">testament
olographe</term> de <persName ref="#pers-65"><forename>Edouard</forename> <forename>Charles</forename> <surname>Pfitzinger</surname></persName>,
mort pour la France le <date when="1917-02-12">12 février
1917</date> à <placeName ref="#pl-94">Berry au Bac au
Kodat</placeName>.</p></summary>
</msContents>
<physDesc>
<objectDesc>
<supportDesc>
<support>Papier à en-tête quadrillé (testament). Enveloppe à en-tête
(enveloppe). </support>
<extent>1 page et 1 enveloppe. Dimensions du testament : <dimensions type="willPage" unit="cm">
<height>20,8</height>
<width>13,4</width>
</dimensions>. Dimensions de l’enveloppe : <dimensions type="willEnvelope" unit="cm">
<height>11,3</height>
<width>14,4</width>
</dimensions>.</extent>
</supportDesc>
</objectDesc>
<handDesc>
<p>Testament : encre. Enveloppe : encre.</p>
</handDesc>
</physDesc>
<history>
<provenance><orgName>étude notariale de Versailles, étude
Gayot</orgName></provenance>
</history>
</msDesc>
<msDesc xml:id="will_AD78_0068_min">
<msIdentifier>
<country>France</country>
<institution>Archives départementales des Yvelines</institution>
<collection>Archives notariales</collection>
<idno>3E44 1010, minute du 9 janvier 1918 (dépôt du testament de Edouard
Charles Pfitzinger)</idno>
<msName>Couverture de la minute, et le cas échéant jugement inclus dans la
minute</msName>
</msIdentifier>
</msDesc>
</sourceDesc>
</fileDesc>
<profileDesc>
<creation><date type="willDate" when="1915-06-06">6 juin 1915</date></creation>
<langUsage><language ident="fr">français</language></langUsage>
<abstract><p>6 juin 1915.
Garches.</p><p>testament
olographe de Edouard Charles Pfitzinger,
mort pour la France le 12 février
1917 à Berry au Bac au
Kodat.</p></abstract>
<textClass>
<keywords>
<term type="subject">Grande Guerre</term>
<term type="subject">Poilu</term>
<term type="subject">testament</term>
</keywords>
</textClass>
</profileDesc>
<revisionDesc>
<change when-iso="2018-01-24/2020-05-27" who="#SL. #lelia #EPerrin">transcription</change>
<change when-iso="2018-01-24/2018-10-02" who="#PCharbonnier #FClavaud ">validation</change>
<change who="#FClavaud #PCharbonnier" when-iso="2020-10-26/2020-12-08">enrichissements
et contrôle de qualité finaux</change>
</revisionDesc>
</teiHeader>
<facsimile xml:base="https://testaments-de-poilus.huma-num.fr/iiif/2/">
<surface type="will-page" n="01">
<graphic url="testament_AD78_0068___JPEG___FRAD78_Poilus_t-0068_01.jpg" xml:id="FRAD78_Poilus_t-0068_01"/>
</surface>
<surface type="will-envelope-recto" n="01">
<graphic url="testament_AD78_0068___JPEG___FRAD78_Poilus_t-0068_03.jpg" xml:id="FRAD78_Poilus_t-0068_03"/>
</surface>
</facsimile>
<text xml:id="will_AD78_0068">
<body>
<div type="will">
<pb facs="#FRAD78_Poilus_t-0068_01"/>
<dateline rend="centered"><placeName type="willPlace" ref="#pl-121">Garches</placeName><choice><sic> -</sic><corr>,</corr></choice>
<date type="willDate" when="1915-06-06">le <lb/>six
<choice><sic>Juin</sic><corr>juin</corr></choice> <lb/>mil neuf cent
quinze</date><choice><sic/><corr>.</corr></choice></dateline>
<metamark function="separating" rend="horizontal-line"/>
<space dim="vertical" unit="lines" quantity="1"/>
<p rend="left">En cas de <choice><sic>dèces</sic><corr>décès</corr></choice> de ma
part <lb/>de <choice><sic>lèguer</sic><corr>léguer</corr></choice> toutes mes
affaires <lb/>personnelles ainsi que ce qui <lb/>pourrait me revenir de ma
<lb/>famille ou autre à ma soeur <lb/><space quantity="1" unit="lines" dim="vertical"/><persName>Madame
<surname><unclear>Doert</unclear></surname><lb/>née Elise
<surname>Pfitzinger</surname></persName><choice><sic/><corr>.</corr></choice></p>
<space quantity="2" unit="lines" dim="vertical"/>
<signed rend="centered"><persName ref="#pers-65">Ed<surname>Pfitzinger</surname></persName></signed>
</div>
<div type="envelope">
<pb facs="#FRAD78_Poilus_t-0068_03"/>
<p rend="centered"><choice><sic>à</sic><corr>À</corr></choice>
<lb/><choice><sic>Remettre</sic><corr>remettre</corr></choice> <lb/>à
<persName>Madame Doert</persName><choice><sic/><corr>.</corr></choice></p>
</div>
</body>
</text>
</TEI> | 74.261538 | 698 | 0.5549 |
0887e14a02594d08943fb978a656a4564fbd16d2 | 248 | xml | XML | docs/ClientNET45/toc/BE0CB0EB.xml | Stormancer/Stormancer-sdk-net-unity | 09b7908923c37ddb34a1a43796fde9e26cb1e048 | [
"MIT"
] | 4 | 2016-01-21T07:35:10.000Z | 2019-06-09T16:04:02.000Z | docs/ClientNET45/toc/BE0CB0EB.xml | pourfun/Stormancer-sdk-net-unity | 09b7908923c37ddb34a1a43796fde9e26cb1e048 | [
"MIT"
] | null | null | null | docs/ClientNET45/toc/BE0CB0EB.xml | pourfun/Stormancer-sdk-net-unity | 09b7908923c37ddb34a1a43796fde9e26cb1e048 | [
"MIT"
] | 2 | 2018-08-21T06:12:45.000Z | 2018-09-17T08:10:20.000Z | <?xml version="1.0" encoding="utf-8"?><HelpTOCNode Title="IScenePeer Methods" Url="html/BE0CB0EB.htm"><HelpTOCNode Title="GetComponent(T) Method " Url="html/23F02984.htm" /><HelpTOCNode Title="Send Method " Url="html/7AB6F9E8.htm" /></HelpTOCNode> | 248 | 248 | 0.737903 |
08b7f2cb5e5fa59fc62649aa949d67e4521838e7 | 35,528 | storyboard | XML | WebShell/Base.lproj/Main.storyboard | maximejf42/WebShell | 6cc7efc4e48146d9c0d3a297b1528b30feb8e779 | [
"MIT"
] | 1,688 | 2015-12-20T15:43:16.000Z | 2022-01-13T12:24:26.000Z | WebShell/Base.lproj/Main.storyboard | maximejf42/WebShell | 6cc7efc4e48146d9c0d3a297b1528b30feb8e779 | [
"MIT"
] | 75 | 2015-12-21T03:23:28.000Z | 2019-06-10T06:54:46.000Z | WebShell/Base.lproj/Main.storyboard | maximejf42/WebShell | 6cc7efc4e48146d9c0d3a297b1528b30feb8e779 | [
"MIT"
] | 149 | 2015-12-21T02:44:09.000Z | 2021-12-19T06:05:22.000Z | <?xml version="1.0" encoding="UTF-8"?>
<document type="com.apple.InterfaceBuilder3.Cocoa.Storyboard.XIB" version="3.0" toolsVersion="13771" targetRuntime="MacOSX.Cocoa" propertyAccessControl="none" useAutolayout="YES" initialViewController="B8D-0N-5wS">
<dependencies>
<deployment identifier="macosx"/>
<plugIn identifier="com.apple.InterfaceBuilder.CocoaPlugin" version="13771"/>
<plugIn identifier="com.apple.WebKitIBPlugin" version="13771"/>
<capability name="documents saved in the Xcode 8 format" minToolsVersion="8.0"/>
</dependencies>
<scenes>
<!--Application-->
<scene sceneID="JPo-4y-FX3">
<objects>
<application id="hnw-xV-0zn" sceneMemberID="viewController">
<menu key="mainMenu" title="Main Menu" systemMenu="main" id="AYu-sK-qS6">
<items>
<menuItem title="WebShell" id="1Xt-HY-uBw">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="WebShell" systemMenu="apple" id="uQy-DD-JDr">
<items>
<menuItem title="About WebShell" id="5kV-Vb-QxS">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="orderFrontStandardAboutPanel:" target="Ady-hI-5gd" id="Exp-CZ-Vem"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="VOq-y0-SEH"/>
<menuItem title="Hide WebShell" keyEquivalent="h" id="Olw-nP-bQN">
<connections>
<action selector="hide:" target="Ady-hI-5gd" id="PnN-Uc-m68"/>
</connections>
</menuItem>
<menuItem title="Hide Others" keyEquivalent="h" id="Vdr-fp-XzO">
<modifierMask key="keyEquivalentModifierMask" option="YES" command="YES"/>
<connections>
<action selector="hideOtherApplications:" target="Ady-hI-5gd" id="VT4-aY-XCT"/>
</connections>
</menuItem>
<menuItem title="Show All" id="Kd2-mp-pUS">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="unhideAllApplications:" target="Ady-hI-5gd" id="Dhg-Le-xox"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="kCx-OE-vgT"/>
<menuItem title="Close" keyEquivalent="w" id="E0V-gE-2XR">
<connections>
<action selector="performClose:" target="Ady-hI-5gd" id="pTe-th-gPN"/>
</connections>
</menuItem>
<menuItem title="Quit WebShell" keyEquivalent="q" id="4sb-4s-VLi">
<connections>
<action selector="terminate:" target="Ady-hI-5gd" id="Te7-pn-YzF"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
<menuItem title="Control" id="Ca3-nV-juN">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Control" id="qkf-xU-qKS">
<items>
<menuItem title="Home" keyEquivalent="H" id="fWh-O7-fkt">
<modifierMask key="keyEquivalentModifierMask" shift="YES" command="YES"/>
<connections>
<action selector="goHome:" target="Voe-Tx-rLC" id="v60-sm-Go5"/>
</connections>
</menuItem>
<menuItem title="Reload" keyEquivalent="R" id="ynQ-Ma-mpv">
<modifierMask key="keyEquivalentModifierMask" shift="YES" command="YES"/>
<connections>
<action selector="reload:" target="Voe-Tx-rLC" id="6qi-i1-yDo"/>
</connections>
</menuItem>
<menuItem title="Print" keyEquivalent="p" id="dlv-gu-35p">
<connections>
<action selector="printThisPage:" target="Voe-Tx-rLC" id="Jy5-eU-rLh"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="7ie-IE-K6N"/>
<menuItem title="Copy current URL" id="F42-Mv-oVO">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="copyUrl:" target="Voe-Tx-rLC" id="lTh-k1-YH6"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
<menuItem title="Edit" id="kM9-IE-xVd">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Edit" id="Wah-OC-UhV">
<items>
<menuItem title="Undo" keyEquivalent="z" id="T3K-M0-pds">
<connections>
<action selector="undo:" target="Ady-hI-5gd" id="qIl-hx-yEH"/>
</connections>
</menuItem>
<menuItem title="Redo" keyEquivalent="Z" id="qqN-o9-bKr">
<connections>
<action selector="redo:" target="Ady-hI-5gd" id="2TX-ff-iIy"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="8Kt-uE-HBY"/>
<menuItem title="Cut" keyEquivalent="x" id="i4s-n8-wXz">
<connections>
<action selector="cut:" target="Ady-hI-5gd" id="9Rf-im-BB5"/>
</connections>
</menuItem>
<menuItem title="Copy" keyEquivalent="c" id="cHO-Y8-CkV">
<connections>
<action selector="copy:" target="Ady-hI-5gd" id="kkm-M9-zKH"/>
</connections>
</menuItem>
<menuItem title="Paste" keyEquivalent="v" id="HAk-2k-oTs">
<connections>
<action selector="paste:" target="Ady-hI-5gd" id="wDv-1c-PcC"/>
</connections>
</menuItem>
<menuItem title="Paste and Match Style" keyEquivalent="V" id="Wah-va-YHm">
<modifierMask key="keyEquivalentModifierMask" option="YES" command="YES"/>
<connections>
<action selector="pasteAsPlainText:" target="Ady-hI-5gd" id="wL9-01-GBT"/>
</connections>
</menuItem>
<menuItem title="Delete" id="XfS-gH-udC">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="delete:" target="Ady-hI-5gd" id="dnQ-1Z-0uf"/>
</connections>
</menuItem>
<menuItem title="Select All" keyEquivalent="a" id="KZX-VJ-OIl">
<connections>
<action selector="selectAll:" target="Ady-hI-5gd" id="QOg-2K-Jca"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="YCj-XY-FSC"/>
<menuItem title="Find" id="vur-Ee-IsR">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Find" id="aYU-p3-vbI">
<items>
<menuItem title="Find…" tag="1" keyEquivalent="f" id="Q1d-Fv-HmW">
<connections>
<action selector="performFindPanelAction:" target="Ady-hI-5gd" id="ObB-Mz-VZK"/>
</connections>
</menuItem>
<menuItem title="Find and Replace…" tag="12" keyEquivalent="f" id="zd7-xr-xod">
<modifierMask key="keyEquivalentModifierMask" option="YES" command="YES"/>
<connections>
<action selector="performFindPanelAction:" target="Ady-hI-5gd" id="4j3-9C-sFS"/>
</connections>
</menuItem>
<menuItem title="Find Next" tag="2" keyEquivalent="g" id="Xx1-fz-mt3">
<connections>
<action selector="performFindPanelAction:" target="Ady-hI-5gd" id="jfa-aq-sdm"/>
</connections>
</menuItem>
<menuItem title="Find Previous" tag="3" keyEquivalent="G" id="p8c-hB-c6m">
<connections>
<action selector="performFindPanelAction:" target="Ady-hI-5gd" id="V0x-2H-rDD"/>
</connections>
</menuItem>
<menuItem title="Use Selection for Find" tag="7" keyEquivalent="e" id="i9D-5H-yVn">
<connections>
<action selector="performFindPanelAction:" target="Ady-hI-5gd" id="A0f-rK-Qdw"/>
</connections>
</menuItem>
<menuItem title="Jump to Selection" keyEquivalent="j" id="Owh-gY-yb3">
<connections>
<action selector="centerSelectionInVisibleArea:" target="Ady-hI-5gd" id="S6p-w8-anG"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
<menuItem title="Spelling and Grammar" id="bcd-NF-0kD">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Spelling" id="hbN-l2-7R3">
<items>
<menuItem title="Show Spelling and Grammar" keyEquivalent=":" id="H1w-Pb-bQf">
<connections>
<action selector="showGuessPanel:" target="Ady-hI-5gd" id="AEi-S9-MCL"/>
</connections>
</menuItem>
<menuItem title="Check Document Now" keyEquivalent=";" id="elw-9g-erD">
<connections>
<action selector="checkSpelling:" target="Ady-hI-5gd" id="NGL-Us-GKH"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="C3i-Pl-pD7"/>
<menuItem title="Check Spelling While Typing" id="VYp-LM-iqJ">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleContinuousSpellChecking:" target="Ady-hI-5gd" id="9II-yQ-uVU"/>
</connections>
</menuItem>
<menuItem title="Check Grammar With Spelling" id="NQd-4F-F7u">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleGrammarChecking:" target="Ady-hI-5gd" id="LiX-wf-Ccr"/>
</connections>
</menuItem>
<menuItem title="Correct Spelling Automatically" id="caM-nD-RQd">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleAutomaticSpellingCorrection:" target="Ady-hI-5gd" id="Fa8-Bn-0sc"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
<menuItem title="Substitutions" id="Clr-cV-qUy">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Substitutions" id="fcK-mU-woF">
<items>
<menuItem title="Show Substitutions" id="tgC-ra-RuK">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="orderFrontSubstitutionsPanel:" target="Ady-hI-5gd" id="Rey-lx-DVe"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="mdo-7L-h8K"/>
<menuItem title="Smart Copy/Paste" id="0cq-vj-EeT">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleSmartInsertDelete:" target="Ady-hI-5gd" id="xiv-xA-z2Z"/>
</connections>
</menuItem>
<menuItem title="Smart Quotes" id="QFF-U6-rj3">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleAutomaticQuoteSubstitution:" target="Ady-hI-5gd" id="DL0-Eh-sVW"/>
</connections>
</menuItem>
<menuItem title="Smart Dashes" id="AYs-Jm-OWX">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleAutomaticDashSubstitution:" target="Ady-hI-5gd" id="4w8-ea-myx"/>
</connections>
</menuItem>
<menuItem title="Smart Links" id="vSL-Er-Dzn">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleAutomaticLinkDetection:" target="Ady-hI-5gd" id="ChU-Vb-v1Y"/>
</connections>
</menuItem>
<menuItem title="Data Detectors" id="RbA-n6-mv4">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleAutomaticDataDetection:" target="Ady-hI-5gd" id="0XY-3u-F33"/>
</connections>
</menuItem>
<menuItem title="Text Replacement" id="XKU-CU-oCg">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="toggleAutomaticTextReplacement:" target="Ady-hI-5gd" id="Cgq-Ro-j31"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
<menuItem title="Transformations" id="Jms-Vz-UXk">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Transformations" id="DpD-Qi-s84">
<items>
<menuItem title="Make Upper Case" id="qER-IV-GIL">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="uppercaseWord:" target="Ady-hI-5gd" id="iaN-Mt-iUm"/>
</connections>
</menuItem>
<menuItem title="Make Lower Case" id="Zqd-ID-Z6K">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="lowercaseWord:" target="Ady-hI-5gd" id="9t4-aY-C6q"/>
</connections>
</menuItem>
<menuItem title="Capitalize" id="hGZ-Nz-DIt">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="capitalizeWord:" target="Ady-hI-5gd" id="bUR-Wg-OtS"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
<menuItem title="Speech" id="qMm-Ld-wUf">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Speech" id="Ukk-qQ-spw">
<items>
<menuItem title="Start Speaking" id="dG3-Ol-VGb">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="startSpeaking:" target="Ady-hI-5gd" id="Jc8-Q4-buc"/>
</connections>
</menuItem>
<menuItem title="Stop Speaking" id="eZE-iS-Gbc">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="stopSpeaking:" target="Ady-hI-5gd" id="D1A-bR-Dio"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
</items>
</menu>
</menuItem>
<menuItem title="Window" id="71M-2z-NLE">
<modifierMask key="keyEquivalentModifierMask"/>
<menu key="submenu" title="Window" systemMenu="window" id="sgJ-mx-Spd">
<items>
<menuItem title="Minimize" keyEquivalent="m" id="cKZ-bA-Hcf">
<connections>
<action selector="performMiniaturize:" target="Ady-hI-5gd" id="KB8-sA-ZCC"/>
</connections>
</menuItem>
<menuItem title="Zoom" id="aSx-R8-PeF">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="performZoom:" target="Ady-hI-5gd" id="fNU-nf-0vt"/>
</connections>
</menuItem>
<menuItem isSeparatorItem="YES" id="Oyj-6x-QkF"/>
<menuItem title="Bring All to Front" id="N4R-FC-3p1">
<modifierMask key="keyEquivalentModifierMask"/>
<connections>
<action selector="arrangeInFront:" target="Ady-hI-5gd" id="1sY-xr-dtd"/>
</connections>
</menuItem>
</items>
</menu>
</menuItem>
</items>
</menu>
<connections>
<outlet property="delegate" destination="Voe-Tx-rLC" id="PrD-fu-P6m"/>
</connections>
</application>
<customObject id="Voe-Tx-rLC" customClass="AppDelegate" customModule="Udemy" customModuleProvider="target"/>
<customObject id="Ady-hI-5gd" userLabel="First Responder" customClass="NSResponder" sceneMemberID="firstResponder"/>
<menuItem title="Reload" keyEquivalent="R" id="Kjh-6x-uSS">
<modifierMask key="keyEquivalentModifierMask" shift="YES" command="YES"/>
<connections>
<action selector="reload:" target="Voe-Tx-rLC" id="hXj-Lk-azX"/>
</connections>
</menuItem>
</objects>
<point key="canvasLocation" x="-208" y="-334"/>
</scene>
<!--Window Controller-->
<scene sceneID="R2V-B0-nI4">
<objects>
<windowController id="B8D-0N-5wS" sceneMemberID="viewController">
<window key="window" title="WebShell" allowsToolTipsWhenApplicationIsInactive="NO" autorecalculatesKeyViewLoop="NO" oneShot="NO" releasedWhenClosed="NO" showsToolbarButton="NO" visibleAtLaunch="NO" frameAutosaveName="WebShellMainWindow" animationBehavior="default" id="IQv-IB-iLA" customClass="WSNSWindow" customModule="Udemy" customModuleProvider="target">
<windowStyleMask key="styleMask" titled="YES" closable="YES" miniaturizable="YES" resizable="YES"/>
<windowCollectionBehavior key="collectionBehavior" managed="YES" participatesInCycle="YES"/>
<rect key="contentRect" x="196" y="240" width="1000" height="640"/>
<rect key="screenRect" x="0.0" y="0.0" width="1680" height="1027"/>
<value key="minSize" type="size" width="1000" height="640"/>
<value key="minFullScreenContentSize" type="size" width="1000" height="640"/>
<connections>
<outlet property="delegate" destination="B8D-0N-5wS" id="NkL-hx-iT9"/>
</connections>
</window>
<connections>
<segue destination="XfG-lQ-9wD" kind="relationship" relationship="window.shadowedContentViewController" id="cq2-FE-JQM"/>
</connections>
</windowController>
<customObject id="Oky-zY-oP4" userLabel="First Responder" customClass="NSResponder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="24" y="188"/>
</scene>
<!--View Controller-->
<scene sceneID="hIz-AP-VOD">
<objects>
<viewController storyboardIdentifier="WSView" id="XfG-lQ-9wD" customClass="WSViewController" customModule="Udemy" customModuleProvider="target" sceneMemberID="viewController">
<view key="view" wantsLayer="YES" id="m2S-Jp-Qdl">
<rect key="frame" x="0.0" y="0.0" width="1000" height="640"/>
<autoresizingMask key="autoresizingMask"/>
<subviews>
<webView wantsLayer="YES" translatesAutoresizingMaskIntoConstraints="NO" id="hmw-jr-NE4">
<rect key="frame" x="0.0" y="0.0" width="1000" height="640"/>
<backgroundFilters>
<ciFilter name="CIGaussianBlur">
<configuration>
<null key="inputImage"/>
<real key="inputRadius" value="10"/>
</configuration>
</ciFilter>
</backgroundFilters>
<webPreferences key="preferences" defaultFontSize="16" defaultFixedFontSize="13" minimumFontSize="0">
<nil key="identifier"/>
</webPreferences>
<connections>
<outlet property="frameLoadDelegate" destination="XfG-lQ-9wD" id="qU6-JS-OJO"/>
</connections>
</webView>
<textField horizontalHuggingPriority="251" verticalHuggingPriority="750" translatesAutoresizingMaskIntoConstraints="NO" id="1wx-8i-Jol">
<rect key="frame" x="408" y="300" width="185" height="41"/>
<textFieldCell key="cell" scrollable="YES" lineBreakMode="clipping" sendsActionOnEndEditing="YES" title="Launching..." id="y40-R0-LYw">
<font key="font" metaFont="system" size="34"/>
<color key="backgroundColor" name="controlColor" catalog="System" colorSpace="catalog"/>
</textFieldCell>
</textField>
<progressIndicator wantsLayer="YES" maxValue="100" style="bar" translatesAutoresizingMaskIntoConstraints="NO" id="gaZ-Ka-5Vb">
<rect key="frame" x="-4" y="627" width="1007" height="20"/>
</progressIndicator>
</subviews>
<constraints>
<constraint firstItem="gaZ-Ka-5Vb" firstAttribute="centerX" secondItem="hmw-jr-NE4" secondAttribute="centerX" id="2hL-FH-Wfj"/>
<constraint firstItem="hmw-jr-NE4" firstAttribute="top" secondItem="m2S-Jp-Qdl" secondAttribute="top" id="92o-Jz-CSd"/>
<constraint firstItem="gaZ-Ka-5Vb" firstAttribute="leading" secondItem="m2S-Jp-Qdl" secondAttribute="leading" constant="-4" id="EES-MF-Sf3"/>
<constraint firstItem="gaZ-Ka-5Vb" firstAttribute="top" secondItem="m2S-Jp-Qdl" secondAttribute="top" constant="-6" id="cpS-2I-0k3"/>
<constraint firstItem="hmw-jr-NE4" firstAttribute="centerY" secondItem="1wx-8i-Jol" secondAttribute="centerY" id="dhZ-8b-6UL"/>
<constraint firstAttribute="trailing" secondItem="hmw-jr-NE4" secondAttribute="trailing" id="fTP-He-DVd"/>
<constraint firstItem="1wx-8i-Jol" firstAttribute="centerX" secondItem="hmw-jr-NE4" secondAttribute="centerX" id="iSX-MF-GkG"/>
<constraint firstItem="hmw-jr-NE4" firstAttribute="leading" secondItem="m2S-Jp-Qdl" secondAttribute="leading" id="seh-Ze-ETS"/>
<constraint firstAttribute="bottom" secondItem="hmw-jr-NE4" secondAttribute="bottom" id="uH0-vb-1cq"/>
</constraints>
<shadow key="shadow">
<color key="color" white="0.0" alpha="1" colorSpace="calibratedWhite"/>
</shadow>
<backgroundFilters>
<ciFilter name="CIGaussianBlur">
<configuration>
<null key="inputImage"/>
<real key="inputRadius" value="10"/>
</configuration>
</ciFilter>
</backgroundFilters>
</view>
<connections>
<outlet property="launchingLabel" destination="1wx-8i-Jol" id="Fju-U1-weU"/>
<outlet property="mainWebview" destination="hmw-jr-NE4" id="QFr-gH-tAs"/>
<outlet property="mainWindow" destination="m2S-Jp-Qdl" id="TDZ-2t-Gaw"/>
<outlet property="progressBar" destination="gaZ-Ka-5Vb" id="2Jx-H1-4qV"/>
</connections>
</viewController>
<customObject id="rPt-NT-nkU" userLabel="First Responder" customClass="NSResponder" sceneMemberID="firstResponder"/>
</objects>
<point key="canvasLocation" x="24" y="1008"/>
</scene>
</scenes>
</document>
| 79.838202 | 377 | 0.369708 |
87a996e2ed209480838f3bc2d867d278f88d20a5 | 1,048 | xml | XML | app/src/main/res/values/styles.xml | llcwz/yunzhi | 18a2b018bd957a18dd5e78b154d8baa3b1eb814e | [
"Apache-2.0"
] | 5 | 2018-02-13T08:33:15.000Z | 2019-03-24T15:26:00.000Z | app/src/main/res/values/styles.xml | llcwz/yunzhi | 18a2b018bd957a18dd5e78b154d8baa3b1eb814e | [
"Apache-2.0"
] | null | null | null | app/src/main/res/values/styles.xml | llcwz/yunzhi | 18a2b018bd957a18dd5e78b154d8baa3b1eb814e | [
"Apache-2.0"
] | null | null | null | <resources>
<!--透明状态栏-->
<style name="AppTheme.Base" parent="Theme.AppCompat.Light">
<item name="windowActionBar">false</item>
<item name="windowNoTitle">true</item>
</style>
<style name="BaseAppTheme" parent="AppTheme.Base">
<item name="colorPrimary">@color/transparence</item> <!-- 状态栏 -->
<item name="colorPrimaryDark">@color/transparence</item> <!-- toolbar -->
<item name="colorAccent">@color/colorAccent</item> <!-- 重点 -->
</style>
<style name="AppTheme" parent="BaseAppTheme"/>
<style name="WelcomeHeadingAppearance" parent="@android:style/TextAppearance.Large">
<item name="android:textSize">@dimen/welcome_heading</item>
<item name="android:textColor">@android:color/white</item>
</style>
<style name="WelcomeContentAppearance" parent="@android:style/TextAppearance">
<item name="android:textSize">@dimen/welcome_content</item>
<item name="android:textColor">@android:color/white</item>
</style>
</resources>
| 29.111111 | 88 | 0.648855 |
7ecfb28bdd5b43bd17cdf41ab84cb66697ef3ca6 | 70,829 | xml | XML | grobid-trainer/resources/dataset/segmentation/corpus/tei/1471-2148-9-32.training.segmentation.tei.xml | AaronNGray/grobid | 5d2d81461ab144c20a25a18b93d141548f81260b | [
"Apache-2.0"
] | 20 | 2016-02-22T10:47:56.000Z | 2021-08-31T08:21:00.000Z | grobid-trainer/resources/dataset/segmentation/corpus/tei/1471-2148-9-32.training.segmentation.tei.xml | AaronNGray/grobid | 5d2d81461ab144c20a25a18b93d141548f81260b | [
"Apache-2.0"
] | 8 | 2015-06-03T03:45:19.000Z | 2016-10-14T16:21:58.000Z | grobid-trainer/resources/dataset/segmentation/corpus/tei/1471-2148-9-32.training.segmentation.tei.xml | AaronNGray/grobid | 5d2d81461ab144c20a25a18b93d141548f81260b | [
"Apache-2.0"
] | 7 | 2015-05-16T16:17:43.000Z | 2021-08-31T08:21:01.000Z | <?xml version="1.0" ?>
<tei>
<teiHeader>
<fileDesc xml:id="_1471-2148-9-32"/>
</teiHeader>
<text xml:lang="en">
<note place="headnote">BioMed Central <lb/></note>
<page>Page 1 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
<front>BMC Evolutionary Biology <lb/> Open Access <lb/> Research article <lb/> Genetic analysis of hybridization and introgression between wild <lb/>mongoose and brown lemurs <lb/> Jennifer Pastorini* 1,2 , Alphonse Zaramody 3 , Deborah J Curtis 4 , <lb/>Caroline M Nievergelt 5 and Nicholas I Mundy 6 <lb/> Address: 1 Anthropologisches Institut, Universität Zürich, Winterthurerstrasse 190, 8057 Zürich, Switzerland, 2 Centre for Conservation and <lb/>Research, 35 Gunasekara Gardens, Nawala Road, Rajagiriya, Sri Lanka, 3 Département des Sciences de la Terre, Université de Mahajanga, Faculté <lb/>des Sciences, Dépt. de Biologie Animale, B.P. 652, Mahajanga 401, Madagascar, 4 Department of Anthropology & Geography, School of Social <lb/>Sciences & Law, Oxford Brookes University, Gipsy Lane, Headington, Oxford, OX3 0BP, UK, 5 Department of Psychiatry, University of California <lb/>at San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0603, USA and 6 Department of Zoology, University of Cambridge, Downing Street, <lb/>Cambridge, CB2 3EJ, UK <lb/>Email: Jennifer Pastorini* -jenny@aim.uzh.ch; Alphonse Zaramody -zaramody@univ-mahajanga.mg; <lb/>Deborah J Curtis -curtis@scimedtrans.co.uk; Caroline M Nievergelt -cnieverg@ucsd.edu; Nicholas I Mundy -nim21@cam.ac.uk <lb/>* Corresponding author <lb/> Abstract <lb/> Background: Hybrid zones generally represent areas of secondary contact after speciation. The <lb/>nature of the interaction between genes of individuals in a hybrid zone is of interest in the study of <lb/>evolutionary processes. In this study, data from nuclear microsatellites and mitochondrial DNA <lb/>sequences were used to genetically characterize hybridization between wild mongoose lemurs <lb/>(Eulemur mongoz) and brown lemurs (E. fulvus) at Anjamena in west Madagascar. <lb/> Results: Two segments of mtDNA have been sequenced and 12 microsatellite loci screened in <lb/>162 brown lemurs and mongoose lemurs. Among the mongoose lemur population at Anjamena, <lb/>we identified two F1 hybrids (one also having the mtDNA haplotype of E. fulvus) and six other <lb/>individuals with putative introgressed alleles in their genotype. Principal component analysis groups <lb/>both hybrids as intermediate between E. mongoz and E. fulvus and admixture analyses revealed an <lb/>admixed genotype for both animals. Paternity testing proved one F1 hybrid to be fertile. Of the <lb/>eight brown lemurs genotyped, all have either putative introgressed microsatellite alleles and/or <lb/>the mtDNA haplotype of E. mongoz. <lb/> Conclusion: Introgression is bidirectional for the two species, with an indication that it is more <lb/>frequent in brown lemurs than in mongoose lemurs. We conclude that this hybridization occurs <lb/>because mongoose lemurs have expanded their range relatively recently. Introgressive <lb/>hybridization may play an important role in the unique lemur radiation, as has already been shown <lb/>in other rapidly evolving animals. <lb/></front>
<body> Background <lb/> Hybridization among animals has traditionally been <lb/>viewed as an unusual event. However, recent genetic stud-<lb/>ies have shown that it occurs more commonly than origi-<lb/>nally believed [1,2]. Hybridization may occur due to <lb/>human impact, such as between domestic or captive spe-<lb/>cies, wild and domestic species [3,4] or between intro-<lb/>duced and native species [5,6]. Natural hybridization has <lb/></body>
<front>Published: 5 February 2009 <lb/> BMC Evolutionary Biology 2009, 9:32 doi:10.1186/1471-2148-9-32 <lb/> Received: 5 April 2008 <lb/> Accepted: 5 February 2009 <lb/> This article is available from: http://www.biomedcentral.com/1471-2148/9/32 <lb/> © 2009 Pastorini et al; licensee BioMed Central Ltd. <lb/>This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), <lb/>which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. <lb/>
BMC Evolutionary Biology 2009, 9:32 <lb/>
http://www.biomedcentral.com/1471-2148/9/32 <lb/></front>
<page>Page 2 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
<body>been found across the animal kingdom, including insects <lb/>[7], fish [8], amphibians [9], birds [10,11], carnivores <lb/>[12], and monkeys [13-15]. Among the Malagasy lemurs, <lb/>a few cases of hybridization between subspecies have been <lb/>reported in the wild [16-19]. <lb/>Harrison [20] defined hybridization as "the interbreeding <lb/>of individuals from two populations, or groups of popu-<lb/>lations, which are distinguishable on the basis of one or <lb/>more heritable characters." Hybridization occurs when <lb/>there are incomplete reproductive barriers between two <lb/>taxa. There are many possible evolutionary outcomes of <lb/>hybridization: 1) The two hybridizing taxa may merge, 2) <lb/>reproductive barriers may be reinforced between the <lb/>parental taxa, 3) transfer of genetic material into one or <lb/>both parental taxa may occur, which might facilitate adap-<lb/>tive evolution 4) a new species of hybrid origin may be <lb/>formed, or 5) the hybrid zone may become established <lb/>without any major impact on the parental taxa [21,22]. <lb/>Therefore, studies of natural hybrids and their genetic <lb/>composition can shed new light on issues concerning <lb/>reproductive barriers, survivorship and fitness of hybrids <lb/>and give important insights into evolutionary processes <lb/>and the adaptation of species. <lb/>The Malagasy lemurs are a spectacular example of adap-<lb/>tive radiation and provide an ideal model for studies of <lb/>evolutionary diversification [23]. Currently, 71 lemur spe-<lb/>cies and subspecies are recognized, which are distributed <lb/>across 15 genera in 5 families [24]. Madagascar's isola-<lb/>tion, diverse climate, geology and vegetation provide con-<lb/>ditions equating to a natural experiment in taxonomic <lb/>diversification. Hybridization has been found to play a <lb/>major role in rapid radiations such as Darwin's finches <lb/>[11], East African cichlid fishes [8], Hawaiian crickets [25] <lb/>and passion-vine butterflies [7]. However, little is known <lb/>about interspecific gene flow or its role in the radiation of <lb/>lemurs. <lb/>During a field study on mongoose lemurs (Eulemur mon-<lb/> goz) at Anjamena in western Madagascar an animal was <lb/>observed which exhibited a pelage coloration intermedi-<lb/>ate between that of red-fronted brown lemurs (E. fulvus <lb/>rufus) and mongoose lemurs [26]. This phenotypic varia-<lb/>tion was the first sign that interspecific hybridization <lb/>might be occurring at this site. When sequencing some E. <lb/>f. rufus individuals from the same locality for a phyloge-<lb/>netic study of brown lemurs [27], one individual was <lb/>found to have the mtDNA haplotype of E. mongoz [28]. <lb/>This hardened the suspicion of Anjamena being a hybrid <lb/>zone between two taxonomically well accepted Eulemur <lb/> species. <lb/>Mongoose lemurs and brown lemurs are two of five spe-<lb/>cies in the genus Eulemur, in the family Lemuridae. E. mon-<lb/>goz occurs in the west of Madagascar. Brown lemurs are <lb/>divided into 6 subspecies, which together range over a <lb/>large area of Madagascar, excluding the South of the <lb/>island. Notably, E. fulvus and E. mongoz are the only two <lb/>species of lemurs found outside Madagascar, and are <lb/>thought to have been introduced to the Comoros by <lb/>humans. In Madagascar, East of the Betsiboka river (Fig-<lb/>ure 1), mongoose lemur distribution overlaps with that of <lb/> E. f. fulvus. To the west of the Betsiboka river E. mongoz is <lb/>sympatric with E. f. rufus. The ranges of both brown lemur <lb/>subspecies are much larger than the relatively small area <lb/>mongoose lemurs occupy. E. mongoz is identified as 'vul-<lb/>nerable' in the IUCN red list of threatened species, while <lb/> E. fulvus is classified as at 'lower risk' of extinction [29]. <lb/>Habitat destruction and forest fragmentation are the main <lb/>threats to both taxa. <lb/>Mongoose lemurs at Anjamena live in small family groups <lb/>of 2–6 individuals, consisting of an adult pair and associ-<lb/>ated offspring. Group composition remains relatively <lb/>constant, with changes being limited to births and emigra-<lb/>tion of subadult individuals [26]. Mongoose lemurs are <lb/>cathemeral throughout the year with shifts towards more <lb/>diurnal activity in the wet season and more nocturnal <lb/>activity in the dry season [30]. E. mongoz is predominantly <lb/>frugivorous, its diet being supplemented by leaves, flow-<lb/>ers, and nectar [31]. <lb/>The most important potential competitor for mongoose <lb/>lemurs at Anjamena is E. f. rufus, as it not only shares food <lb/>resources (fruit and leaves) with E. mongoz but also exhib-<lb/>its a similar activity pattern [26]. Brown lemurs at Anja-<lb/>mena live in large groups of up to nine individuals with a <lb/>variable sex and age composition [32]. In 1995, popula-<lb/>tion density of E. f. rufus (121 individuals per km 2 ) in the <lb/>vicinity of Anjamena was much higher than that of E. <lb/>mongoz (45 individuals per km 2 ) [32]. Both E. mongoz and <lb/> E. fulvus exhibit sexual dichromatism. The pelage colora-<lb/>tion of brown lemur males and females is very different <lb/>from that of mongoose lemur males and females (for <lb/>illustrations see [24]). At Anjamena, the body weight of <lb/>adult brown lemurs (ca. 1700 g) is higher than that of <lb/>adult mongoose lemurs (ca. 1200 g, pers. observation). <lb/>Association between the two species has not been <lb/>observed at Anjamena [26]. <lb/>We conducted a comprehensive genetic analysis, includ-<lb/>ing both nuclear microsatellites and mitochondrial DNA <lb/>(mtDNA) sequences of E. mongoz and E. fulvus, to gain <lb/>insights into the genetic composition of the two species, <lb/>and to assess hybridization between them in Anjamena. <lb/>Microsatellites show a high degree of length polymor-<lb/>phism, which makes it possible to obtain pedigree-level <lb/>characterization of populations as well as to detect intro-<lb/>gression of alleles between species. Analysis of mtDNA <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 3 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
sequences allows direct determination of matrilineal <lb/>relatedness, which provides information on past hybrid <lb/>events. <lb/> Methods <lb/> Study population <lb/> A total of 163 samples from mongoose lemurs (108) and <lb/>brown lemurs (55) were collected from the wild and cap-<lb/>tivity (Table 1). The main study site Anjamena is situated <lb/>in the riverine forests of the Mahavavy in western Mada-<lb/>gascar (45°55'E, 16°03'S, Figure 1) from where a total of <lb/>38 samples of E. mongoz were collected. Five hair samples <lb/>were collected in 1994 and 1995 during a behavioural <lb/>study [30]. From August to September 1997, samples of <lb/>33 mongoose lemurs from 12 neighbouring groups and 8 <lb/>brown lemurs from 7 groups were collected at Anjamena. <lb/>In the same time period, 4 E. mongoz and 2 E. fulvus sam-<lb/>ples were collected from animals living near Anadabo-<lb/>mandry across the Mahavavy river from Anjamena. <lb/>Additionally, 2 mongoose lemur and 3 brown lemur sam-<lb/>ples from Ampijoroa (110 km east of Anjamena, sepa-<lb/>rated by the river Betsiboka, Figure 1) were analysed. From <lb/>the animals sampled in 1997, body weight was measured <lb/>and fur coloration was recorded by taking photographs. <lb/>A total of 63 blood, hair or tissue samples were collected <lb/>from mongoose lemurs in captivity. The origin of the cap-<lb/>tive mongoose lemur population is not entirely known, <lb/>but some founder animals originated from the Comoro <lb/>islands. One E. mongoz sample was of unknown origin. An <lb/>additional 42 E. fulvus samples were acquired from vari-<lb/>ous zoos, covering all brown lemur subspecies (Table 1). <lb/>In addition, samples of 3 E. coronatus, 3 E. rubriventer, 3 E. <lb/>macaco macaco, 3 E. m. flavifrons and 2 Lemur catta (all zoo <lb/>animals) were sequenced for mtDNA [for more details see <lb/>Additional file 1]. <lb/> Molecular methods <lb/> DNA was extracted from hair, blood or tissue samples <lb/>using a standard phenol-chloroform extraction [33]. <lb/>Approximately 10–100 ng template DNA was amplified <lb/>in 20 μl (microsatellites) or 50 μl (mtDNA) reactions <lb/>using 0.06 M Tris, 0.015 M (NH 4 ) 2 SO 4 , 1.5 mM MgCl 2 , <lb/>0.78 M DMSO, 0.025 mM for each dNTP, 1 mM for each <lb/>primer, and 0.5 U Thermophilus aquaticus (Taq) polymer-<lb/>ase. Samples were amplified for 25–35 cycles, with dena-<lb/>turing at 95°C for 30 s, primer annealing at 50–65°C for <lb/>60 s, and extension at 72°C for 60 s, followed by a final <lb/>extension for 5 min at 72°C. The number of cycles and/or <lb/>the annealing temperature was changed as necessary, to <lb/>optimize the PCR conditions for each locus. <lb/>A total of 12 microsatellite loci were used for this study. <lb/>Locus Efr09J was originally isolated from E. f. rufus [34]. <lb/>We performed the PCR of that locus with 60°C annealing <lb/>and 25 cycles. To amplify locus Lc8, which was developed <lb/>for L. catta [35], 55°C annealing temperature and 35 <lb/>cycles were used. The other 10 loci were amplified using <lb/>the PCR conditions described in [36]. PCR products were <lb/>run on an ABI PRISM 377XL or 3730 automated DNA <lb/>sequencer. Allele sizes were determined with GeneScan <lb/>software (Applied Biosystems). For all loci, samples of 30 <lb/>offspring and their known pairs of parents as well as 15 <lb/>offspring with one available parent from the captive mon-<lb/>goose lemur colony were genotyped, allowing testing for <lb/>Mendelian inheritance. <lb/> Location of Anjamena (red cross) where E. mongoz and E. ful-<lb/>vus hybridize <lb/> Figure 1 <lb/>Location of Anjamena (red cross) where E. mongoz <lb/> and E. fulvus hybridize. Two additional sample locations <lb/>(Anadabomandry and Ampijoroa) and one fossil site (Anjo-<lb/>hibe) are labelled in red. Green areas are forests. The inset <lb/>shows the distribution of E. mongoz (blue border), E. f. rufus <lb/> (yellow) and other E. fulvus subspecies (red). <lb/> Canale de Moçambique <lb/> 20 km <lb/>0 <lb/> Lac Kinkony <lb/> Katsepy <lb/>Namakia <lb/> Mahajanga <lb/> Mitsinjo <lb/> ANJAMENA <lb/> Marovoay <lb/> Ampijoroa <lb/> A n k a r a f a n t s i k a <lb/> Bekipa <lb/> B e ts ib o k a <lb/> M a h a v a v y <lb/> M ah aj am ba <lb/> A <lb/> n <lb/> o <lb/> m <lb/> a <lb/> v <lb/> o <lb/> Anjohibe <lb/> Anadabomandry <lb/> Table 1: Samples available from mongoose and brown lemurs <lb/> Taxon <lb/>Location <lb/># Samples <lb/> Eulemur mongoz Anjamena <lb/>38 <lb/>Anadabomandry <lb/>4 <lb/>Ampijoroa <lb/>2 <lb/>Madagascar (unknown) <lb/>1 <lb/>Captivity <lb/>63 <lb/> E. fulvus rufus <lb/> Anjamena <lb/>8 <lb/>Anadabomandry <lb/>2 <lb/>Other <lb/>12 <lb/> E. f. fulvus <lb/> Various zoos/locations <lb/>14 <lb/> E. f. albifrons <lb/> Various zoos/locations <lb/>10 <lb/> E. f. sanfordi <lb/> Tsimbazaza Zoo <lb/>3 <lb/> E. f. collaris <lb/> Banham Zoo, pet in Fort Dauphin <lb/>2 <lb/> E. f. albocollaris <lb/> Strasbourg, Tsimbazaza Zoo <lb/> 4 <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 4 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
The 3' end of the tRNA Thr gene, the complete tRNA Pro gene <lb/>and the 5' end of the control region (D-loop), as well as <lb/>part of the NADH-dehydrogenase subunit 4 (ND4) gene <lb/>were amplified and sequenced, using the primers listed in <lb/>Table 2. The PCR products were electrophoresed in 2% <lb/>agarose gels to estimate template concentration. The <lb/>sequencing reactions were carried out with the BigDye <lb/>Terminator Cycle Sequencing Ready Reaction Kit <lb/>(Applied Biosystems), using 1 μl of terminator mix and 2 <lb/> μl of 5× buffer for a 9 μl reaction. The completed sequenc-<lb/>ing reactions were cleaned of excess dyes with ethanol pre-<lb/>cipitation before being run on an automated DNA <lb/>sequencer. All templates were sequenced in their entirety <lb/>for both strands. The sequencing data was aligned with <lb/>Sequencher™ 4.2.2 (Gene Codes Corporation). <lb/> Statistical analyses <lb/> For microsatellite data, CERVUS 3.0.3 [37] was used to <lb/>calculate observed (H O ) and expected (H E ) heterozygosi-<lb/>ties, frequency estimates for null alleles and to test for <lb/>deviations from the Hardy-Weinberg equilibrium. Addi-<lb/>tionally, non-exclusion probabilities for first and second <lb/>parents on the 12 autosomal microsatellite loci and the <lb/>probability for two random individuals having the same <lb/>genotype were determined with CERVUS. GENEPOP <lb/>4.0.6 [38] was used to test for genotypic linkage disequi-<lb/>librium in the wild mongoose lemurs at Anjamena. Bon-<lb/>ferroni correction was applied to alpha to adjust for <lb/>multiple testing of 12 loci. The population genetic struc-<lb/>ture was inferred by calculating F is , F st and R st estimates in <lb/>GENEPOP and by performing an analysis of molecular <lb/>variance (AMOVA) in Arlequin 3.11 [39]. Principal com-<lb/>ponent analysis of the multilocus genotypes was carried <lb/>out with GENETIX 4.05 [40]. STRUCTURE 2.2.2 [41] was <lb/>used to infer the genetic structure of the populations <lb/>based on microsatellite loci. The number K of populations <lb/>was estimated using a burn-in period of 10,000 and <lb/>100,000 MCMC replicates, applying the admixture model <lb/>and independent or correlated allele frequencies. The esti-<lb/>mated membership coefficients Q for each individual in <lb/>each cluster was calculated by STRUCTURE, in order to <lb/>assign the individual to one or, if admixed, to several clus-<lb/>ters. <lb/>The aligned mtDNA sequences were analysed with PAUP <lb/>4.0b10 [42] using maximum parsimony (2500 random <lb/>addition heuristic search) and neighbor-joining (Kimura <lb/>2-parameter distances) methods. Gaps were considered as <lb/>a fifth character state in parsimony analyses, whereas in <lb/>neighbor-joining analyses they were treated as missing <lb/>data. Bootstrap analyses of 1000 replicates (10 random <lb/>addition heuristic searches each) for maximum parsi-<lb/>mony and 2500 replicates for neighbor-joining were per-<lb/>formed to examine the relative support of each <lb/>relationship in the resultant topologies. Two Lemur catta <lb/> sequences were used as the outgroup. <lb/> Results <lb/> Microsatellite variation <lb/> Overall, the multilocus panel employed was found to be <lb/>very informative. The probability that two individuals <lb/>cannot be differentiated is 3.08E-9 for E. mongoz and <lb/>3.64E-14 for E. fulvus. With one exception, all individuals <lb/>have unique multilocus genotypes. One adult mongoose <lb/>lemur male from Anjamena sampled in 1995 has exactly <lb/>the same genotype as a male from 1997. Because none of <lb/>the wild animals sampled were marked permanently, it is <lb/>likely that the same male was captured twice. Therefore, <lb/>one of the two samples was removed from the data set. <lb/>Variation among mongoose and brown lemurs for the 12 <lb/>microsatellite loci is summarized in Table 3. There is no <lb/>evidence for linkage disequilibrium between loci in the <lb/>mongoose lemur population at Anjamena. When assess-<lb/>ing the parent-offspring relationships in the captive mon-<lb/>goose lemur population with known pedigrees, all alleles <lb/>are found to segregate with Mendelian expectations. <lb/>Allelic diversity ranges from 3 to 9 alleles per locus (mean <lb/>= 5.9 ± 1.8 SE) in mongoose lemurs and from 3 to 17 (9.0 <lb/>± 3.9) in brown lemurs. Mongoose lemurs at Anjamena <lb/>have observed heterozygosities of 0.16 to 0.89 (0.50 ± <lb/>0.20) per locus, which are slightly higher than expected <lb/>heterozygosities (Table 3). In the mongoose lemur popu-<lb/>lation at Anjamena, no locus differs significantly from <lb/>Hardy-Weinberg equilibrium. The other samples were not <lb/>tested for the Hardy-Weinberg equilibrium because they <lb/>are either from captivity (no random mating) or from dif-<lb/> Table 2: Forward (F) and reverse (R) primers used to amplify (A) and sequence (S) the two mtDNA fragments <lb/> Primer <lb/>Sequence 5'-3' <lb/>Map position* <lb/>F/R <lb/>A <lb/>S <lb/> 283 <lb/> tacactggtcttgtaaacc <lb/>15908–15926 <lb/>F <lb/>x <lb/>x <lb/>LemurDLF1 <lb/>aagcctagtccatacgcatataagc <lb/>16181–16205 <lb/>F <lb/>x <lb/>x <lb/>LemurDLR2 <lb/>ggtagattaagctacgatc <lb/>16303–16321 <lb/>R <lb/>x <lb/>x <lb/>LemurDLR4 <lb/>atctcYtatgtccttcaagcat <lb/>219–240 <lb/>R <lb/>x <lb/>x <lb/>282 <lb/>aaggctaggaccaaacct <lb/>651–668 <lb/>R <lb/>x <lb/>ND4F <lb/>taggaggataYggRataatacg <lb/>11472–11493 <lb/>F <lb/>x <lb/>x <lb/>ND4R <lb/>atagatattagggtattttctcg <lb/>12053–12075 <lb/>R <lb/>x <lb/>x <lb/>* Relative to human mtDNA [GenBank: V00662] <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 5 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
ferent subspecies (different populations). All loci have <lb/>low inbreeding coefficients (-0.17<F is < 0.40, Table 3). <lb/>With one exception, estimates of null allele frequencies <lb/>range from -0.11 to 0.05 for each locus, indicating <lb/>absence of null alleles. Locus Em5 has an estimated null <lb/>allele frequency of 0.24. However, since the locus is in <lb/>Hardy-Weinberg equilibrium and the alleles are inherited <lb/>in Mendelian fashion when testing the 45 offspring with <lb/>known parents, the presence of a null allele is unlikely to <lb/>be the reason for this result. We therefore retained this <lb/>locus for further data analyses. <lb/> Species differentiation and hybrids <lb/> Analysis of molecular variance applied to the two Eulemur <lb/> species showed 23.21% between-species variability <lb/>(AMOVA, P < 0.0001), indicating that 76.79% of the <lb/>genetic variation was found within each species. Genetic <lb/>differentiation between the two species is relatively high <lb/>(F st = 0.232, R st = 0.636) and significant at each locus <lb/>(exact G test, P = 0). <lb/>Principal component analysis (PCA) clearly separates <lb/>brown lemurs from mongoose lemurs (left and right on <lb/>Figure 2). Within E. mongoz, the wild and captive popula-<lb/>tions are grouped apart (top and bottom in Figure 2) with <lb/>little overlap. There are no obvious subgroups among <lb/>brown lemurs. Two mongoose lemurs (JP167 and JP184) <lb/>are intermediate between E. mongoz and E. fulvus (Figure <lb/>2). <lb/>We used STRUCTURE on the microsatellite data to iden-<lb/>tify distinct genetic populations, assign individuals to <lb/>populations, and identify admixed individuals. When <lb/>assuming two populations (K = 2), all 162 samples are <lb/>correctly assigned to their species (Figure 3). Most mon-<lb/>goose lemurs clearly fall into cluster 1 with the proportion <lb/>of membership Q1 ranging from 0.833 to 0.998 (0.994 ± <lb/>0.018). Only two mongoose lemurs from Anjamena <lb/>(JP167 and JP184) split between cluster 1 (Q1 = 0.632 <lb/>and 0.539) and cluster 2 (Q2 = 0.368 and 0.461). All 55 <lb/>brown lemurs are grouped into cluster 2, with Q2 ranging <lb/>from 0.814 to 0.998 (0.983 ± 0.035). <lb/>When K is increased from 2 up to 16, the samples are <lb/>divided into more clusters, with K = 12 showing the high-<lb/>est probability. The different clusters mainly represent <lb/>subspecies in E. fulvus or populations/groups in mon-<lb/>goose lemurs (data not shown). However, while individ-<lb/>uals might be admixed between populations or <lb/>subspecies of the same species, there is no admixture of <lb/>the two species (apart from JP167 and JP184). These tests <lb/>confirm the clear separation of the two species and the <lb/>intermediate positioning of JP167 and JP184. <lb/>We also ran analyses using only the 42 mongoose and <lb/>brown lemurs from Anjamena. When assuming K = 2 <lb/>populations, most lemurs are clearly assigned to the cor-<lb/>rect species (Q1 = 0.996 ± 0.006 in most E. mongoz and Q2 <lb/>= 0.995 ± 0.004 in all E. fulvus). There are 3 mongoose <lb/>lemurs that are split between the two clusters. As in the <lb/>previous analyses, the two individuals JP167 and JP184 <lb/>have the highest probabilities to be admixed (Q1/Q2 = <lb/>0.527/0.473 and 0.714//0.286). In addition, a third mon-<lb/>goose lemur (JP152) has a slightly increased proportion <lb/>of membership for cluster 2 (Q2 = 0.192). When increas-<lb/>ing K, no further subdivision at Anjamena is possible. <lb/> Introgression of microsatellite alleles in mongoose lemurs <lb/> A total of 71 alleles are found at the 12 loci in the 107 <lb/>mongoose lemurs studied. The 37 E. mongoz at Anjamena <lb/> Table 3: Characteristics* of the 12 microsatellite loci used in E. mongoz and E. fulvus <lb/> Locus <lb/> E. mongoz at Anjamena <lb/> E. mongoz <lb/>E. fulvus <lb/> N I <lb/> N A <lb/> H O <lb/> H E <lb/> F is <lb/> SR <lb/>N I <lb/> N A <lb/> SR <lb/>N I <lb/> N A <lb/> Em1 <lb/> 37 <lb/>5 <lb/>0.892 <lb/>0.767 <lb/>-0.165 <lb/>161–175 <lb/>107 <lb/>8 <lb/>161–199 <lb/>53 <lb/>17 <lb/>Em2 <lb/>37 <lb/>3 <lb/>0.162 <lb/>0.153 <lb/>-0.061 <lb/>156–164 <lb/>107 <lb/>4 <lb/>150–176 <lb/>54 <lb/>11 <lb/>Em4 <lb/>37 <lb/>4 <lb/>0.568 <lb/>0.504 <lb/>-0.129 <lb/>146–158 <lb/>107 <lb/>5 <lb/>142–160 <lb/>55 <lb/>8 <lb/>Em5 <lb/>37 <lb/>2 <lb/>0.270 <lb/>0.444 <lb/>0.395 <lb/>172–176 <lb/>107 <lb/>3 <lb/>170–180 <lb/>55 <lb/>6 <lb/>Em7 <lb/>37 <lb/>6 <lb/>0.649 <lb/>0.729 <lb/>0.112 <lb/>129–147 <lb/>107 <lb/>7 <lb/>129–151 <lb/>55 <lb/>9 <lb/>Em8 <lb/>37 <lb/>6 <lb/>0.703 <lb/>0.719 <lb/>0.023 <lb/>159–177 <lb/>107 <lb/>9 <lb/>143–175 <lb/>55 <lb/>12 <lb/>Em9 <lb/>37 <lb/>4 <lb/>0.432 <lb/>0.437 <lb/>0.011 <lb/>171–183 <lb/>106 <lb/>7 <lb/>169–197 <lb/>53 <lb/>13 <lb/>Em11 <lb/>37 <lb/>4 <lb/>0.541 <lb/>0.534 <lb/>-0.013 <lb/>250–259 <lb/>107 <lb/>6 <lb/>247–257 <lb/>55 <lb/>6 <lb/>Em15 <lb/>37 <lb/>4 <lb/>0.595 <lb/>0.652 <lb/>0.089 <lb/>206–224 <lb/>107 <lb/>6 <lb/>204–212 <lb/>55 <lb/>3 <lb/>Lc1 <lb/>37 <lb/>5 <lb/>0.757 <lb/>0.672 <lb/>-0.129 <lb/>86–98 <lb/>107 <lb/>5 <lb/>90–100 <lb/>55 <lb/>6 <lb/>Lc8 <lb/>35 <lb/>5 <lb/>0.429 <lb/>0.393 <lb/>-0.091 <lb/>221–231 <lb/>104 <lb/>7 <lb/>217–237 <lb/>50 <lb/>11 <lb/>Efr09 <lb/>37 <lb/>4 <lb/>0.622 <lb/>0.542 <lb/>-0.150 <lb/>99–105 <lb/>107 <lb/>4 <lb/>95–107 <lb/>51 <lb/>6 <lb/>Mean <lb/>36.8 <lb/>4.3 <lb/>0.552 <lb/>0.545 <lb/>-0.009 <lb/>106.7 <lb/>5.9 <lb/>53.8 <lb/>9.0 <lb/>* N I = number of individuals genotyped; N A = number of alleles found; H O = observed heterozygosity; H E = expected heterozygosity; F is = <lb/>inbreeding coefficient; SR = size range of alleles in base positions <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 6 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
have 53 different alleles, of which 10 alleles are not found <lb/>in any other mongoose lemur outside Anjamena. Assum-<lb/>ing that hybridization is restricted to Anjamena, these 10 <lb/>private alleles for Anjamena are potential candidates for <lb/>introgression into the mongoose lemur gene pool by <lb/>hybridization with brown lemurs. However, one allele is <lb/>not observed in any brown lemur, which excludes it from <lb/>being of E. fulvus origin. Details of the remaining 9 alleles <lb/>are given in Table 4. <lb/>Five of the possibly introgressed alleles are very common <lb/>(>20%) in E. f. rufus at Anjamena, which supports their <lb/>origin in brown lemurs. Three alleles are found only once <lb/>or twice among the 8 Anjamena brown lemurs (6–13%), <lb/>however, since they are very rare in mongoose lemurs <lb/>(each allele only found once), they might still be of brown <lb/>lemur origin. One mongoose lemur at Anjamena has an <lb/>allele (Lc8–223), not found in any other mongoose lemur <lb/>and also not in the brown lemurs at Anjamena. Only one <lb/> E. f. fulvus has that same allele. <lb/>The two hybrid mongoose lemurs (JP167 and JP184) <lb/>identified from PCA/STRUCTURE analyses have 4 puta-<lb/>tive introgressed alleles each. These two animals have 7 <lb/>putative introgressed alleles found only once or twice in <lb/>the mongoose lemurs at Anjamena (Table 4). Another 6 <lb/>mongoose lemurs at Anjamena have one or both of the <lb/>remaining 2 possibly introgressed alleles. One allele (Lc1– <lb/>98) occurs in 3 mongoose lemurs and with a frequency of <lb/>31% is well represented among the brown lemurs in Anja-<lb/>mena. The other allele (Lc8–221) is found 5 times in <lb/>mongoose lemurs and has an allele frequency of 21% in <lb/> E. f. rufus. <lb/> Parentage of hybrids <lb/> At the time of our field study, JP167 was still a juvenile <lb/>female without offspring. The other hybrid JP184 was an <lb/>adult female. We were able to collect samples from the <lb/>adult male and the juvenile of her social group. In parent-<lb/>age testing using microsatellites, neither the adult male <lb/>nor the hybrid female JP184 are excluded as parents of the <lb/>juvenile JP152. With a high probability (99.0% if accept-<lb/>ing the adult male as the father, 91.0% if only considering <lb/>the female), this makes JP184 the mother of the juvenile. <lb/> Introgressed microsatellite alleles in brown lemurs <lb/> The 13 brown lemurs in the E. f. rufus subspecies clade, <lb/>which includes the animals from Anjamena (see Figure 4, <lb/>the other 9 E. f. rufus samples mentioned in Table 1 form <lb/>another subspecies clade), have 60 different alleles. Seven <lb/>alleles are unique to the 8 brown lemurs at Anjamena and <lb/>also present in the mongoose lemur gene pool at Anja-<lb/>mena. Two of these alleles are only found in mongoose <lb/>and brown lemurs at Anjamena and hence could originate <lb/>from either species (Em4–146 and Lc8–221, Table 4). <lb/>Based on their low frequency in mongoose lemurs and <lb/>high frequency in brown lemurs they are more likely to be <lb/>of brown lemur origin. This leaves 5 alleles, which might <lb/>have been introduced into the brown lemur gene pool by <lb/>hybridization (Table 4). With one exception, each brown <lb/>lemur has 1 to 5 of these possibly introgressed alleles in <lb/>its haplotype (2.57 ± 1.51). Due to the very low sample <lb/>size for E. f. rufus (N = 13), this identification of putatively <lb/>introgressed alleles is only preliminary. <lb/> mtDNA results <lb/> We sequenced two fragments of the mtDNA genome for <lb/>107 mongoose lemurs and 55 brown lemurs, as well as 12 <lb/>individuals from the other three Eulemur species and 2 <lb/> Lemur catta. The aligned nucleotide sequences span a total <lb/>of 1463 base positions (bp). The analysed data set consists <lb/>of 31 bp of tRNA Thr , 66 bp of tRNA Pro , 804 bp of D-loop <lb/>and 559 bp of ND4. Details on the number of haplotypes <lb/>found with D-loop data, ND4 data and the combined <lb/>data set in animals at Anjamena or across the species <lb/>range are given in Table 5. A total of 36 variable positions <lb/>are present among mongoose lemurs, while brown <lb/>lemurs exhibit 178 variable sites (Table 5). Nucleotide <lb/>divergence between the two species ranges from 0.054 to <lb/>0.077 (0.063 ± 0.004 Tamura-Nei distance). Some of the <lb/>ND4 sequences have been published previously [27,43]. <lb/>New sequences were deposited on GenBank [D-loop: <lb/>EU333172–EU333247, ND4: EU333248–EU333274, see <lb/>also Additional file 1]. <lb/>There are 5 mtDNA haplotypes (MA-ME) in the mon-<lb/>goose lemur population at Anjamena. In addition, one <lb/>mongoose lemur exhibits the mtDNA haplotype of a <lb/>brown lemur. The brown lemurs at Anjamena have 3 hap-<lb/>lotypes (FA, FB, FC). One of these (FA), is the haplotype <lb/>also observed in the mongoose lemur. There are 4 E. fulvus <lb/> at Anjamena with the E. mongoz haplotype MF, which is <lb/>not found in any mongoose lemur at Anjamena. While <lb/>the haplotypes MA-ME differ from each other by 1 or 2 bp, <lb/>haplotype MF is 4–5 bp different from the other haplo-<lb/>types found among mongoose lemurs in Anjamena. The 3 <lb/> E. fulvus haplotypes at Anjamena differ from each other by <lb/>1 or 2 bp. <lb/>Among all 107 mongoose lemurs, 10 haplotypes (MA-<lb/>MK) are found. The most common (57%) haplotype, MI, <lb/>is present in 61 E. mongoz kept in various zoos. Two ani-<lb/>mals in captivity each have a unique haplotype (MJ and <lb/>MK). The 3 haplotypes found in captivity differ from each <lb/>other by only 1 or 2 bp. The two animals at Ampijoroa <lb/>have haplotype MH and the 4 mongoose lemurs from <lb/>Anadabomandry have haplotype MG. <lb/>In the phylogenetic analyses, four distinct clades of mon-<lb/>goose lemurs can be recognized (Figure 4). One clade con-<lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 7 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
tains the animals from Anjamena, including the <lb/>haplotype found in the 4 brown lemurs at Anjamena. The <lb/>3 haplotypes from the captive mongoose lemurs form a <lb/>second clade while the haplotypes from Ampijoroa and <lb/>Anadabomandry each form a separate clade. Haplotypes <lb/>between those 4 clades differ from each other at 12 to 21 <lb/>bp (17.6 ± 3.2). <lb/>Among brown lemurs, a total of 34 haplotypes are found. <lb/>Phylogenetic analyses group them into 6 clades (Figure <lb/>4). Each of these subspecies clades gets 93 – 100% boot-<lb/>strap support in neighbor-joining and maximum parsi-<lb/>mony analyses (Figure 4). The clade containing the brown <lb/>lemurs from Anjamena includes 5 additional animals, <lb/>which add 4 more haplotypes to this clade: Two haplo-<lb/>types FD and FE are present at Anadabomandry, which <lb/>differ from each other by 5 bp. One zoo animal of <lb/>unknown origin also exhibits haplotype FD. The remain-<lb/>ing 2 haplotypes are found in a zoo animal of unknown <lb/>origin (FF) and in a red-fronted brown lemur from <lb/>Maintirano, which lies further south from Anjamena on <lb/>the western coast of Madagascar (FG). <lb/> Discussion <lb/> F1 hybrids in the mongoose lemur population <lb/> Principal component analysis positions two animals <lb/>between E. mongoz and E. fulvus (Figure 2) and admixture <lb/>analyses reveal an admixed genotype for the same two <lb/>individuals (Figure 3). These two animals are most likely <lb/>F1 hybrids. Whereas one allele per locus and, hence, 12 <lb/>introgressed alleles would be expected in an F1 hybrid, we <lb/>observed only 4. The 8 brown lemurs from Anjamena <lb/>have a total of 37 different alleles in their genotypes, of <lb/>which 16 alleles are shared with the mongoose lemurs at <lb/>Anjamena. Therefore, only 21 alleles are unique to E. ful-<lb/>vus and are identifiable as introgressed in a hybrid. Taking <lb/>the allele frequencies into account, a hybrid would inherit <lb/>from its brown lemur parent on average 5.03 alleles which <lb/>are exclusive to brown lemurs and 6.97 alleles which are <lb/>shared between E. mongoz and E. fulvus, which is consist-<lb/>ent with the pattern found. <lb/>JP167 is a juvenile female, which is part of a group con-<lb/>sisting of 3 animals. Fur coloration of JP167 is clearly <lb/>intermediate between brown lemur and mongoose lemur <lb/>females. This led us to suspect in the field, that she might <lb/>be a hybrid. The two other group members are an adult <lb/>male and an adult female. We were only able to capture <lb/>the adult female, that exhibited normal mongoose lemur <lb/>fur coloration. She has the mtDNA haplotype of a regular <lb/>mongoose lemur and has no putative introgressed alleles. <lb/>Apart from the mtDNA, this adult female is also excluded <lb/>at 2 microsatellite loci from being the mother of JP167. <lb/>The second mongoose lemur of hybrid origin is an adult <lb/>female (JP184). She is a member of a small social group, <lb/>including herself, an adult male, subadult female and <lb/>juvenile male. The adult male has the normal fur colora-<lb/>tion of a mongoose lemur male. The juvenile (JP152), like <lb/>JP184 exhibits a mixture of fur colours from E. mongoz and <lb/> E. fulvus. Parentage testing indicates that the adult hybrid <lb/>female JP184 is most likely (>90%) the mother of the <lb/>juvenile. The genotype of the juvenile contains none of <lb/>the 4 putative introgressed alleles from the mother. How-<lb/>ever, admixture analyses of the lemurs at Anjamena reveal <lb/>a proportion of brown lemur ancestry (Q2 = 0.192) in its <lb/>genotype that is consistent with an F2. <lb/> Descendants of hybrids in the mongoose lemur population <lb/> The 6 mongoose lemurs with one or two putative intro-<lb/>gressed alleles might be descendants of a hybrid crossing. <lb/>Neither PCA nor admixture analyses were able to differen-<lb/>tiate them from other mongoose lemurs. Consistent with <lb/> Principal component analysis of individual E. mongoz and E. <lb/>fulvus genotypes <lb/> Figure 2 <lb/>Principal component analysis of individual E. mongoz <lb/> and E. fulvus genotypes. First and second axes represent <lb/>the first two factorial components. The two hybrids (JP167 <lb/>and JP184) are specially marked. <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 8 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
this, their coat coloration was normal for mongoose <lb/>lemurs and so they could not be F1s, and are unlikely to <lb/>be F2s, since the confirmed offspring of an F1 hybrid and <lb/>a mongoose lemur (JP152) has intermediate coat colour. <lb/>If hybridization had occurred, a single event could have <lb/>accounted for the allele distribution. Further data would <lb/>be required to assess whether these alleles truly represent <lb/>a signature of past introgression events, and to estimate <lb/>the rate of introgression. <lb/> Conclusions on hybrid crossings in the mongoose lemur <lb/>population <lb/> We found genetic evidence for a minimum of 2 hybridiza-<lb/>tion events in mongoose lemurs of Anjamena. Two hybrid <lb/>crossings were very recent (F1). In addition, one of the F1 <lb/>hybrids had an offspring where paternity could be geneti-<lb/>cally confirmed. Therefore, hybridization between mon-<lb/>goose and brown lemurs occurs in the wild and yields <lb/>fertile offspring, which can successfully backcross with <lb/>mongoose lemurs. A third potential hybrid crossing might <lb/>have happened a few generations ago, which would again <lb/>show the fertility of the hybrids. <lb/>One of the F1 hybrids has the mtDNA haplotype of a <lb/>brown lemur and the other of a mongoose lemur. Hybrid <lb/>crossings can therefore occur between E. mongoz females <lb/>and E. fulvus males as well as between E. mongoz males and <lb/> E. fulvus females. <lb/> Introgression into the brown lemur population <lb/> Due to the small sample size (N = 8) and also not know-<lb/>ing the familial relationships among the members of each <lb/>social group (containing several males and females), no <lb/>detailed information on hybrid crossings can be obtained <lb/>for the brown lemurs at Anjamena. However, half of the <lb/>brown lemurs sampled have an E. mongoz mtDNA haplo-<lb/>type. As all 4 animals have the same haplotype MF, the <lb/>presence of that haplotype could be the consequence of a <lb/>single hybrid crossing. Interestingly, haplotype MF is not <lb/>found in any of the 35 mongoose lemurs sampled at Anja-<lb/>mena and is the most divergent of the 5 E. mongoz haplo-<lb/>types found there (Figure 4). These two factors make it <lb/>likely that the hybrid crossing from which haplotype MF <lb/>is derived occurred in the past, with the mongoose lemurs <lb/>at Anjamena subsequently losing haplotype MF due to <lb/>genetic drift. Alternatively, it could have occurred between <lb/>a brown lemur male and a mongoose lemur female <lb/>located some distance from Anjamena. <lb/>Seven of the eight brown lemur genotypes from Anjamena <lb/>contain putative introgressed microsatellite alleles. The <lb/>only brown lemur without any introgressed alleles has the <lb/>mtDNA genotype of E. mongoz. The samples were col-<lb/>lected from animals living in 7 different social groups at <lb/>Anjamena. Principal component analysis failed to group <lb/>the 8 animals closely together (Figure 2). Therefore, close <lb/>familial relationships are no explanation for the high <lb/>presence of introgressed alleles among these brown <lb/>lemurs. Fur coloration of all 8 animals appeared to be nor-<lb/>mal for red-fronted brown lemurs, excluding them from <lb/>being F1 or F2 hybrids. However, a larger sample from <lb/>brown lemurs at Anjamena and across the subspecies <lb/>range is needed to confirm this result. Some of the current <lb/>putative introgressed alleles might be found in other E. f. <lb/>rufus outside Anjamena, making an origin in E. mongoz <lb/> unlikely, while a more detailed study on the brown <lb/>lemurs at Anjamena might reveal new introgressed alleles. <lb/> Evolutionary consequences <lb/> Some time after the five species of Eulemur radiated across <lb/>Madagascar, a brown lemur radiation started, most likely <lb/>in the South, where E. f. albocollaris and E. f. collaris occur. <lb/>This is the only area where brown lemurs do not overlap <lb/>with another Eulemur species. Brown lemurs then radiated <lb/>back across the island to the North [43], becoming sym-<lb/>patric with the other 4 Eulemur species. However, no <lb/>hybrids are reported between the brown lemurs and sym-<lb/>patric E. rubriventer in the East, E. coronatus in the North, <lb/>or E. macaco in the Northwest. E mongoz is sympatric with <lb/> E. f. fulvus and E. f. rufus in the West, but there also seems <lb/>to be no hybridization between E. mongoz and E. f. fulvus. <lb/> Only E. f. rufus and E. mongoz at Anjamena are known to <lb/>hybridize. <lb/>A possible explanation for this hybridization is that one <lb/>species only recently expanded its range and there were no <lb/>reproductive barriers in place between the two newly <lb/>overlapping taxa. During the radiation of brown lemurs <lb/>the Betsiboka river formed a barrier dividing E. fulvus pop-<lb/> Admixture analysis of 162 mongoose and brown lemurs <lb/> Figure 3 <lb/>Admixture analysis of 162 mongoose and brown <lb/>lemurs. Each individual is represented by a single vertical <lb/>line broken into K = 2 segments, with lengths proportional <lb/>to the estimated membership in each cluster (Q1 for E. mon-<lb/>goz and Q2 for E. fulvus). The two hybrids (JP167 and JP184) <lb/>are marked with *. <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 9 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
ulations, resulting in it being the northern limit of E. f. <lb/>rufus, with E. f. fulvus subspecies being formed across the <lb/>river (see also Figure 1). In contrast, E. mongoz is one of the <lb/>few lemur taxa for which the Betsiboka river is not a taxo-<lb/>nomic boundary [44]. The current mongoose lemur range <lb/>extends a little southwest of Anjamena, across the Maha-<lb/>vavy river. Our mtDNA sequence data shows (Figure 4) <lb/>that the mongoose lemurs at Anjamena are substantially <lb/>different from those at Ampijoroa (14–15 bp out of 1463 <lb/>bp), but do not differ to the extent seen in the two brown <lb/>lemur subspecies (44–46 bp). This implies that the Betsi-<lb/>boka river serves as a geographic boundary in both taxa, <lb/>but was crossed by E. mongoz later. The other option <lb/>would be that E. f. rufus, coming from the southwest, only <lb/>recently crossed the Mahavavy river. However, genetic dis-<lb/>tances between animals on the west (Anadabomandry) <lb/>and east (Anjamena) side of this river are higher for E. f. <lb/>rufus (21–24 bp) than for E. mongoz (12–15 bp). This <lb/>again indicates that E. mongoz expanded its range more <lb/>recently than E. f. rufus. <lb/> A cladistic biogeographic analysis on the extant lemur dis-<lb/>tribution in western Madagascar suggests that E. mongoz <lb/> either had a wide distribution in the past and then disap-<lb/>peared from large parts of its former range, or dispersed <lb/>across otherwise efficient geographical barriers [45]. In <lb/>1939, Lamberton found a subfossil femur of E. mongoz at <lb/>Ampasambazimba [46], which lies in the central western <lb/>highlands of Madagascar, where the Betsiboka and Maha-<lb/>vavy rivers originate. More subfossil mongoose lemur <lb/>remains were found near the coast at Anjohibe [46], to the <lb/>east of the Betsiboka river (Figure 1). There are two possi-<lb/>ble scenarios, which would explain the unusual current <lb/>mongoose lemur distribution [45], the fossil evidence <lb/>thus far available [46] and the low genetic differentiation <lb/>across the Betsiboka and Mahavavy rivers in E. mongoz <lb/> (this study). One is, that mongoose lemurs had a large dis-<lb/>tribution in the past with regular gene flow across the <lb/>range. Only once they lost their range in central Madagas-<lb/>car relatively recently, was gene flow no longer possible <lb/>across the range because the Betsiboka and Mahavay rivers <lb/>became geographical barriers. The other option is, that in <lb/>the past mongoose lemurs occurred only to the east of the <lb/>Betsiboka river all the way up to central highlands and <lb/>only later expanded their range towards the coast on the <lb/>west side of the Betsiboka and Mahavavy rivers, while dis-<lb/>appearing from central Madagascar. In the first scenario <lb/>they were sympatric with E. f. fulvus and E. f. rufus for a <lb/>long time, while in the second scenario they only became <lb/>sympatric with E. f. rufus relatively recently. <lb/>The influx of a new species into a novel ecosystem can <lb/>result in hybridization between the new species (in this <lb/>case E. mongoz) and the related native species (E. fulvus). <lb/> Where few reproductive barriers to gene flow exist, this <lb/>frequently leads to the rapid introgression of genetic and <lb/>phenotypic characters from one species into another [47]. <lb/>In captivity, crosses between various E. fulvus subspecies <lb/>resulted in fertile offspring [48]. Among captive Eulemur <lb/> species, crossbreeding between E. macaco and E. fulvus <lb/> Table 4: Details on 15 microsatellite alleles, which might originate from the other species <lb/> E. mongoz <lb/>E. fulvus <lb/> Origin <lb/>Locus <lb/>Allele <lb/>N a <lb/> F b <lb/> Other c <lb/> N a <lb/> F b <lb/> Other c <lb/> Fulvus <lb/> Em11 <lb/> 251 <lb/>1 <lb/>0.01 <lb/>2 <lb/>0.13 <lb/>+ <lb/>Em11 <lb/>253 <lb/>1 <lb/>0.01 <lb/>13 <lb/>0.81 <lb/>+ <lb/>Em2 <lb/>164 <lb/>1 <lb/>0.01 <lb/>1 <lb/>0.06 <lb/>+ <lb/>Em7 <lb/>129 <lb/>1 <lb/>0.01 <lb/>1 <lb/>0.06 <lb/>+ <lb/>Lc8 <lb/>223 <lb/>1 <lb/>0.01 <lb/>0 <lb/>-<lb/>+ <lb/>Em15 <lb/>206 <lb/>2 <lb/>0.03 <lb/>14 <lb/>0.88 <lb/>+ <lb/>Lc1 <lb/>98 <lb/>3 <lb/>0.04 <lb/>5 <lb/>0.31 <lb/>+ <lb/> Fulvus d <lb/> Em4 <lb/>146 <lb/>1 <lb/>0.01 <lb/>7 <lb/>0.44 <lb/>+ <lb/>Lc8 <lb/>221 <lb/>5 <lb/>0.07 <lb/>3 <lb/>0.21 <lb/>+ <lb/> Mongoz <lb/> Em1 <lb/>163 <lb/>12 <lb/>0.16 <lb/>+ <lb/>9 <lb/>0.64 <lb/>Em1 <lb/>167 <lb/>23 <lb/>0.30 <lb/>+ <lb/>2 <lb/>0.14 <lb/>+ <lb/>Em8 <lb/>159 <lb/>19 <lb/>0.23 <lb/>+ <lb/>2 <lb/>0.13 <lb/>+ <lb/>Em9 <lb/>179 <lb/>2 <lb/>0.03 <lb/>+ <lb/>3 <lb/>0.19 <lb/>+ <lb/>L c 1 <lb/>9 4 <lb/>1 9 <lb/>0 . 2 4 <lb/>+ <lb/>2 <lb/>0 . 1 3 <lb/>+ <lb/> a Number of alleles found at Anjamena <lb/> b Allele frequency at Anjamena <lb/> c + indicates that the allele is also found in individuals outside Anjamena <lb/> d Those two alleles are hybrid candidates for both taxa. <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 10 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
Neighbor-joining phylogram of 176 lemurs sequenced for a D-loop and ND4 fragment of the mtDNA genome <lb/> Figure 4 <lb/>Neighbor-joining phylogram of 176 lemurs sequenced for a D-loop and ND4 fragment of the mtDNA genome. <lb/> Clades containing animals with identical haplotypes were lumped together into one branch, providing the number of united <lb/>individuals behind the taxon name. The two haplotypes of E. mongoz and E. fulvus, which were also found in the other species, <lb/>are marked with an asterisk (*). Bootstrap values obtained with neighbor-joining (above nodes) and maximum parsimony <lb/>(below nodes) analyses are provided at relevant branches. "ns" means that the maximum parsimony tree topology did not <lb/>show that node. <lb/> E.f. albocollaris <lb/>E.f. albocollaris (3) <lb/> E.f. collaris <lb/> MI (61) <lb/>MK <lb/>MJ <lb/>MA (25) <lb/>MD <lb/>ME (2) <lb/>MB (7) <lb/>MC (2) <lb/>MF (4) <lb/>MG (4) <lb/>MH (2) <lb/> E.f. rufus -FA (2) <lb/> E.f. rufus -FC <lb/> E.f. rufus -FB (2) <lb/> E.f. rufus -FF <lb/> E.f. rufus -FG <lb/> E.f. rufus -FD (2) <lb/> E.f. rufus -FE <lb/> E.f. albifrons (4) <lb/> E.f. fulvus <lb/>E.f. mayottensis <lb/>E.f. fulvus (3) <lb/> E.f. mayottensis <lb/>E.f. fulvus <lb/>E.f. mayottensis (2) <lb/> E.f. fulvus <lb/>E.f. albifrons <lb/>E.f. albifrons (2) <lb/> E.f. albifrons <lb/>E.f. sanfordi <lb/>E.f. fulvus <lb/>E.f. fulvus <lb/>E.f. sanfordi (2) <lb/> E.f. albifrons <lb/>E.f. albifrons <lb/>E.f. albifrons <lb/>E.f. fulvus <lb/>E.f. rufus (2) <lb/> E.f. rufus (3) <lb/> E.f. rufus <lb/>E.f. rufus (3) <lb/> E.f. collaris <lb/>E. rubriventer <lb/>E. rubriventer <lb/>E. rubriventer <lb/>E. coronatus <lb/>E. coronatus <lb/>E. coronatus <lb/>E.m. macaco (2) <lb/> E.m. macaco <lb/>E.m. flavifrons <lb/>E.m. flavifrons (2) <lb/> Lemur catta <lb/>Lemur catta <lb/> 0.005 substitutions/site <lb/> 100 <lb/>97 <lb/>100 <lb/>100 <lb/>98 <lb/>100 <lb/>76 <lb/>100 <lb/>100 <lb/>97 <lb/>52 <lb/>98 <lb/>100 <lb/>100 <lb/>100 <lb/>35 <lb/>99 <lb/>64 <lb/>100 <lb/>100 <lb/>100 <lb/>100 <lb/>100 <lb/> Anjamena <lb/> Anadabomandry <lb/>Ampijoroa <lb/>Captivity <lb/> Anjamena <lb/> Anadabomandry <lb/> 92 <lb/> Ampijoroa <lb/> E. mongoz <lb/> 1 <lb/>2 <lb/>3 <lb/>4 <lb/>5 <lb/>6 <lb/> E. fulvus <lb/> * <lb/>* <lb/> 100 <lb/>92 <lb/>100 <lb/>97 <lb/>93 <lb/>100 <lb/>56 <lb/>97 <lb/>100 <lb/>57 <lb/>71 <lb/>95 <lb/>94 <lb/>100 <lb/>100 <lb/>54 <lb/>48 <lb/>ns <lb/>100 <lb/>100 <lb/>100 <lb/>99 <lb/>100 <lb/> 94 <lb/>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 11 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
gave rise to fertile hybrids [48]. In the wild, hybridization <lb/>has been reported between E. macaco macaco and E. m. fla-<lb/>vifrons [16], E. f. fulvus and E. f. rufus [17], and E. f. rufus <lb/>and E. f. albocollaris [18] subspecies. All these hybridiza-<lb/>tion events among Eulemur species and subspecies indi-<lb/>cate that reproductive barriers among Eulemur taxa are not <lb/>very well developed. <lb/>Hybridization between newly overlapping species pro-<lb/>vides a unique opportunity to observe the initial stages of <lb/>hybridization and its evolutionary consequences. Hybrid-<lb/>ization which results in fertile offspring, is expected to <lb/>introduce sets of alleles that gradually disperse through <lb/>the gene pool of the parent organisms through successive <lb/>backcrosses. Such extensive introgression might have <lb/>occurred among brown lemurs at Anjamena with 7 (88%) <lb/>brown lemurs possibly having introgressed alleles and 4 <lb/>(50%) brown lemurs having the mtDNA haplotype of E. <lb/>mongoz. However, larger sample sizes are needed to con-<lb/>firm the extent of introgression. In mongoose lemurs, <lb/>only 8 (22%) of the 37 animals studied show signs of <lb/>introgression. <lb/>There are several possible evolutionary consequences of <lb/>hybridization (see also introduction). In extreme cases, <lb/>parental taxa may be lost in the process and/or new taxa <lb/>formed [21,22]. A third possibility is that a stable hybrid <lb/>zone will form, with limited introgression across the zone. <lb/>Having already radiated across Madagascar twice, the <lb/>genus Eulemur has proved to be very successful in adapt-<lb/>ing to a variety of ecological niches. Introgressive hybridi-<lb/>zation among taxa is known to quickly increase levels of <lb/>variation, allowing more rapid responses to environmen-<lb/>tal changes [21,22]. Considering all the reported hybridi-<lb/>zation events known so far between Eulemur taxa in the <lb/>wild [[16-18], this study], hybridization might also have <lb/>played an important role in the success of the radiation of <lb/> Eulemur across Madagascar. <lb/> Conclusion <lb/> The genetic data presented here confirms the occurrence <lb/>of hybridization between E. mongoz and E. fulvus in west-<lb/>ern Madagascar. Most other hybrid zones reported so far <lb/>in lemurs are also between Eulemur taxa [16-18]. Only one <lb/>hybridization event has been found among other lemur <lb/>taxa, that of Varecia variegata subspecies [19]. It is known <lb/>that some groups of organisms seem to hybridize more <lb/>readily than others [1,47] and Eulemur may be more capa-<lb/>ble of hybridizing than other lemur taxa. However, <lb/>hybrids are not easy to detect. They are much easier to <lb/>identify and are generally recorded more often if the <lb/>hybridizing taxa are brightly and distinctively coloured <lb/>(e.g., birds, butterflies [1]). That is very much the case for <lb/> Eulemur species and subspecies, as well as for Varecia vari-<lb/>egata subspecies. The detection of hybridization in lemurs <lb/>may follow a similar time sequence as the discovery of <lb/>parent taxa, with nocturnal species lagging behind. For <lb/>nocturnal lemurs, the pelage coloration of which is nei-<lb/>ther bright nor varies much between taxa, only detailed <lb/>genetic studies are likely to detect hybridization events. <lb/>Our study records an instance of on-going hybridization <lb/>in the wild. Introgressive hybridization may hasten speci-<lb/>ation and allow rapid ecological adaptation of taxa, hence <lb/>be one of the driving forces for the adaptive radiation of <lb/>lemurs in Madagascar. <lb/> Authors' contributions <lb/> JP participated in the design of the study and the field <lb/>expedition, carried out the lab work, conducted data anal-<lb/>yses and wrote the first draft of the manuscript. AZ organ-<lb/>ized and lead the field expedition to Anjamena to collect <lb/>the samples. DC participated in the design of the study, <lb/>helped with the logistics of the field expedition and <lb/>revised a draft version of the manuscript. CN advised and <lb/>participated in the data analyses. NM critically revised the <lb/>draft version of the manuscript. All authors approved the <lb/>final version of the manuscript. <lb/> Table 5: mtDNA haplotypes found in mongoose lemurs and brown lemurs <lb/> E. mongoz <lb/>E. fulvus <lb/> Anjamena <lb/>All <lb/>Anjamena <lb/> E. f. rufus a <lb/> All <lb/> # individuals <lb/>37 <lb/>107 <lb/>8 <lb/>13 <lb/>55 <lb/># haplotypes D-loop <lb/>2+1* <lb/>5+1* <lb/>1+1* <lb/>5+1* <lb/>31+1* <lb/># haplotypes ND4 <lb/>4+1* <lb/>9+1* <lb/>3+1* <lb/>6+1* <lb/>30+1* <lb/># haplotypes D-loop & ND4 <lb/>5+1* <lb/>10+1* <lb/>3+1* <lb/>7+1* <lb/>34+1* <lb/># variable base positions D-loop b <lb/> 1 <lb/>25 <lb/>0 <lb/>29 <lb/>114 <lb/># variable base positions ND4 b <lb/> 3 <lb/>1 1 <lb/>2 <lb/>8 <lb/>6 4 <lb/> a only brown lemurs from the same subspecies clade (clade #4 in Figure 4) <lb/> b excluding the haplotype from the other species <lb/>* one haplotype was found from the other Eulemur species <lb/>
</body>
<back>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 12 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
<div type="annex">Additional material <lb/></div>
<div type="acknowledgement">Acknowledgements<lb/> We would like to thank M. Clark (London Zoo), P. Ferebee (Natural Sci-<lb/>ence Center of Greensboro) T. Geissmann (Universität Zürich), D. Haring <lb/>(Duke University Primate Center), A. Kitchener (National Museums of <lb/>Scotland), P. Moisson (Mulhouse Zoo), K. Parr (Cleveland Metroparks <lb/>Zoo), G. Peters (Musem Koenig, Bonn), C. Rabarivola (Université de <lb/>Antananarivo), G. Rakotoarisoa (Parc Zoologique et Botanique de Tsim-<lb/>bazaza), M. Rasmussen (Duke University), Y. Rumpler (Université Louis <lb/>Pasteur, Strasbourg), N. Vasey (Pennsylvania State University) and Y. <lb/>Wyner (American Museum of Natural History) for providing the samples. <lb/>We are most grateful to G. Anzenberger, T. Bettinger, E. Davis, K. <lb/>Detwiler, R. Humphrey and R.D. Martin for help with the sample collection. <lb/>We are grateful for support during the field research from M. Clark, J. Ger-<lb/>son, A. Müller, C. Rabarivola, E.O. Raheliarisoa, W. Scheffrahn, U. Thal-<lb/>mann and M. Waters. We thank W. Amos (University of Cambridge), M. <lb/>Krützen (Universität Zürich) and D. Melnick (Columbia University) for let-<lb/>ting us use their lab facilities and for valuable assistance during the lab work. <lb/>We are grateful for M. Roth's help with Figure 1. We appreciate P. Fern-<lb/>ando's helpful comments on the manuscript. Acquisition of samples in <lb/>Madagascar was conducted under an 'Accord de Coopération' between the <lb/>Universities of Zürich (Switzerland) and Mahajanga (Madagascar), and the <lb/>governmental institutions of Madagascar (Commission Tripartite) gave <lb/>research permission. Financial support from the Swiss National Science <lb/>Foundation, Vontobel Foundation, Julius Klaus Foundation, A.H. Schultz <lb/>Foundation and Cleveland Zoological Society is gratefully acknowledged. <lb/></div>
<listBibl>References <lb/> 1. <lb/>Mallet J: Hybridization as an invasion of the genome. Trends <lb/> Ecol Evol 2005, 20:229-237. <lb/> 2. <lb/>Arnold ML, Meyer A: Natural hybridization in primates: One <lb/>evolutionary mechanism. Zoology 2006, 109:261-276. <lb/> 3. <lb/>Nijman IJ, Otsen M, Verkaar ELC, de Ruijter C, Hanekamp E, Ochieng <lb/>JW, Shamshad S, Rege JEO, Hanotte O, Barwegen MW, Sulawati T, <lb/>Lenstra JA: Hybridization of banteng (Bos javanicus) and zebu <lb/>(Bos indicus) revealed by mitochondrial DNA, satellite DNA, <lb/>AFLP and microsatellites. Heredity 2003, 90:10-16. <lb/> 4. <lb/>Lecis R, Pierpaoli M, Biro ZS, Szemethy L, Ragni B, Vercillo F, Randi E: <lb/> Bayesian analyses of admixture in wild and domestic cats <lb/>(Felis silvestris) using linked microsatellite loci. Mol Ecol 2006, <lb/> 15:119-131. <lb/> 5. <lb/>Goodman SJ, Barton NH, Swanson G, Abernethy K, Pemberton JM: <lb/> Introgression through rare hybridization: A genetic study of <lb/>a hybrid zone between red and sika deer (genus Cervus) in <lb/>Argyll, Scotland. Genetics 1999, 152:355-371. <lb/> 6. <lb/>Riley SPD, Shaffer HB, Voss SR, Fitzpatrick BM: Hybridization <lb/>between a rare, native tiger salamander (Ambystoma cali-<lb/>forniense) and its introduced congener. Ecol Applic 2003, <lb/> 13:1263-1275. <lb/> 7. <lb/>Beltrán M, Jiggins CD, Bull V, Linares M, Mallet J, McMillan WO, Ber-<lb/>mingham E: Phylogenetic discordance at the species boundary: <lb/>Comparative gene genealogies among rapidly radiating Heli-<lb/>conius butterflies. Mol Biol Evol 2002, 19:2176-2190. <lb/> 8. <lb/>Salzburger W, Baric S, Sturmbauer C: Speciation via introgressive <lb/>hybridization in East African cichlids? <lb/> Mol Ecol 2002, <lb/> 11:619-625. <lb/> 9. <lb/>Szymura JM, Barton NH: The genetic structure of the hybrid <lb/>zone between the fire-bellied toads Bombina bombina and B. <lb/>variegata: Comparison between transects and between loci. <lb/> Evolution 1991, 45:237-261. <lb/> 10. Saetre G-P, Borge T, Lindell J, Moum T, Primmer CR, Sheldon BC, <lb/>Haavie J, Johnsen A, Ellegren H: Speciation, introgressive hybrid-<lb/>ization and nonlinear rate of molecular evolution in flycatch-<lb/>ers. Mol Ecol 2001, 10:737-749. <lb/> 11. Grant PR, Grant BR, Markert JA, Keller LF, Petren K: Convergent <lb/>evolution of Darwin's finches caused by introgressive hybrid-<lb/>ization and selection. Evolution 2004, 58:1588-1599. <lb/> 12. Lehman N, Eisenhawer A, Hansen K, Mech DL, Peterson RO, Gogan <lb/>PJP, Wayne RK: Introgression of coyote mitochondrial DNA <lb/>into sympatric north American gray wolf populations. Evolu-<lb/>tion 1991, 45:104-119. <lb/> 13. Alberts SC, Altmann J: Immigration and hybridization patterns <lb/>of yellow and anubis baboons in and around Amboseli, <lb/>Kenya. Am J Primatol 2001, 53:139-154. <lb/> 14. Evans BJ, Supriatna J, Melnick DJ: Hybridization and population <lb/>genetics of two macaque species in Sulawesi, Indonesia. Evo-<lb/>lution 2001, 55:1686-1702. <lb/> 15. Cortés-Ortiz L, Duda TF Jr, Canales-Espinosa D, Garcia-Orduna F, <lb/>Rodriguez-Luna E, Bermingham E: Hybridization in large-bodied <lb/>New World primates. Genetics 2007, 176:2421-2425. <lb/> 16. Rabarivola C, Meyers D, Rumpler Y: Distribution and morpholog-<lb/>ical character of inermediate forms between the black lemur <lb/>(Eulemur macaco macaco) and the sclater's lemur (E. m. flav-<lb/>ifrons). Primates 1991, 32:269-273. <lb/> 17. Lehman SM, Wright PC: Preliminary study of the conservation <lb/>status of lemur communities in the Betsakafandrika region <lb/>of eastern Madagascar. Lemur News 2000, 5:23-25 [http:// <lb/>www.dpz.gwdg.de/index.php?id=53&L=0]. <lb/>18. Wyner YM, Johnson SE, Stumpf RM, DeSalle R: Genetic assess-<lb/>ment of a white-collared x red-fronted lemur hybrid zone at <lb/>Andringitra, Madagascar. Am J Primatol 2002, 67:51-66. <lb/> 19. Vasey N, Tattersall I: Do ruffed lemurs form a hybrid zone? Dis-<lb/>tribution and discovery of Varecia, with systematic and con-<lb/>servation implications. Am Mus Novitates 2002, 3376:1-26. <lb/> 20. Harrison RG: Hybrids and hybrid zones: historical perspective. <lb/> In Hybrid Zones and the Evolutionary Process Edited by: Harrison RG. <lb/>Oxford, UK: Oxford University Press; 1993:3-12. <lb/>21. Arnold ML: Natural hybridization as an evolutionary process. <lb/> Annu Rev Ecol Syst 1992, 23:237-261. <lb/> 22. Seehausen O: Hybridization and adaptive radiation. Trends Ecol <lb/>Evol 2004, 19:198-207. <lb/> 23. Martin RD: Adaptive radiation and behaviour of the Malagasy <lb/>lemurs. Phil Trans R Soc Lond B 1972, 264:295-352. <lb/> 24. Mittermeier RA, Konstant WR, Hawkins F, Louis EE, Langrand O, <lb/>Ratsimbazafy J, Rasoloarison R, Ganzhorn JU, Rajaoblina S, Tattersall <lb/>I, Meyers DM: Lemurs of Madagascar Second edition. Washington, <lb/>DC: Conservation International; 2006. <lb/>25. Shaw KL: Conflict between nuclear and mitochondrial DNA <lb/>phylogenies of a recent species radiation: What mtDNA <lb/>reveals and conceals about modes of speciation in Hawaiian <lb/>crickets. Proc Natl Acad Sci USA 2002, 99:16122-16127. <lb/> 26. Curtis DJ, Zaramody A: Group size, home range use, and sea-<lb/>sonal variation in the ecology of Eulemur mongoz. Int J Primatol <lb/> 1998, 19:811-835. <lb/> 27. Pastorini J, Forstner MRJ, Martin RD: Relationships among brown <lb/>lemurs (Eulemur fulvus) based on mitochondrial DNA <lb/>sequences. Mol Phylogenet Evol 2000, 16:418-429. <lb/> 28. Zaramody A, Pastorini J: Indications for hybridisation between <lb/>red-fronted lemurs (Eulemur fulvus rufus) and mongoose <lb/>lemurs (E. mongoz) in northwest Madagascar. Lemur News <lb/> 2001, 6:28-31 [http://www.dpz.gwdg.de/index.php?id=53&L=0]. <lb/>29. IUCN: IUCN Red List of Threatened Species. 2007 [http:// <lb/>www.iucnredlist.org]. <lb/>30. Curtis DJ, Zaramody A, Martin RD: Cathemerality in the mon-<lb/>goose lemur, Eulemur mongoz. Am J Primatol 1999, 47:279-298. <lb/> 31. Curtis DJ: Diet and nutrition in wild mongoose lemurs (Eule-<lb/> mur mongoz) and their implications for the evolution of <lb/>female dominance and small group size in lemurs. Am J Phys <lb/>Anthropol 2004, 124:234-247. <lb/> 32. Müller P, Velo A, Raheliarisoa E-O, Zaramody A, Curtis DJ: Surveys <lb/>of sympatric lemurs at Anjamena, northwest Madagascar. <lb/> Afr J Ecol 2000, 38:248-257. <lb/></listBibl>
<div type="annex">Additional File 1 <lb/> Locality, sample type and GenBank numbers for all E. mongoz hap-<lb/>lotypes and E. fulvus samples. none. <lb/> Click here for file <lb/>[http://www.biomedcentral.com/content/supplementary/1471-<lb/>2148-9-32-S1.doc] <lb/></div>
<note place="footnote">Publish with Bio Med Central and every <lb/>scientist can read your work free of charge <lb/> "BioMed Central will be the most significant development for <lb/>disseminating the results of biomedical researc h in our lifetime." <lb/> Sir Paul Nurse, Cancer Research UK <lb/> Your research papers will be: <lb/> available free of charge to the entire biomedical community <lb/>peer reviewed and published immediately upon acceptance <lb/>cited in PubMed and archived on PubMed Central <lb/>yours — you keep the copyright <lb/> Submit your manuscript here: <lb/> http://www.biomedcentral.com/info/publishing_adv.asp <lb/> BioMedcentral <lb/></note>
<note place="headnote">BMC Evolutionary Biology 2009, 9:32 <lb/></note>
<note place="headnote">http://www.biomedcentral.com/1471-2148/9/32 <lb/></note>
<page>Page 13 of 13 <lb/></page>
<note place="footnote">(page number not for citation purposes) <lb/></note>
<listBibl>33. Sambrook J, Fritsch E, Maniatis T: Molecular Cloning – A Laboratory <lb/>Manual Cold Spring Harbour: Cold Spring Harbour Laboratory Press; <lb/>1989. <lb/>34. Jekielek J, Strobeck C: Characterization of polymorphic brown <lb/>lemur (Eulemur fulvus) microsatellite loci and their amplifica-<lb/>tion in the family Lemuridae. Mol Ecol 1999, 8:901-903. <lb/> 35. Pastorini J, Fernando P, Forstner MRJ, Melnick DJ: Characteriza-<lb/>tion of new microsatellite loci for the ring-tailed lemur <lb/>(Lemur catta). Mol Ecol Notes 2005, 5:149-151. <lb/> 36. Pastorini J, Fernando P, Melnick DJ, Forstner MRJ: Isolation of 10 <lb/>microsatellite markers for mongoose lemurs (Eulemur mon-<lb/>goz). Mol Ecol Notes 2004, 4:67-69. <lb/> 37. Kalinowski ST, Taper ML, Marshall TC: Revising how the compu-<lb/>ter program CERVUS accommodates genotyping error <lb/>increases success in paternity assignment. Mol Ecol 2007, <lb/> 16:1099-1106. <lb/> 38. Raymond M, Rousset F: GENEPOP (Version 1.2): Population <lb/>genetics software for exact tests and ecumenicism. J Hered <lb/> 1995, 86:248-249. <lb/> 39. Excoffier L, Laval G, Schneider S: Arlequin (ver. 3.0): An inte-<lb/>grated software package for population genetics data analy-<lb/>sis. Evol Bioinformatics Online 2005, 1:47-50. <lb/> 40. Belkhir K, Borsa P, Chikhi L, Raufaste N, Bonhomme F: GENETIX 4.05, <lb/>logiciel sous Windows TM pour la génétique des populations 2004 [http:// <lb/>www.genetix.univ-montp2.fr/genetix/genetix.htm]. <lb/>Laboratoire <lb/>Génome, Populations, Université de Montpellier II, Montpellier, <lb/>France <lb/>41. Pritchard JK, Stephens M, Donnelly P: Inference of population <lb/>structure using multilocus genotype data. Genetics 2000, <lb/> 155:945-959. <lb/> 42. Swofford DL: PAUP* Phylogenetic Analysis Using Parsimony (*and Other <lb/>Methods). Version 4 Sunderland: Sinauer Associates; 1999. <lb/>43. Pastorini J, Forstner MRJ, Martin RD: Phylogenetic relationships <lb/>among Lemuridae (Primates): evidence from mtDNA. J Hum <lb/>Evol 2002, 43:463-478. <lb/> 44. Pastorini J, Thalmann U, Martin RD: A molecular approach to <lb/>comparative phylogeography of extant Malagasy lemurs. <lb/> Proc Natl Acad Sci USA 2003, 100:5879-5884. <lb/> 45. Thalmann U: Lemur diversity and distribution in western <lb/>Madagascar – Inferences and predictions using a cladistic <lb/>approach. In Diversité et Endémisme à Madagascar Edited by: <lb/>Lourenço WR, Goodman SM. Paris: Mémoires de la Société de <lb/>Biogéographie, ORSTOM; 2000:191-202. <lb/>46. Godfrey LR, Jungers WL, Simons EL, Chatrath PS, Rakotosamimanana <lb/>B: Past and present distributions of lemurs in Madagascar. In <lb/> New Directions in Lemur Studies Edited by: Rakotosamimanana B, Ras-<lb/>amimanana H, Ganzhorn JU, Goodman SM. New York and Boston: <lb/>Kluwer Academic/Plenum Publishers; 1999:19-53. <lb/>47. Abbott RJ, James JK, Milne RI, Gillies ACM: Plant introductions, <lb/>hybridization and gene flow. Phil Trans R Soc Lond B 2003, <lb/> 358:1123-1132. <lb/> 48. Djelati R, Brun B, Rumpler Y: Meiotic study of hybrids in the <lb/>genus Eulemur and taxonomic considerations. Am J Primatol <lb/> 1997, 42:235-245. </listBibl>
</back>
</text>
</tei>
| 456.96129 | 6,393 | 0.735405 |
1ec98599bb846e8aff307ba735b97c90631c0c83 | 2,579 | xaml | XML | Pomodoro/SettingsWindow.xaml | korn3l/Pomodoro | 4001b287a877db8adb404f6bd422467dbe8ea3ec | [
"MIT"
] | 1 | 2016-07-07T14:52:27.000Z | 2016-07-07T14:52:27.000Z | Pomodoro/SettingsWindow.xaml | korn3l/Pomodoro | 4001b287a877db8adb404f6bd422467dbe8ea3ec | [
"MIT"
] | null | null | null | Pomodoro/SettingsWindow.xaml | korn3l/Pomodoro | 4001b287a877db8adb404f6bd422467dbe8ea3ec | [
"MIT"
] | null | null | null | <Window x:Class="Pomodoro.SettingsWindow"
xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"
xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"
xmlns:d="http://schemas.microsoft.com/expression/blend/2008"
xmlns:local="clr-namespace:Pomodoro"
xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"
xmlns:wpfTool="clr-namespace:Xceed.Wpf.Toolkit;assembly=Xceed.Wpf.Toolkit"
Title="Settings"
Width="300"
Height="200"
mc:Ignorable="d">
<DockPanel>
<Grid DockPanel.Dock="Top">
<Grid.ColumnDefinitions>
<ColumnDefinition Width="45*" />
<ColumnDefinition Width="101*" />
</Grid.ColumnDefinitions>
<Grid.RowDefinitions>
<RowDefinition Height="27" />
<RowDefinition Height="27" />
<RowDefinition Height="27" />
<RowDefinition Height="27" />
</Grid.RowDefinitions>
<Label Content="Pomodoro" />
<wpfTool:TimeSpanUpDown x:Name="tsPomodoro"
Grid.Column="1"
Margin="10,2"
DefaultValue="0:20:0" />
<Label Grid.Row="1" Content="Short Break" />
<wpfTool:TimeSpanUpDown x:Name="tsShortBreak"
Grid.Row="1"
Grid.Column="1"
Margin="10,2"
DefaultValue="0:05:0" />
<Label Grid.Row="2" Content="Long Break" />
<wpfTool:TimeSpanUpDown x:Name="tsLongBreak"
Grid.Row="2"
Grid.Column="1"
Margin="10,2"
DefaultValue="0:15:0" />
<Label Grid.Row="3" Content="Always on top" />
<CheckBox Name="cbAlwaysOnTop"
Grid.Row="3"
Grid.Column="1"
Margin="10,0,0,0"
VerticalAlignment="Center"
IsChecked="True" />
</Grid>
<WrapPanel Margin="0,0,0,10"
HorizontalAlignment="Center"
VerticalAlignment="Bottom"
DockPanel.Dock="Bottom">
<Button x:Name="btnOK"
Width="50"
Margin="0,0,10,0"
Click="Button_Click"
Content="Ok" />
<Button Width="50"
Margin="10,0,0,0"
Click="Button_Click_1"
Content="Cancel" />
</WrapPanel>
</DockPanel>
</Window>
| 39.676923 | 83 | 0.49399 |
906d3232fc539b87051954fe1a1471e468c9a6f5 | 697 | xml | XML | klayout_dot_config/tech/EBeam/fdtd/GC.xml | YixuanWUSTL/SiEPIC_EBeam_PDK | 38cc7ef2af17e418eaa4757a43ec240f1f5c4b17 | [
"MIT"
] | 95 | 2015-11-15T10:23:13.000Z | 2022-03-10T22:00:44.000Z | klayout_dot_config/tech/EBeam/fdtd/GC.xml | YixuanWUSTL/SiEPIC_EBeam_PDK | 38cc7ef2af17e418eaa4757a43ec240f1f5c4b17 | [
"MIT"
] | 155 | 2015-11-14T12:08:09.000Z | 2020-05-17T01:37:23.000Z | klayout_dot_config/tech/EBeam/fdtd/GC.xml | YixuanWUSTL/SiEPIC_EBeam_PDK | 38cc7ef2af17e418eaa4757a43ec240f1f5c4b17 | [
"MIT"
] | 87 | 2015-11-16T12:23:22.000Z | 2022-03-31T19:01:59.000Z | <?xml version="1.0" encoding="utf-8"?>
<GC>
<floats>
<angle>13</angle>
<target_length>25e-6</target_length>
<thickness_Si>0.22e-6</thickness_Si>
<etch_depth>0.13e-6</etch_depth>
<duty_cycle>0.63</duty_cycle>
<pitch>0.66e-6</pitch>
<radius>25e-6</radius>
<y_span>15e-6</y_span>
<length_extra>40e-6</length_extra>
<waveguide_width>0.5e-6</waveguide_width>
<waveguide_length>3.5e-6</waveguide_length>
</floats>
<strings>
<material_Clad>SiO2 (Glass) - Palik</material_Clad>
<material_Si>Si (Silicon) - Palik</material_Si>
<polarization>TM</polarization>
<particle_swarm_optimization>yes</particle_swarm_optimization>
<simulate_3d>yes</simulate_3d>
</strings>
</GC>
| 29.041667 | 64 | 0.72023 |
70dbb694dcd037cf6c1f02d0cb81e1992ace7bfd | 35,804 | xml | XML | Star Citizen/layout_T16000MStephan313_exported.xml | Eutyches/eutyches-space-sim | 5b4af877421287d151ceb1ae0733d27c743b1a20 | [
"CC0-1.0"
] | null | null | null | Star Citizen/layout_T16000MStephan313_exported.xml | Eutyches/eutyches-space-sim | 5b4af877421287d151ceb1ae0733d27c743b1a20 | [
"CC0-1.0"
] | null | null | null | Star Citizen/layout_T16000MStephan313_exported.xml | Eutyches/eutyches-space-sim | 5b4af877421287d151ceb1ae0733d27c743b1a20 | [
"CC0-1.0"
] | null | null | null | <ActionMaps version="1" optionsVersion="2" rebindVersion="2" profileName="T16000MStephan313">
<CustomisationUIHeader label="T16000MStephan313" description="" image="">
<devices>
<keyboard instance="1"/>
<mouse instance="1"/>
<joystick instance="1"/>
<joystick instance="2"/>
<joystick instance="3"/>
<joystick instance="4"/>
</devices>
<categories>
<category label="@ui_CCSpaceFlight"/>
<category label="@ui_CGLightControllerDesc"/>
<category label="@ui_CCFPS"/>
<category label="@ui_CCEVA"/>
<category label="@ui_CCVehicle"/>
<category label="@ui_CGEASpectator"/>
<category label="@ui_CGUIGeneral"/>
<category label="@ui_CGOpticalTracking"/>
<category label="@ui_CGInteraction"/>
<category label="@ui_CCCamera"/>
</categories>
</CustomisationUIHeader>
<options type="keyboard" instance="1" Product="Wine Keyboard {6F1D2B61-D5A0-11CF-BFC7-444553540000}"/>
<options type="joystick" instance="1" Product="Thrustmaster T.16000M (event) {B10A044F-0000-0000-0000-504944564944}">
<flight_move_pitch exponent="1.3000001"/>
<flight_move_yaw exponent="1.3000001"/>
<flight_move_roll exponent="2"/>
<flight_move_strafe_vertical exponent="3"/>
<flight_move_strafe_lateral exponent="3"/>
<flight_move_strafe_longitudinal invert="1" exponent="3"/>
</options>
<options type="joystick" instance="2" Product="Thrustmaster T.16000M (event) {B10A044F-0000-0000-0000-504944564944}">
<flight_move_pitch exponent="1.3000001"/>
<flight_move_yaw exponent="1.3000001"/>
<flight_move_roll exponent="2"/>
<flight_move_strafe_vertical exponent="3"/>
<flight_move_strafe_lateral exponent="3"/>
<flight_move_strafe_longitudinal invert="1" exponent="3"/>
</options>
<options type="joystick" instance="3" Product="Thrustmaster T.16000M (js) {B10A044F-0000-0000-0000-504944564944}"/>
<options type="joystick" instance="4" Product="Thrustmaster T.16000M (js) {B10A044F-0000-0000-0000-504944564944}"/>
<modifiers />
<actionmap name="spaceship_general">
<action name="v_close_all_doors">
<rebind input="js2_button11"/>
</action>
<action name="v_cooler_throttle_down">
<rebind input="js3_ "/>
</action>
<action name="v_cooler_throttle_up">
<rebind input="js3_ "/>
</action>
<action name="v_eject">
<rebind input="js3_ "/>
</action>
<action name="v_emergency_exit">
<rebind input="js2_rctrl+button10" multiTap="2"/>
</action>
<action name="v_exit">
<rebind input="js3_ "/>
</action>
<action name="v_flightready">
<rebind input="js2_button8"/>
</action>
<action name="v_lock_all_doors">
<rebind input="js2_rctrl+button11"/>
</action>
<action name="v_open_all_doors">
<rebind input="js2_button16"/>
</action>
<action name="v_self_destruct">
<rebind input="js3_ "/>
</action>
<action name="v_toggle_all_doorlocks">
<rebind input="js3_ "/>
</action>
<action name="v_toggle_all_doors">
<rebind input="js3_ "/>
</action>
<action name="v_unlock_all_doors">
<rebind input="js2_rctrl+button16"/>
</action>
</actionmap>
<actionmap name="spaceship_view">
<action name="v_view_cycle_fwd">
<rebind input="js1_button7"/>
</action>
<action name="v_view_cycle_internal_fwd">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_abs">
<rebind input="js1_slider1"/>
</action>
<action name="v_view_dynamic_zoom_abs_toggle">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_rel">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_rel_in">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_rel_out">
<rebind input="js3_ "/>
</action>
<action name="v_view_freelook_mode">
<rebind input="js2_rctrl+hat1_up"/>
</action>
<action name="v_view_interact">
<rebind input="js3_ "/>
</action>
<action name="v_view_look_behind">
<rebind input="js2_rctrl+hat1_down"/>
</action>
<action name="v_view_mode">
<rebind input="js3_ "/>
</action>
<action name="v_view_option">
<rebind input="js3_ "/>
</action>
<action name="v_view_pitch">
<rebind input="js3_ "/>
</action>
<action name="v_view_pitch_down">
<rebind input="js3_ "/>
</action>
<action name="v_view_pitch_up">
<rebind input="js3_ "/>
</action>
<action name="v_view_yaw">
<rebind input="js3_ "/>
</action>
<action name="v_view_yaw_left">
<rebind input="js3_ "/>
</action>
<action name="v_view_yaw_right">
<rebind input="js3_ "/>
</action>
<action name="v_view_zoom_in">
<rebind input="js3_ "/>
</action>
<action name="v_view_zoom_out">
<rebind input="js3_ "/>
</action>
</actionmap>
<actionmap name="spaceship_movement">
<action name="v_accel_range_down">
<rebind input="js2_button15"/>
</action>
<action name="v_accel_range_up">
<rebind input="js2_button12"/>
</action>
<action name="v_afterburner">
<rebind input="js2_button4"/>
</action>
<action name="v_autoland">
<rebind input="js2_rctrl+button3"/>
</action>
<action name="v_dock_toggle_view">
<rebind input="js2_ "/>
</action>
<action name="v_ifcs_speed_limiter_reset_scm">
<rebind input="js2_rctrl+button2" activationMode="double_tap"/>
</action>
<action name="v_ifcs_toggle_cruise_control">
<rebind input="js2_button2"/>
</action>
<action name="v_ifcs_toggle_esp">
<rebind input="js1_button15"/>
</action>
<action name="v_ifcs_toggle_gforce_safety">
<rebind input="js2_button13"/>
</action>
<action name="v_ifcs_toggle_speed_limiter">
<rebind input="js2_rctrl+button2"/>
</action>
<action name="v_ifcs_toggle_vector_decoupling">
<rebind input="js2_button3"/>
</action>
<action name="v_pitch_down">
<rebind input="js3_ "/>
</action>
<action name="v_pitch_up">
<rebind input="js3_ "/>
</action>
<action name="v_roll_left">
<rebind input="js3_ "/>
</action>
<action name="v_roll_right">
<rebind input="js3_ "/>
</action>
<action name="v_space_brake">
<rebind input="js2_button4" multiTap="2"/>
</action>
<action name="v_speed_range_abs">
<rebind input="js3_ "/>
</action>
<action name="v_speed_range_down">
<rebind input="js2_hat1_down"/>
</action>
<action name="v_speed_range_rel">
<rebind input="js3_ "/>
</action>
<action name="v_speed_range_up">
<rebind input="js2_hat1_up"/>
</action>
<action name="v_strafe_back">
<rebind input="js3_ "/>
</action>
<action name="v_strafe_down">
<rebind input="js3_ "/>
</action>
<action name="v_strafe_forward">
<rebind input="js3_ "/>
</action>
<action name="v_strafe_lateral">
<rebind input="js2_x"/>
</action>
<action name="v_strafe_left">
<rebind input="js3_ "/>
</action>
<action name="v_strafe_longitudinal">
<rebind input="js2_y"/>
</action>
<action name="v_strafe_longitudinal_invert">
<rebind input="js3_ "/>
</action>
<action name="v_strafe_right">
<rebind input="js3_ "/>
</action>
<action name="v_strafe_up">
<rebind input="js3_ "/>
</action>
<action name="v_strafe_vertical">
<rebind input="js2_rotz"/>
</action>
<action name="v_target_match_vel">
<rebind input="js3_ "/>
</action>
<action name="v_toggle_landing_system">
<rebind input="js2_rctrl+button3"/>
</action>
<action name="v_toggle_qdrive_engagement">
<rebind input="js2_button14"/>
</action>
<action name="v_toggle_qdrive_spooling">
<rebind input="js2_button14"/>
</action>
<action name="v_toggle_vtol">
<rebind input="js2_rctrl+button4"/>
</action>
<action name="v_toggle_yaw_roll_swap">
<rebind input="js1_rctrl+button9"/>
</action>
<action name="v_yaw_left">
<rebind input="js3_ "/>
</action>
<action name="v_yaw_right">
<rebind input="js3_ "/>
</action>
</actionmap>
<actionmap name="spaceship_targeting">
<action name="v_enter_remote_turret_1">
<rebind input="js1_rctrl+button13"/>
</action>
<action name="v_enter_remote_turret_2">
<rebind input="js1_rctrl+button12"/>
</action>
<action name="v_enter_remote_turret_3">
<rebind input="js1_rctrl+button11"/>
</action>
<action name="v_look_ahead_enable">
<rebind input="js1_button6"/>
</action>
<action name="v_look_ahead_start_target_tracking">
<rebind input="js1_button9"/>
</action>
<action name="v_target_cycle_reticle_mode">
<rebind input="js1_rctrl+button15"/>
</action>
<action name="v_target_remove_all_pins">
<rebind input="js1_button16"/>
</action>
<action name="v_target_toggle_lock_index_1">
<rebind input="js1_button13"/>
</action>
<action name="v_target_toggle_lock_index_2">
<rebind input="js1_button12"/>
</action>
<action name="v_target_toggle_lock_index_3">
<rebind input="js1_button11"/>
</action>
<action name="v_target_toggle_pin_index_1">
<rebind input="js3_ "/>
</action>
<action name="v_target_toggle_pin_index_1_hold">
<rebind input="js1_button13"/>
</action>
<action name="v_target_toggle_pin_index_2">
<rebind input="js3_ "/>
</action>
<action name="v_target_toggle_pin_index_2_hold">
<rebind input="js1_button12"/>
</action>
<action name="v_target_toggle_pin_index_3">
<rebind input="js3_ "/>
</action>
<action name="v_target_toggle_pin_index_3_hold">
<rebind input="js1_button11"/>
</action>
<action name="v_target_tracking_auto_zoom">
<rebind input="js1_rctrl+button6"/>
</action>
<action name="v_target_unlock_selected">
<rebind input="js1_rctrl+hat1_up"/>
</action>
</actionmap>
<actionmap name="spaceship_targeting_advanced">
<action name="v_target_cycle_all_fwd">
<rebind input="js1_rctrl+hat1_left"/>
</action>
<action name="v_target_cycle_attacker_fwd">
<rebind input="js1_rctrl+hat1_right"/>
</action>
<action name="v_target_cycle_attacker_reset">
<rebind input="js1_rctrl+hat1_down"/>
</action>
<action name="v_target_cycle_friendly_fwd">
<rebind input="js1_hat1_left"/>
</action>
<action name="v_target_cycle_hostile_fwd">
<rebind input="js1_hat1_right"/>
</action>
<action name="v_target_cycle_hostile_reset">
<rebind input="js1_hat1_down"/>
</action>
<action name="v_target_cycle_in_view_fwd">
<rebind input="js1_hat1_up"/>
</action>
<action name="v_target_cycle_in_view_reset">
<rebind input="js1_hat1_up"/>
</action>
<action name="v_target_cycle_subitem_fwd">
<rebind input="js1_rctrl+button4"/>
</action>
<action name="v_target_cycle_subitem_reset">
<rebind input="js1_rctrl+button4" multiTap="2"/>
</action>
</actionmap>
<actionmap name="spaceship_scanning">
<action name="v_scanning_trigger_scan">
<rebind input="js1_button1"/>
</action>
<action name="v_toggle_scan_mode">
<rebind input="js1_button8"/>
</action>
</actionmap>
<actionmap name="spaceship_ping">
<action name="v_dec_ping_focus_angle">
<rebind input="js1_hat1_down"/>
</action>
<action name="v_inc_ping_focus_angle">
<rebind input="js1_hat1_up"/>
</action>
<action name="v_invoke_ping">
<rebind input="js1_button3"/>
</action>
</actionmap>
<actionmap name="spaceship_mining">
<action name="v_decrease_mining_throttle">
<rebind input="js3_ "/>
</action>
<action name="v_increase_mining_throttle">
<rebind input="js3_ "/>
</action>
<action name="v_mining_throttle">
<rebind input="js2_slider1"/>
</action>
<action name="v_mining_use_consumable1">
<rebind input="js1_hat1_up"/>
</action>
<action name="v_mining_use_consumable2">
<rebind input="js1_hat1_left"/>
</action>
<action name="v_mining_use_consumable3">
<rebind input="js1_hat1_right"/>
</action>
<action name="v_toggle_mining_laser_fire">
<rebind input="js3_ "/>
</action>
<action name="v_toggle_mining_laser_type">
<rebind input="js1_button3"/>
</action>
<action name="v_toggle_mining_mode">
<rebind input="js1_rctrl+button8"/>
</action>
</actionmap>
<actionmap name="spaceship_weapons">
<action name="v_attack1_group1">
<rebind input="js3_button1"/>
</action>
<action name="v_attack1_group2">
<rebind input="js1_button3"/>
</action>
<action name="v_weapon_cycle_aimmode">
<rebind input="js1_button14"/>
</action>
<action name="v_weapon_manual_gimbal_cycle_source">
<rebind input="js1_rctrl+button14"/>
</action>
</actionmap>
<actionmap name="spaceship_missiles">
<action name="v_weapon_arm_missile">
<rebind input="js1_button2"/>
</action>
<action name="v_weapon_cycle_missile_fwd">
<rebind input="js1_rctrl+button2"/>
</action>
<action name="v_weapon_launch_missile">
<rebind input="js1_button2"/>
</action>
<action name="v_weapon_unarm_all_missiles">
<rebind input="js1_button2" multiTap="2"/>
</action>
</actionmap>
<actionmap name="spaceship_defensive">
<action name="v_shield_raise_level_back">
<rebind input="js3_ "/>
</action>
<action name="v_shield_raise_level_down">
<rebind input="js3_ " activationMode="press"/>
</action>
<action name="v_shield_raise_level_forward">
<rebind input="js3_ "/>
</action>
<action name="v_shield_raise_level_left">
<rebind input="js3_ "/>
</action>
<action name="v_shield_raise_level_right">
<rebind input="js3_ "/>
</action>
<action name="v_shield_raise_level_up">
<rebind input="js3_ " activationMode="press"/>
</action>
<action name="v_shield_reset_level">
<rebind input="js3_ "/>
</action>
<action name="v_weapon_countermeasure_decoy_launch">
<rebind input="js2_hat1_left"/>
</action>
<action name="v_weapon_countermeasure_noise_launch">
<rebind input="js2_hat1_right"/>
</action>
</actionmap>
<actionmap name="spaceship_power">
<action name="v_power_focus_shields">
<rebind input="js2_button6"/>
</action>
<action name="v_power_focus_thrusters">
<rebind input="js2_button5"/>
</action>
<action name="v_power_focus_weapons">
<rebind input="js2_button7"/>
</action>
<action name="v_power_reset_focus">
<rebind input="js2_button9"/>
</action>
<action name="v_power_throttle_down">
<rebind input="js3_ "/>
</action>
<action name="v_power_throttle_max">
<rebind input="js3_ " activationMode="press"/>
</action>
<action name="v_power_throttle_min">
<rebind input="js3_ " activationMode="press"/>
</action>
<action name="v_power_throttle_up">
<rebind input="js3_ "/>
</action>
<action name="v_power_toggle">
<rebind input="js2_rctrl+button8"/>
</action>
<action name="v_power_toggle_shields">
<rebind input="js2_rctrl+button6"/>
</action>
<action name="v_power_toggle_thrusters">
<rebind input="js2_rctrl+button5"/>
</action>
<action name="v_power_toggle_weapons">
<rebind input="js2_rctrl+button7"/>
</action>
</actionmap>
<actionmap name="spaceship_radar">
<action name="v_radar_cycle_focus_back">
<rebind input="js3_ "/>
</action>
<action name="v_radar_cycle_focus_fwd">
<rebind input="js3_ "/>
</action>
<action name="v_radar_cycle_mode_back">
<rebind input="js3_ "/>
</action>
<action name="v_radar_cycle_mode_fwd">
<rebind input="js3_ "/>
</action>
<action name="v_radar_cycle_zoom_back">
<rebind input="js3_ "/>
</action>
<action name="v_radar_cycle_zoom_fwd">
<rebind input="js3_ "/>
</action>
<action name="v_radar_toggle_active_or_passive">
<rebind input="js3_ "/>
</action>
<action name="v_radar_toggle_onoff">
<rebind input="js3_ "/>
</action>
<action name="v_radar_toggle_view_focus">
<rebind input="js3_ "/>
</action>
</actionmap>
<actionmap name="spaceship_hud">
<action name="v_cycle_pitch_ladder_mode">
<rebind input="js2_rctrl+button9"/>
</action>
<action name="v_hud_cancel">
<rebind input="js3_ "/>
</action>
<action name="v_hud_confirm">
<rebind input="js3_ "/>
</action>
<action name="v_hud_focused_cycle_mode_back">
<rebind input="js3_ "/>
</action>
<action name="v_hud_focused_cycle_mode_fwd">
<rebind input="js3_ "/>
</action>
<action name="v_hud_interact_toggle">
<rebind input="js3_ "/>
</action>
<action name="v_hud_left_panel_down">
<rebind input="js3_ "/>
</action>
<action name="v_hud_left_panel_left">
<rebind input="js3_ "/>
</action>
<action name="v_hud_left_panel_right">
<rebind input="js3_ "/>
</action>
<action name="v_hud_left_panel_up">
<rebind input="js3_ "/>
</action>
<action name="v_hud_open_scoreboard">
<rebind input="js3_ "/>
</action>
<action name="v_starmap">
<rebind input="js3_ "/>
</action>
<action name="visor_wipe">
<rebind input="js2_button10"/>
</action>
</actionmap>
<actionmap name="lights_controller">
<action name="v_lights">
<rebind input="js1_rctrl+button3"/>
</action>
<action name="v_toggle_cabin_lights">
<rebind input="js3_ "/>
</action>
<action name="v_toggle_running_lights">
<rebind input="js3_ "/>
</action>
</actionmap>
<actionmap name="player">
<action name="attack1">
<rebind input="js2_ "/>
</action>
<action name="combathealtarget">
<rebind input="js2_ "/>
</action>
<action name="consume">
<rebind input="js2_ "/>
</action>
<action name="customize">
<rebind input="js2_ "/>
</action>
<action name="drop">
<rebind input="js2_ "/>
</action>
<action name="fixed_speed_decrement">
<rebind input="js2_ "/>
</action>
<action name="fixed_speed_increment">
<rebind input="js2_ "/>
</action>
<action name="force_respawn">
<rebind input="js2_ "/>
</action>
<action name="free_thirdperson_camera">
<rebind input="js2_ "/>
</action>
<action name="gp_crouch">
<rebind input="js2_ "/>
</action>
<action name="gp_movex">
<rebind input="js2_ "/>
</action>
<action name="gp_movey">
<rebind input="js2_ "/>
</action>
<action name="gp_rotatepitch">
<rebind input="js2_ "/>
</action>
<action name="gp_rotateyaw">
<rebind input="js2_ "/>
</action>
<action name="holster">
<rebind input="js2_ "/>
</action>
<action name="inspect">
<rebind input="js2_ "/>
</action>
<action name="jump">
<rebind input="js2_ "/>
</action>
<action name="leanleft">
<rebind input="js2_ "/>
</action>
<action name="leanright">
<rebind input="js2_ "/>
</action>
<action name="melee_AttackHeavyLeft">
<rebind input="js2_ "/>
</action>
<action name="melee_AttackHeavyRight">
<rebind input="js2_ "/>
</action>
<action name="melee_AttackLightLeft">
<rebind input="js2_ "/>
</action>
<action name="melee_AttackLightRight">
<rebind input="js2_ "/>
</action>
<action name="melee_block">
<rebind input="js2_ "/>
</action>
<action name="moveback">
<rebind input="js2_ "/>
</action>
<action name="moveforward">
<rebind input="js2_ "/>
</action>
<action name="moveleft">
<rebind input="js2_ "/>
</action>
<action name="moveright">
<rebind input="js2_ "/>
</action>
<action name="nextitem">
<rebind input="js2_ "/>
</action>
<action name="nextweapon">
<rebind input="js2_ "/>
</action>
<action name="pl_hud_open_scoreboard">
<rebind input="js2_ "/>
</action>
<action name="port_modification_select">
<rebind input="js2_ "/>
</action>
<action name="prevItem">
<rebind input="js2_ "/>
</action>
<action name="prevweapon">
<rebind input="js2_ "/>
</action>
<action name="prone">
<rebind input="js2_ "/>
</action>
<action name="reload">
<rebind input="js2_ "/>
</action>
<action name="selectMeleeWeapon">
<rebind input="js2_ "/>
</action>
<action name="selectUnarmedCombat">
<rebind input="js2_ "/>
</action>
<action name="selectUtilityItem">
<rebind input="js2_ "/>
</action>
<action name="selectgadget">
<rebind input="js2_ "/>
</action>
<action name="selectpistol">
<rebind input="js2_ "/>
</action>
<action name="selectprimary">
<rebind input="js2_ "/>
</action>
<action name="selectsecondary">
<rebind input="js2_ "/>
</action>
<action name="sprint">
<rebind input="js2_ "/>
</action>
<action name="stabilize">
<rebind input="js2_ "/>
</action>
<action name="thirdperson">
<rebind input="js2_ "/>
</action>
<action name="throw_overhand">
<rebind input="js2_ "/>
</action>
<action name="throw_underhand">
<rebind input="js2_ "/>
</action>
<action name="toggleEquipHelmet">
<rebind input="js2_ "/>
</action>
<action name="toggle_flashlight">
<rebind input="js2_ "/>
</action>
<action name="use">
<rebind input="js2_ "/>
</action>
<action name="v_eject">
<rebind input="js2_ "/>
</action>
<action name="v_eject_cinematic">
<rebind input="js2_ "/>
</action>
<action name="v_starmap">
<rebind input="js2_ "/>
</action>
<action name="visor_wipe">
<rebind input="js2_ "/>
</action>
<action name="walk">
<rebind input="js2_ "/>
</action>
<action name="weapon_auxiliary_action">
<rebind input="js2_ "/>
</action>
<action name="weapon_change_firemode">
<rebind input="js2_ "/>
</action>
<action name="weapon_melee">
<rebind input="js2_ "/>
</action>
<action name="weapon_zeroing_decrease">
<rebind input="js2_ "/>
</action>
<action name="weapon_zeroing_increase">
<rebind input="js2_ "/>
</action>
<action name="zoom">
<rebind input="js2_ "/>
</action>
<action name="zoom_in">
<rebind input="js2_ "/>
</action>
<action name="zoom_in_out">
<rebind input="js2_ "/>
</action>
<action name="zoom_out">
<rebind input="js2_ "/>
</action>
</actionmap>
<actionmap name="prone">
<action name="prone_rollleft">
<rebind input="js2_ " activationMode="press"/>
</action>
<action name="prone_rollright">
<rebind input="js2_ " activationMode="press"/>
</action>
</actionmap>
<actionmap name="tractor_beam">
<action name="tractor_beam_decrease_distance">
<rebind input="js2_button4"/>
</action>
<action name="tractor_beam_increase_distance">
<rebind input="js2_button3"/>
</action>
</actionmap>
<actionmap name="zero_gravity_eva">
<action name="eva_boost">
<rebind input="js2_ "/>
</action>
<action name="eva_brake">
<rebind input="js2_ "/>
</action>
<action name="eva_detach">
<rebind input="js2_ "/>
</action>
<action name="eva_launch">
<rebind input="js2_ "/>
</action>
<action name="eva_push_back">
<rebind input="js2_ "/>
</action>
<action name="eva_push_forward">
<rebind input="js2_ "/>
</action>
<action name="eva_roll">
<rebind input="js2_ "/>
</action>
<action name="eva_roll_left">
<rebind input="js2_ "/>
</action>
<action name="eva_roll_right">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_back">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_down">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_forward">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_lateral">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_left">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_longitudinal">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_right">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_up">
<rebind input="js2_ "/>
</action>
<action name="eva_strafe_vertical">
<rebind input="js2_ "/>
</action>
<action name="eva_toggle_headlook_mode">
<rebind input="js2_ "/>
</action>
<action name="eva_view_pitch">
<rebind input="js2_ "/>
</action>
<action name="eva_view_pitch_down">
<rebind input="js2_ "/>
</action>
<action name="eva_view_pitch_up">
<rebind input="js2_ "/>
</action>
<action name="eva_view_yaw">
<rebind input="js2_ "/>
</action>
<action name="eva_view_yaw_left">
<rebind input="js2_ "/>
</action>
<action name="eva_view_yaw_right">
<rebind input="js2_ "/>
</action>
</actionmap>
<actionmap name="vehicle_general">
<action name="v_attack1_group1">
<rebind input="js3_ "/>
</action>
<action name="v_attack1_group2">
<rebind input="js2_rctrl+button1"/>
</action>
<action name="v_close_all_doors">
<rebind input="js2_button11"/>
</action>
<action name="v_exit">
<rebind input="js3_ "/>
</action>
<action name="v_flightready">
<rebind input="js2_button8"/>
</action>
<action name="v_horn">
<rebind input="js3_ "/>
</action>
<action name="v_lock_all_doors">
<rebind input="js2_rctrl+button11"/>
</action>
<action name="v_open_all_doors">
<rebind input="js2_button16"/>
</action>
<action name="v_starmap">
<rebind input="js3_ "/>
</action>
<action name="v_unlock_all_doors">
<rebind input="js2_rctrl+button16"/>
</action>
<action name="v_view_cycle_fwd">
<rebind input="js3_ "/>
</action>
<action name="v_view_freelook_mode">
<rebind input="js2_rctrl+hat1_up"/>
</action>
<action name="v_view_look_behind">
<rebind input="js3_ "/>
</action>
<action name="v_view_pitch">
<rebind input="js3_ "/>
</action>
<action name="v_view_yaw">
<rebind input="js3_ "/>
</action>
<action name="v_view_zoom_in">
<rebind input="js3_ "/>
</action>
<action name="v_view_zoom_out">
<rebind input="js3_ "/>
</action>
<action name="visor_wipe">
<rebind input="js2_button10"/>
</action>
</actionmap>
<actionmap name="vehicle_driver">
<action name="v_attack1">
<rebind input="js3_ "/>
</action>
<action name="v_attack2">
<rebind input="js3_ "/>
</action>
<action name="v_boost">
<rebind input="js3_ "/>
</action>
<action name="v_brake">
<rebind input="js3_ "/>
</action>
<action name="v_move">
<rebind input="js2_y"/>
</action>
<action name="v_move_back">
<rebind input="js3_ "/>
</action>
<action name="v_move_forward">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_abs">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_abs_toggle">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_rel">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_rel_in">
<rebind input="js3_ "/>
</action>
<action name="v_view_dynamic_zoom_rel_out">
<rebind input="js3_ "/>
</action>
<action name="v_yaw">
<rebind input="js2_x"/>
</action>
<action name="v_yaw_left">
<rebind input="js3_ "/>
</action>
<action name="v_yaw_right">
<rebind input="js3_ "/>
</action>
</actionmap>
<actionmap name="spectator">
<action name="spectate_gen_nextcamera">
<rebind input="js2_ "/>
</action>
<action name="spectate_gen_nextmode">
<rebind input="js2_ "/>
</action>
<action name="spectate_gen_prevmode">
<rebind input="js2_ "/>
</action>
<action name="spectate_next_target">
<rebind input="js2_button1"/>
</action>
<action name="spectate_prev_target">
<rebind input="js2_button2"/>
</action>
<action name="spectate_rotatepitch">
<rebind input="js2_y"/>
</action>
<action name="spectate_rotatepitch_mouse">
<rebind input="js2_y"/>
</action>
<action name="spectate_rotateyaw">
<rebind input="js2_x"/>
</action>
<action name="spectate_rotateyaw_mouse">
<rebind input="js2_x"/>
</action>
<action name="spectate_toggle_hud">
<rebind input="js2_ "/>
</action>
<action name="spectate_toggle_lock_target">
<rebind input="js2_ "/>
</action>
<action name="spectate_toggle_thirdperson">
<rebind input="js2_ "/>
</action>
<action name="spectate_zoom">
<rebind input="js2_ "/>
</action>
<action name="spectate_zoom_in">
<rebind input="js2_hat1_up"/>
</action>
<action name="spectate_zoom_out">
<rebind input="js2_hat1_down"/>
</action>
</actionmap>
<actionmap name="default">
<action name="focus_on_chat_textinput">
<rebind input="js3_ "/>
</action>
<action name="pl_exit">
<rebind input="js2_rctrl+button10"/>
</action>
<action name="toggle_chat">
<rebind input="js3_ "/>
</action>
<action name="toggle_contact">
<rebind input="js3_ "/>
</action>
</actionmap>
<actionmap name="player_emotes">
<action name="emote_agree">
<rebind input="js2_ "/>
</action>
<action name="emote_angry">
<rebind input="js2_ "/>
</action>
<action name="emote_atease">
<rebind input="js2_ "/>
</action>
<action name="emote_attention">
<rebind input="js2_ "/>
</action>
<action name="emote_blah">
<rebind input="js2_ "/>
</action>
<action name="emote_bored">
<rebind input="js2_ "/>
</action>
<action name="emote_bow">
<rebind input="js2_ "/>
</action>
<action name="emote_burp">
<rebind input="js2_ "/>
</action>
<action name="emote_cheer">
<rebind input="js2_ "/>
</action>
<action name="emote_chicken">
<rebind input="js2_ "/>
</action>
<action name="emote_clap">
<rebind input="js2_ "/>
</action>
<action name="emote_come">
<rebind input="js2_ "/>
</action>
<action name="emote_cry">
<rebind input="js2_ "/>
</action>
<action name="emote_cs_forward">
<rebind input="js2_ "/>
</action>
<action name="emote_cs_left">
<rebind input="js2_ "/>
</action>
<action name="emote_cs_no">
<rebind input="js2_ "/>
</action>
<action name="emote_cs_right">
<rebind input="js2_ "/>
</action>
<action name="emote_cs_stop">
<rebind input="js2_ "/>
</action>
<action name="emote_cs_yes">
<rebind input="js2_ "/>
</action>
<action name="emote_dance">
<rebind input="js2_ "/>
</action>
<action name="emote_disagree">
<rebind input="js2_ "/>
</action>
<action name="emote_failure">
<rebind input="js2_ "/>
</action>
<action name="emote_flex">
<rebind input="js2_ "/>
</action>
<action name="emote_flirt">
<rebind input="js2_ "/>
</action>
<action name="emote_gasp">
<rebind input="js2_ "/>
</action>
<action name="emote_gloat">
<rebind input="js2_ "/>
</action>
<action name="emote_greet">
<rebind input="js2_ "/>
</action>
<action name="emote_laugh">
<rebind input="js2_ "/>
</action>
<action name="emote_launch">
<rebind input="js2_ "/>
</action>
<action name="emote_point">
<rebind input="js2_ "/>
</action>
<action name="emote_rude">
<rebind input="js2_ "/>
</action>
<action name="emote_salute">
<rebind input="js2_ "/>
</action>
<action name="emote_sit">
<rebind input="js2_ "/>
</action>
<action name="emote_sleep">
<rebind input="js2_ "/>
</action>
<action name="emote_smell">
<rebind input="js2_ "/>
</action>
<action name="emote_taunt">
<rebind input="js2_ "/>
</action>
<action name="emote_threaten">
<rebind input="js2_ "/>
</action>
<action name="emote_wait">
<rebind input="js2_ "/>
</action>
<action name="emote_wave">
<rebind input="js2_ "/>
</action>
<action name="emote_whistle">
<rebind input="js2_ "/>
</action>
</actionmap>
<actionmap name="player_input_optical_tracking">
<action name="foip_recalibrate">
<rebind input="js1_rctrl+button10"/>
</action>
<action name="foip_viewownplayer">
<rebind input="js1_rctrl+button5"/>
</action>
<action name="headtrack_enabled">
<rebind input="js1_button5"/>
</action>
<action name="headtrack_recenter_device">
<rebind input="js1_button10"/>
</action>
</actionmap>
<actionmap name="player_choice">
<action name="pc_camera_orbit">
<rebind input="js2_ "/>
</action>
<action name="pc_focus">
<rebind input="js2_button7"/>
</action>
<action name="pc_interaction_mode">
<rebind input="js2_button6"/>
</action>
<action name="pc_interaction_select">
<rebind input="js2_ "/>
</action>
<action name="pc_item_primary">
<rebind input="js2_ "/>
</action>
<action name="pc_item_secondary">
<rebind input="js2_ "/>
</action>
<action name="pc_personal_back">
<rebind input="js2_ "/>
</action>
<action name="pc_personal_thought">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_emotes">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_empty_backpack">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_flight_systems">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_inventory">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_item_actions">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_item_drop">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_item_unstown">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_miningmode_actions">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_mobiglas_actions">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_player_actions">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_remote_turrets">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_ship_systems">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_vehicle_actions">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_weapon_selection">
<rebind input="js2_ "/>
</action>
<action name="pc_pit_weapons_systems">
<rebind input="js2_ "/>
</action>
<action name="pc_qs_consumables">
<rebind input="js2_ "/>
</action>
<action name="pc_qs_flight_mode">
<rebind input="js2_ "/>
</action>
<action name="pc_qs_grenades">
<rebind input="js2_ "/>
</action>
<action name="pc_qs_weapons_pistol">
<rebind input="js2_ "/>
</action>
<action name="pc_qs_weapons_primary">
<rebind input="js2_ "/>
</action>
<action name="pc_qs_weapons_secondary">
<rebind input="js2_ "/>
</action>
<action name="pc_screen_focus_down">
<rebind input="js2_ "/>
</action>
<action name="pc_screen_focus_left">
<rebind input="js2_ "/>
</action>
<action name="pc_screen_focus_right">
<rebind input="js2_ "/>
</action>
<action name="pc_screen_focus_up">
<rebind input="js2_ "/>
</action>
<action name="pc_select">
<rebind input="js2_button1"/>
</action>
<action name="pc_ui_back">
<rebind input="js2_ "/>
</action>
<action name="pc_zoom_in">
<rebind input="js2_ "/>
</action>
<action name="pc_zoom_out">
<rebind input="js2_ "/>
</action>
</actionmap>
<actionmap name="view_director_mode">
<action name="view_fov_in">
<rebind input="js2_ "/>
</action>
<action name="view_fov_out">
<rebind input="js2_ "/>
</action>
<action name="view_fstop_in">
<rebind input="js2_ "/>
</action>
<action name="view_fstop_out">
<rebind input="js2_ "/>
</action>
<action name="view_restore_defaults">
<rebind input="js2_ "/>
</action>
</actionmap>
</ActionMaps>
| 27.626543 | 119 | 0.639035 |
6166f31c3568c261fa651c8b693fd822785402f6 | 3,551 | xml | XML | VOCdevkit/VOC2007/Annotations/8995ab7a0c7da9aebc524bd2210b265f_250.xml | 1162620106/Pedestrian-warning-system | dc3ab15c74c6df7dc11a4dcd5535ca4bd0bf351b | [
"MIT"
] | 3 | 2021-04-20T12:16:44.000Z | 2021-12-23T02:44:26.000Z | VOCdevkit/VOC2007/Annotations/8995ab7a0c7da9aebc524bd2210b265f_250.xml | 1162620106/Pedestrian-warning-system | dc3ab15c74c6df7dc11a4dcd5535ca4bd0bf351b | [
"MIT"
] | null | null | null | VOCdevkit/VOC2007/Annotations/8995ab7a0c7da9aebc524bd2210b265f_250.xml | 1162620106/Pedestrian-warning-system | dc3ab15c74c6df7dc11a4dcd5535ca4bd0bf351b | [
"MIT"
] | 1 | 2021-11-01T20:21:55.000Z | 2021-11-01T20:21:55.000Z | <?xml version="1.0" ?>
<annotation>
<folder>JPEGImages</folder>
<filename>8995ab7a0c7da9aebc524bd2210b265f_250</filename>
<path>C:/AIoT/Projects/keras-yolo3-master/VOCdevkit/VOC2007/JPEGImages/8995ab7a0c7da9aebc524bd2210b265f_250.jpg</path>
<source>
<database>Unknown</database>
</source>
<size>
<width>1920</width>
<height>1080</height>
<depth>3</depth>
</size>
<segmented>0</segmented>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1318.86</xmin>
<ymin>438.27</ymin>
<xmax>1333.43</xmax>
<ymax>486.33</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1295.20</xmin>
<ymin>439.22</ymin>
<xmax>1311.05</xmax>
<ymax>487.70</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1243.08</xmin>
<ymin>435.60</ymin>
<xmax>1261.77</xmax>
<ymax>481.00</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1566.78</xmin>
<ymin>371.19</ymin>
<xmax>1625.17</xmax>
<ymax>632.30</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1704.98</xmin>
<ymin>388.87</ymin>
<xmax>1749.91</xmax>
<ymax>552.36</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1726.68</xmin>
<ymin>385.73</ymin>
<xmax>1823.70</xmax>
<ymax>658.20</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1620.12</xmin>
<ymin>400.74</ymin>
<xmax>1684.80</xmax>
<ymax>616.20</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1424.25</xmin>
<ymin>429.00</ymin>
<xmax>1439.41</xmax>
<ymax>484.73</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1205.70</xmin>
<ymin>438.58</ymin>
<xmax>1221.22</xmax>
<ymax>486.77</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1356.28</xmin>
<ymin>448.11</ymin>
<xmax>1389.60</xmax>
<ymax>508.23</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1372.41</xmin>
<ymin>362.26</ymin>
<xmax>1382.32</xmax>
<ymax>404.40</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1442.25</xmin>
<ymin>430.91</ymin>
<xmax>1463.30</xmax>
<ymax>462.30</ymax>
</bndbox>
</object>
<object>
<name>person</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>1183.54</xmin>
<ymin>433.09</ymin>
<xmax>1202.23</xmax>
<ymax>487.33</ymax>
</bndbox>
</object>
</annotation>
| 20.645349 | 119 | 0.633061 |
7abdb0585c4bf46a5989b07fc5ef9ff8b723d849 | 19,272 | xml | XML | jupyter/data/dataset/P00562.xml | TommasoBarberis/Visualisation-des-donnees-biologiques | ecac55de417b2bbdadbe0e248a210eed93865ece | [
"MIT"
] | null | null | null | jupyter/data/dataset/P00562.xml | TommasoBarberis/Visualisation-des-donnees-biologiques | ecac55de417b2bbdadbe0e248a210eed93865ece | [
"MIT"
] | null | null | null | jupyter/data/dataset/P00562.xml | TommasoBarberis/Visualisation-des-donnees-biologiques | ecac55de417b2bbdadbe0e248a210eed93865ece | [
"MIT"
] | null | null | null | <?xml version='1.0' encoding='UTF-8'?>
<uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry dataset="Swiss-Prot" created="1986-07-21" modified="2019-05-08" version="169">
<accession>P00562</accession>
<accession>P77856</accession>
<accession>Q2M8N6</accession>
<name>AK2H_ECOLI</name>
<protein>
<recommendedName>
<fullName>Bifunctional aspartokinase/homoserine dehydrogenase 2</fullName>
</recommendedName>
<alternativeName>
<fullName>Aspartokinase II/homoserine dehydrogenase II</fullName>
<shortName>AKII-HDII</shortName>
</alternativeName>
<domain>
<recommendedName>
<fullName>Aspartokinase</fullName>
<ecNumber>2.7.2.4</ecNumber>
</recommendedName>
</domain>
<domain>
<recommendedName>
<fullName>Homoserine dehydrogenase</fullName>
<ecNumber>1.1.1.3</ecNumber>
</recommendedName>
</domain>
</protein>
<gene>
<name type="primary">metL</name>
<name type="synonym">metM</name>
<name type="ordered locus">b3940</name>
<name type="ordered locus">JW3911</name>
</gene>
<organism>
<name type="scientific">Escherichia coli (strain K12)</name>
<dbReference type="NCBI Taxonomy" id="83333"/>
<lineage>
<taxon>Bacteria</taxon>
<taxon>Proteobacteria</taxon>
<taxon>Gammaproteobacteria</taxon>
<taxon>Enterobacterales</taxon>
<taxon>Enterobacteriaceae</taxon>
<taxon>Escherichia</taxon>
</lineage>
</organism>
<reference key="1">
<citation type="journal article" date="1983" name="J. Biol. Chem." volume="258" first="3028" last="3031">
<title>Nucleotide sequence of the metL gene of Escherichia coli. Its product, the bifunctional aspartokinase II-homoserine dehydrogenase II, and the bifunctional product of the thrA gene, aspartokinase I-homoserine dehydrogenase I, derive from a common ancestor.</title>
<authorList>
<person name="Zakin M.M."/>
<person name="Duchange N."/>
<person name="Ferrara P."/>
<person name="Cohen G.N."/>
</authorList>
<dbReference type="PubMed" id="6298218"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [GENOMIC DNA]</scope>
<scope>PROTEIN SEQUENCE OF 2-10</scope>
</reference>
<reference key="2">
<citation type="journal article" date="1993" name="Nucleic Acids Res." volume="21" first="3391" last="3398">
<title>Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes.</title>
<authorList>
<person name="Plunkett G. III"/>
<person name="Burland V."/>
<person name="Daniels D.L."/>
<person name="Blattner F.R."/>
</authorList>
<dbReference type="PubMed" id="8346018"/>
<dbReference type="DOI" id="10.1093/nar/21.15.3391"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
<source>
<strain>K12 / MG1655 / ATCC 47076</strain>
</source>
</reference>
<reference key="3">
<citation type="journal article" date="1997" name="Science" volume="277" first="1453" last="1462">
<title>The complete genome sequence of Escherichia coli K-12.</title>
<authorList>
<person name="Blattner F.R."/>
<person name="Plunkett G. III"/>
<person name="Bloch C.A."/>
<person name="Perna N.T."/>
<person name="Burland V."/>
<person name="Riley M."/>
<person name="Collado-Vides J."/>
<person name="Glasner J.D."/>
<person name="Rode C.K."/>
<person name="Mayhew G.F."/>
<person name="Gregor J."/>
<person name="Davis N.W."/>
<person name="Kirkpatrick H.A."/>
<person name="Goeden M.A."/>
<person name="Rose D.J."/>
<person name="Mau B."/>
<person name="Shao Y."/>
</authorList>
<dbReference type="PubMed" id="9278503"/>
<dbReference type="DOI" id="10.1126/science.277.5331.1453"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
<source>
<strain>K12 / MG1655 / ATCC 47076</strain>
</source>
</reference>
<reference key="4">
<citation type="journal article" date="2006" name="Mol. Syst. Biol." volume="2" first="E1" last="E5">
<title>Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.</title>
<authorList>
<person name="Hayashi K."/>
<person name="Morooka N."/>
<person name="Yamamoto Y."/>
<person name="Fujita K."/>
<person name="Isono K."/>
<person name="Choi S."/>
<person name="Ohtsubo E."/>
<person name="Baba T."/>
<person name="Wanner B.L."/>
<person name="Mori H."/>
<person name="Horiuchi T."/>
</authorList>
<dbReference type="PubMed" id="16738553"/>
<dbReference type="DOI" id="10.1038/msb4100049"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
<source>
<strain>K12 / W3110 / ATCC 27325 / DSM 5911</strain>
</source>
</reference>
<comment type="catalytic activity">
<reaction>
<text>L-homoserine + NADP(+) = H(+) + L-aspartate 4-semialdehyde + NADPH</text>
<dbReference type="Rhea" id="RHEA:15761"/>
<dbReference type="ChEBI" id="CHEBI:15378"/>
<dbReference type="ChEBI" id="CHEBI:57476"/>
<dbReference type="ChEBI" id="CHEBI:57783"/>
<dbReference type="ChEBI" id="CHEBI:58349"/>
<dbReference type="ChEBI" id="CHEBI:537519"/>
<dbReference type="EC" id="1.1.1.3"/>
</reaction>
</comment>
<comment type="catalytic activity">
<reaction>
<text>L-homoserine + NAD(+) = H(+) + L-aspartate 4-semialdehyde + NADH</text>
<dbReference type="Rhea" id="RHEA:15757"/>
<dbReference type="ChEBI" id="CHEBI:15378"/>
<dbReference type="ChEBI" id="CHEBI:57476"/>
<dbReference type="ChEBI" id="CHEBI:57540"/>
<dbReference type="ChEBI" id="CHEBI:57945"/>
<dbReference type="ChEBI" id="CHEBI:537519"/>
<dbReference type="EC" id="1.1.1.3"/>
</reaction>
</comment>
<comment type="catalytic activity">
<reaction>
<text>ATP + L-aspartate = 4-phospho-L-aspartate + ADP</text>
<dbReference type="Rhea" id="RHEA:23776"/>
<dbReference type="ChEBI" id="CHEBI:29991"/>
<dbReference type="ChEBI" id="CHEBI:30616"/>
<dbReference type="ChEBI" id="CHEBI:57535"/>
<dbReference type="ChEBI" id="CHEBI:456216"/>
<dbReference type="EC" id="2.7.2.4"/>
</reaction>
</comment>
<comment type="pathway">
<text>Amino-acid biosynthesis; L-lysine biosynthesis via DAP pathway; (S)-tetrahydrodipicolinate from L-aspartate: step 1/4.</text>
</comment>
<comment type="pathway">
<text>Amino-acid biosynthesis; L-methionine biosynthesis via de novo pathway; L-homoserine from L-aspartate: step 1/3.</text>
</comment>
<comment type="pathway">
<text>Amino-acid biosynthesis; L-methionine biosynthesis via de novo pathway; L-homoserine from L-aspartate: step 3/3.</text>
</comment>
<comment type="pathway">
<text>Amino-acid biosynthesis; L-threonine biosynthesis; L-threonine from L-aspartate: step 1/5.</text>
</comment>
<comment type="pathway">
<text>Amino-acid biosynthesis; L-threonine biosynthesis; L-threonine from L-aspartate: step 3/5.</text>
</comment>
<comment type="subunit">
<text>Homotetramer.</text>
</comment>
<comment type="miscellaneous">
<text>Aspartokinase I-homoserine dehydrogenase I and aspartokinase III also catalyze the same reaction(s).</text>
</comment>
<comment type="similarity">
<text evidence="3">In the N-terminal section; belongs to the aspartokinase family.</text>
</comment>
<comment type="similarity">
<text evidence="3">In the C-terminal section; belongs to the homoserine dehydrogenase family.</text>
</comment>
<dbReference type="EC" id="2.7.2.4"/>
<dbReference type="EC" id="1.1.1.3"/>
<dbReference type="EMBL" id="V00305">
<property type="protein sequence ID" value="CAA23585.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="EMBL" id="L19201">
<property type="protein sequence ID" value="AAB03072.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="EMBL" id="U00096">
<property type="protein sequence ID" value="AAC76922.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="EMBL" id="AP009048">
<property type="protein sequence ID" value="BAE77370.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="PIR" id="S40883">
<property type="entry name" value="DEECK2"/>
</dbReference>
<dbReference type="RefSeq" id="NP_418375.1">
<property type="nucleotide sequence ID" value="NC_000913.3"/>
</dbReference>
<dbReference type="RefSeq" id="WP_000110772.1">
<property type="nucleotide sequence ID" value="NZ_LN832404.1"/>
</dbReference>
<dbReference type="SMR" id="P00562"/>
<dbReference type="BioGrid" id="4261101">
<property type="interactions" value="419"/>
</dbReference>
<dbReference type="DIP" id="DIP-10197N"/>
<dbReference type="IntAct" id="P00562">
<property type="interactions" value="3"/>
</dbReference>
<dbReference type="STRING" id="511145.b3940"/>
<dbReference type="jPOST" id="P00562"/>
<dbReference type="PaxDb" id="P00562"/>
<dbReference type="PRIDE" id="P00562"/>
<dbReference type="EnsemblBacteria" id="AAC76922">
<property type="protein sequence ID" value="AAC76922"/>
<property type="gene ID" value="b3940"/>
</dbReference>
<dbReference type="EnsemblBacteria" id="BAE77370">
<property type="protein sequence ID" value="BAE77370"/>
<property type="gene ID" value="BAE77370"/>
</dbReference>
<dbReference type="GeneID" id="948433"/>
<dbReference type="KEGG" id="ecj:JW3911"/>
<dbReference type="KEGG" id="eco:b3940"/>
<dbReference type="PATRIC" id="fig|1411691.4.peg.2765"/>
<dbReference type="EchoBASE" id="EB0585"/>
<dbReference type="EcoGene" id="EG10590">
<property type="gene designation" value="metL"/>
</dbReference>
<dbReference type="eggNOG" id="ENOG4105CFH">
<property type="taxonomic scope" value="Bacteria"/>
</dbReference>
<dbReference type="eggNOG" id="COG0460">
<property type="taxonomic scope" value="LUCA"/>
</dbReference>
<dbReference type="eggNOG" id="COG0527">
<property type="taxonomic scope" value="LUCA"/>
</dbReference>
<dbReference type="HOGENOM" id="HOG000271594"/>
<dbReference type="InParanoid" id="P00562"/>
<dbReference type="KO" id="K12525"/>
<dbReference type="PhylomeDB" id="P00562"/>
<dbReference type="BioCyc" id="EcoCyc:ASPKINIIHOMOSERDEHYDROGII-MONOMER"/>
<dbReference type="BioCyc" id="ECOL316407:JW3911-MONOMER"/>
<dbReference type="BioCyc" id="MetaCyc:ASPKINIIHOMOSERDEHYDROGII-MONOMER"/>
<dbReference type="UniPathway" id="UPA00034">
<property type="reaction ID" value="UER00015"/>
</dbReference>
<dbReference type="UniPathway" id="UPA00050">
<property type="reaction ID" value="UER00063"/>
</dbReference>
<dbReference type="UniPathway" id="UPA00050">
<property type="reaction ID" value="UER00461"/>
</dbReference>
<dbReference type="UniPathway" id="UPA00051">
<property type="reaction ID" value="UER00462"/>
</dbReference>
<dbReference type="UniPathway" id="UPA00051">
<property type="reaction ID" value="UER00465"/>
</dbReference>
<dbReference type="PRO" id="PR:P00562"/>
<dbReference type="Proteomes" id="UP000000318">
<property type="component" value="Chromosome"/>
</dbReference>
<dbReference type="Proteomes" id="UP000000625">
<property type="component" value="Chromosome"/>
</dbReference>
<dbReference type="GO" id="GO:0005829">
<property type="term" value="C:cytosol"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="EcoCyc"/>
</dbReference>
<dbReference type="GO" id="GO:0004072">
<property type="term" value="F:aspartate kinase activity"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="EcoCyc"/>
</dbReference>
<dbReference type="GO" id="GO:0005524">
<property type="term" value="F:ATP binding"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-KW"/>
</dbReference>
<dbReference type="GO" id="GO:0004412">
<property type="term" value="F:homoserine dehydrogenase activity"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="EcoCyc"/>
</dbReference>
<dbReference type="GO" id="GO:0050661">
<property type="term" value="F:NADP binding"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="InterPro"/>
</dbReference>
<dbReference type="GO" id="GO:0009090">
<property type="term" value="P:homoserine biosynthetic process"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="EcoCyc"/>
</dbReference>
<dbReference type="GO" id="GO:0009089">
<property type="term" value="P:lysine biosynthetic process via diaminopimelate"/>
<property type="evidence" value="ECO:0000314"/>
<property type="project" value="EcoCyc"/>
</dbReference>
<dbReference type="GO" id="GO:0009086">
<property type="term" value="P:methionine biosynthetic process"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-KW"/>
</dbReference>
<dbReference type="GO" id="GO:0009088">
<property type="term" value="P:threonine biosynthetic process"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-UniPathway"/>
</dbReference>
<dbReference type="CDD" id="cd04257">
<property type="entry name" value="AAK_AK-HSDH"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="Gene3D" id="3.40.1160.10">
<property type="match status" value="1"/>
</dbReference>
<dbReference type="InterPro" id="IPR036393">
<property type="entry name" value="AceGlu_kinase-like_sf"/>
</dbReference>
<dbReference type="InterPro" id="IPR041743">
<property type="entry name" value="AK-HSDH_N"/>
</dbReference>
<dbReference type="InterPro" id="IPR001048">
<property type="entry name" value="Asp/Glu/Uridylate_kinase"/>
</dbReference>
<dbReference type="InterPro" id="IPR005106">
<property type="entry name" value="Asp/hSer_DH_NAD-bd"/>
</dbReference>
<dbReference type="InterPro" id="IPR001341">
<property type="entry name" value="Asp_kinase"/>
</dbReference>
<dbReference type="InterPro" id="IPR018042">
<property type="entry name" value="Aspartate_kinase_CS"/>
</dbReference>
<dbReference type="InterPro" id="IPR011147">
<property type="entry name" value="Bifunc_aspartokin/hSer_DH"/>
</dbReference>
<dbReference type="InterPro" id="IPR001342">
<property type="entry name" value="HDH_cat"/>
</dbReference>
<dbReference type="InterPro" id="IPR019811">
<property type="entry name" value="HDH_CS"/>
</dbReference>
<dbReference type="InterPro" id="IPR036291">
<property type="entry name" value="NAD(P)-bd_dom_sf"/>
</dbReference>
<dbReference type="Pfam" id="PF00696">
<property type="entry name" value="AA_kinase"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="Pfam" id="PF00742">
<property type="entry name" value="Homoserine_dh"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="Pfam" id="PF03447">
<property type="entry name" value="NAD_binding_3"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PIRSF" id="PIRSF000727">
<property type="entry name" value="ThrA"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="SUPFAM" id="SSF51735">
<property type="entry name" value="SSF51735"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="SUPFAM" id="SSF53633">
<property type="entry name" value="SSF53633"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="TIGRFAMs" id="TIGR00657">
<property type="entry name" value="asp_kinases"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS00324">
<property type="entry name" value="ASPARTOKINASE"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS01042">
<property type="entry name" value="HOMOSER_DHGENASE"/>
<property type="match status" value="1"/>
</dbReference>
<proteinExistence type="evidence at protein level"/>
<keyword id="KW-0028">Amino-acid biosynthesis</keyword>
<keyword id="KW-0067">ATP-binding</keyword>
<keyword id="KW-0181">Complete proteome</keyword>
<keyword id="KW-0903">Direct protein sequencing</keyword>
<keyword id="KW-0418">Kinase</keyword>
<keyword id="KW-0486">Methionine biosynthesis</keyword>
<keyword id="KW-0511">Multifunctional enzyme</keyword>
<keyword id="KW-0521">NADP</keyword>
<keyword id="KW-0547">Nucleotide-binding</keyword>
<keyword id="KW-0560">Oxidoreductase</keyword>
<keyword id="KW-1185">Reference proteome</keyword>
<keyword id="KW-0808">Transferase</keyword>
<feature type="initiator methionine" description="Removed" evidence="2">
<location>
<position position="1"/>
</location>
</feature>
<feature type="chain" description="Bifunctional aspartokinase/homoserine dehydrogenase 2" id="PRO_0000066683">
<location>
<begin position="2"/>
<end position="810"/>
</location>
</feature>
<feature type="nucleotide phosphate-binding region" description="NADP" evidence="1">
<location>
<begin position="464"/>
<end position="471"/>
</location>
</feature>
<feature type="region of interest" description="Aspartokinase">
<location>
<begin position="2"/>
<end position="252"/>
</location>
</feature>
<feature type="region of interest" description="Interface">
<location>
<begin position="253"/>
<end position="463"/>
</location>
</feature>
<feature type="region of interest" description="Homoserine dehydrogenase">
<location>
<begin position="464"/>
<end position="810"/>
</location>
</feature>
<feature type="sequence conflict" description="In Ref. 1; CAA23585." ref="1" evidence="3">
<original>Q</original>
<variation>R</variation>
<location>
<position position="56"/>
</location>
</feature>
<feature type="sequence conflict" description="In Ref. 1; CAA23585." ref="1" evidence="3">
<original>N</original>
<variation>S</variation>
<location>
<position position="59"/>
</location>
</feature>
<feature type="sequence conflict" description="In Ref. 1; CAA23585." ref="1" evidence="3">
<original>A</original>
<variation>G</variation>
<location>
<position position="333"/>
</location>
</feature>
<feature type="sequence conflict" description="In Ref. 1; CAA23585." ref="1" evidence="3">
<original>M</original>
<variation>S</variation>
<location>
<position position="674"/>
</location>
</feature>
<feature type="sequence conflict" description="In Ref. 1; CAA23585." ref="1" evidence="3">
<original>A</original>
<variation>R</variation>
<location>
<position position="762"/>
</location>
</feature>
<evidence key="1" type="ECO:0000255"/>
<evidence key="2" type="ECO:0000269">
<source>
<dbReference type="PubMed" id="6298218"/>
</source>
</evidence>
<evidence key="3" type="ECO:0000305"/>
<sequence length="810" mass="88888" checksum="BD2515E3554F9B44" modified="2007-01-23" version="3">
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLFGKGNIGSRWLELFARE
QSTLSARTGFEFVLAGVVDSRRSLLSYDGLDASRALAFFNDEAVEQDEESLFLWMRAHPY
DDLVVLDVTASQQLADQYLDFASHGFHVISANKLAGASDSNKYRQIHDAFEKTGRHWLYN
ATVGAGLPINHTVRDLIDSGDTILSISGIFSGTLSWLFLQFDGSVPFTELVDQAWQQGLT
EPDPRDDLSGKDVMRKLVILAREAGYNIEPDQVRVESLVPAHCEGGSIDHFFENGDELNE
QMVQRLEAAREMGLVLRYVARFDANGKARVGVEAVREDHPLASLLPCDNVFAIESRWYRD
NPLVIRGPGAGRDVTAGAIQSDINRLAQLL
</sequence>
</entry>
<copyright>
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
</copyright>
</uniprot> | 37.348837 | 270 | 0.740401 |
7af48664265e3ceb8574fe515726a4decf01ec67 | 874 | xml | XML | android_mobile/src/main/res/layout/widget_upcomingevents_list_bankholiday.xml | madlymad/Memento-Calendar | cc3aaee7a5a5dbd43a41bcb84e0d55774296a90b | [
"MIT"
] | 230 | 2016-10-22T18:47:07.000Z | 2022-02-11T18:26:03.000Z | android_mobile/src/main/res/layout/widget_upcomingevents_list_bankholiday.xml | alexstyl/MementoNamedays | d224f0af53ee3d4ecadad5df0a2731e2c9031a23 | [
"MIT"
] | 44 | 2016-10-25T15:50:33.000Z | 2021-01-10T17:52:19.000Z | android_mobile/src/main/res/layout/widget_upcomingevents_list_bankholiday.xml | alexstyl/MementoNamedays | d224f0af53ee3d4ecadad5df0a2731e2c9031a23 | [
"MIT"
] | 61 | 2016-10-24T02:02:50.000Z | 2022-02-11T18:26:11.000Z | <?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:tools="http://schemas.android.com/tools"
android:id="@+id/widget_row_upcoming_bankholiday_background"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:orientation="vertical">
<TextView
style="@style/Widget.Upcoming.Header"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:text="@string/Bank_holiday"
android:textColor="@color/bankholiday_green" />
<TextView
android:id="@+id/row_upcoming_bankholiday"
style="@style/Widget.Upcoming.Text"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginTop="@dimen/upcoming_space_between_title_and_content"
tools:text="October Fest" />
</LinearLayout>
| 33.615385 | 78 | 0.757437 |
9f54c4a4666e09d6c2eb593820bfd13c06e71f22 | 78 | xml | XML | tags/OOMP-oomlout-tags.xml | oomlout/oomlout-TPGE | 7501a3662111d5ed996dd33e0d580d75d012ff8e | [
"CC0-1.0"
] | null | null | null | tags/OOMP-oomlout-tags.xml | oomlout/oomlout-TPGE | 7501a3662111d5ed996dd33e0d580d75d012ff8e | [
"CC0-1.0"
] | null | null | null | tags/OOMP-oomlout-tags.xml | oomlout/oomlout-TPGE | 7501a3662111d5ed996dd33e0d580d75d012ff8e | [
"CC0-1.0"
] | null | null | null | <xml>
<oompBasics>
<shortURL>http://oom.lt</shortURL>
</oompBasics>
</xml> | 15.6 | 36 | 0.653846 |
e9e83aadf0aa14f65153ecc1258eb0ec2879311d | 14,235 | xml | XML | all/xml/ficker-an-thun-1855-03-08-a3-xxi-d332.xml | acdh-oeaw/thun | 0c282b16f53ee7c7b4b666fea8b2a90c370587ce | [
"MIT"
] | null | null | null | all/xml/ficker-an-thun-1855-03-08-a3-xxi-d332.xml | acdh-oeaw/thun | 0c282b16f53ee7c7b4b666fea8b2a90c370587ce | [
"MIT"
] | 8 | 2017-10-17T06:56:32.000Z | 2018-11-02T14:31:16.000Z | all/xml/ficker-an-thun-1855-03-08-a3-xxi-d332.xml | acdh-oeaw/thun | 0c282b16f53ee7c7b4b666fea8b2a90c370587ce | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<?oxygen RNGSchema="http://thun-korrespondenz.uibk.ac.at/svn/thun/thun-korrespondenz/schema/thun-schema.rnc" type="compact"?><TEI xmlns="http://www.tei-c.org/ns/1.0" xml:base="http://thun-korrespondenz.uibk.ac.at:8080/exist/rest/db/files/thun/xml/" xml:id="ficker-an-thun_1855-03-08_A3-XXI-D332.xml"><teiHeader><fileDesc><titleStmt><title><persName key="ficker-julius" role="sender:gelehrter">Julius
Ficker</persName> an <persName key="thun-hohenstein-leo" role="recipient">Leo Thun</persName><lb/><placeName>Innsbruck</placeName>, <date when="1855-03-08">8. März 1855</date></title></titleStmt><publicationStmt><p/></publicationStmt><sourceDesc><msDesc><msIdentifier><institution>Staatliches Gebietsarchiv Leitmeritz, Zweigstelle
Tetschen-Bodenbach</institution><repository>Familienarchiv Thun-Hohenstein, Linie Tetschen, Nachlass Leo
Thun</repository><idno>A3 XXI D332</idno></msIdentifier><msContents><p>Der Historiker Julius Ficker beantwortet einen Brief Leo Thuns, in dem
der Minister um Empfehlung von fähigen Kandidaten für das Lehramt an
österreichischen Gymnasien gebeten hatte. Ficker glaubt, dass sich in
seiner Heimat Westfalen gewiss einige Kandidaten finden ließen.
Allerdings hätten katholische Gymnasiallehrer nicht dieselben
Schwierigkeiten, eine Anstellung in Preußen zu finden wie
Universitätsdozenten. Ein Anreiz könnte jedoch das höhere
Einstiegsgehalt in Österreich sein. Ficker will daher sofort an Bekannte
in Bonn und Münster schreiben und sich bei diesen erkundigen.
Anschließend erteilt Ficker Auskunft in einer zweiten von Thun
angesprochenen Angelegenheit, nämlich über die angeblichen
Ungereimtheiten bei der Lehramtsprüfung des Benediktinerpaters Raas.
Ficker versichert jedoch, dass Raas die Prüfung allein deshalb nicht
bestanden hatte, weil seine Kenntnisse hierzu nicht ausreichend waren
und nicht, wie kolportiert, ein Vorurteil Prof. Georg Schenachs
gegenüber Raas der entscheidende Grund gewesen sei. Zum Beweis fügt
Ficker einige Notizen über die betreffende Sitzung der
Prüfungskommission bei. Aus diesen gehe hervor, dass bereits die Frage
der Zulassung zur mündlichen Prüfung wegen formaler Fehler kontrovers
diskutiert worden war und er selbst damals für eine Nichtzulassung
plädierte. Nach der mündlichen Prüfung sprach sich der zuständige
Fachprüfer Prof. Malecki gegen eine Approbation aus, was von der
Mehrheit der Prüfer gebilligt wurde. Ficker versichert dem Minister
zudem, dass sich Prof. Schenach bei Prüfungen niemals von persönlichen
Leidenschaften habe leiten lassen.</p></msContents></msDesc></sourceDesc></fileDesc><revisionDesc docStatus="approved"/></teiHeader><text><body><div type="transcript"><index><term>Personalfragen</term><term>Gymnasien</term><term>Universität Innsbruck</term><term>Lehramtsprüfung</term></index><p>Innsbruck, 8. März 1855</p><p>Euer Excellenz!</p><p>In dem gnädigen Schreiben vom 4. dieses [sic!] Monats <note xml:id="note_1">Vgl.
<ref target="thun/thun-korrespondenz/thun-an-ficker_1855-02-04_CA180.xml">Leo
Thun an Julius Ficker. Wien, 4. Februar 1855.</ref></note> geruhten Euer
Excellenz mir die Anfrage zu stellen, ob ich glaube, daß sich in
<region>Rheinland</region> und <region>Westfalen</region> katholische
Kandidaten der Philologie finden würden, die befähigt und bereit seien, unter
angegebenen Bedingungen eine Stelle an einem österreichischen Gymnasium
anzunehmen.<lb/>Ich glaube diese Frage wohl bejahen zu dürfen. Allerdings finden
in <country key="preussen">Preußen</country> die katholischen Kandidaten des
Lehramts für die Gymnasien nicht dieselben Schwierigkeiten, die sich der
Anstellung katholischer Dozenten an den Universitäten entgegenstellen; ihre Zahl
ist nicht gar zu groß und sie können im allgemeinen auf baldige Anstellung nach
bestandenem Examen rechnen. Da jedoch ein Gehalt von 800 Gulden denjenigen
übersteigt, auf den sie für die erste Zeit in <country key="preussen">Preußen</country> zu hoffen haben, andererseits meine Landsleute den
Aufenthalt an den Gymnasien der Provinzen <country key="preussen">Preußen</country> und <region>Posen</region>, wo insbesondere viele
Westfalen angestellt werden, kaum einer Anstellung an einem österreichischen
Landgymnasium oder in einer entlegenern Stadt der Monarchie vorziehen würden, so
bezweifle ich kaum, daß es gelingen würde, auch befähigtere Kandidaten für eine
solche Stellung zu gewinnen. Ich glaube nun den Absichten Euer Excellenz am
besten zu entsprechen, wenn ich noch heute an verläßliche und urtheilsfähige mir
befreundete Professoren zu <placeName>Bonn</placeName> und zu
<placeName>Münster</placeName> schreibe, die mit den dortigen Verhältnissen
und Aussichten völlig vertraut genügende Auskunft werden geben können, ob
überhaupt auf eine Annahme dieser Bedingungen durch befähigte junge Philologen
zu rechnen sei, und vielleicht auch in der Lage wären, vorläufig auf den einen
oder andern aufmerksam machen zu können. Ich werde dann nicht verfehlen, Euer
Excellenz baldmöglichst vom Resultate dieser vorläufigen Anfragen in Kenntnis zu
setzen und werde mit Vergnügen alles thuen, was irgend dazu dienen kann, die
Absichten Euer Excellenz zu verwirklichen.<lb/>Daß ich die weitere Anfrage, die
Euer Excellenz mir zu stellen geruhten, mit gewissenhaftester Aufrichtigkeit
beantworten werde, darf ich wohl kaum versichern, da eine Unaufrichtigkeit in
diesem Falle nicht blos eine Verletzung meiner Pflicht als Staatsbeamter,
sondern auch ein Mißbrauch des gnädigen Vertrauens Euer Excellenz sein würde.
<lb/>Ob Professor <persName key="schenach-georg">Schenach</persName> oder irgend
ein anderes Mitglied der Kommission persönlich gegen den Herrn <persName key="raas-chrysostomos">Pater Raas</persName> eingenommen war, kann ich
nicht beurtheilen, wohl aber versichern, daß weder in den Kommissionssitzungen
etwas vorgefallen ist, was darauf hätte schließen lassen, noch mir anderweitig
etwas darüber bekannt geworden ist, weßhalb mich die Anfrage Euer Excellenz
höchlich überraschte. Das Einzige, was etwa, abgesehen von anderen mir
unbekannten Gründen, zu einer solchen Annahme hätte Anlaß geben können, wäre
meines Erachtens Folgendes:<lb/>Zugleich mit dem Herrn <persName key="raas-chrysostomos">Pater Raas</persName> machte der <persName key="orgler-flavian">Pater Orgler</persName> aus dem Orden des Heiligen
Franziskus die Prüfung für Geschichte und Geographie und bestand dieselbe zur
allgemeinsten Zufriedenheit. Bei dieser Gelegenheit wurden nun nebenbei vom
<persName key="schenach-georg">Prof. Schenach</persName> und andern
Mitgliedern in der Sitzung darüber gesprochen, daß abermals der Pater
Franziskaner eine sehr gute Prüfung bestanden habe, während Kandidaten von
<orgName key="stift-marienberg">Marienberg</orgName> sich auch schon früher
nicht ausgezeichnet hätten, und der Grund doch nicht lediglich darin gesucht
werden könne, daß dieselben nicht Gelegenheit zu Universitätsstudien gehabt
hätten, da die Franziskaner sich in derselben Lage befänden. Ich habe das für
eine durchaus gelegentliche Bemerkung gehalten; sollte man sie aber wirklich in
Folge anderer mir unbekannter Gründe als Ausfluß einer gehässigen Gesinnung
auffassen wollen, so glaube ich wenigstens versichern zu dürfen, daß die
Reprobazion des Herrn <persName key="raas-chrysostomos">Pater Raas</persName>
durch ein etwa vorhanden gewesenes Vorurtheil weder herbeigeführt wurde noch
herbeigeführt werden konnte, und erlaube mir zur Begründung einige Notizen über
die betreffenden Kommissionssitzungen hinzuzufügen.<lb/>Als es sich darum
handelte, ob der Herr Pater <persName key="raas-chrysostomos">Raas</persName>
auf Grund der schriftlichen Arbeiten zur mündlichen Prüfung zuzulassen sei,
erklärte der Fachexaminator <persName key="kopetzky-karl">Prof.
Kopetzky</persName>, daß der Inhalt der Antworten ihm allenfalls genüge, die
Zulassung zu beantragen, daß aber ein formeller Mangel vorliege, da die Fragen
angeblich aus Mangel an Zeit nicht vollständig beantwortet seien, und die
Kommission zu entscheiden habe, ob die Zulassung dennoch statthaft sei. Da die
Meinungen getheilt waren, schlug der gehorsamst Gefertigte vor, die
Klausurarbeiten wegen des formellen Defektes für ungültig zu erklären, aber auf
Grund neuer Klausurarbeiten über die Zulassung zu entschieden. Da sich dieses
nach dem Gesetze als unstatthaft erwies, trat er der auch von <persName key="schenach-georg">Prof. Schenach</persName> getheilten Meinung bei, daß
aus formellen Gründen die Zulassung nicht statthaft sei, weil Gefahr sei, daß,
wenn einmal angenommen werde, die vollständige Beantwortung der gestellten
Fragen in der festgesetzten Zeit sei nicht unumgänglich nöthig, künftig mit
Absicht die Kandidaten solche Fragen, die ihnen Schwierigkeiten böten, durch
desto ausführlichere Behandlung der anderen beseitigen würden. Bei der
Abstimmung wurde jedoch mit einer Stimme Majorität die Zulassung ausgesprochen.
<lb/>Was dann die schließliche Entscheidung nach abgelegter mündlicher Prüfung
betrifft, so hing diese damals, wie gewöhnlich, wesentlich vom Gutachten des
Fachexaminator ab, da es wohl in der Natur der Sache liegt, daß andere
Mitglieder der Ansicht desselben, so weit diese die wissenschaftliche Befähigung
betrifft, wohl füglich nur ausnahmsweise entgegentreten können. Nach diesem
Gutachten, und nachdem auch der Professor <persName key="malecki-antoni">Malecky</persName> mit Rücksicht auf die Leistungen des Herrn <persName key="raas-chrysostomos">Pater Raas</persName> bei der früher mit Erfolg
bestandenen Prüfung seine Meinung dahin ausgesprochen hatte, daß er ihn für das
Untergymnasium, nicht aber für das Obergymnasium auch im Lateinischen befähigt
halte, während sich Niemand für die Befähigung aussprach, – wurde, wenn ich mich
recht erinnere, mit Einhelligkeit, jedenfalls mit weit überwiegender Majorität
beschlossen, die Befähigung für das Obergymnasium nicht zu ertheilen; die
Befähigung für das Untergymnasium auszusprechen war nach dem Gesetze nicht
statthaft, es wurde aber, wenn ich nicht irre, beschlossen oder wenigstens
besprochen und stillschweigend genehmigt, dem Kandidaten in irgend einer Form zu
bedeuten, daß ihm die Befähigung für das Untergymnasium nicht verweigert worden
wäre, wenn von derselben überhaupt Rede gewesen wäre. Bei diesem ganzen Vorgange
konnte füglich kein Mitglied der Kommission auf die Reprobation entscheidend
einwirken, als der Fachexaminator; daß dieser keinerlei Vorurtheil hatte, bin
ich überzeugt, da er sowohl in der Kommission wie in Privatunterredungen große
Theilnahme für den Kandidaten zeigte.<lb/>Was die Schlußfrage Euer Excellenz
betrifft, ob ich es überhaupt für glaublich halte, daß <persName key="schenach-georg">Prof. Schenach</persName> sich bei Leitung der
Prüfungen durch Leidenschaftlichkeit bestimmen lasse, so glaube ich mit bestem
Gewissen darauf entschieden verneinend antworten zu dürfen; sein Vorgehen bei
den Prüfungen hat mir immer nur den Eindruck der strengsten Unparteilichkeit
gemacht und eine solche Annahme würde überhaupt mit der Besonnenheit, Offenheit
und Ehrenhaftigkeit seines Characters, die hier wohl allgemein anerkannt wird
und von der ich durch nähern Umgang mich zu überzeugen Gelegenheit hatte, schwer
vereinbar erscheinen.<lb/>Mit aufrichtigstem Danke für das gnädigst geschenkte
Zutrauen verbleibe ich</p><p>Euer Excellenz ganz gehorsamster und ergebenster<lb/>Dr. Ficker</p></div></body></text></TEI> | 108.664122 | 456 | 0.661468 |
ea5875fea27a6e44c7bc7e3bf1343cf60bec451a | 6,647 | xml | XML | pom.xml | MHuiG/WebSocketTemplate | 82462edf540e620b21bb5ea1636cffad3dfd8a22 | [
"MIT"
] | null | null | null | pom.xml | MHuiG/WebSocketTemplate | 82462edf540e620b21bb5ea1636cffad3dfd8a22 | [
"MIT"
] | null | null | null | pom.xml | MHuiG/WebSocketTemplate | 82462edf540e620b21bb5ea1636cffad3dfd8a22 | [
"MIT"
] | 1 | 2021-04-04T16:05:04.000Z | 2021-04-04T16:05:04.000Z | <?xml version="1.0" encoding="UTF-8"?>
<project xmlns="http://maven.apache.org/POM/4.0.0"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd">
<modelVersion>4.0.0</modelVersion>
<groupId>cn</groupId>
<artifactId>WebSocketTest</artifactId>
<version>1.0-SNAPSHOT</version>
<packaging>war</packaging>
<repositories>
<repository>
<id>cloudera</id>
<url>https://repository.cloudera.com/artifactory/cloudera-repos/</url>
</repository>
</repositories>
<dependencies>
<!-- WebSocket -->
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-websocket</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-messaging</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<!-- Spring -->
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-context</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-beans</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-webmvc</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-jdbc</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-aspects</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-jms</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<dependency>
<groupId>org.springframework</groupId>
<artifactId>spring-context-support</artifactId>
<version>4.2.4.RELEASE</version>
</dependency>
<!-- Mybatis -->
<dependency>
<groupId>org.mybatis</groupId>
<artifactId>mybatis</artifactId>
<version>3.2.8</version>
</dependency>
<dependency>
<groupId>org.mybatis</groupId>
<artifactId>mybatis-spring</artifactId>
<version>1.2.2</version>
</dependency>
<dependency>
<groupId>com.github.miemiedev</groupId>
<artifactId>mybatis-paginator</artifactId>
<version>1.2.15</version>
</dependency>
<!-- MySql -->
<dependency>
<groupId>mysql</groupId>
<artifactId>mysql-connector-java</artifactId>
<version>8.0.16</version>
</dependency>
<!-- 连接池 -->
<dependency>
<groupId>com.alibaba</groupId>
<artifactId>druid</artifactId>
<version>1.0.9</version>
</dependency>
<!-- JSP相关 -->
<dependency>
<groupId>jstl</groupId>
<artifactId>jstl</artifactId>
<version>1.2</version>
</dependency>
<dependency>
<groupId>javax.servlet</groupId>
<artifactId>servlet-api</artifactId>
<version>2.5</version>
<scope>provided</scope>
</dependency>
<dependency>
<groupId>javax.servlet</groupId>
<artifactId>jsp-api</artifactId>
<version>2.0</version>
<scope>provided</scope>
</dependency>
<dependency>
<groupId>com.fasterxml.jackson.core</groupId>
<artifactId>jackson-databind</artifactId>
<version>2.10.0.pr1</version>
</dependency>
<!-- https://mvnrepository.com/artifact/com.alibaba/fastjson -->
<dependency>
<groupId>com.alibaba</groupId>
<artifactId>fastjson</artifactId>
<version>1.2.41</version>
</dependency>
<!-- junit-->
<!-- https://mvnrepository.com/artifact/junit/junit -->
<dependency>
<groupId>junit</groupId>
<artifactId>junit</artifactId>
<version>4.11</version>
<scope>test</scope>
</dependency>
<dependency>
<groupId>org.testng</groupId>
<artifactId>testng</artifactId>
<version>RELEASE</version>
</dependency>
</dependencies>
<build>
<plugins>
<plugin>
<groupId>org.apache.maven.plugins</groupId>
<artifactId>maven-shade-plugin</artifactId>
<version>2.4.3</version>
<executions>
<execution>
<phase>package</phase>
<goals>
<goal>shade</goal>
</goals>
<configuration>
<minimizeJar>true</minimizeJar>
</configuration>
</execution>
</executions>
</plugin>
<!-- 配置Tomcat插件 -->
<plugin>
<groupId>org.apache.tomcat.maven</groupId>
<artifactId>tomcat7-maven-plugin</artifactId>
<version>2.2</version>
<configuration>
<path>/</path>
<port>8080</port>
</configuration>
</plugin>
</plugins>
<finalName>${project.artifactId}</finalName>
<resources>
<resource>
<directory>src/main/java</directory>
<includes>
<include>**/*.properties</include>
<include>**/*.xml</include>
</includes>
<filtering>false</filtering>
</resource>
<resource>
<directory>src/main/resources</directory>
<includes>
<include>**/*.properties</include>
<include>**/*.xml</include>
</includes>
<filtering>false</filtering>
</resource>
</resources>
</build>
</project> | 35.92973 | 108 | 0.513766 |
631f18ef602c64e01a4b20bc0785483298f87595 | 3,938 | ui | XML | Lab2/mainwindow.ui | alekseykondus/ooop-2020-2021-semester-1 | 4717ea3a58762009d7b8f185f87748a6787776a2 | [
"MIT"
] | null | null | null | Lab2/mainwindow.ui | alekseykondus/ooop-2020-2021-semester-1 | 4717ea3a58762009d7b8f185f87748a6787776a2 | [
"MIT"
] | null | null | null | Lab2/mainwindow.ui | alekseykondus/ooop-2020-2021-semester-1 | 4717ea3a58762009d7b8f185f87748a6787776a2 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<ui version="4.0">
<class>MainWindow</class>
<widget class="QMainWindow" name="MainWindow">
<property name="geometry">
<rect>
<x>0</x>
<y>0</y>
<width>924</width>
<height>447</height>
</rect>
</property>
<property name="sizePolicy">
<sizepolicy hsizetype="Preferred" vsizetype="Expanding">
<horstretch>0</horstretch>
<verstretch>0</verstretch>
</sizepolicy>
</property>
<property name="windowTitle">
<string>MainWindow</string>
</property>
<widget class="QWidget" name="centralwidget">
<layout class="QGridLayout" name="gridLayout">
<item row="0" column="0">
<spacer name="horizontalSpacer">
<property name="orientation">
<enum>Qt::Horizontal</enum>
</property>
<property name="sizeType">
<enum>QSizePolicy::Fixed</enum>
</property>
<property name="sizeHint" stdset="0">
<size>
<width>800</width>
<height>20</height>
</size>
</property>
</spacer>
</item>
<item row="1" column="1">
<layout class="QVBoxLayout" name="verticalLayout_2">
<property name="sizeConstraint">
<enum>QLayout::SetFixedSize</enum>
</property>
<item>
<widget class="QPushButton" name="new_task">
<property name="text">
<string>New task</string>
</property>
</widget>
</item>
<item>
<widget class="QListWidget" name="listWidget"/>
</item>
<item>
<widget class="QLabel" name="label">
<property name="text">
<string>History</string>
</property>
</widget>
</item>
<item>
<widget class="QListWidget" name="listWidget_2"/>
</item>
</layout>
</item>
<item row="1" column="0">
<widget class="QTabWidget" name="tbwNotation1">
<property name="sizePolicy">
<sizepolicy hsizetype="Expanding" vsizetype="Ignored">
<horstretch>0</horstretch>
<verstretch>0</verstretch>
</sizepolicy>
</property>
<property name="minimumSize">
<size>
<width>800</width>
<height>0</height>
</size>
</property>
<property name="currentIndex">
<number>0</number>
</property>
<widget class="QWidget" name="tab">
<attribute name="title">
<string>Notes</string>
</attribute>
<layout class="QGridLayout" name="gridLayout_2">
<item row="0" column="0">
<widget class="QTableWidget" name="tbwNotation_Notes">
<property name="enabled">
<bool>true</bool>
</property>
<property name="minimumSize">
<size>
<width>780</width>
<height>0</height>
</size>
</property>
<property name="sortingEnabled">
<bool>false</bool>
</property>
</widget>
</item>
</layout>
</widget>
<widget class="QWidget" name="tab_2">
<attribute name="title">
<string>Archive</string>
</attribute>
<layout class="QGridLayout" name="gridLayout_3">
<item row="0" column="0">
<widget class="QTableWidget" name="tbwNotation_Archive">
<property name="minimumSize">
<size>
<width>780</width>
<height>0</height>
</size>
</property>
<property name="sortingEnabled">
<bool>false</bool>
</property>
</widget>
</item>
</layout>
</widget>
</widget>
</item>
</layout>
</widget>
<widget class="QMenuBar" name="menubar">
<property name="geometry">
<rect>
<x>0</x>
<y>0</y>
<width>924</width>
<height>26</height>
</rect>
</property>
</widget>
<widget class="QStatusBar" name="statusbar"/>
</widget>
<resources/>
<connections/>
</ui>
| 26.972603 | 65 | 0.546216 |
632a6525cdc041ff6af35345c7b1a90c8b043a1c | 5,004 | xml | XML | meertens-song-collection-DH2019/train/186667.xml | vincentsarbachpulicani/Wilhelmus_project | 0078bb111a864843d0c0fdda663908759c6ba4c8 | [
"MIT"
] | null | null | null | meertens-song-collection-DH2019/train/186667.xml | vincentsarbachpulicani/Wilhelmus_project | 0078bb111a864843d0c0fdda663908759c6ba4c8 | [
"MIT"
] | 1 | 2021-12-14T17:03:15.000Z | 2021-12-14T17:03:15.000Z | meertens-song-collection-DH2019/train/186667.xml | vincentsarbachpulicani/Wilhelmus_project | 0078bb111a864843d0c0fdda663908759c6ba4c8 | [
"MIT"
] | 1 | 2021-12-14T16:52:37.000Z | 2021-12-14T16:52:37.000Z | <?xml version='1.0' encoding='utf-8' standalone='yes'?>
<song>
<meta>
<id>186667</id>
<date>
<year-start>1794</year-start>
<year-end>1794</year-end>
</date>
<location>
<orginal-name>dordrecht</orginal-name>
<standard-name>Dordrecht, The Netherlands</standard-name>
<coordinates>
<lon>51.7958812</lon>
<lat>4.6779351</lat>
</coordinates>
</location>
<tags/>
<melody>Wat raar geval, wat raar geval</melody>
<author>Gerrit Manheer</author></meta>
<text>
<lg type="song">
<lg id="s1" type="stanza">
<l id="s1:l1" met="4" type="-+">Hoor Rozemond, hoor <rhyme label="a" type="m">Rozemond</rhyme>,</l>
<l id="s1:l2" met="4" type="-+">Het maantje scheen, 't was <rhyme label="a" type="m" corresp="#s1:l1">avondstond</rhyme>,</l>
<l id="s1:l3" met="3" type="-+">Toen Dafnis aan kwam <rhyme label="b" type="f">roeijen</rhyme>,</l>
<l id="s1:l4" met="4" type="-+">Zy voer digt aan den kant, - den <rhyme label="c" type="m">kant</rhyme>,</l>
<l id="s1:l5" met="3" type="-+">En stapte vluch aan <rhyme label="c" type="m" corresp="#s1:l4">land</rhyme>.</l>
</lg>
<lg id="s2" type="stanza">
<l id="s2:l1" met="4" type="-+">Lubin zei zy, Lubin zei <rhyme label="a" type="m">zy</rhyme>,</l>
<l id="s2:l2" met="4" type="-+">Zie 't maantje schynt, kom wil met <rhyme label="a" type="m" corresp="#s2:l1">my</rhyme></l>
<l id="s2:l3" met="3" type="-+">Treên in myn aartig <rhyme label="b" type="f">schuitje</rhyme>.</l>
<l id="s2:l4" met="4" type="-+">Vaar met my door den stroom,- den <rhyme label="c" type="m">stroom</rhyme>,</l>
<l id="s2:l5" met="3" type="-+">Langs dezen groenen <rhyme label="c" type="m" corresp="#s2:l4">zoom</rhyme>.</l>
</lg>
<lg id="s3" type="stanza">
<l id="s3:l1" met="4" type="-+">Wat zoude ik doen? wat zoude ik <rhyme label="a" type="m">doen</rhyme>?</l>
<l id="s3:l2" met="4" type="-+">Zy lonkt my toe, schonk my een <rhyme label="a" type="m" corresp="#s3:l1">zoen</rhyme>,</l>
<l id="s3:l3" met="3" type="-+">Toen zonk ik in het <rhyme label="b" type="f">boodje</rhyme>,</l>
<l id="s3:l4" met="4" type="-+">Met roosjes opgetooid, - <rhyme label="c" type="m">getooid</rhyme>,</l>
<l id="s3:l5" met="3" type="-+">En mirteblaân <rhyme label="c" type="m" corresp="#s3:l4">bestrooid</rhyme>.</l>
</lg>
<lg id="s4" type="stanza">
<l id="s4:l1" met="4" type="-+">Het koeltje blies, het koeltje <rhyme label="a" type="m">blies</rhyme>,</l>
<l id="s4:l2" met="4" type="-+">Dus voeren wy, door lis ep <rhyme label="a" type="m" corresp="#s4:l1">bies</rhyme>,</l>
<l id="s4:l3" met="3" type="-+">Vast richten wy het <rhyme label="b" type="f">mastje</rhyme></l>
<l id="s4:l4" met="4" type="-+">In 't schuitjen op, en wy, - en <rhyme label="c" type="m">wy</rhyme>,</l>
<l id="s4:l5" met="3" type="-+">Laveerden tegen 't <rhyme label="c" type="m" corresp="#s4:l4">ty</rhyme>.</l>
</lg>
<lg id="s5" type="stanza">
<l id="s5:l1" met="4" type="-+">Het kabblend nat, het kabblend <rhyme label="a" type="m">nat</rhyme>,</l>
<l id="s5:l2" met="4" type="-+">Dat om de boot, by 't varen <rhyme label="a" type="m" corresp="#s5:l1">spatt'</rhyme>,</l>
<l id="s5:l3" met="3" type="-+">Kon Dafnis regt <rhyme label="b" type="f">vermaken</rhyme>:</l>
<l id="s5:l4" met="4" type="-+">Ik vierde 't schootje toen, - ja <rhyme label="c" type="m">toen</rhyme>,</l>
<l id="s5:l5" met="3" type="-+">Om meer en meer te <rhyme label="c" type="m" corresp="#s5:l4">spoên</rhyme>.</l>
</lg>
<lg id="s6" type="stanza">
<l id="s6:l1" met="4" type="-+">Dus zeilden wy, dus zeilden <rhyme label="a" type="m">wy</rhyme>;</l>
<l id="s6:l2" met="4" type="-+">Doch, zwaaiden 't roer, op 't laatst, aan <rhyme label="a" type="m" corresp="#s6:l1">ly</rhyme>,</l>
<l id="s6:l3" met="3" type="-+">Ik liet het mastje <rhyme label="b" type="f">vallen</rhyme>,</l>
<l id="s6:l4" met="4" type="-+">Een kus tot dank, daar mee, - daar <rhyme label="c" type="m">meê</rhyme>,</l>
<l id="s6:l5" met="3" type="-+">Was 't lieve lam te <rhyme label="c" type="m" corresp="#s6:l4">vreé</rhyme>.</l>
</lg>
<lg id="s7" type="stanza">
<l id="s7:l1" met="4" type="-+">Kom Rozemond, kom <rhyme label="a" type="m">Rozemond</rhyme>,</l>
<l id="s7:l2" met="4" type="-+">Vergun my ook zoo'n <rhyme label="a" type="m" corresp="#s7:l1">avondstond</rhyme>;</l>
<l id="s7:l3" met="3" type="-+">Last ons dus ook eens <rhyme label="b" type="f">varen</rhyme>,</l>
<l id="s7:l4" met="4" type="-+">'k Zal stuurman zyn, welaan, - <rhyme label="c" type="m">welaan</rhyme>,</l>
<l id="s7:l5" met="3" type="-+">'t Is immers lichte <rhyme label="c" type="m" corresp="#s7:l4">maan</rhyme>?</l>
</lg>
</lg>
</text>
</song>
| 67.621622 | 140 | 0.551159 |
5a3c14d1295da749ad4e5217a545514440c4bc1f | 548 | xml | XML | model/relations/AssociationRelationship_7a61a3d0-6758-4618-a6fb-1398521fab7e.xml | nfigay/archimagine | e4cd13a4536451605cd478cece8f9c6f47dda7da | [
"Apache-2.0"
] | 7 | 2017-06-16T08:08:59.000Z | 2021-01-14T00:21:05.000Z | model/relations/AssociationRelationship_7a61a3d0-6758-4618-a6fb-1398521fab7e.xml | nfigay/archimagine | e4cd13a4536451605cd478cece8f9c6f47dda7da | [
"Apache-2.0"
] | null | null | null | model/relations/AssociationRelationship_7a61a3d0-6758-4618-a6fb-1398521fab7e.xml | nfigay/archimagine | e4cd13a4536451605cd478cece8f9c6f47dda7da | [
"Apache-2.0"
] | 5 | 2018-02-19T17:11:07.000Z | 2020-06-25T01:08:16.000Z | <archimate:AssociationRelationship
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xmlns:archimate="http://www.archimatetool.com/archimate"
name="import"
id="7a61a3d0-6758-4618-a6fb-1398521fab7e">
<source
xsi:type="archimate:Product"
href="Product_1d2f8b33-b71e-4a7e-b426-1f1c2278e733.xml#1d2f8b33-b71e-4a7e-b426-1f1c2278e733"/>
<target
xsi:type="archimate:Product"
href="Product_c0c743a4-156d-4afe-b710-d3490fa0eb49.xml#c0c743a4-156d-4afe-b710-d3490fa0eb49"/>
</archimate:AssociationRelationship>
| 42.153846 | 100 | 0.75 |
c45e9808ecc3365e88662d1a810999d669809950 | 170 | xml | XML | .idea/dictionaries/harlem88.xml | UDOOboard/UDOOBluLib-android | 2f6a632e2e9975b64f92b102c74e80c22ecbff0d | [
"Apache-2.0"
] | 2 | 2017-04-06T09:29:03.000Z | 2017-05-11T08:41:33.000Z | .idea/dictionaries/harlem88.xml | UDOOboard/UDOOBluLib-android | 2f6a632e2e9975b64f92b102c74e80c22ecbff0d | [
"Apache-2.0"
] | null | null | null | .idea/dictionaries/harlem88.xml | UDOOboard/UDOOBluLib-android | 2f6a632e2e9975b64f92b102c74e80c22ecbff0d | [
"Apache-2.0"
] | 1 | 2020-07-30T01:04:48.000Z | 2020-07-30T01:04:48.000Z | <component name="ProjectDictionaryState">
<dictionary name="harlem88">
<words>
<w>bindable</w>
<w>cardview</w>
</words>
</dictionary>
</component> | 21.25 | 41 | 0.623529 |
d696f5b9e0f9b7c76393861f7ec670ceb2afcc9a | 476 | xml | XML | docs/api/toc/A8E716AC.xml | RotenInformatik/UtilitiesDotNet | 6bf145879060d38fc01b5634c3841eea91fdc926 | [
"Apache-2.0"
] | null | null | null | docs/api/toc/A8E716AC.xml | RotenInformatik/UtilitiesDotNet | 6bf145879060d38fc01b5634c3841eea91fdc926 | [
"Apache-2.0"
] | 33 | 2020-08-20T19:21:14.000Z | 2021-06-06T10:04:50.000Z | docs/api/toc/A8E716AC.xml | RotenInformatik/UtilitiesDotNet | 6bf145879060d38fc01b5634c3841eea91fdc926 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?><HelpTOCNode Title="RomanNumber Structure" Url="html/A8E716AC.htm"><HelpTOCNode Title="RomanNumber Constructor " Url="html/1CA15ABE.htm" /><HelpTOCNode Title="RomanNumber Properties" Url="html/F1FCE55F.htm" HasChildren="true" /><HelpTOCNode Title="RomanNumber Methods" Url="html/C16B471B.htm" HasChildren="true" /><HelpTOCNode Title="RomanNumber Operators and Type Conversions" Url="html/405392FE.htm" HasChildren="true" /></HelpTOCNode> | 476 | 476 | 0.77521 |
17fc79a3a43f4d8d290637450c925817477f849a | 10,474 | xml | XML | scripts/out_sonar/rules-jsp.xml | MSUSEL/msusel-patterns-experimenter | 95dffd2b5e797efc540317a30a11ed4414cc1b0d | [
"MIT"
] | null | null | null | scripts/out_sonar/rules-jsp.xml | MSUSEL/msusel-patterns-experimenter | 95dffd2b5e797efc540317a30a11ed4414cc1b0d | [
"MIT"
] | null | null | null | scripts/out_sonar/rules-jsp.xml | MSUSEL/msusel-patterns-experimenter | 95dffd2b5e797efc540317a30a11ed4414cc1b0d | [
"MIT"
] | 1 | 2018-10-03T10:09:13.000Z | 2018-10-03T10:09:13.000Z | <!--
The MIT License (MIT)
MSUSEL Arc Framework
Copyright (c) 2015-2019 Montana State University, Gianforte School of Computing,
Software Engineering Laboratory and Idaho State University, Informatics and
Computer Science, Empirical Software Engineering Laboratory
Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:
The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
SOFTWARE.
-->
<rules><!-- This file is auto-generated. -->
<rule key='JSP_INCLUDE' priority='CRITICAL'>
<name>Security - Dynamic JSP inclusion</name>
<configKey>JSP_INCLUDE</configKey>
<description><p>The inclusion of JSP file allow the entry of dynamic value. It may allow an attacker to control the JSP page included.
If this is the case, an attacker will try to include a file on disk that he controls. By including arbitrary files, the
attacker gets the ability to execute any code.
</p>
<p>
<b>Vulnerable Code:</b>
<pre>&lt;jsp:include page="${param.secret_param}" /&gt;</pre>
</p>
<p>
<b>Solution:</b>
<pre>&lt;c:if test="${param.secret_param == 'page1'}"&gt;
&lt;jsp:include page="page1.jsp" /&gt;
&lt;/c:if&gt;</pre>
</p>
<br/>
<p>
<b>References</b><br/>
<a href="http://resources.infosecinstitute.com/file-inclusion-attacks/">InfosecInstitute: File Inclusion Attacks</a><br/>
<a href="http://projects.webappsec.org/w/page/13246955/Remote%20File%20Inclusion">WASC-05: Remote File Inclusion</a><br/>
</p></description>
<tag>wasc</tag>
<tag>jsp</tag>
<tag>security</tag>
</rule>
<rule key='JSP_SPRING_EVAL' priority='CRITICAL'>
<name>Security - Dynamic variable in Spring expression</name>
<configKey>JSP_SPRING_EVAL</configKey>
<description><p>A Spring expression is built with a dynamic value. The source of the value(s) should be verified to avoid that unfiltered values fall into this risky code evaluation.
</p>
<p>
<b>Vulnerable Code:</b>
<pre>&lt;%@ taglib prefix="spring" uri="http://www.springframework.org/tags" %&gt;
&lt;spring:eval expression="${param.lang}" var="lang" /&gt;</pre>
<br>
<pre>&lt;%@ taglib prefix="spring" uri="http://www.springframework.org/tags" %&gt;
&lt;spring:eval expression="'${param.lang}'=='fr'" var="languageIsFrench" /&gt;</pre>
</p>
<p>
<b>Solution:</b>
<pre>&lt;c:set var="lang" value="${param.lang}"/&gt;</pre>
<br/>
<pre>&lt;c:set var="languageIsFrench" value="${param.lang == 'fr'}"/&gt;</pre>
</p>
<br/>
<p>
<b>References</b><br/>
<a href="http://cwe.mitre.org/data/definitions/94.html">CWE-94: Improper Control of Generation of Code ('Code Injection')</a><br/>
<a href="http://cwe.mitre.org/data/definitions/95.html">CWE-95: Improper Neutralization of Directives in Dynamically Evaluated Code ('Eval Injection')</a><br/>
</p></description>
<tag>owasp-a1</tag>
<tag>injection</tag>
<tag>cwe</tag>
<tag>jsp</tag>
<tag>security</tag>
</rule>
<rule key='JSP_JSTL_OUT' priority='MAJOR'>
<name>Security - Escaping of special XML characters is disabled</name>
<configKey>JSP_JSTL_OUT</configKey>
<description><p>A potential XSS was found. It could be used to execute unwanted JavaScript in a client's browser. (See references)
</p>
<p>
<b>Vulnerable Code:</b>
<pre>&lt;%@ taglib prefix="c" uri="http://java.sun.com/jsp/jstl/core" %&gt;
&lt;c:out value="${param.test_param}" escapeXml="false"/&gt;</pre>
</p>
<p>
<b>Solution:</b>
<pre>&lt;%@ taglib prefix="c" uri="http://java.sun.com/jsp/jstl/core" %&gt;
&lt;c:out value="${param.test_param}"/&gt;</pre>
</p>
<br/>
<p>
<b>References</b><br/>
<a href="http://projects.webappsec.org/w/page/13246920/Cross%20Site%20Scripting">WASC-8: Cross Site Scripting</a><br/>
<a href="https://www.owasp.org/index.php/XSS_%28Cross_Site_Scripting%29_Prevention_Cheat_Sheet">OWASP: XSS Prevention Cheat Sheet</a><br/>
<a href="https://www.owasp.org/index.php/Top_10_2013-A3-Cross-Site_Scripting_%28XSS%29">OWASP: Top 10 2013-A3: Cross-Site Scripting (XSS)</a><br/>
<a href="http://cwe.mitre.org/data/definitions/79.html">CWE-79: Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')</a><br/>
<a href="http://docs.oracle.com/javaee/5/jstl/1.1/docs/tlddocs/c/out.html">JSTL Javadoc: Out tag</a><br/>
</p></description>
<tag>owasp-a3</tag>
<tag>wasc</tag>
<tag>cwe</tag>
<tag>jsp</tag>
<tag>security</tag>
</rule>
<rule key='XSS_JSP_PRINT' priority='MAJOR'>
<name>Security - Potential XSS in JSP</name>
<configKey>XSS_JSP_PRINT</configKey>
<description><p>A potential XSS was found. It could be used to execute unwanted JavaScript in a client's browser. (See references)
</p>
<p>
<b>Vulnerable Code:</b>
<pre><%
String taintedInput = (String) request.getAttribute("input");
%>
[...]
&lt;%= taintedInput %&gt;</pre>
</p>
<p>
<b>Solution:</b>
<pre>
&lt;%
String taintedInput = (String) request.getAttribute("input");
%&gt;
[...]
&lt;%= Encode.forHtml(taintedInput) %&gt;
</pre>
</p>
<p>
The best defense against XSS is context sensitive output encoding like the example above. There are typically 4 contexts to consider:
HTML, JavaScript, CSS (styles), and URLs. Please follow the XSS protection rules defined in the OWASP XSS Prevention Cheat Sheet,
which explains these defenses in significant detail.
</p>
<br/>
<p>
<b>References</b><br/>
<a href="http://projects.webappsec.org/w/page/13246920/Cross%20Site%20Scripting">WASC-8: Cross Site Scripting</a><br/>
<a href="https://www.owasp.org/index.php/XSS_%28Cross_Site_Scripting%29_Prevention_Cheat_Sheet">OWASP: XSS Prevention Cheat Sheet</a><br/>
<a href="https://www.owasp.org/index.php/Top_10_2013-A3-Cross-Site_Scripting_%28XSS%29">OWASP: Top 10 2013-A3: Cross-Site Scripting (XSS)</a><br/>
<a href="http://cwe.mitre.org/data/definitions/79.html">CWE-79: Improper Neutralization of Input During Web Page Generation ('Cross-site Scripting')</a><br/>
<a href="https://code.google.com/p/owasp-java-encoder/">OWASP Java Encoder</a><br/>
</p></description>
<tag>owasp-a3</tag>
<tag>wasc</tag>
<tag>cwe</tag>
<tag>jsp</tag>
<tag>security</tag>
</rule>
<rule key='JSP_XSLT' priority='CRITICAL'>
<name>Security - A malicious XSLT could be provided</name>
<configKey>JSP_XSLT</configKey>
<description><p>
"XSLT (Extensible Stylesheet Language Transformations) is a language for transforming XML documents into other XML documents".<sup>[1]</sup><br/>
It is possible to attach malicious behavior to those stylesheets. Therefore, if an attacker can control the content or the source of the
stylesheet, he might be able to trigger remote code execution.<sup>[2]</sup>
</p>
<p>
<b>Code at risk:</b><br/>
<pre>
&#x3C;x:transform xml=&#x22;${xmlData}&#x22; xslt=&#x22;${xsltControlledByUser}&#x22; /&#x3E;
</pre>
</p>
<p>
<b>Solution:</b><br/>
<p>
The solution would be to make sure the stylesheet is loaded from a safe sources and make sure that vulnerabilities such as
Path traversal <sup>[3][4]</sup> are not possible.
</p>
<p>
<b>References</b><br/>
[1] <a href="https://en.wikipedia.org/wiki/XSLT">Wikipedia: XSLT (Extensible Stylesheet Language Transformations)</a><br/>
<a href="https://prezi.com/y_fuybfudgnd/offensive-xslt/">Offensive XSLT</a> by Nicolas Gregoire<br/>
[2] <a href="http://www.agarri.fr/kom/archives/2012/07/02/from_xslt_code_execution_to_meterpreter_shells/index.html">From XSLT code execution to Meterpreter shells</a> by Nicolas Gregoire<br/>
<a href="http://xhe.myxwiki.org/xwiki/bin/view/Main/">XSLT Hacking Encyclopedia</a> by Nicolas Gregoire<br/>
<a href="http://www.acunetix.com/blog/articles/the-hidden-dangers-of-xsltprocessor-remote-xsl-injection/">Acunetix.com : The hidden dangers of XSLTProcessor - Remote XSL injection</a><br/>
<a href="https://www.w3.org/TR/xslt">w3.org XSL Transformations (XSLT) Version 1.0</a> : w3c specification<br/>
[3] <a href="http://projects.webappsec.org/w/page/13246952/Path%20Traversal">WASC: Path Traversal</a><br/>
[4] <a href="https://www.owasp.org/index.php/Path_Traversal">OWASP: Path Traversal</a><br/>
</p></description>
<tag>owasp-a1</tag>
<tag>injection</tag>
<tag>owasp-a4</tag>
<tag>wasc</tag>
<tag>jsp</tag>
<tag>security</tag>
</rule>
</rules> | 51.596059 | 210 | 0.699351 |
64b8e14543289dd47f213f8a486c9d95ad495f28 | 12,960 | xml | XML | Lab2-1170300316/build.xml | RealTonyShaw/SoftwareConstructionLabs | d46e165540796f2c06fee478e37f12cf8072d12e | [
"MIT"
] | null | null | null | Lab2-1170300316/build.xml | RealTonyShaw/SoftwareConstructionLabs | d46e165540796f2c06fee478e37f12cf8072d12e | [
"MIT"
] | null | null | null | Lab2-1170300316/build.xml | RealTonyShaw/SoftwareConstructionLabs | d46e165540796f2c06fee478e37f12cf8072d12e | [
"MIT"
] | 2 | 2020-03-13T06:51:02.000Z | 2020-03-14T08:23:30.000Z | <?xml version="1.0" encoding="UTF-8" standalone="no"?>
<!-- WARNING: Eclipse auto-generated file.
Any modifications will be overwritten.
To include a user specific buildfile here, simply create one in the same
directory with the processing instruction <?eclipse.ant.import?>
as the first entry and export the buildfile again. --><project basedir="." default="build" name="Lab2-1170300316">
<property environment="env"/>
<property name="ECLIPSE_HOME" value="../../../../eclipse031-2018-12/Eclipse.app/Contents/Eclipse/"/>
<property name="junit.output.dir" value="junit"/>
<property name="debuglevel" value="source,lines,vars"/>
<property name="target" value="11"/>
<property name="source" value="11"/>
<path id="JUnit 5.libraryclasspath">
<pathelement location="../../../../.p2/pool/plugins/org.junit.jupiter.api_5.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.jupiter.engine_5.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.jupiter.migrationsupport_5.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.jupiter.params_5.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.platform.commons_1.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.platform.engine_1.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.platform.launcher_1.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.platform.runner_1.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.platform.suite.api_1.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit.vintage.engine_5.3.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.opentest4j_1.1.1.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.apiguardian_1.0.0.v20181005-1442.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.junit_4.12.0.v201504281640/junit.jar"/>
<pathelement location="../../../../.p2/pool/plugins/org.hamcrest.core_1.3.0.v20180420-1519.jar"/>
</path>
<path id="Lab2-1170300316.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<pathelement location="bin"/>
</path>
<path id="run.Menu.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.FriendshipGraphTest (2).classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.GraphStaticTest.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.GoGUI.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.ConcreteVerticesGraphTest.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.ChessGUI.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.Main (1).classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.ConcreteEdgesGraphTest.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.P1.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.GraphPoetTest.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.MyChessAndGoGame.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.test.P2.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.poet.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.graph.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.MyChessandGoGameTest.classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<path id="run.Main (2).classpath">
<path refid="JUnit 5.libraryclasspath"/>
<path refid="Lab2-1170300316.classpath"/>
</path>
<target name="init">
<mkdir dir="bin"/>
<copy includeemptydirs="false" todir="bin">
<fileset dir="src/P1">
<exclude name="**/*.launch"/>
<exclude name="**/*.java"/>
</fileset>
</copy>
<copy includeemptydirs="false" todir="bin">
<fileset dir="test/P1">
<exclude name="**/*.launch"/>
<exclude name="**/*.java"/>
</fileset>
</copy>
<copy includeemptydirs="false" todir="bin">
<fileset dir=".">
<exclude name="**/*.launch"/>
<exclude name="**/*.java"/>
<exclude name="src/P1/"/>
<exclude name="test/P1/"/>
</fileset>
</copy>
</target>
<target name="clean">
<delete dir="bin"/>
</target>
<target depends="clean" name="cleanall"/>
<target depends="build-subprojects,build-project" name="build"/>
<target name="build-subprojects"/>
<target depends="init" name="build-project">
<echo message="${ant.project.name}: ${ant.file}"/>
<javac debug="true" debuglevel="${debuglevel}" destdir="bin" includeantruntime="false" source="${source}" target="${target}">
<src path="src/P1"/>
<src path="test/P1"/>
<src path="."/>
<exclude name="src/P1/"/>
<exclude name="test/P1/"/>
<classpath refid="Lab2-1170300316.classpath"/>
</javac>
</target>
<target description="Build all projects which reference this project. Useful to propagate changes." name="build-refprojects"/>
<target description="copy Eclipse compiler jars to ant lib directory" name="init-eclipse-compiler">
<copy todir="${ant.library.dir}">
<fileset dir="${ECLIPSE_HOME}/plugins" includes="org.eclipse.jdt.core_*.jar"/>
</copy>
<unzip dest="${ant.library.dir}">
<patternset includes="jdtCompilerAdapter.jar"/>
<fileset dir="${ECLIPSE_HOME}/plugins" includes="org.eclipse.jdt.core_*.jar"/>
</unzip>
</target>
<target description="compile project with Eclipse compiler" name="build-eclipse-compiler">
<property name="build.compiler" value="org.eclipse.jdt.core.JDTCompilerAdapter"/>
<antcall target="build"/>
</target>
<target name="Menu">
<java classname="src.P3.Menu" failonerror="true" fork="yes">
<classpath refid="run.Menu.classpath"/>
</java>
</target>
<target name="FriendshipGraphTest (2)">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="test.P2.FriendshipGraphTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.FriendshipGraphTest (2).classpath"/>
</junit>
</target>
<target name="GraphStaticTest">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="graph.GraphStaticTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.GraphStaticTest.classpath"/>
</junit>
</target>
<target name="GoGUI">
<java classname="src.P3.GoGUI" failonerror="true" fork="yes">
<classpath refid="run.GoGUI.classpath"/>
</java>
</target>
<target name="ConcreteVerticesGraphTest">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="graph.ConcreteVerticesGraphTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.ConcreteVerticesGraphTest.classpath"/>
</junit>
</target>
<target name="ChessGUI">
<java classname="src.P3.ChessGUI" failonerror="true" fork="yes">
<classpath refid="run.ChessGUI.classpath"/>
</java>
</target>
<target name="Main (1)">
<java classname="poet.Main" failonerror="true" fork="yes">
<classpath refid="run.Main (1).classpath"/>
</java>
</target>
<target name="ConcreteEdgesGraphTest">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="graph.ConcreteEdgesGraphTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.ConcreteEdgesGraphTest.classpath"/>
</junit>
</target>
<target name="P1">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="graph.ConcreteEdgesGraphTest" todir="${junit.output.dir}"/>
<test name="graph.ConcreteVerticesGraphTest" todir="${junit.output.dir}"/>
<test name="graph.GraphStaticTest" todir="${junit.output.dir}"/>
<test name="poet.GraphPoetTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.P1.classpath"/>
</junit>
</target>
<target name="GraphPoetTest">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="poet.GraphPoetTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.GraphPoetTest.classpath"/>
</junit>
</target>
<target name="MyChessAndGoGame">
<java classname="src.P3.MyChessAndGoGame" failonerror="true" fork="yes">
<classpath refid="run.MyChessAndGoGame.classpath"/>
</java>
</target>
<target name="test.P2">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="test.P2.FriendshipGraphTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.test.P2.classpath"/>
</junit>
</target>
<target name="poet">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="poet.GraphPoetTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.poet.classpath"/>
</junit>
</target>
<target name="graph">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="graph.ConcreteEdgesGraphTest" todir="${junit.output.dir}"/>
<test name="graph.ConcreteVerticesGraphTest" todir="${junit.output.dir}"/>
<test name="graph.GraphStaticTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.graph.classpath"/>
</junit>
</target>
<target name="MyChessandGoGameTest">
<mkdir dir="${junit.output.dir}"/>
<junit fork="yes" printsummary="withOutAndErr">
<formatter type="xml"/>
<test name="test.P3.MyChessandGoGameTest" todir="${junit.output.dir}"/>
<jvmarg line="-ea"/>
<classpath refid="run.MyChessandGoGameTest.classpath"/>
</junit>
</target>
<target name="Main (2)">
<java classname="src.P2.Main" failonerror="true" fork="yes">
<classpath refid="run.Main (2).classpath"/>
</java>
</target>
<target name="junitreport">
<junitreport todir="${junit.output.dir}">
<fileset dir="${junit.output.dir}">
<include name="TEST-*.xml"/>
</fileset>
<report format="frames" todir="${junit.output.dir}"/>
</junitreport>
</target>
</project>
| 45.473684 | 133 | 0.590278 |
00ee1744c65a4aea9ef000fa4c65b205b775f810 | 23,962 | xml | XML | .idea/workspace.xml | ForrestHeiYing/Detectron | 787f5a9bf80b4149adb4913e86b2edd8a441bf09 | [
"Apache-2.0"
] | null | null | null | .idea/workspace.xml | ForrestHeiYing/Detectron | 787f5a9bf80b4149adb4913e86b2edd8a441bf09 | [
"Apache-2.0"
] | null | null | null | .idea/workspace.xml | ForrestHeiYing/Detectron | 787f5a9bf80b4149adb4913e86b2edd8a441bf09 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<project version="4">
<component name="ChangeListManager">
<list default="true" id="dd81dd99-7449-4d01-a4ad-4aa6013ae1c5" name="Default Changelist" comment="">
<change afterPath="$PROJECT_DIR$/configs/12_2017_baselines/e2e_mask_rcnn_R-50-FPN_1x (复件).yaml" afterDir="false" />
<change afterPath="$PROJECT_DIR$/tools/normal_test/__init__.py" afterDir="false" />
<change afterPath="$PROJECT_DIR$/tools/normal_test/class_test.py" afterDir="false" />
<change afterPath="$PROJECT_DIR$/tools/normal_test/globals_fun_test.py" afterDir="false" />
<change beforePath="$PROJECT_DIR$/detectron/core/config.py" beforeDir="false" afterPath="$PROJECT_DIR$/detectron/core/config.py" afterDir="false" />
<change beforePath="$PROJECT_DIR$/detectron/modeling/detector.py" beforeDir="false" afterPath="$PROJECT_DIR$/detectron/modeling/detector.py" afterDir="false" />
<change beforePath="$PROJECT_DIR$/detectron/modeling/model_builder.py" beforeDir="false" afterPath="$PROJECT_DIR$/detectron/modeling/model_builder.py" afterDir="false" />
<change beforePath="$PROJECT_DIR$/detectron/utils/train.py" beforeDir="false" afterPath="$PROJECT_DIR$/detectron/utils/train.py" afterDir="false" />
<change beforePath="$PROJECT_DIR$/tools/train_net.py" beforeDir="false" afterPath="$PROJECT_DIR$/tools/train_net.py" afterDir="false" />
</list>
<option name="EXCLUDED_CONVERTED_TO_IGNORED" value="true" />
<option name="SHOW_DIALOG" value="false" />
<option name="HIGHLIGHT_CONFLICTS" value="true" />
<option name="HIGHLIGHT_NON_ACTIVE_CHANGELIST" value="false" />
<option name="LAST_RESOLUTION" value="IGNORE" />
</component>
<component name="FUSProjectUsageTrigger">
<session id="-2136012435">
<usages-collector id="statistics.lifecycle.project">
<counts>
<entry key="project.open.time.0" value="1" />
<entry key="project.opened" value="1" />
</counts>
</usages-collector>
<usages-collector id="statistics.file.extensions.open">
<counts>
<entry key="py" value="20" />
<entry key="yaml" value="5" />
</counts>
</usages-collector>
<usages-collector id="statistics.file.types.open">
<counts>
<entry key="Python" value="20" />
<entry key="YAML" value="5" />
</counts>
</usages-collector>
<usages-collector id="statistics.file.extensions.edit">
<counts>
<entry key="py" value="944" />
</counts>
</usages-collector>
<usages-collector id="statistics.file.types.edit">
<counts>
<entry key="Python" value="944" />
</counts>
</usages-collector>
</session>
</component>
<component name="FileEditorManager">
<leaf>
<file pinned="false" current-in-tab="false">
<entry file="file://$PROJECT_DIR$/detectron/utils/train.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="402">
<caret line="146" column="32" selection-start-line="146" selection-start-column="26" selection-end-line="146" selection-end-column="32" />
<folding>
<element signature="e#979#1017#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="false">
<entry file="file://$PROJECT_DIR$/configs/12_2017_baselines/e2e_mask_rcnn_R-50-FPN_1x (复件).yaml">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="20">
<caret line="1" column="24" selection-start-line="1" selection-start-column="8" selection-end-line="1" selection-end-column="24" />
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="false">
<entry file="file://$PROJECT_DIR$/detectron/core/config.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="223">
<caret line="450" column="14" selection-start-line="450" selection-start-column="4" selection-end-line="450" selection-end-column="14" />
<folding>
<element signature="e#1616#1654#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="false">
<entry file="file://$USER_HOME$/detectron_mask/local/lib/python2.7/site-packages/caffe2/python/workspace.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="440">
<caret line="22" column="40" selection-start-line="22" selection-start-column="21" selection-end-line="22" selection-end-column="40" />
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="true">
<entry file="file://$PROJECT_DIR$/detectron/modeling/model_builder.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="237">
<caret line="73" column="28" lean-forward="true" selection-start-line="73" selection-start-column="28" selection-end-line="73" selection-end-column="28" />
<folding>
<element signature="e#1346#1384#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="false">
<entry file="file://$PROJECT_DIR$/detectron/modeling/detector.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="902">
<caret line="72" column="23" selection-start-line="72" selection-start-column="8" selection-end-line="72" selection-end-column="23" />
<folding>
<element signature="e#753#791#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="false">
<entry file="file://$PROJECT_DIR$/tools/normal_test/class_test.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="437">
<caret line="28" lean-forward="true" selection-start-line="28" selection-end-line="29" />
<folding>
<marker date="1568794679501" expanded="true" signature="340:548" ph="..." />
<marker date="1568794679501" expanded="true" signature="536:541" ph="..." />
</folding>
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="false">
<entry file="file://$PROJECT_DIR$/tools/normal_test/globals_fun_test.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="533">
<caret line="31" column="8" lean-forward="true" selection-start-line="31" selection-start-column="8" selection-end-line="31" selection-end-column="8" />
<folding>
<marker date="1568798817107" expanded="true" signature="269:312" ph="..." />
</folding>
</state>
</provider>
</entry>
</file>
<file pinned="false" current-in-tab="false">
<entry file="file://$USER_HOME$/detectron_mask/local/lib/python2.7/site-packages/caffe2/python/model_helper.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="100">
<caret line="101" column="29" selection-start-line="101" selection-start-column="29" selection-end-line="101" selection-end-column="29" />
<folding>
<element signature="e#61#99#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
</file>
</leaf>
</component>
<component name="FileTemplateManagerImpl">
<option name="RECENT_TEMPLATES">
<list>
<option value="Python Script" />
</list>
</option>
</component>
<component name="FindInProjectRecents">
<findStrings>
<find>MODEL</find>
<find>MAX_ITER</find>
<find>WEIGHTS</find>
<find>osp</find>
<find>start_iter</find>
<find>AUTO_RESUME</find>
<find>__C</find>
<find>opts</find>
<find>MEMONGER</find>
<find>MODEL.TYPE</find>
<find>only_build_forward_pass</find>
<find>model_type_func</find>
<find>weights_file</find>
<find>generalized_rcnn</find>
</findStrings>
</component>
<component name="Git.Settings">
<option name="RECENT_GIT_ROOT_PATH" value="$PROJECT_DIR$" />
</component>
<component name="IdeDocumentHistory">
<option name="CHANGED_PATHS">
<list>
<option value="$PROJECT_DIR$/detectron/core/config.py" />
<option value="$PROJECT_DIR$/tools/train_net.py" />
<option value="$PROJECT_DIR$/tools/normal_test/class_test.py" />
<option value="$PROJECT_DIR$/detectron/modeling/detector.py" />
<option value="$PROJECT_DIR$/detectron/utils/train.py" />
<option value="$PROJECT_DIR$/tools/normal_test/globals_fun_test.py" />
<option value="$PROJECT_DIR$/detectron/modeling/model_builder.py" />
</list>
</option>
</component>
<component name="ProjectFrameBounds" extendedState="6">
<option name="x" value="347" />
<option name="y" value="255" />
<option name="width" value="1539" />
<option name="height" value="937" />
</component>
<component name="ProjectView">
<navigator proportions="" version="1">
<foldersAlwaysOnTop value="true" />
</navigator>
<panes>
<pane id="Scope" />
<pane id="ProjectPane">
<subPane>
<expand>
<path>
<item name="Detectron" type="b2602c69:ProjectViewProjectNode" />
<item name="Detectron" type="462c0819:PsiDirectoryNode" />
</path>
<path>
<item name="Detectron" type="b2602c69:ProjectViewProjectNode" />
<item name="Detectron" type="462c0819:PsiDirectoryNode" />
<item name="configs" type="462c0819:PsiDirectoryNode" />
</path>
<path>
<item name="Detectron" type="b2602c69:ProjectViewProjectNode" />
<item name="Detectron" type="462c0819:PsiDirectoryNode" />
<item name="tools" type="462c0819:PsiDirectoryNode" />
</path>
<path>
<item name="Detectron" type="b2602c69:ProjectViewProjectNode" />
<item name="Detectron" type="462c0819:PsiDirectoryNode" />
<item name="tools" type="462c0819:PsiDirectoryNode" />
<item name="normal_test" type="462c0819:PsiDirectoryNode" />
</path>
</expand>
<select />
</subPane>
</pane>
</panes>
</component>
<component name="PropertiesComponent">
<property name="last_opened_file_path" value="$USER_HOME$/workspace_cuda8.0-cudnn6-recognize/dish_rec_inference" />
<property name="settings.editor.selected.configurable" value="com.jetbrains.python.configuration.PyActiveSdkModuleConfigurable" />
</component>
<component name="RecentsManager">
<key name="CopyFile.RECENT_KEYS">
<recent name="$PROJECT_DIR$/configs/12_2017_baselines" />
</key>
</component>
<component name="RunDashboard">
<option name="ruleStates">
<list>
<RuleState>
<option name="name" value="ConfigurationTypeDashboardGroupingRule" />
</RuleState>
<RuleState>
<option name="name" value="StatusDashboardGroupingRule" />
</RuleState>
</list>
</option>
</component>
<component name="RunManager">
<configuration name="globals_fun_test" type="PythonConfigurationType" factoryName="Python" temporary="true">
<module name="Detectron" />
<option name="INTERPRETER_OPTIONS" value="" />
<option name="PARENT_ENVS" value="true" />
<envs>
<env name="PYTHONUNBUFFERED" value="1" />
</envs>
<option name="SDK_HOME" value="" />
<option name="WORKING_DIRECTORY" value="$PROJECT_DIR$/tools/normal_test" />
<option name="IS_MODULE_SDK" value="true" />
<option name="ADD_CONTENT_ROOTS" value="true" />
<option name="ADD_SOURCE_ROOTS" value="true" />
<option name="SCRIPT_NAME" value="$PROJECT_DIR$/tools/normal_test/globals_fun_test.py" />
<option name="PARAMETERS" value="" />
<option name="SHOW_COMMAND_LINE" value="false" />
<option name="EMULATE_TERMINAL" value="false" />
<option name="MODULE_MODE" value="false" />
<option name="REDIRECT_INPUT" value="false" />
<option name="INPUT_FILE" value="" />
<method v="2" />
</configuration>
<recent_temporary>
<list>
<item itemvalue="Python.globals_fun_test" />
</list>
</recent_temporary>
</component>
<component name="SvnConfiguration">
<configuration />
</component>
<component name="TaskManager">
<task active="true" id="Default" summary="Default task">
<changelist id="dd81dd99-7449-4d01-a4ad-4aa6013ae1c5" name="Default Changelist" comment="" />
<created>1568602035367</created>
<option name="number" value="Default" />
<option name="presentableId" value="Default" />
<updated>1568602035367</updated>
</task>
<servers />
</component>
<component name="ToolWindowManager">
<frame x="65" y="-4" width="1855" height="1084" extended-state="6" />
<editor active="true" />
<layout>
<window_info id="Favorites" side_tool="true" />
<window_info content_ui="combo" id="Project" order="0" visible="true" weight="0.18157034" />
<window_info id="Structure" order="1" side_tool="true" weight="0.25" />
<window_info anchor="bottom" id="Version Control" />
<window_info anchor="bottom" id="Python Console" />
<window_info active="true" anchor="bottom" id="Terminal" visible="true" weight="0.1280683" />
<window_info anchor="bottom" id="Event Log" side_tool="true" />
<window_info anchor="bottom" id="Message" order="0" />
<window_info anchor="bottom" id="Find" order="1" />
<window_info anchor="bottom" id="Run" order="2" weight="0.30522946" />
<window_info anchor="bottom" id="Debug" order="3" weight="0.4" />
<window_info anchor="bottom" id="Cvs" order="4" weight="0.25" />
<window_info anchor="bottom" id="Inspection" order="5" weight="0.4" />
<window_info anchor="bottom" id="TODO" order="6" />
<window_info anchor="right" id="Commander" internal_type="SLIDING" order="0" type="SLIDING" weight="0.4" />
<window_info anchor="right" id="Ant Build" order="1" weight="0.25" />
<window_info anchor="right" content_ui="combo" id="Hierarchy" order="2" weight="0.25" />
</layout>
</component>
<component name="VcsContentAnnotationSettings">
<option name="myLimit" value="2678400000" />
</component>
<component name="XDebuggerManager">
<breakpoint-manager>
<breakpoints>
<line-breakpoint enabled="true" suspend="THREAD" type="python-line">
<url>file://$PROJECT_DIR$/detectron/core/config.py</url>
<line>39</line>
<option name="timeStamp" value="1" />
</line-breakpoint>
<line-breakpoint enabled="true" suspend="THREAD" type="python-line">
<url>file://$USER_HOME$/detectron_mask/local/lib/python2.7/site-packages/caffe2/python/model_helper.py</url>
<line>2</line>
<option name="timeStamp" value="2" />
</line-breakpoint>
</breakpoints>
</breakpoint-manager>
</component>
<component name="editorHistoryManager">
<entry file="file://$PROJECT_DIR$/detectron/roi_data/loader.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="4491">
<caret line="243" column="8" selection-start-line="243" selection-start-column="8" selection-end-line="243" selection-end-column="8" />
<folding>
<element signature="e#1691#1729#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/utils/training_stats.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="763">
<caret line="55" column="33" selection-start-line="55" selection-start-column="33" selection-end-line="55" selection-end-column="33" />
<folding>
<element signature="e#725#763#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/utils/logging.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="559">
<caret line="74" lean-forward="true" selection-start-line="74" selection-end-line="74" />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/utils/c2.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="559">
<caret line="157" lean-forward="true" selection-start-line="157" selection-end-line="157" />
<folding>
<element signature="e#721#759#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$USER_HOME$/detectron_mask/local/lib/python2.7/site-packages/caffe2/python/cnn.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="260">
<caret line="13" column="6" selection-start-line="13" selection-start-column="6" selection-end-line="13" selection-end-column="6" />
<folding>
<element signature="e#43#81#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/tools/train_net.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="332">
<caret line="113" column="51" selection-start-line="113" selection-start-column="40" selection-end-line="113" selection-end-column="51" />
<folding>
<element signature="e#733#771#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$USER_HOME$/detectron_mask/local/lib/python2.7/site-packages/caffe2/python/model_helper.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="100">
<caret line="101" column="29" selection-start-line="101" selection-start-column="29" selection-end-line="101" selection-end-column="29" />
<folding>
<element signature="e#61#99#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$USER_HOME$/detectron_mask/local/lib/python2.7/site-packages/caffe2/python/workspace.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="440">
<caret line="22" column="40" selection-start-line="22" selection-start-column="21" selection-end-line="22" selection-end-column="40" />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/configs/12_2017_baselines/e2e_mask_rcnn_R-50-FPN_1x.yaml">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="20">
<caret line="1" column="24" selection-start-line="1" selection-start-column="8" selection-end-line="1" selection-end-column="24" />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/core/config.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="223">
<caret line="450" column="14" selection-start-line="450" selection-start-column="4" selection-end-line="450" selection-end-column="14" />
<folding>
<element signature="e#1616#1654#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/modeling/name_compat.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="530">
<caret line="61" column="20" selection-start-line="61" selection-start-column="11" selection-end-line="61" selection-end-column="20" />
<folding>
<element signature="e#1485#1523#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/configs/12_2017_baselines/e2e_mask_rcnn_R-50-FPN_1x (复件).yaml">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="20">
<caret line="1" column="24" selection-start-line="1" selection-start-column="8" selection-end-line="1" selection-end-column="24" />
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/tools/normal_test/class_test.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="437">
<caret line="28" lean-forward="true" selection-start-line="28" selection-end-line="29" />
<folding>
<marker date="1568794679501" expanded="true" signature="340:548" ph="..." />
<marker date="1568794679501" expanded="true" signature="536:541" ph="..." />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/modeling/detector.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="902">
<caret line="72" column="23" selection-start-line="72" selection-start-column="8" selection-end-line="72" selection-end-column="23" />
<folding>
<element signature="e#753#791#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/tools/normal_test/globals_fun_test.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="533">
<caret line="31" column="8" lean-forward="true" selection-start-line="31" selection-start-column="8" selection-end-line="31" selection-end-column="8" />
<folding>
<marker date="1568798817107" expanded="true" signature="269:312" ph="..." />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/utils/train.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="402">
<caret line="146" column="32" selection-start-line="146" selection-start-column="26" selection-end-line="146" selection-end-column="32" />
<folding>
<element signature="e#979#1017#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
<entry file="file://$PROJECT_DIR$/detectron/modeling/model_builder.py">
<provider selected="true" editor-type-id="text-editor">
<state relative-caret-position="237">
<caret line="73" column="28" lean-forward="true" selection-start-line="73" selection-start-column="28" selection-end-line="73" selection-end-column="28" />
<folding>
<element signature="e#1346#1384#0" expanded="true" />
</folding>
</state>
</provider>
</entry>
</component>
</project> | 47.262327 | 176 | 0.614932 |
f64be47eca80daf96b85b58f172724961f481804 | 495 | xml | XML | evaluation_format/test_corpus/v0.9/event_mentions_extended/1/1_5ecbplus.xml | JianLiu91/eventrelation | 0a11fef738178bfb44f5573cf9b566aca4988d0c | [
"CC-BY-3.0"
] | 53 | 2017-06-03T00:32:50.000Z | 2022-03-17T22:56:31.000Z | evaluation_format/test_corpus/v0.9/event_mentions_extended/1/1_5ecbplus.xml | JianLiu91/eventrelation | 0a11fef738178bfb44f5573cf9b566aca4988d0c | [
"CC-BY-3.0"
] | 9 | 2017-09-18T02:40:45.000Z | 2021-07-12T14:35:39.000Z | evaluation_format/test_corpus/v0.9/event_mentions_extended/1/1_5ecbplus.xml | JianLiu91/eventrelation | 0a11fef738178bfb44f5573cf9b566aca4988d0c | [
"CC-BY-3.0"
] | 9 | 2019-01-03T15:20:37.000Z | 2022-01-05T16:01:46.000Z | 173 188 PRECONDITION
113 155 PRECONDITION
52_53 173 FALLING_ACTION
125 205 PRECONDITION
198 201 FALLING_ACTION
198 205 PRECONDITION
76 99_100 FALLING_ACTION
141 146 FALLING_ACTION
113 125 FALLING_ACTION
99_100 205 PRECONDITION
76 119 FALLING_ACTION
99_100 113 PRECONDITION
76 83 FALLING_ACTION
30_31 173 FALLING_ACTION
76 205 FALLING_ACTION
83 155 PRECONDITION
99_100 155 PRECONDITION
155 205 FALLING_ACTION
119 155 PRECONDITION
76 113 FALLING_ACTION
83 88 FALLING_ACTION
113 198 FALLING_ACTION
| 21.521739 | 24 | 0.866667 |
8716a2d2b36cd88d66a27391dcd0ce2b4f531647 | 897 | xml | XML | src/site/site.xml | darxriggs/jobConfigHistory-plugin | a195c77588905895b3f18e658306f104b1bfec26 | [
"MIT"
] | 34 | 2015-01-08T23:07:33.000Z | 2021-09-07T08:47:53.000Z | src/site/site.xml | jenkinsci/jobConfigHistory-plugin | a195c77588905895b3f18e658306f104b1bfec26 | [
"MIT"
] | 39 | 2015-03-27T13:42:51.000Z | 2021-12-16T01:16:48.000Z | src/site/site.xml | darxriggs/jobConfigHistory-plugin | a195c77588905895b3f18e658306f104b1bfec26 | [
"MIT"
] | 52 | 2015-03-18T18:24:25.000Z | 2021-07-12T09:34:32.000Z | <?xml version="1.0" encoding="UTF-8"?>
<project xmlns="project"
xsi:schemaLocation="project http://maven.apache.org/maven-navigation-1.0.xsd">
<publishDate format="MM-dd-yy HH:mm" />
<skin>
<groupId>org.kohsuke</groupId>
<artifactId>maven-skin</artifactId>
<version>1.1</version>
</skin>
<poweredBy>
<logo name="Jenkins" href="https://www.jenkins.io/"
img="https://get.jenkins.io/art/jenkins-logo/24x24/logo+title.png" />
<logo name="Maven" href="https://maven.apache.org/"
img="https://maven.apache.org/images/logos/maven-feather.png" />
</poweredBy>
<body>
<links>
<item name="Jenkins" href="https://www.jenkins.io/" />
<item name="Wiki" href="https://plugins.jenkins.io/jobConfigHistory/" />
</links>
<menu ref="reports" />
</body>
</project>
| 37.375 | 85 | 0.586399 |
72ce5f0781fb1d538d9a561ba63090bde1abf002 | 4,795 | xml | XML | en/CoreGraphics/CGPDFStream.xml | dmariogatto/apple-api-docs | c01080d73ad29c1124c6c5c0b13bfa11c4c08ce0 | [
"CC-BY-4.0",
"MIT"
] | 28 | 2019-05-10T03:23:56.000Z | 2022-02-24T04:04:29.000Z | en/CoreGraphics/CGPDFStream.xml | dmariogatto/apple-api-docs | c01080d73ad29c1124c6c5c0b13bfa11c4c08ce0 | [
"CC-BY-4.0",
"MIT"
] | 87 | 2019-04-06T22:42:13.000Z | 2022-03-21T00:04:35.000Z | en/CoreGraphics/CGPDFStream.xml | dmariogatto/apple-api-docs | c01080d73ad29c1124c6c5c0b13bfa11c4c08ce0 | [
"CC-BY-4.0",
"MIT"
] | 41 | 2019-05-10T18:34:41.000Z | 2021-12-15T20:52:24.000Z | <Type Name="CGPDFStream" FullName="CoreGraphics.CGPDFStream">
<TypeSignature Language="C#" Value="public class CGPDFStream : ObjCRuntime.INativeObject" />
<TypeSignature Language="ILAsm" Value=".class public auto ansi beforefieldinit CGPDFStream extends System.Object implements class ObjCRuntime.INativeObject" />
<TypeSignature Language="DocId" Value="T:CoreGraphics.CGPDFStream" />
<TypeSignature Language="F#" Value="type CGPDFStream = class
 interface INativeObject" />
<AssemblyInfo>
<AssemblyName>Xamarin.iOS</AssemblyName>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<AssemblyInfo>
<AssemblyName>Xamarin.Mac</AssemblyName>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<Base>
<BaseTypeName>System.Object</BaseTypeName>
</Base>
<Interfaces>
<Interface>
<InterfaceName>ObjCRuntime.INativeObject</InterfaceName>
</Interface>
</Interfaces>
<Docs>
<summary>A PDF Stream.</summary>
<remarks>To be added.</remarks>
</Docs>
<Members>
<Member MemberName="Dictionary">
<MemberSignature Language="C#" Value="public CoreGraphics.CGPDFDictionary Dictionary { get; }" />
<MemberSignature Language="ILAsm" Value=".property instance class CoreGraphics.CGPDFDictionary Dictionary" />
<MemberSignature Language="DocId" Value="P:CoreGraphics.CGPDFStream.Dictionary" />
<MemberSignature Language="F#" Value="member this.Dictionary : CoreGraphics.CGPDFDictionary" Usage="CoreGraphics.CGPDFStream.Dictionary" />
<MemberType>Property</MemberType>
<AssemblyInfo>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
<AssemblyName>Xamarin.iOS</AssemblyName>
</AssemblyInfo>
<AssemblyInfo>
<AssemblyName>Xamarin.Mac</AssemblyName>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>CoreGraphics.CGPDFDictionary</ReturnType>
</ReturnValue>
<Docs>
<summary>The dictionary associated with the PDF stream.</summary>
<value>To be added.</value>
<remarks>To be added.</remarks>
</Docs>
</Member>
<Member MemberName="GetData">
<MemberSignature Language="C#" Value="public Foundation.NSData GetData (out CoreGraphics.CGPDFDataFormat format);" />
<MemberSignature Language="ILAsm" Value=".method public hidebysig instance class Foundation.NSData GetData([out] valuetype CoreGraphics.CGPDFDataFormat& format) cil managed" />
<MemberSignature Language="DocId" Value="M:CoreGraphics.CGPDFStream.GetData(CoreGraphics.CGPDFDataFormat@)" />
<MemberSignature Language="F#" Value="member this.GetData : -> Foundation.NSData" Usage="cGPDFStream.GetData format" />
<MemberType>Method</MemberType>
<AssemblyInfo>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
<AssemblyName>Xamarin.iOS</AssemblyName>
</AssemblyInfo>
<AssemblyInfo>
<AssemblyName>Xamarin.Mac</AssemblyName>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>Foundation.NSData</ReturnType>
</ReturnValue>
<Parameters>
<Parameter Name="format" Type="CoreGraphics.CGPDFDataFormat" RefType="out" />
</Parameters>
<Docs>
<param name="format">To be added.</param>
<summary>The data associated with the PDF stream, and also returns the file format of the data.</summary>
<returns>To be added.</returns>
<remarks>To be added.</remarks>
</Docs>
</Member>
<Member MemberName="Handle">
<MemberSignature Language="C#" Value="public IntPtr Handle { get; }" />
<MemberSignature Language="ILAsm" Value=".property instance native int Handle" />
<MemberSignature Language="DocId" Value="P:CoreGraphics.CGPDFStream.Handle" />
<MemberSignature Language="F#" Value="member this.Handle : nativeint" Usage="CoreGraphics.CGPDFStream.Handle" />
<MemberType>Property</MemberType>
<Implements>
<InterfaceMember>P:ObjCRuntime.INativeObject.Handle</InterfaceMember>
</Implements>
<AssemblyInfo>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
<AssemblyName>Xamarin.iOS</AssemblyName>
</AssemblyInfo>
<AssemblyInfo>
<AssemblyName>Xamarin.Mac</AssemblyName>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.IntPtr</ReturnType>
</ReturnValue>
<Docs>
<summary>Handle (pointer) to the unmanaged object representation.</summary>
<value>A pointer</value>
<remarks>This IntPtr is a handle to the underlying unmanaged representation for this object.</remarks>
</Docs>
</Member>
</Members>
</Type>
| 45.666667 | 186 | 0.691345 |
0dcc79077eb69af25d4143a977058ec9eccb697c | 8,007 | csproj | XML | src/Afluistic/Afluistic.csproj | handcraftsman/Afluistic | fbb01643e2f5d33f74dd2f3f37697392e8899d88 | [
"MIT"
] | null | null | null | src/Afluistic/Afluistic.csproj | handcraftsman/Afluistic | fbb01643e2f5d33f74dd2f3f37697392e8899d88 | [
"MIT"
] | null | null | null | src/Afluistic/Afluistic.csproj | handcraftsman/Afluistic | fbb01643e2f5d33f74dd2f3f37697392e8899d88 | [
"MIT"
] | 2 | 2015-12-30T01:48:15.000Z | 2021-09-29T10:26:39.000Z | <?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="3.5" DefaultTargets="Build" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<PropertyGroup>
<Configuration Condition=" '$(Configuration)' == '' ">Debug</Configuration>
<Platform Condition=" '$(Platform)' == '' ">AnyCPU</Platform>
<ProductVersion>9.0.30729</ProductVersion>
<SchemaVersion>2.0</SchemaVersion>
<ProjectGuid>{B422DA8D-FEB4-4598-89D7-0F02B795BCE0}</ProjectGuid>
<OutputType>Exe</OutputType>
<AppDesignerFolder>Properties</AppDesignerFolder>
<RootNamespace>Afluistic</RootNamespace>
<AssemblyName>Afluistic</AssemblyName>
<TargetFrameworkVersion>v3.5</TargetFrameworkVersion>
<FileAlignment>512</FileAlignment>
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
<DebugSymbols>true</DebugSymbols>
<DebugType>full</DebugType>
<Optimize>false</Optimize>
<OutputPath>bin\Debug\</OutputPath>
<DefineConstants>DEBUG;TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Release|AnyCPU' ">
<DebugType>pdbonly</DebugType>
<Optimize>true</Optimize>
<OutputPath>bin\Release\</OutputPath>
<DefineConstants>TRACE</DefineConstants>
<ErrorReport>prompt</ErrorReport>
<WarningLevel>4</WarningLevel>
</PropertyGroup>
<ItemGroup>
<Reference Include="Newtonsoft.Json, Version=4.5.0.0, Culture=neutral, PublicKeyToken=30ad4fe6b2a6aeed, processorArchitecture=MSIL">
<SpecificVersion>False</SpecificVersion>
<HintPath>..\..\lib\JsonNet\Newtonsoft.Json.dll</HintPath>
</Reference>
<Reference Include="QIFGet, Version=1.0.0.0, Culture=neutral, processorArchitecture=MSIL">
<SpecificVersion>False</SpecificVersion>
<HintPath>..\..\lib\QifGet\QIFGet.dll</HintPath>
</Reference>
<Reference Include="StructureMap, Version=2.5.3.0, Culture=neutral, PublicKeyToken=e60ad81abae3c223, processorArchitecture=MSIL">
<SpecificVersion>False</SpecificVersion>
<HintPath>..\..\lib\StructureMap\StructureMap.dll</HintPath>
</Reference>
<Reference Include="System" />
<Reference Include="System.Core">
<RequiredTargetFramework>3.5</RequiredTargetFramework>
</Reference>
<Reference Include="System.Xml.Linq">
<RequiredTargetFramework>3.5</RequiredTargetFramework>
</Reference>
<Reference Include="System.Data.DataSetExtensions">
<RequiredTargetFramework>3.5</RequiredTargetFramework>
</Reference>
<Reference Include="System.Data" />
<Reference Include="System.Xml" />
</ItemGroup>
<ItemGroup>
<Compile Include="CommandHandler.cs" />
<Compile Include="Commands\AddAccountType.cs" />
<Compile Include="Commands\ArgumentChecks\IsTheIndexOfAnExistingAccount.cs" />
<Compile Include="Commands\ArgumentChecks\IsATaxabilityTypeKey.cs" />
<Compile Include="Commands\ArgumentChecks\IsTheIndexOfAnExistingAccountType.cs" />
<Compile Include="Commands\ArgumentChecks\IsTheNameOfAnExistingAccount.cs" />
<Compile Include="Commands\ArgumentChecks\IsTheNameOfAnExistingAccountType.cs" />
<Compile Include="Commands\ArgumentChecks\IsTheNameOfAnExistingTaxReportingCategory.cs" />
<Compile Include="Commands\ArgumentChecks\Logic\IArgumentLogicModifier.cs" />
<Compile Include="Commands\ArgumentChecks\Logic\MatchesAllOf.cs" />
<Compile Include="Commands\ArgumentChecks\Logic\MatchesAnyOf.cs" />
<Compile Include="Commands\ArgumentChecks\Logic\MatchesNoneOf.cs" />
<Compile Include="Commands\ArgumentChecks\VerifyThatArgument.cs" />
<Compile Include="Commands\ArgumentChecks\IArgumentValidator.cs" />
<Compile Include="Commands\ArgumentChecks\IsAFilePath.cs" />
<Compile Include="Commands\ChangeAccountTypeTaxabilityType.cs" />
<Compile Include="Commands\ChangeAccountTypeName.cs" />
<Compile Include="Commands\AddAccount.cs" />
<Compile Include="Commands\ChangeAccountName.cs" />
<Compile Include="Commands\ChangeAccountType.cs" />
<Compile Include="Commands\AddTaxReportingCategory.cs" />
<Compile Include="Commands\ChangeName.cs" />
<Compile Include="Commands\Prerequisites\RequireSelectedAccount.cs" />
<Compile Include="Commands\SelectAccount.cs" />
<Compile Include="Commands\ListTaxReportingCategories.cs" />
<Compile Include="Commands\DeleteAccount.cs" />
<Compile Include="Commands\PostConditions\IChangeApplicationSettings.cs" />
<Compile Include="Commands\PostConditions\IChangeStatement.cs" />
<Compile Include="Commands\Prerequisites\RequireTaxReportingCategoriesExist.cs" />
<Compile Include="Commands\ShowAccountType.cs" />
<Compile Include="Commands\ListAccountTypes.cs" />
<Compile Include="Commands\ExecutionArguments.cs" />
<Compile Include="Commands\Prerequisites\IPrerequisite.cs" />
<Compile Include="Commands\Prerequisites\PrerequisiteChecker.cs" />
<Compile Include="Commands\Prerequisites\RequireAccountTypesExist.cs" />
<Compile Include="Commands\Prerequisites\RequireActiveAccountsExist.cs" />
<Compile Include="Commands\Prerequisites\RequireAtLeastNArgs.cs" />
<Compile Include="Commands\ListAccounts.cs" />
<Compile Include="Commands\ICommand.cs" />
<Compile Include="Commands\Init.cs" />
<Compile Include="Commands\Prerequisites\RequireApplicationSettingsAlreadyInitialized.cs" />
<Compile Include="Commands\Prerequisites\RequireApplicationSettings.cs" />
<Compile Include="Commands\Prerequisites\RequireAtMostNArgs.cs" />
<Compile Include="Commands\Prerequisites\RequireExactlyNArgs.cs" />
<Compile Include="Commands\Prerequisites\RequireStatement.cs" />
<Compile Include="Commands\ShowSettings.cs" />
<Compile Include="Constants.cs" />
<Compile Include="Domain\Account.cs" />
<Compile Include="Domain\AccountType.cs" />
<Compile Include="Domain\CommandHistory.cs" />
<Compile Include="Domain\NamedConstants\TaxabilityType.cs" />
<Compile Include="Domain\NamedConstants\TransactionDetailType.cs" />
<Compile Include="Domain\Statement.cs" />
<Compile Include="Domain\TaxReportingCategory.cs" />
<Compile Include="Domain\TransactionType.cs" />
<Compile Include="Extensions\CommandExtensions.cs" />
<Compile Include="Extensions\IEnumerableTExtensions.cs" />
<Compile Include="Extensions\PropertyInfoExtensions.cs" />
<Compile Include="Extensions\StringExtensions.cs" />
<Compile Include="Extensions\TypeExtensions.cs" />
<Compile Include="IndexedItem.cs" />
<Compile Include="IoC.cs" />
<Compile Include="MvbaCore\Extensions\IEnumerableExtensions.cs" />
<Compile Include="MvbaCore\Notification.cs" />
<Compile Include="MvbaCore\NotificationMessage.cs" />
<Compile Include="MvbaCore\NotificationSeverity.cs" />
<Compile Include="MvbaCore\Reflection.cs" />
<Compile Include="Program.cs" />
<Compile Include="Properties\AssemblyInfo.cs" />
<Compile Include="Services\ApplicationSettingsService.cs" />
<Compile Include="Services\FileSystemService.cs" />
<Compile Include="Services\JsonSerializer.cs" />
<Compile Include="Services\NamedConstantJsonConverter.cs" />
<Compile Include="Services\SerializationService.cs" />
<Compile Include="Domain\ApplicationSettings.cs" />
<Compile Include="Services\StorageService.cs" />
<Compile Include="Services\SystemService.cs" />
<Compile Include="UIDescriptionAttribute.cs" />
</ItemGroup>
<ItemGroup>
<Content Include="MvbaCore\provenance.txt" />
</ItemGroup>
<Import Project="$(MSBuildToolsPath)\Microsoft.CSharp.targets" />
<!-- To modify your build process, add your task inside one of the targets below and uncomment it.
Other similar extension points exist, see Microsoft.Common.targets.
<Target Name="BeforeBuild">
</Target>
<Target Name="AfterBuild">
</Target>
-->
</Project> | 53.38 | 136 | 0.738354 |
fce50a73a837679e90ff6f2ad076877526a29d53 | 11,928 | xib | XML | MMMoviePlayer/MoviePlayerView.xib | mminami/MMMoviePlayer | dc82e3dd1361c0cfa1b4ff915e0cb49522565ab3 | [
"MIT"
] | null | null | null | MMMoviePlayer/MoviePlayerView.xib | mminami/MMMoviePlayer | dc82e3dd1361c0cfa1b4ff915e0cb49522565ab3 | [
"MIT"
] | null | null | null | MMMoviePlayer/MoviePlayerView.xib | mminami/MMMoviePlayer | dc82e3dd1361c0cfa1b4ff915e0cb49522565ab3 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<document type="com.apple.InterfaceBuilder3.CocoaTouch.XIB" version="3.0" toolsVersion="13196" targetRuntime="iOS.CocoaTouch" propertyAccessControl="none" useAutolayout="YES" useTraitCollections="YES" useSafeAreas="YES" colorMatched="YES">
<device id="retina4_7" orientation="portrait">
<adaptation id="fullscreen"/>
</device>
<dependencies>
<deployment identifier="iOS"/>
<plugIn identifier="com.apple.InterfaceBuilder.IBCocoaTouchPlugin" version="13173"/>
<capability name="Safe area layout guides" minToolsVersion="9.0"/>
<capability name="documents saved in the Xcode 8 format" minToolsVersion="8.0"/>
</dependencies>
<objects>
<placeholder placeholderIdentifier="IBFilesOwner" id="-1" userLabel="File's Owner" customClass="MoviePlayerView" customModule="Demo" customModuleProvider="target">
<connections>
<outlet property="backwardButton" destination="NmZ-sL-KH3" id="Zek-UF-ujj"/>
<outlet property="contentView" destination="7eY-JP-L56" id="sra-Og-heh"/>
<outlet property="controlView" destination="6mP-f1-emf" id="Wfd-oE-ZEW"/>
<outlet property="durationTimeLabel" destination="xm2-MI-2Zd" id="w2i-Ti-cU0"/>
<outlet property="forwardButton" destination="esU-sA-12g" id="LOG-zF-JTZ"/>
<outlet property="playButton" destination="syO-lt-MMc" id="4G5-i6-gA1"/>
<outlet property="playerView" destination="GIk-0l-f4w" id="4oz-vy-uJe"/>
<outlet property="progressTimeLabel" destination="aYR-dt-2oS" id="7CA-WK-p1K"/>
<outlet property="slashLabel" destination="i7V-S2-BXz" id="nLd-zy-Yij"/>
<outlet property="slider" destination="LXj-tz-Pgn" id="YK3-fP-GIG"/>
</connections>
</placeholder>
<placeholder placeholderIdentifier="IBFirstResponder" id="-2" customClass="UIResponder"/>
<view contentMode="scaleToFill" id="7eY-JP-L56">
<rect key="frame" x="0.0" y="0.0" width="325" height="236"/>
<autoresizingMask key="autoresizingMask" flexibleMaxX="YES" flexibleMaxY="YES"/>
<subviews>
<view contentMode="scaleToFill" translatesAutoresizingMaskIntoConstraints="NO" id="GIk-0l-f4w" customClass="PlayerView" customModule="Demo" customModuleProvider="target">
<rect key="frame" x="0.0" y="0.0" width="325" height="236"/>
<color key="backgroundColor" white="1" alpha="1" colorSpace="custom" customColorSpace="genericGamma22GrayColorSpace"/>
</view>
<view contentMode="scaleToFill" translatesAutoresizingMaskIntoConstraints="NO" id="6mP-f1-emf">
<rect key="frame" x="0.0" y="0.0" width="325" height="236"/>
<subviews>
<button opaque="NO" contentMode="scaleToFill" contentHorizontalAlignment="center" contentVerticalAlignment="center" buttonType="roundedRect" lineBreakMode="middleTruncation" translatesAutoresizingMaskIntoConstraints="NO" id="syO-lt-MMc">
<rect key="frame" x="147" y="103" width="31" height="30"/>
<state key="normal" title="再生"/>
<connections>
<action selector="playButtonDidTap:" destination="-1" eventType="touchUpInside" id="oJd-aY-Ygm"/>
</connections>
</button>
<slider opaque="NO" contentMode="scaleToFill" contentHorizontalAlignment="center" contentVerticalAlignment="center" value="0.5" minValue="0.0" maxValue="1" translatesAutoresizingMaskIntoConstraints="NO" id="LXj-tz-Pgn">
<rect key="frame" x="187.5" y="198" width="119.5" height="31"/>
</slider>
<label opaque="NO" userInteractionEnabled="NO" contentMode="left" horizontalHuggingPriority="251" verticalHuggingPriority="251" text="00:00:00" textAlignment="center" lineBreakMode="tailTruncation" baselineAdjustment="alignBaselines" minimumScaleFactor="0.5" translatesAutoresizingMaskIntoConstraints="NO" id="aYR-dt-2oS">
<rect key="frame" x="20" y="202.5" width="75" height="21"/>
<constraints>
<constraint firstAttribute="width" constant="75" id="2aQ-oZ-efJ"/>
</constraints>
<fontDescription key="fontDescription" type="system" pointSize="17"/>
<nil key="textColor"/>
<nil key="highlightedColor"/>
</label>
<label opaque="NO" userInteractionEnabled="NO" contentMode="left" horizontalHuggingPriority="251" verticalHuggingPriority="251" text="00:00:00" textAlignment="center" lineBreakMode="tailTruncation" baselineAdjustment="alignBaselines" minimumScaleFactor="0.5" translatesAutoresizingMaskIntoConstraints="NO" id="xm2-MI-2Zd">
<rect key="frame" x="104.5" y="203" width="75" height="21"/>
<fontDescription key="fontDescription" type="system" pointSize="17"/>
<nil key="textColor"/>
<nil key="highlightedColor"/>
</label>
<label opaque="NO" userInteractionEnabled="NO" contentMode="left" horizontalHuggingPriority="251" verticalHuggingPriority="251" text="/" textAlignment="natural" lineBreakMode="tailTruncation" baselineAdjustment="alignBaselines" adjustsFontSizeToFit="NO" translatesAutoresizingMaskIntoConstraints="NO" id="i7V-S2-BXz">
<rect key="frame" x="97" y="203" width="5.5" height="21"/>
<fontDescription key="fontDescription" type="system" pointSize="17"/>
<nil key="textColor"/>
<nil key="highlightedColor"/>
</label>
<button opaque="NO" contentMode="scaleToFill" contentHorizontalAlignment="center" contentVerticalAlignment="center" buttonType="roundedRect" lineBreakMode="middleTruncation" translatesAutoresizingMaskIntoConstraints="NO" id="esU-sA-12g">
<rect key="frame" x="193" y="103" width="33" height="30"/>
<state key="normal" title="10->"/>
<connections>
<action selector="didTapForwardButton:" destination="-1" eventType="touchUpInside" id="7QG-zR-zSo"/>
</connections>
</button>
<button opaque="NO" contentMode="scaleToFill" contentHorizontalAlignment="center" contentVerticalAlignment="center" buttonType="roundedRect" lineBreakMode="middleTruncation" translatesAutoresizingMaskIntoConstraints="NO" id="NmZ-sL-KH3">
<rect key="frame" x="99" y="103" width="33" height="30"/>
<state key="normal" title="<-10"/>
<connections>
<action selector="didTapBackwardButton:" destination="-1" eventType="touchUpInside" id="kAH-mD-zMX"/>
</connections>
</button>
</subviews>
<color key="backgroundColor" white="1" alpha="1" colorSpace="custom" customColorSpace="genericGamma22GrayColorSpace"/>
<constraints>
<constraint firstItem="esU-sA-12g" firstAttribute="leading" secondItem="syO-lt-MMc" secondAttribute="trailing" constant="15" id="64J-1p-985"/>
<constraint firstItem="i7V-S2-BXz" firstAttribute="leading" secondItem="aYR-dt-2oS" secondAttribute="trailing" constant="2" id="9Q8-YK-v6j"/>
<constraint firstItem="xm2-MI-2Zd" firstAttribute="leading" secondItem="i7V-S2-BXz" secondAttribute="trailing" constant="2" id="Azg-8F-GyE"/>
<constraint firstItem="xm2-MI-2Zd" firstAttribute="centerY" secondItem="i7V-S2-BXz" secondAttribute="centerY" id="CbY-rh-Qc8"/>
<constraint firstItem="syO-lt-MMc" firstAttribute="centerY" secondItem="QJN-vW-Csu" secondAttribute="centerY" id="LAh-Cm-X5k"/>
<constraint firstItem="LXj-tz-Pgn" firstAttribute="leading" secondItem="xm2-MI-2Zd" secondAttribute="trailing" constant="10" id="OJa-qY-1gc"/>
<constraint firstItem="syO-lt-MMc" firstAttribute="leading" secondItem="NmZ-sL-KH3" secondAttribute="trailing" constant="15" id="Oap-bd-LiF"/>
<constraint firstItem="aYR-dt-2oS" firstAttribute="centerY" secondItem="LXj-tz-Pgn" secondAttribute="centerY" id="OxS-8C-hnc"/>
<constraint firstItem="QJN-vW-Csu" firstAttribute="bottom" secondItem="LXj-tz-Pgn" secondAttribute="bottom" constant="8" id="SWc-Nd-RcJ"/>
<constraint firstItem="NmZ-sL-KH3" firstAttribute="centerY" secondItem="syO-lt-MMc" secondAttribute="centerY" id="TLZ-QS-n7c"/>
<constraint firstItem="QJN-vW-Csu" firstAttribute="bottom" secondItem="aYR-dt-2oS" secondAttribute="bottom" constant="12.5" id="U5y-If-0j1"/>
<constraint firstItem="esU-sA-12g" firstAttribute="centerY" secondItem="syO-lt-MMc" secondAttribute="centerY" id="aCv-2y-AUD"/>
<constraint firstItem="i7V-S2-BXz" firstAttribute="centerY" secondItem="aYR-dt-2oS" secondAttribute="centerY" id="fuy-O1-rcG"/>
<constraint firstItem="aYR-dt-2oS" firstAttribute="width" secondItem="xm2-MI-2Zd" secondAttribute="width" id="nXK-ts-VsD"/>
<constraint firstItem="aYR-dt-2oS" firstAttribute="leading" secondItem="QJN-vW-Csu" secondAttribute="leading" constant="20" id="vGB-Wq-Tgk"/>
<constraint firstItem="syO-lt-MMc" firstAttribute="centerX" secondItem="QJN-vW-Csu" secondAttribute="centerX" id="xNE-BI-806"/>
<constraint firstItem="QJN-vW-Csu" firstAttribute="trailing" secondItem="LXj-tz-Pgn" secondAttribute="trailing" constant="20" id="zdz-Rc-W7f"/>
</constraints>
<viewLayoutGuide key="safeArea" id="QJN-vW-Csu"/>
</view>
</subviews>
<constraints>
<constraint firstItem="6mP-f1-emf" firstAttribute="trailing" secondItem="e0T-Cj-Ov8" secondAttribute="trailing" id="4f1-Nx-1x8"/>
<constraint firstItem="e0T-Cj-Ov8" firstAttribute="bottom" secondItem="GIk-0l-f4w" secondAttribute="bottom" id="HnV-Bu-Inx"/>
<constraint firstItem="e0T-Cj-Ov8" firstAttribute="top" secondItem="6mP-f1-emf" secondAttribute="top" id="N1i-Dh-WyR"/>
<constraint firstAttribute="trailing" secondItem="GIk-0l-f4w" secondAttribute="trailing" id="UJ5-w8-hJ2"/>
<constraint firstItem="e0T-Cj-Ov8" firstAttribute="leading" secondItem="6mP-f1-emf" secondAttribute="leading" id="dHK-FD-tyo"/>
<constraint firstItem="GIk-0l-f4w" firstAttribute="leading" secondItem="7eY-JP-L56" secondAttribute="leading" id="fnV-20-qUd"/>
<constraint firstItem="GIk-0l-f4w" firstAttribute="top" secondItem="7eY-JP-L56" secondAttribute="top" id="hb0-38-jb5"/>
<constraint firstItem="6mP-f1-emf" firstAttribute="bottom" secondItem="e0T-Cj-Ov8" secondAttribute="bottom" id="tFj-7P-3Wm"/>
</constraints>
<freeformSimulatedSizeMetrics key="simulatedDestinationMetrics"/>
<viewLayoutGuide key="safeArea" id="e0T-Cj-Ov8"/>
<point key="canvasLocation" x="307" y="-292"/>
</view>
</objects>
</document>
| 96.193548 | 346 | 0.608903 |
3daf86cffae0d283224c27ccc024dc733dfb961a | 358 | xml | XML | app/src/main/res/drawable/ic_skip_next_white_16dp.xml | ArchangelXu/MXSlider | 1dc9b81174f7ac036089c1e8d731ec95e46ef0bd | [
"MIT"
] | 3 | 2019-02-28T03:22:54.000Z | 2019-05-10T04:39:39.000Z | app/src/main/res/drawable/ic_skip_next_white_16dp.xml | ArchangelXu/MXSlider | 1dc9b81174f7ac036089c1e8d731ec95e46ef0bd | [
"MIT"
] | null | null | null | app/src/main/res/drawable/ic_skip_next_white_16dp.xml | ArchangelXu/MXSlider | 1dc9b81174f7ac036089c1e8d731ec95e46ef0bd | [
"MIT"
] | null | null | null | <vector xmlns:android = "http://schemas.android.com/apk/res/android"
android:width = "16dp"
android:height = "16dp"
android:tint = "#FFFFFF"
android:viewportHeight = "24.0"
android:viewportWidth = "24.0">
<path
android:fillColor = "#FF000000"
android:pathData = "M6,18l8.5,-6L6,6v12zM16,6v12h2V6h-2z"/>
</vector>
| 32.545455 | 68 | 0.634078 |
cd608b8a9f334dd7efe46fa2997619192b9c9229 | 6,651 | kml | XML | public/map-sources/zip78224.kml | temass1997/lothub | 3d00a3c27c8c4708ed08ac9a166b15c421a60fe3 | [
"MIT"
] | null | null | null | public/map-sources/zip78224.kml | temass1997/lothub | 3d00a3c27c8c4708ed08ac9a166b15c421a60fe3 | [
"MIT"
] | 4 | 2020-10-06T14:58:11.000Z | 2021-05-11T04:14:34.000Z | public/map-sources/zip78224.kml | temass1997/lothub | 3d00a3c27c8c4708ed08ac9a166b15c421a60fe3 | [
"MIT"
] | 1 | 2019-01-21T18:43:24.000Z | 2019-01-21T18:43:24.000Z | <?xml version="1.0" encoding="UTF-8" standalone="yes"?>
<kml xmlns:gx="http://www.google.com/kml/ext/2.2" xmlns:atom="http://www.w3.org/2005/Atom" xmlns="http://www.opengis.net/kml/2.2">
<Document>
<LookAt>
<longitude>-102</longitude>
<latitude>38.5</latitude>
<range>7000000</range>
<tilt>10</tilt>
<heading>0</heading>
</LookAt>
<name>cb_2016_us_zcta510_500k</name>
<visibility>1</visibility>
<Style id="KMLStyler">
<IconStyle>
<scale>0.8</scale>
</IconStyle>
<LabelStyle>
<scale>1.0</scale>
</LabelStyle>
<LineStyle>
<color>ffbc822f</color>
<width>2</width>
<gx:labelVisibility>0</gx:labelVisibility>
</LineStyle>
<PolyStyle>
<color>7fe1ca9e</color>
</PolyStyle>
</Style>
<Schema name="cb_2016_us_zcta510_500k" id="kml_schema_ft_cb_2016_us_zcta510_500k">
<SimpleField type="xsd:string" name="ZCTA5CE10">
<displayName>ZCTA5CE10</displayName>
</SimpleField>
<SimpleField type="xsd:string" name="AFFGEOID10">
<displayName>AFFGEOID10</displayName>
</SimpleField>
<SimpleField type="xsd:string" name="GEOID10">
<displayName>GEOID10</displayName>
</SimpleField>
<SimpleField type="xsd:double" name="ALAND10">
<displayName>ALAND10</displayName>
</SimpleField>
<SimpleField type="xsd:double" name="AWATER10">
<displayName>AWATER10</displayName>
</SimpleField>
</Schema>
<Folder id="kml_ft_cb_2016_us_zcta510_500k">
<name>cb_2016_us_zcta510_500k</name>
</Folder>
<Placemark id="cb_2016_us_zcta510_500k.kml">
<name><at><openparen>78224<closeparen></name>
<visibility>1</visibility>
<description><center><table><tr><th colspan='2' align='center'><em>Attributes</em></th></tr><tr bgcolor="#E3E3F3">
<th>ZCTA5CE10</th>
<td>78224</td>
</tr><tr bgcolor="">
<th>AFFGEOID10</th>
<td>8600000US78224</td>
</tr><tr bgcolor="#E3E3F3">
<th>GEOID10</th>
<td>78224</td>
</tr><tr bgcolor="">
<th>ALAND10</th>
<td>57288152</td>
</tr><tr bgcolor="#E3E3F3">
<th>AWATER10</th>
<td>342010</td>
</tr></table></center></description>
<styleUrl>#KMLStyler</styleUrl>
<ExtendedData>
<SchemaData schemaUrl="#kml_schema_ft_cb_2016_us_zcta510_500k">
<SimpleData name="ZCTA5CE10">78224</SimpleData>
<SimpleData name="AFFGEOID10">8600000US78224</SimpleData>
<SimpleData name="GEOID10">78224</SimpleData>
<SimpleData name="ALAND10">57288152</SimpleData>
<SimpleData name="AWATER10">342010</SimpleData>
</SchemaData>
</ExtendedData>
<Polygon>
<extrude>0</extrude>
<tessellate>1</tessellate>
<altitudeMode>clampToGround</altitudeMode>
<outerBoundaryIs>
<LinearRing>
<coordinates>-98.581752,29.26182,0.0 -98.580433,29.260966,0.0 -98.577609,29.260989,0.0 -98.57673,29.259234,0.0 -98.576454,29.257176,0.0 -98.577075,29.256626,0.0 -98.575977,29.255784,0.0 -98.574095,29.25612,0.0 -98.571742,29.254959,0.0 -98.569082,29.255724,0.0 -98.567965,29.256638,0.0 -98.566434,29.255521,0.0 -98.563454,29.255279,0.0 -98.563228,29.253375,0.0 -98.563981,29.252187,0.0 -98.562437,29.250591,0.0 -98.559828,29.250586,0.0 -98.557875,29.249235,0.0 -98.553296,29.24688,0.0 -98.548497,29.246687,0.0 -98.546916,29.244844,0.0 -98.544777,29.246115,0.0 -98.544438,29.247424,0.0 -98.542731,29.248376,0.0 -98.542292,29.247501,0.0 -98.540924,29.24793,0.0 -98.539958,29.247154,0.0 -98.538528,29.248402,0.0 -98.540473,29.250991,0.0 -98.539977,29.251849,0.0 -98.536087,29.251353,0.0 -98.533477,29.250002,0.0 -98.532229,29.248737,0.0 -98.531055,29.249074,0.0 -98.529192,29.24856,0.0 -98.529199,29.250383,0.0 -98.527542,29.25337,0.0 -98.526544,29.252666,0.0 -98.527216,29.251753,0.0 -98.526112,29.251142,0.0 -98.525102,29.251972,0.0 -98.524606,29.251251,0.0 -98.522793,29.250833,0.0 -98.521293,29.252807,0.0 -98.520721,29.255294,0.0 -98.521097,29.2564,0.0 -98.518605,29.259783,0.0 -98.516666,29.260646,0.0 -98.516214,29.261592,0.0 -98.515228,29.261785,0.0 -98.514752,29.260238,0.0 -98.512738,29.259687,0.0 -98.512969,29.262945,0.0 -98.511739,29.263472,0.0 -98.508162,29.263509,0.0 -98.508032,29.260379,0.0 -98.50642,29.26056,0.0 -98.505258,29.261836,0.0 -98.503852,29.262429,0.0 -98.502642,29.262011,0.0 -98.500347,29.259402,0.0 -98.499189,29.259403,0.0 -98.497288,29.260559,0.0 -98.498117,29.26156,0.0 -98.497027,29.263646,0.0 -98.49643,29.262837,0.0 -98.495452,29.26429,0.0 -98.492748,29.264968,0.0 -98.491365,29.26387,0.0 -98.491949,29.265836,0.0 -98.493071,29.267528,0.0 -98.500477,29.276454,0.0 -98.51503,29.298417,0.0 -98.516091,29.300451,0.0 -98.516369,29.303876,0.0 -98.515265,29.310137,0.0 -98.515126,29.312155,0.0 -98.516345,29.318231,0.0 -98.516958,29.320037,0.0 -98.51705,29.320276,0.0 -98.529057,29.344695,0.0 -98.533119,29.350852,0.0 -98.53093,29.351925,0.0 -98.527529,29.354812,0.0 -98.525964,29.356658,0.0 -98.523246,29.36083,0.0 -98.534033,29.361633,0.0 -98.534134,29.356638,0.0 -98.536856,29.356644,0.0 -98.538618,29.36099,0.0 -98.542292,29.361024,0.0 -98.546441,29.360512,0.0 -98.551789,29.354318,0.0 -98.552216,29.353532,0.0 -98.552328,29.343179,0.0 -98.551094,29.343686,0.0 -98.550768,29.341993,0.0 -98.552334,29.3417,0.0 -98.552312,29.334417,0.0 -98.550907,29.33443,0.0 -98.550897,29.330176,0.0 -98.552299,29.330176,0.0 -98.552308,29.327886,0.0 -98.550987,29.327876,0.0 -98.553135,29.320159,0.0 -98.56794,29.320062,0.0 -98.569117,29.316559,0.0 -98.568407,29.31104,0.0 -98.569324,29.310341,0.0 -98.572781,29.313468,0.0 -98.573473,29.313587,0.0 -98.57427,29.31291,0.0 -98.574747,29.312184,0.0 -98.57503,29.311326,0.0 -98.574986,29.310985,0.0 -98.574622,29.310275,0.0 -98.574038,29.309901,0.0 -98.573416,29.309821,0.0 -98.568068,29.306826,0.0 -98.567892,29.30599,0.0 -98.568369,29.301808,0.0 -98.567722,29.299321,0.0 -98.565092,29.295277,0.0 -98.564866,29.293517,0.0 -98.565513,29.291987,0.0 -98.566624,29.291344,0.0 -98.567628,29.293297,0.0 -98.568601,29.293077,0.0 -98.570132,29.290782,0.0 -98.569711,29.288956,0.0 -98.568651,29.287327,0.0 -98.566523,29.285919,0.0 -98.565496,29.282126,0.0 -98.568185,29.279635,0.0 -98.573956,29.272816,0.0 -98.580242,29.264641,0.0 -98.581752,29.26182,0.0</coordinates>
</LinearRing>
</outerBoundaryIs>
</Polygon>
</Placemark>
</Document>
</kml> | 73.9 | 3,433 | 0.675387 |
7f35974c6886101418b661ee37395db949cab02f | 1,090 | xml | XML | domoticzapi/src/main/res/values-fr/strings_switches.xml | AresMaster/domoticz-android | 266598255a845fefbf6d786484649625d9e5daf2 | [
"Apache-2.0"
] | 108 | 2016-01-03T19:43:42.000Z | 2021-12-30T15:38:12.000Z | domoticzapi/src/main/res/values-fr/strings_switches.xml | AresMaster/domoticz-android | 266598255a845fefbf6d786484649625d9e5daf2 | [
"Apache-2.0"
] | 469 | 2016-01-03T10:45:51.000Z | 2022-03-21T02:13:18.000Z | domoticzapi/src/main/res/values-fr/strings_switches.xml | AresMaster/domoticz-android | 266598255a845fefbf6d786484649625d9e5daf2 | [
"Apache-2.0"
] | 98 | 2016-01-02T22:36:12.000Z | 2022-01-15T13:33:52.000Z | <?xml version="1.0" encoding="utf-8"?>
<!--Generated by crowdin.com-->
<resources xmlns:tools="http://schemas.android.com/tools" tools:ignore="MissingTranslation">
<!-- only temporarily to suppress the missing translations errors for now!! -->
<string name="title_switches">Interrupteurs</string>
<string name="txt_notAvailable">N/A</string>
<string name="idx">IDX</string>
<string name="placeholder_value">255</string>
<string name="color_set">Couleur pour</string>
<string name="state_set">État défini pour</string>
<string name="error_favorite">Impossible d\'ajouter en favoris</string>
<string name="error_logs">Impossible de trouver des logs à afficher</string>
<string name="error_color">Impossible de changer la couleur</string>
<string name="error_state">Impossible de changer l\'état</string>
<string name="error_timer">Impossible d\'afficher les timers</string>
<string name="error_notifications">Impossible d\'afficher les notifications</string>
<string name="set_level_switch">"Régler le niveau de l'interrupteur : %1$s à %2$d"</string>
</resources>
| 57.368421 | 93 | 0.744954 |
70cdb01c64c487ecb08ce12cdf5db7846063dbec | 462 | sublime-snippet | XML | NetworkFirewall/cfn-NetworkFirewall-LoggingConfiguration.sublime-snippet | x31b/cfn-yaml | 9d841fb0205e74bf7d3bfe22a11ad968d62b5d70 | [
"Apache-2.0"
] | null | null | null | NetworkFirewall/cfn-NetworkFirewall-LoggingConfiguration.sublime-snippet | x31b/cfn-yaml | 9d841fb0205e74bf7d3bfe22a11ad968d62b5d70 | [
"Apache-2.0"
] | null | null | null | NetworkFirewall/cfn-NetworkFirewall-LoggingConfiguration.sublime-snippet | x31b/cfn-yaml | 9d841fb0205e74bf7d3bfe22a11ad968d62b5d70 | [
"Apache-2.0"
] | null | null | null | <snippet>
<content><![CDATA[
#AWS-DOC https://docs.aws.amazon.com/AWSCloudFormation/latest/UserGuide/aws-resource-networkfirewall-loggingconfiguration.html
Type: AWS::NetworkFirewall::LoggingConfiguration
Properties:
FirewallArn: String
FirewallName: String
LoggingConfiguration:
LoggingConfiguration
]]></content>
<tabTrigger>cfn-NetworkFirewall-LoggingConfiguration</tabTrigger>
<scope>source.yaml, source.cloudformation</scope>
</snippet> | 33 | 126 | 0.794372 |
339f99b769c0b12e0a19b2bd98f6160b8e94693c | 331,452 | xml | XML | A89788.xml | textcreationpartnership/A89788 | 05466f6a1024a6c7867d8702118db407ea9257fe | [
"CC0-1.0"
] | null | null | null | A89788.xml | textcreationpartnership/A89788 | 05466f6a1024a6c7867d8702118db407ea9257fe | [
"CC0-1.0"
] | null | null | null | A89788.xml | textcreationpartnership/A89788 | 05466f6a1024a6c7867d8702118db407ea9257fe | [
"CC0-1.0"
] | null | null | null | <TEI xmlns="http://www.tei-c.org/ns/1.0">
<teiHeader>
<fileDesc>
<titleStmt>
<title>Beames of former light, discovering how evil it is to impose doubtfull and disputable formes or practises, upon ministers: especially under the penalty of ejection for non-conformity unto the same. As also something about catechizing.</title>
<author>Nye, Philip, 1596?-1672.</author>
</titleStmt>
<editionStmt>
<edition>
<date>1660</date>
</edition>
</editionStmt>
<extent>Approx. 267 KB of XML-encoded text transcribed from 134 1-bit group-IV TIFF page images.</extent>
<publicationStmt>
<publisher>Text Creation Partnership,</publisher>
<pubPlace>Ann Arbor, MI ; Oxford (UK) :</pubPlace>
<date when="2011-12">2011-12 (EEBO-TCP Phase 2).</date>
<idno type="DLPS">A89788</idno>
<idno type="STC">Wing N1484</idno>
<idno type="STC">Thomason E1794_2</idno>
<idno type="EEBO-CITATION">99868565</idno>
<idno type="PROQUEST">99868565</idno>
<idno type="VID">170378</idno>
<availability>
<p>To the extent possible under law, the Text Creation Partnership has waived all copyright and related or neighboring rights to this keyboarded and encoded edition of the work described above, according to the terms of the CC0 1.0 Public Domain Dedication (http://creativecommons.org/publicdomain/zero/1.0/). This waiver does not extend to any page images or other supplementary files associated with this work, which may be protected by copyright or other license restrictions. Please go to https://www.textcreationpartnership.org/ for more information about the project.</p>
</availability>
</publicationStmt>
<seriesStmt>
<title>Early English books online.</title>
</seriesStmt>
<notesStmt>
<note>(EEBO-TCP ; phase 2, no. A89788)</note>
<note>Transcribed from: (Early English Books Online ; image set 170378)</note>
<note>Images scanned from microfilm: (Thomason Tracts ; 224:E1794[2])</note>
</notesStmt>
<sourceDesc>
<biblFull>
<titleStmt>
<title>Beames of former light, discovering how evil it is to impose doubtfull and disputable formes or practises, upon ministers: especially under the penalty of ejection for non-conformity unto the same. As also something about catechizing.</title>
<author>Nye, Philip, 1596?-1672.</author>
</titleStmt>
<extent>[18], 241, [7] p. </extent>
<publicationStmt>
<publisher>Printed by R.I. for Adoniram Byfield, at the three Bibles in Cornhill, next door to Popes-head-Alley.,</publisher>
<pubPlace>London, :</pubPlace>
<date>1660.</date>
</publicationStmt>
<notesStmt>
<note>Attributed to Philip Nye by Wing.</note>
<note>With two final advertisement leaves.</note>
<note>Annotation on Thomason copy: "March. 1659"; the 60 in the imprint date has been crossed out.</note>
<note>Reproduction of the original in the British Library.</note>
</notesStmt>
</biblFull>
</sourceDesc>
</fileDesc>
<encodingDesc>
<projectDesc>
<p>Created by converting TCP files to TEI P5 using tcp2tei.xsl,
TEI @ Oxford.
</p>
</projectDesc>
<editorialDecl>
<p>EEBO-TCP is a partnership between the Universities of Michigan and Oxford and the publisher ProQuest to create accurately transcribed and encoded texts based on the image sets published by ProQuest via their Early English Books Online (EEBO) database (http://eebo.chadwyck.com). The general aim of EEBO-TCP is to encode one copy (usually the first edition) of every monographic English-language title published between 1473 and 1700 available in EEBO.</p>
<p>EEBO-TCP aimed to produce large quantities of textual data within the usual project restraints of time and funding, and therefore chose to create diplomatic transcriptions (as opposed to critical editions) with light-touch, mainly structural encoding based on the Text Encoding Initiative (http://www.tei-c.org).</p>
<p>The EEBO-TCP project was divided into two phases. The 25,368 texts created during Phase 1 of the project (2000-2009), initially available only to institutions that contributed to their creation, were released into the public domain on 1 January 2015. The approximately 40,000 texts produced during Phase 2 (2009- ), of which 34,963 had been released as of 2020, originally similarly restricted, were similarly freed from all restrictions on 1 August 2020. As of that date anyone is free to take and use these texts for any purpose (modify them, annotate them, distribute them, etc.). But we do respectfully request that due credit and attribution be given to their original source.</p>
<p>Users should be aware of the process of creating the TCP texts, and therefore of any assumptions that can be made about the data.</p>
<p>Text selection was based on the New Cambridge Bibliography of English Literature (NCBEL). If an author (or for an anonymous work, the title) appears in NCBEL, then their works are eligible for inclusion. Selection was intended to range over a wide variety of subject areas, to reflect the true nature of the print record of the period. In general, first editions of a works in English were prioritized, although there are a number of works in other languages, notably Latin and Welsh, included and sometimes a second or later edition of a work was chosen if there was a compelling reason to do so.</p>
<p>Image sets were sent to external keying companies for transcription and basic encoding. Quality assurance was then carried out by editorial teams in Oxford and Michigan. 5% (or 5 pages, whichever is the greater) of each text was proofread for accuracy and those which did not meet QA standards were returned to the keyers to be redone. After proofreading, the encoding was enhanced and/or corrected and characters marked as illegible were corrected where possible up to a limit of 100 instances per text. Any remaining illegibles were encoded as <gap>s. Understanding these processes should make clear that, while the overall quality of TCP data is very good, some errors will remain and some readable characters will be marked as illegible. Users should bear in mind that in all likelihood such instances will never have been looked at by a TCP editor.</p>
<p>The texts were encoded and linked to page images in accordance with level 4 of the TEI in Libraries guidelines.</p>
<p>Copies of the texts have been issued variously as SGML (TCP schema; ASCII text with mnemonic sdata character entities); displayable XML (TCP schema; characters represented either as UTF-8 Unicode or text strings within braces); or lossless XML (TEI P5, characters represented either as UTF-8 Unicode or TEI g elements).</p>
<p>Keying and markup guidelines are available at the <ref target="http://www.textcreationpartnership.org/docs/.">Text Creation Partnership web site</ref>.</p>
</editorialDecl>
<listPrefixDef>
<prefixDef ident="tcp"
matchPattern="([0-9\-]+):([0-9IVX]+)"
replacementPattern="http://eebo.chadwyck.com/downloadtiff?vid=$1&page=$2"/>
<prefixDef ident="char"
matchPattern="(.+)"
replacementPattern="https://raw.githubusercontent.com/textcreationpartnership/Texts/master/tcpchars.xml#$1"/>
</listPrefixDef>
</encodingDesc>
<profileDesc>
<langUsage>
<language ident="eng">eng</language>
</langUsage>
<textClass>
<keywords scheme="http://authorities.loc.gov/">
<term>Christian life -- Early works to 1800.</term>
</keywords>
</textClass>
</profileDesc>
<revisionDesc>
<change>
<date>2010-07</date>
<label>TCP</label>Assigned for keying and markup</change>
<change>
<date>2010-08</date>
<label>SPi Global</label>Keyed and coded from ProQuest page images</change>
<change>
<date>2010-10</date>
<label>Ali Jakobson</label>Sampled and proofread</change>
<change>
<date>2010-10</date>
<label>Ali Jakobson</label>Text and markup reviewed and edited</change>
<change>
<date>2011-06</date>
<label>pfs</label>Batch review (QC) and XML conversion</change>
</revisionDesc>
</teiHeader>
<text xml:lang="eng">
<front>
<div type="title_page">
<pb facs="tcp:170378:1" rendition="simple:additions"/>
<p>Beames Of Former Light, Diſcovering how Evil it is TO IMPOSE Doubtfull and Diſputable Formes or Practiſes, upon Miniſters: ESPECIALLY Under the Penalty of <hi>Ejection</hi> for Non-conformity unto the ſame.</p>
<p>AS ALSO Something about CATECHIZING.</p>
<p>
<hi>LONDON,</hi> Printed by <hi>R.I.</hi> for <hi>Adoniram Byfield,</hi> at the three Bibles in <hi>Cornhill,</hi> next door to Popes-head-Alley. 1660.</p>
</div>
<div type="preface">
<pb facs="tcp:170378:2"/>
<pb facs="tcp:170378:2"/>
<head>The PREFACE.</head>
<p>
<hi>
<seg rend="decorInit">C</seg>Atechizing,</hi> which is a <q>plain laying down the <hi>Principles</hi> of the <hi>Ora<g ref="char:EOLhyphen"/>cles of God,</hi> or of the <hi>Doctrine of Chriſt,</hi> and is a part of <hi>Preaching,</hi> (as ſaith the late Reverend Aſſembly)</q>
</p>
<p>It is a <hi>part</hi> or <hi>branch</hi> of that great <hi>Ordinance,</hi> by which <hi>Faith</hi> is wrought, & the <hi>Spirit</hi> received, and our <hi>Souls</hi> ſaved. It is ſuch a kinde of inſtru<g ref="char:EOLhyphen"/>cting or <hi>preaching,</hi> ſo uſeful, and of ſuch importance, as it cannot be <hi>omitted</hi> (if wee de<g ref="char:EOLhyphen"/>ſire to edifie our people) with more ſecurity, than a <hi>founda<g ref="char:EOLhyphen"/>tion</hi> by him that intends an
<pb facs="tcp:170378:3"/>
<hi>edifice</hi> or <hi>building.</hi> The A<g ref="char:EOLhyphen"/>poſtle profeſſeth himſelf at a <hi>ſtand,</hi> and that hee could not go on with his <hi>people,</hi> to <hi>build</hi> them up ſome <hi>ſtories</hi> higher in the <hi>Faith,</hi> and <hi>Myſteries</hi> of <hi>Chriſt our High Prieſt;</hi> becauſe there had been ſuch a woful ſlowneſs in <hi>learning</hi> the <hi>funda<g ref="char:EOLhyphen"/>mentals,</hi>
<note place="margin">Heb. 5.</note> Heb. 5. It is in the ſame place made as neceſſary to our <hi>Infancy</hi> in Religion (be we old or young) as <hi>Milk</hi> is to children; If when Infants wee begin their nouriſhment with ſtrong meat, wee ſhall either <hi>ſtarve</hi> them, or <hi>radicate</hi> ſuch <hi>diſtempers,</hi> as a wearyiſh ſickly frame is likely to be the condition of thoſe <hi>perſons</hi> all their daies.</p>
<p>
<pb facs="tcp:170378:3"/>I am perſwaded, the woful diſtempers of <hi>Profeſſors,</hi> bro<g ref="char:EOLhyphen"/>ken out in theſe <hi>latter</hi> daies, to ſuch a monſtrouſneſs, and the ſtrange <hi>totterings</hi> and <hi>Apo<g ref="char:EOLhyphen"/>ſtacy</hi> amongſt us from the <hi>ſound Truths</hi> of the <hi>Goſpel,</hi> hath been hence, even the neg<g ref="char:EOLhyphen"/>lect of holding perſons in their <hi>first</hi> inſtitution to plain Fundamental Truths; <hi>ſuch,</hi>
<note place="margin">Heb. 5.12</note> (ſaith <hi>Paul) have NEED of Milk, and not of strong meat.</hi>
</p>
<p>
<hi>Catechizing</hi> is <hi>a branch</hi> of <hi>Preaching,</hi> as was ſaid; Two things there are in it peculiar, which <hi>eminently</hi> commend this courſe.</p>
<p n="1">1 The Subject Matter; It is <hi>converſant</hi> about ſuch <hi>Truths,</hi> as being <hi>moſt neceſſary</hi> to <hi>Salva<g ref="char:EOLhyphen"/>tion,</hi>
<pb facs="tcp:170378:4"/>
are ſo to our hand laid down in Scripture, as <hi>Milk</hi> is in nature, which taken in from the <hi>breast,</hi> and with leaſt Cookery and dreſſing, is moſt wholeſome; It is our firſt food, and with ſuch truths our inſtruction muſt of ne<g ref="char:EOLhyphen"/>ceſſity begin. The Church of God, in the daies of <hi>Adam, E<g ref="char:EOLhyphen"/>noch, Noah, &c.</hi> its firſt in<g ref="char:EOLhyphen"/>fancy, had little other know<g ref="char:EOLhyphen"/>ledge but of ſuch plain truths; Afterwards a further acceſſion of light was brought them by <hi>Moſes</hi> and the Prophets. Yet then, as <hi>David</hi> tells us, The Ignorant muſt have of theſe eaſie truths, for entrance and initiation;<note place="margin">Pſal. 119.130.</note>
<hi>The</hi> entrance <hi>of thy Word giveth light to the</hi> ſimple.
<pb facs="tcp:170378:4"/>
There was an Infancy alſo of the Church after Chriſt; the Apoſtle in that age of it did for the moſt part teach the people ſuch fundamentals onely, the ſumme whereof was, as <hi>Act.</hi> 20.21. <hi>Repentance toward God, and Faith toward our Lord Jeſus Chriſt;</hi> and in ſo doing hee tells them, <hi>hee kept back nothing that was</hi> pro<g ref="char:EOLhyphen"/>fitable <hi>to them;</hi> though hee had higher <hi>wiſdome,</hi>
<note place="margin">1 Cor. 2.6</note> which <hi>hee ſpake among them that were perfect,</hi> and more knowing. <hi>As a wiſe Ma<g ref="char:EOLhyphen"/>ſter-builder, hee laid the foundation;</hi> this hee did at his firſt coming to them, afterwards by his E<g ref="char:EOLhyphen"/>piſtles, hee builds them up fur<g ref="char:EOLhyphen"/>ther, <hi>leaving the Principles of the Doctrine of Christ; let us</hi> (ſaith hee) <hi>go on to perfection, and this
<pb facs="tcp:170378:5"/>
will wee do if God permit,</hi> Heb. 6.1.13.</p>
<p n="2">2 The Manner, which is ſo to <hi>inſtruct,</hi> as to require a <hi>per<g ref="char:EOLhyphen"/>ſonal account</hi> of what is under<g ref="char:EOLhyphen"/>ſtood and remembred by them that are <hi>taught,</hi> whereas in <hi>preach<g ref="char:EOLhyphen"/>ing</hi> there is liberty for the moſt part, left to the <hi>hearer,</hi> whether hee will <hi>heed</hi> or not: but this kind of <hi>Instruction</hi> is ordinarily ſo managed, as to leave ſome kinde of greater <hi>neceſsity</hi> in the <hi>hearer</hi> to <hi>attend</hi> and obſerve <hi>what</hi> is ſaid unto <hi>him,</hi> each perſon for <hi>himſelf.</hi>
</p>
<p>It is incredible how little, poor <hi>Ignorant</hi> ſouls, attend the <hi>doctrinal part</hi> of a <hi>Sermon:</hi> when in the <hi>Application</hi> their <hi>Morals</hi> are dealt with, their <hi>Adultery,
<pb facs="tcp:170378:5"/>
Drunkenneſſe, Swearing, Sabbath-breaking,</hi> and the like groſs ſins; poſſibly there is ſome little <hi>at<g ref="char:EOLhyphen"/>tention,</hi> at leaſt as they are the ſins of others, which corrupt nature is pleaſed as well to <hi>hear,</hi> as to <hi>ſpeak</hi> of.</p>
<p>A <hi>diſcourſe</hi> of <hi>Navigation,</hi> to a company of men, whoſe <hi>under<g ref="char:EOLhyphen"/>ſtanding</hi> and <hi>profeſſion</hi> is to <hi>till</hi> the Earth, will bee little <hi>heeded,</hi> or in the leaſt able to draw their minds from what their preſent <hi>thoughts</hi> are ſet <hi>upon:</hi> But if there bee an <hi>acquaintance</hi> with the loweſt <hi>Elements</hi> of a <hi>Profeſſion,</hi> wee will of our ſelves with <hi>delight</hi> attend to the open<g ref="char:EOLhyphen"/>ing of the <hi>higher Secrets</hi> and Myſteries thereof. There is a <hi>neceſſity</hi> therefore in a more
<pb facs="tcp:170378:6"/>
familiar way to indeavour that each mans ſoul in <hi>particular</hi> un<g ref="char:EOLhyphen"/>der our charge bee brought in<g ref="char:EOLhyphen"/>to <hi>acquaintance</hi> with the <hi>Elements</hi> and firſt <hi>Principles of</hi> Religion, o<g ref="char:EOLhyphen"/>therwiſe your moſt conſtant and frequent <hi>hearers</hi> will ſit at <hi>Sermons</hi> as thoſe,<note place="margin">Ezek. 33.31.</note>
<hi>Ezek.</hi> 33. <hi>they ſit before thee as my people, &c.</hi> Or if they do <hi>attend;</hi> for want of ſuch <hi>praecognita</hi> or <hi>preparative</hi> light, they profit little, by much and frequent <hi>hearing;</hi> They may grow up in an <hi>overlie</hi> and un<g ref="char:EOLhyphen"/>grounded <hi>knowledge, bee ever learning,</hi>
<note place="margin">2 Tim 37</note>
<hi>yet never bee able to come to ſuch ſolid knowledge of the Truth,</hi> as will preſerve their ſouls from the <hi>luſts</hi> that are within, or <hi>ſe<g ref="char:EOLhyphen"/>ducers</hi> without.</p>
<p>Now, by how much the
<pb facs="tcp:170378:6"/>
more <hi>excellent</hi> and neceſſary a<g ref="char:EOLhyphen"/>ny Ordinance is found to be, by ſo much the more <hi>watchful</hi> and induſtrious, Satan & his inſtru<g ref="char:EOLhyphen"/>ments have alwaies been to clog it with ſome Ceremony or ad<g ref="char:EOLhyphen"/>ditional of their own, that they may be ſwallowed together, as, the <hi>Apocripha</hi> with the <hi>Bible,</hi> which if it had gone forth in<g ref="char:EOLhyphen"/>to the world, by it ſelf, or with ſome other book, it would never have gained ſuch re<g ref="char:EOLhyphen"/>verence, or ſo <hi>ſacred</hi> an eſteem generally with men; ſo <hi>kneeling</hi> was added to the Lords Supper, the <hi>Croſſe</hi> to Baptiſm, a <hi>Surpleſſe</hi> to our publick worſhip, a ſtint<g ref="char:EOLhyphen"/>ed and <hi>limited form</hi> of words to our prayers; & the like attemp<g ref="char:EOLhyphen"/>ted in this <hi>CASE.</hi> If any man hereupon
<pb facs="tcp:170378:7"/>
ſcrupling theſe Formes and Ceremonies, withdraw from thoſe excellent Ordinances, though upon <hi>that account</hi> only, as many in all ages have done: yet ſhall they ſuffer under the reproach of deſpiſing Sacra<g ref="char:EOLhyphen"/>ments, and the unqueſtionable duties of a Chriſtian.</p>
<p>The Lord having now (by very ſtrange turnings of provi<g ref="char:EOLhyphen"/>dence) called in to place thoſe Honourable <hi>Knights</hi> and <hi>Bur<g ref="char:EOLhyphen"/>geſſes,</hi> the great Reformers in matters of Religion, who have by their <hi>care</hi> and vigilance, done more herein, than ever was by any Parliament ſince Popery hath been rejected, The <hi>Wonder<g ref="char:EOLhyphen"/>ful Counſellor,</hi> wee hope in mer<g ref="char:EOLhyphen"/>cy will ſtill guide them, and all
<pb facs="tcp:170378:7"/>
Parliaments hereafter by their example, <hi>to carry on</hi> this work of Reformation with like <hi>modera<g ref="char:EOLhyphen"/>tion,</hi> as hath been hitherto the progeſs of it.</p>
<p>It will prove a great burden, and become an endleſs ſtrife and contention in the Churches of Chriſt, If <hi>Magistrates</hi> or <hi>Sy<g ref="char:EOLhyphen"/>nods</hi> ſhall impoſe with heavy pe<g ref="char:EOLhyphen"/>nalties, <hi>every</hi> ſuch practice and obſervance as poſſibly they may <hi>conceive</hi> to bee <hi>pious</hi> and <hi>uſeful</hi> for the better or more ſolemn performance of the ſervice and worſhip of God. That <hi>Synod</hi> in the year, 1640. which was <hi>rigid</hi> and <hi>impoſing</hi> enough, exer<g ref="char:EOLhyphen"/>ciſeth a remarkable moderation in their ſeventh Canon. A practice they endeavour there, to
<pb facs="tcp:170378:8"/>
bring into the Church; which they profeſs to be <hi>pious in it ſelf, profitable unto us, and edifying unto others,</hi> yet notwithſtanding en<g ref="char:EOLhyphen"/>joyn it not, much leſs under a<g ref="char:EOLhyphen"/>ny penalty; but, <hi>think it very meet and behoveful, and heartily commend it to all good and well-af<g ref="char:EOLhyphen"/>fected people, members of this Church, it being an ancient and lau<g ref="char:EOLhyphen"/>dable cuſtome.</hi> And with this imitable moderation and ten<g ref="char:EOLhyphen"/>derneſs conclude the Canon in theſe words. <hi>And in the practice or omiſſion of this right, wee deſire that the Rule of Charity preſcribed by the Apoſtle, may bee obſerved, which is, That they which uſe this Rite, deſpiſe not them that uſe it not, and they that uſe it not, condemn not them that uſe it.</hi>
</p>
<p>
<pb facs="tcp:170378:8"/>Such a Chriſtian charity and tenderneſs in <hi>Magiſtrates</hi> and <hi>Synods</hi> in reſpect to Rites and Obſervances, or matters of like nature, not evidently neceſ<g ref="char:EOLhyphen"/>ſary, to the worſhip and ſer<g ref="char:EOLhyphen"/>vice of God: is all this little <hi>Treatiſe</hi> humbly pleads for.</p>
<p>And truly it may ſeem very reaſonable, conſidering how <hi>plain</hi> and punctual the Scripture is in the practical Reſolution of ſuch Caſes, in <hi>Romans</hi> 14. and in 1 <hi>Corinthians</hi> 8, <hi>&c.</hi> And with what woful <hi>diſtractions</hi> and diſturbances the Lord hath cha<g ref="char:EOLhyphen"/>ſtized us, for want of a more ſtrict obſervance thereof. And doubtleſs all matters of the ſame nature in the worſhip and ſer<g ref="char:EOLhyphen"/>vice of God, may ſafely bee or<g ref="char:EOLhyphen"/>dered
<pb facs="tcp:170378:9"/>
by the ſame Scriptures, & the <hi>Rule</hi> in this and the like ca<g ref="char:EOLhyphen"/>ſes, is ſo <hi>perfect,</hi> plain and full, as wee may ſay of it, as Chriſt of his direction about <hi>Aſſeverations,</hi> Mat. 5.37. <hi>Let your communication bee yea, yea, nay, nay; for whatſoe<g ref="char:EOLhyphen"/>ver is more than theſe cometh of e<g ref="char:EOLhyphen"/>vil;</hi> And therefore if ſuch be<g ref="char:EOLhyphen"/>come more <hi>ſevere</hi> than the Lord hath required, it will be their <hi>e<g ref="char:EOLhyphen"/>vil,</hi> our <hi>miſery</hi> only Our Church-Governours queſtionleſs might have brought in one Rite or Ceremony, with the ſame li<g ref="char:EOLhyphen"/>berty to mens conſciences, that they have done <hi>another.</hi> The Croſſe and Surplice, &c. with the ſame liberty, as bowing to the Eaſt, or Altar. Other <hi>of<g ref="char:EOLhyphen"/>ficiatings,</hi> with no more ſtrict<g ref="char:EOLhyphen"/>neſs
<pb facs="tcp:170378:9"/>
of ſtinted words,<note place="margin">The Prieſt ſhall ſay theſe words, <hi>or ſuch like.</hi> Rub. for Churching.</note> than the Churching of Women, &c. they might with ſecurity have ſo done, in reſpect of any thing that the Lord <hi>requireth</hi> more of them, which if they had obſer<g ref="char:EOLhyphen"/>ved from the beginning of Re<g ref="char:EOLhyphen"/>formation, how had the Lord this day been <hi>worſhiped by us in the beauty of holineſſe</hi> throughout the Nation!</p>
<q>
<bibl>
<hi>Pſal. 2.10, 11, 12.</hi>
</bibl>
<p>Bee wiſe now therefore, O yee Kings; bee inſtructed, yee Judges of the Earth.</p>
<p>Serve the Lord with fear, and re<g ref="char:EOLhyphen"/>joyce with trembling.</p>
<p>Kiſſe the Son, leſt hee bee angry, and yee periſh from the way, when his wrath is kindled but a little, Bleſſed are all they that put their trust in him.</p>
</q>
</div>
<div type="errata">
<pb facs="tcp:170378:10"/>
<head>ERRATA.</head>
<p>PAge 17. line 7. read impoſitions, l. 23. r. <hi>qua<g ref="char:EOLhyphen"/>cunque,</hi> p. 34. l. 17. r. methodical, p. 39. l. 17. r. ſay, p. 58. l. 12. r. <hi>indicantur,</hi> p. 80. l. 19. r. learner, p. 95. l. 24. r. Canons of 1571, p. 98. l. 13. r. liber<g ref="char:EOLhyphen"/>ty, p. 110. l. 12. r. have, p. 102. l. 1. r. Book, p. 108. l. 10. r. liturgy. p. 117. l. 4. r. having ſome o<g ref="char:EOLhyphen"/>ther, l. 12. r. of his duty, p. 118. l. 17. r. whom, p. 121. l. 18. r. rigid, p. 122. l. <gap reason="illegible" resp="#PDCC" extent="2 letters">
<desc>••</desc>
</gap>. r. Pretour, p. 133. l. 20. r. yet would, p. 142. l. 23. r. Armach, p. 148. l. 19. r. unto. It, p. 152. l: 6. r. fear for this, p. 154. l. 20. r. appear) p. 158. l. 12. r. left their.</p>
</div>
</front>
<body>
<div type="text">
<pb n="1" facs="tcp:170378:10"/>
<head>Some beams of Light, broke forth in a former age, and now of uſe for the reſolv<g ref="char:EOLhyphen"/>ing a Caſe of Conſcience of preſent importance.</head>
<div n="1" type="chapter">
<head>
<hi>CHAP. I</hi> The Caſe, with an Explication of ſome terms, and the ſtate of the Queſti<g ref="char:EOLhyphen"/>on.</head>
<p>
<hi>Caſe.</hi>
</p>
<p>
<seg rend="decorInit">W</seg>Hether it bee well to im<g ref="char:EOLhyphen"/>poſe upon Miniſters, or publike Preachers ſome one Catechiſme to bee held to, for matter and words as a ſacred help, and more ef<g ref="char:EOLhyphen"/>fectual
<pb n="2" facs="tcp:170378:11"/>
means for propagating the Goſ<g ref="char:EOLhyphen"/>pel, or the like ſpiritual uſe or end.</p>
<p>
<hi>For the further explanation and ſtating this caſe.</hi>
</p>
<div n="1" type="section">
<head>§. 1.</head>
<p>The Magiſtrate, whether chriſtian or Heathen (for in each the ſame pow<g ref="char:EOLhyphen"/>er, though not the ſame light to guide it) is <hi>Cuſtos utriuſque tabu<g ref="char:EOLhyphen"/>lae</hi>) Yet with this difference, in ſe<g ref="char:EOLhyphen"/>cond Table duties, hee hath liber<g ref="char:EOLhyphen"/>ty to create or make Laws <hi>de novo,</hi> ſuch as were never Laws or in being before hee created them, and wee are bound by the Law of God to bee ſubject to ſuch Laws even to every humane creation <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap> for the Lords ſake, 1 <hi>Pet.</hi> 2.13. But not ſo in the duties of the firſt Table, all Laws neceſſary for the managing of the worſhip of God
<pb n="3" facs="tcp:170378:11"/>
and his ſpiritual Kingdome are from himſelf, who onely knows himſelf, and what will bee for his honour, and the edification of his people, upon this account the Lord fre<g ref="char:EOLhyphen"/>quently in the Scripture giveth charge to Princes, as well as others,<note place="margin">Deut. 4.2</note> not to adde too, nor take from his Law, or to do the thing that ſeemeth good in their own eies, be<g ref="char:EOLhyphen"/>cauſe though a Chriſtian, yet hee cannot ſo wel by his wiſdome judge in the matters of Piety what is ſu<g ref="char:EOLhyphen"/>table to God, as a Heathen can judge in matters of Civility what is ſutable to man.</p>
<p>Hee may notwithſtanding exer<g ref="char:EOLhyphen"/>ciſe his authority to the glory of God, even in the matters of worſhip in theſe Caſes,</p>
<p n="1">1 Its granted generally, whatſo<g ref="char:EOLhyphen"/>ever is clearly and evidently ſet forth in the word, as the way in which the Lord will bee ſerved and worſhipped, hee is not onely to ſubmit to it himſelf as a Chriſtian,
<pb n="4" facs="tcp:170378:12"/>
but to uſe all lawful means that o<g ref="char:EOLhyphen"/>thers may do the like, as hee is a Magiſtrate, whatſoever talent wee have received, muſt bee improved to the glory of him that gave it.</p>
<p n="2">2 Seeing the Aſſemblies for the worſhip of God have many things common, being of the ſame nature in the general, and as a <hi>Coetus ho<g ref="char:EOLhyphen"/>minum,</hi> with other Civil aſſemblies, whatſoever is found expedient; comely, and uſeful in theſe, ought carefully to be furthered and look<g ref="char:EOLhyphen"/>ed unto, that the like bee obſerv<g ref="char:EOLhyphen"/>ed in theſe more ſacred meetings. Such Circumſtances or Laws eſta<g ref="char:EOLhyphen"/>bliſhed by the Magiſtrate about them, do not immediately reach the worſhip it ſelf, but the worſhip<g ref="char:EOLhyphen"/>pers: yet ſo neceſſary, as without ſuch proviſion the ſervice cannot ſo conveniently or edifyingly bee per<g ref="char:EOLhyphen"/>formed; if time and place bee not deſigned, if many ſpeak at the ſame time, if in a great Congregation no eminent place for him that preach<g ref="char:EOLhyphen"/>eth,
<pb n="5" facs="tcp:170378:12"/>
the Sermon will not bee ſo e<g ref="char:EOLhyphen"/>difying; And yet there is nothing in ſuch Law or proviſion, more ho<g ref="char:EOLhyphen"/>ly or ſacred than there is any thing evil or ſinful, in the preſervation or keeping up the being of Devils or wicked men; The Magiſtrate may make Laws for the preſervation of the lives of murderers, and the worſt of men, as men and rational Creatures, and yet not by it do any Act, or make any Law that is ſinful or evil, and ſo it is with the Laws and Proviſions for the being or con<g ref="char:EOLhyphen"/>venient being of the ſervice & wor<g ref="char:EOLhyphen"/>ſhip of God; though it be ſacred and ſpiritual, yet ſuch Laws are not. The ſchool-men ſay of Letters, <hi>Literae ſig<g ref="char:EOLhyphen"/>nificantes ſacras ſententias, non ſignifi<g ref="char:EOLhyphen"/>cant eas in quantum ſacra ſunt, ſed in quantum ſunt res, ergo literae non ſunt ſacrae.</hi>
</p>
</div>
<div n="2" type="section">
<pb n="6" facs="tcp:170378:13"/>
<head>
<hi>§ 2.</hi> To impoſe, &c.</head>
<p>The Magiſtrate may not onely permit, but commend and adviſe a practice, without any Coerciſive impreſſion of authority; ſuch was the decree of <hi>Darius, Dan.</hi> 6.25. <hi>I make a decree that in every dominion of my Kingdome, men tremble and fear before the God of Daniel, for hee is the living God, and ſtedfaſt for e<g ref="char:EOLhyphen"/>ver,</hi> &c. <hi>hee worketh ſigns and Wonders,</hi> &c. where, the reaſon of the thing, rather than the autho<g ref="char:EOLhyphen"/>rity of him that commands, is repre<g ref="char:EOLhyphen"/>ſented, ſo in that of <hi>Paul, Philem.</hi> 8. <hi>Though I might enjoyn thee that which is convenient, yet I rather beſeech thee.</hi> And this is ſafe for the Ma<g ref="char:EOLhyphen"/>giſtrate, eſpecially where the rea<g ref="char:EOLhyphen"/>ſon of the practiſe is not ſo evident as to bee of general acceptation by the godly of preſent or former ages, as Infant Baptiſme, neceſſity of or<g ref="char:EOLhyphen"/>dination to all that preach in pub<g ref="char:EOLhyphen"/>lick,
<pb n="7" facs="tcp:170378:13"/>
this or that external form of Church Government, and the like.</p>
<p n="2">2 Hee may protect thoſe that conform to ſuch adviſe, and impoſe penalties (which a private Chriſtian cannot) on any that ſhall moleſt, diſturb, or diſcourage thoſe that ſhall ſo do, of this nature was that injunction, in reſpect to thoſe that were diſturbed in reading the Bible in the Engliſh, or the paraphraſes of <hi>Eraſmus,</hi> upon the Goſpels,<note place="margin">Injunct. of Q<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>
<gap reason="illegible" resp="#PDCC" extent="4 letters">
<desc>••••</desc>
</gap>.</note> which was to bee had in every Church.</p>
<p n="3">3 A penalty or curſe being not eſſential to a Law, The Magiſtrate may command or enjoyn, and yet adde no penalty or forfeiture. In ſuch caſes, a perpetual conſtant practice is not ordinarily expected, peaceable omiſſion upon grounds of reaſon, where no contempt or deſpiſing of authority, is accepted, or at leaſt connived at, and ſo much is intimated in the very forming of a Law, as about Ceremonies in the
<pb n="8" facs="tcp:170378:14"/>
injunctions of Q. <hi>Elizabeth, no man ought obſtinately, no maliciouſly to break and violate the laudable Cere<g ref="char:EOLhyphen"/>monies of the Church,</hi>
<note place="margin">C<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>n. 22</note>
<hi>commanded by publick authority to be obſerved.</hi>
</p>
<p n="4">4. The Caſe is about a command with a penalty, which is the moſt Magiſtratical, there is more of pow<g ref="char:EOLhyphen"/>er and authority,<note place="margin">Premiare poteſt ad quem libet pertinere, ſed punire non perti<g ref="char:EOLhyphen"/>net niſi admini<g ref="char:EOLhyphen"/>ſtrum le<g ref="char:EOLhyphen"/>gis. Aq. 1<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>. ad q. 92. art. 2</note> in a penalty, than in a rewards for to puniſh is peculiar to Magiſtracy, to reward is in the power of any man that hath where<g ref="char:EOLhyphen"/>with. A penalty impoſed with greateſt ſeverity, thoſe that obey not though out of tenderneſs of conſcience, and ever ſo peaceable, and free from contempt in their for<g ref="char:EOLhyphen"/>bearance, and conformable in o<g ref="char:EOLhyphen"/>ther matters, their doom is the ſame, with the obſtinate.</p>
<p>The Common people, eſpecially in their youth and natural conditi<g ref="char:EOLhyphen"/>on are more bruitiſh and indiſpoſ<g ref="char:EOLhyphen"/>ed to inſtruction, ſuch deſpiſe know<g ref="char:EOLhyphen"/>ledge: The Care of a Chriſtian Magiſtrate conduceth more to the
<pb n="9" facs="tcp:170378:14"/>
eternal welfare of their ſouls, than any care they have of themſelves; they heed more the Commands and impoſitions of men than of God, and are more reduced to the uſe of the means from the penalty of a law than from the threatnings of Hell. They come under the Magiſtrates hand, and care, by birth and provi<g ref="char:EOLhyphen"/>dence, But Miniſters and Publike Preachers by his own Election, and ſatisfaction received of their ſufficiency and fitneſſe, and are not admitted to any place of publick inſtructing either of young or old, but as they are found upon exami<g ref="char:EOLhyphen"/>nation to bee both able and willing, To commend or adviſe, will effect as much with ſuch perſons as to com<g ref="char:EOLhyphen"/>mand, yea, injoyn <hi>cum minis & ſup<g ref="char:EOLhyphen"/>pliciis,</hi> will do with thoſe others.</p>
</div>
<div n="3" type="section">
<pb n="10" facs="tcp:170378:15"/>
<head>
<hi>§. 3.</hi> Some one Catechiſm, &c.</head>
<p>TO Catechiſe in the ſence of our Caſe, is to take ſome plaine diſcourſe about the Principles of Religion, formed in method of Queſtions and Anſwers, by which the Miniſter is taught to aske his people queſtions, and taught alſo how to teach them to give him an<g ref="char:EOLhyphen"/>ſwers to thoſe queſtions, a provi<g ref="char:EOLhyphen"/>ſion more ſutable to a former age, when the blinde did lead the blinde, of whom that Scripture was verifi<g ref="char:EOLhyphen"/>ed, <hi>Heb.</hi> 5.12. for after the Bi<g ref="char:EOLhyphen"/>ſhops had made a man a Miniſter, he was enjoyned to learn <hi>Nowels</hi> Catechiſme, and to get ſome Scripture by heart, and give an ac<g ref="char:EOLhyphen"/>count to the Arch-Deacon, or his Official at every Viſitation.</p>
<div type="subsection">
<head>Some one.</head>
<p>The Shorter Catechiſme agreed upon by the Aſſembly of Divines
<pb n="11" facs="tcp:170378:15"/>
at <hi>Weſtminſter,</hi> and preſented to the Honourable Houſes of Parliament then ſitting, and by them ordered to be printed and publiſhed, but no man enjoyned to uſe it, or puniſh<g ref="char:EOLhyphen"/>able if he made uſe of any other to inſtruct his people in. This little Book for the comprehenſiveneſs of it, as alſo exactneſs of order and expreſſion, hath (as it deſerves) a great eſteeme with many Learned men, notwithſtanding to be the one and only Book, for all capacities that are to be inſtructed in Princi<g ref="char:EOLhyphen"/>ples, throughout the Nation, is a perfection not to be expected from any Common gift, nor is this for ſuch purpoſe the fitteſt in its kinde, as wee ſhall endeavour to ſhew in this Diſpute.</p>
</div>
</div>
<div n="4" type="section">
<pb n="12" facs="tcp:170378:16"/>
<head>
<hi>§. 4.</hi> To be held to for matter and words.</head>
<p>Prayer and Inſtruction, are du<g ref="char:EOLhyphen"/>ties the Miniſter is ſpecially to attend and give himſelf to, and to conceive and forme his work both for matter and words, according as he hath received gifts from the Lord Jeſus Chriſt.</p>
<p>It is true, there hath been a Cuſtome even in the reformed Churches, to compoſe by the more learned and prudent, your <hi>Agenda,</hi> or Church Diſpenſatories, that is, ſome Generalls in matter and method by way of a Directory, for ſuch as are leſſe able, as that of the Aſſembly, for Prayer and In<g ref="char:EOLhyphen"/>ſtruction, <hi>leaving the Miniſter to his liberty, to make uſe of the whole, or any part of it, or any thing to like purpoſe, as he ſhall finde expedient,</hi> as it is there expreſſed. So our Brethren the <hi>N. Conformiſts</hi> at <hi>Franckford,</hi> after
<pb n="13" facs="tcp:170378:16"/>
they had gathered a Church out of the Church there,<note place="margin">
<hi>Their Ru<g ref="char:EOLhyphen"/>brick thus,</hi> Gratiarum in hanc aut aliam con<g ref="char:EOLhyphen"/>ſimil<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>m formam pro miniſtri ip<g ref="char:EOLhyphen"/>ſius arbi<g ref="char:EOLhyphen"/>tratu an<g ref="char:EOLhyphen"/>nectit, <hi>p. 50</hi> Miniſter precatione eadem hac qua prace<g ref="char:EOLhyphen"/>dit vel aliae quacun<expan>
<am>
<g ref="char:abque"/>
</am>
<ex>que</ex>
</expan> propria pro inſtinctu animi ſui uti licebit. <hi>p. 37.</hi>
</note> & had ſetled at <hi>Ge<g ref="char:EOLhyphen"/>neva,</hi> compoſed a Directory, which they term, <hi>Forma publice orandi, &c. Anno</hi> 1556. where the like liberty, as in our Directory, is left to the Miniſters. But an impoſition of mat<g ref="char:EOLhyphen"/>ter and words is to doe all, not to direct only, but to doe the thing, and leave no more to the Miniſter to doe than any Childe in the Pa<g ref="char:EOLhyphen"/>riſh that can read Engliſh can doe as well as he. And in this part of his Miniſtry he is in the ſame forme with thoſe, who were rendred o<g ref="char:EOLhyphen"/>dious in darker times by publick Authority, <hi>The Biſhop ſhall ſuffer no man to bee occupied in the Mini<g ref="char:EOLhyphen"/>ſtration of the Church, which calleth himſelf by the idle name of a Reader,</hi> in the Canons of 1571.</p>
</div>
<div n="5" type="section">
<pb n="14" facs="tcp:170378:17"/>
<head>
<hi>§. 5.</hi> As a ſacred and more effectual means.</head>
<p>In the Service and Worſhip of God, Actions or Methods are for the nature of them according to what is there ſtated, &c. if it bee to effect immediately a Holy or Spiritual end, or to prevent the like evil (as in this caſe) it is ſacred and ſpiritual; and whatſoever thing or action of this nature enjoyned by the Civil Magiſtrate, falleth under the firſt Head (as before) and muſt have clear and evident Scripture-warrant; nothing makes a thing holy and ſacred but the Word, and no<g ref="char:EOLhyphen"/>thing will ſerve (in it ſelf) to any ſpiritual end but what God ap<g ref="char:EOLhyphen"/>points. Principles and Fundamen<g ref="char:EOLhyphen"/>tals may be the matter of a Sermon as well as of a Catechiſme, the dif<g ref="char:EOLhyphen"/>ference is only in the method and way; this method and way is ter<g ref="char:EOLhyphen"/>med not only an ancient and <hi>good,</hi>
<pb n="15" facs="tcp:170378:17"/>
but a pious or <hi>holy way of inſtru<g ref="char:EOLhyphen"/>cting,</hi> and deſigned as a <hi>ſpecial means for the propagating the Goſpel, and to prevent the growth of Igno<g ref="char:EOLhyphen"/>rance, Atheiſme, and Hereſie;</hi> and all this as diſtinct from preaching: So it is not for the truthes, or the matter ſake only, for that may bee the ſame in plaine preaching, but in the method and way; for al<g ref="char:EOLhyphen"/>though the people bee inſtructed in the ſame Principles and Fundamen<g ref="char:EOLhyphen"/>tals, by way of preaching according to the Directory, yet if he doe not in<g ref="char:EOLhyphen"/>ſtruct in this method, and way, and words, hee ſhall be put by his Mi<g ref="char:EOLhyphen"/>niſtry and maintenance; this being the nature of the impoſition, and the methods, or matters ſome of our Brethren would have impoſed, it cannot bee judged of as any other thing but the impoſition of a ſa<g ref="char:EOLhyphen"/>cred means of help to the Service and Worſhip of God; the Caſe thus ſtated and explained, the Nega<g ref="char:EOLhyphen"/>tive is aſſerted, namely, the unlaw<g ref="char:EOLhyphen"/>fulneſſe
<pb n="16" facs="tcp:170378:18"/>
of ſuch impoſitions, and how great an evil it is to bring us back again under ſtinted forms in any kind; being ſo happily delivered from them, and from thoſe that kept theſe burdens upon us. And for confirmation hereof, let the follow<g ref="char:EOLhyphen"/>ing reaſonings without prejudice be conſidered of.</p>
</div>
</div>
<div n="2" type="chapter">
<head>
<hi>CHAP. II.</hi> The firſt Argument. Rites and Forms that have a ſtated uſe, and to ſpiritual ends in the worſhip of God, ought to have Scripture warrant for their eſtabliſhment.</head>
<div n="1" type="section">
<head>§ 1.</head>
<p>ALl Methods and forms preſcri<g ref="char:EOLhyphen"/>bed to be received as a matter of Piety, and for ſpiritual and ſpe<g ref="char:EOLhyphen"/>ciall
<pb n="17" facs="tcp:170378:18"/>
ends and advantages in the ſer<g ref="char:EOLhyphen"/>vice of God, ought to have expreſs direction and warrant out of the Word of God. This is one of the great truths our brethren the <hi>Non Conformiſts</hi> aſſerted in their age a<g ref="char:EOLhyphen"/>gainſt humane oppoſitions, and ſeal<g ref="char:EOLhyphen"/>ed it by their ſore and great ſuffe<g ref="char:EOLhyphen"/>rings. Which they have argued a<g ref="char:EOLhyphen"/>gainſt, from theſe Scriptures, <hi>Deut.</hi> 16.21. <hi>Col.</hi> 2.20.23. <hi>Exod.</hi> 20.4. <hi>Eſay</hi> 1.12. <hi>Matth.</hi> 13.19. <hi>Hebrew</hi> 3.4, 5, 6. <hi>Matthew.</hi> 28.20. And by other Scriptures alſo, they prove that, not onely what is done againſt or contrary to the word, but alſo what is done beſides it, <hi>Deuteronomy</hi> 4.2. <hi>Deut.</hi> 12.32. <hi>Prov.</hi> 30.6. <hi>Levit.</hi> 10.1. 2 <hi>Sam.</hi> 7.7. <hi>Jer.</hi> 7.31. is unwarrantable.</p>
<p>That ſaying of <hi>Auguſtine</hi> is fre<g ref="char:EOLhyphen"/>quently urged by them, <hi>ſive de Chriſto, ſive de Eccleſia, ſive de qua<g ref="char:EOLhyphen"/>cumque alia re, non dico ſi nos, ſed ſi Angelus de coelo vobis anuntiaverit preter quam quod in Scripturis acce<g ref="char:EOLhyphen"/>piſtis
<pb n="18" facs="tcp:170378:19"/>
anathema ſit.</hi> Dr. <hi>Reynolds</hi> (a learned <hi>N. Conformiſt</hi>) avouching theſe words, makes this obſervati<g ref="char:EOLhyphen"/>on, hee ſaith not <hi>contra quam,</hi> ſed <hi>preter quam,</hi> ſo that <hi>Auguſtine</hi> thin<g ref="char:EOLhyphen"/>keth not onely things which are contrary to the Word to bee un<g ref="char:EOLhyphen"/>lawful, but even thoſe things alſo which are beſides the word. Doctor <hi>Reynolds</hi> confer. with <hi>Hart. cap.</hi> 2.</p>
<p>And in particular againſt the im<g ref="char:EOLhyphen"/>poſing,</p>
<p n="1">1 A <hi>form, method,</hi> or an <hi>external garb</hi> or way of worſhip to bee held conſtantly, and not appointed in the Word, <hi>We are not to think ſaith Mr.</hi> Cartwright,<note place="margin">Againſt Whitg. lib. 1. p. 26</note>
<hi>that in the word there is onely the ſubſtance of Religion, &c. and thoſe things left out which ſhould pertain to the</hi> form and faſhion <hi>of it. Thoſe</hi> ſaith Mr. Bradſhaw, <hi>that have power to make peculiar forms of Religion and worſhip, have power to invent a Religion and worſhip of their own,</hi> and Page 29. and 30. <hi>True wor<g ref="char:EOLhyphen"/>ſhip both for matter and manner ought
<pb n="19" facs="tcp:170378:19"/>
to bee according to the preſcript rule of Gods word onely:</hi>
<note place="margin">Religio eſt vertus voluntatis ergo ut prolatio exterior ſit vera, debet procedere ex inten<g ref="char:EOLhyphen"/>ſione, pertinente ad religi<g ref="char:EOLhyphen"/>onem.</note>
<hi>Neither hath any mortal man authority to frame accord<g ref="char:EOLhyphen"/>ing to his own conceit,</hi> any form or faſhion <hi>of Gods ſervice and worſhip; for the</hi> manner <hi>of worſhip alſo muſt be ho<g ref="char:EOLhyphen"/>ly, and not the matter onely, and no man hath power to make any thing ho<g ref="char:EOLhyphen"/>ly, that God alloweth not by his word and Spirit.</hi> In the diſcipline of <hi>Scot<g ref="char:EOLhyphen"/>land</hi> as it was ſet forth. <hi>Anno.</hi> 1560. <hi>As the Magiſtrate ought not to preach,</hi> (catechizing is a part<note n="*" place="margin">So term<g ref="char:EOLhyphen"/>ed by the aſſembly in their advice for Chur. Govern<g ref="char:EOLhyphen"/>ment. Engliſh po. Ce<g ref="char:EOLhyphen"/>rem. pag. 139. out of Daneus.</note> of preaching) <hi>ſo hee ought not to preſcribe any rule how it ſhould bee done, but command the Miniſters to obſerve the rule com<g ref="char:EOLhyphen"/>manded in the word.</hi> And a learned Scotchman, <hi>in the worſhip of God whe<g ref="char:EOLhyphen"/>ther internal or external, hee</hi> (the Magiſtrate) <hi>ought to move nothing, preſcribe nothing, except that which is expreſly delivered in Gods written word. Nulla juſta diſponendi ſervos Dei</hi> (ſaith Jun. in Lev. 9) <hi>ad cultum Dei ratio ab hominibus in veſtigari poteſt niſi quam Deus preſcripſerit.</hi>
</p>
</div>
<div n="2" type="section">
<pb n="20" facs="tcp:170378:20"/>
<head>§ 2.</head>
<p n="2">2 A <hi>ſtated ſervice</hi> of God, or a <hi>help</hi> or <hi>means</hi> for the making of ſuch ſervice or any part of it more effectual or acceptable.</p>
<p>
<note place="margin">Medul. lib. 2. cap. 4</note>
<hi>Res illae</hi> ſaith Doctor Ames, <hi>quae inſtitutione ſingulari uſibus religionis deſtinantur tanquam religionis inſtru<g ref="char:EOLhyphen"/>menta, recte etiam propter</hi> ſtatum <hi>aut</hi> relationem fixam <hi>quam habent vo<g ref="char:EOLhyphen"/>cantur religioſae.</hi> Its the ſame with that another ſaith, <hi>what is done by a Servant of God in the ſolemn ſervice and worſhip of God by pre<g ref="char:EOLhyphen"/>ciſe cannon of the Church</hi> (or law of the Common-wealth) <hi>is a part of di<g ref="char:EOLhyphen"/>vine worſhip. Brad.</hi> 12. <hi>Arg. arg.</hi> 3. and of worſh. <hi>p.</hi> 47.</p>
<p>
<note place="margin">Reaſons from Scot<g ref="char:EOLhyphen"/>land.</note>Thus againſt our ſet form of pray<g ref="char:EOLhyphen"/>er they argued, <hi>if there were never an ill word or ſentence in all the pray<g ref="char:EOLhyphen"/>ers (if it were framed all out of Scrip<g ref="char:EOLhyphen"/>ture phraſes & ſentences</hi> ſaith an ano<g ref="char:EOLhyphen"/>ther) <hi>yet to uſe it as a</hi> ſet ſervice, <hi>&c.
<pb n="21" facs="tcp:170378:20"/>
though the words bee good, yet the uſe is nought.</hi> Adm. 2. par. p. 55.<note place="margin">Freſh. Sute p. 211.</note>
<hi>If Chriſt</hi> ſaith Dr. Ames <hi>bee our authentique Teacher in all good that wee learn about Religion, who taught our Prelates ſuch good manners as to put feſcues of their own making into his hand, and ſo ap<g ref="char:EOLhyphen"/>point him</hi> after what manner, <hi>and by what</hi> means <hi>hee ſhall teach us?</hi> And brings this ſaying of <hi>Peter Martyr, For as much as God is moſt wiſe, hee needs not our deviſe for</hi> inſtruments to <hi>stir up faith in us, which alſo no tradeſman in his kinde would endure, but would chuſe to himſelf at his own pleaſure what hee ſhould think moſt fit.</hi>
</p>
<p>Our brethren were offended at the Leiturgy upon this account, becauſe in the Act by which it is eſtabliſhed, you have this reaſon of the impoſition, namely <hi>to make the ſame prayer and faſhion of ſervice more earneſt and fit to ſtir Chriſtian people to the true honour of Almighty God, his Majeſty hath ordered the book of Common Prayer to be peruſed and made fully perfect.</hi>
<note place="margin">Stat. 5. Ed. 6.</note>
</p>
</div>
<div n="3" type="section">
<pb n="22" facs="tcp:170378:21"/>
<head>§ 3.</head>
<p n="3">3 If with opinion of <hi>holineſſe</hi> or <hi>neceſſity</hi> in the reaſons given againſt ſubſcription, by the Miniſters of <hi>Lincoln.</hi>
<note place="margin">Abrid. pa. 38.</note>
<hi>When opinion of</hi> neceſſi<g ref="char:EOLhyphen"/>ty <hi>or</hi> holineſſe <hi>is known to bee annex<g ref="char:EOLhyphen"/>ed, either by ſuch as impoſe or uſe them, in this caſe, it is a part of that confeſ<g ref="char:EOLhyphen"/>ſion which every Chriſtian is bound to make of his religion, to reject them.</hi>
</p>
<p>The Church at <hi>Geneva</hi> to their brethren in <hi>England</hi> write thus, <hi>hu<g ref="char:EOLhyphen"/>mana decreta atque inventa omnia quantumvis illuſtrem ſecum ſplendo<g ref="char:EOLhyphen"/>rem perſuaſionemque apportent, ſi vel verbum Dei curſum impediant vel</hi> ne<g ref="char:EOLhyphen"/>ceſſitatem <hi>inferant abſque omni dubi<g ref="char:EOLhyphen"/>tatione refringi reſcindi<expan>
<am>
<g ref="char:abque"/>
</am>
<ex>que</ex>
</expan> debent.</hi>
</p>
<p>It is then ſacred, when appropri<g ref="char:EOLhyphen"/>ated to ſome holy end or uſe (as was ſaid before) The holy God onely, and by his holy Word ſanctifies and ſeparates what hee is pleaſed to accept from us as
<pb n="23" facs="tcp:170378:21"/>
holy in all our approaches be<g ref="char:EOLhyphen"/>fore him. <hi>Things appropriated to religious or ſpiritual perſons, Fun<g ref="char:EOLhyphen"/>ctions or Actions, either are or ought to be religious and ſpiritual. And therefore either are, or ought to bee instituted immediately by God, who alone is the Author and Inſtitutor of all religious and ſpiritual actions and things, whether internal or ex<g ref="char:EOLhyphen"/>ternal, Doctor</hi> Ames <hi>in his</hi> Pur. Anglic. <hi>cap.</hi> 1.6. What is holy muſt bee from God, <hi>A ſolo Deo diximus, quia ejus ſolius eſt, & ſuum cultum, & res cultui, & rebus Ceremo<g ref="char:EOLhyphen"/>nias, & omnibus ipſas Circumstantias ſacrare.</hi> Anon. de adiaph. p. 11.</p>
<p>And then in our eſteem neceſſary. 1 When urged in the uſe, to bee conſtant, and without intermiſſion, ſuch an impoſition either findes things, or makes the things impoſed to be ſo, <hi>Ritibus ne accedat perpetua obſervatio,</hi>
<note place="margin">Part 1. p. 88.</note> Parker <hi>out of</hi> Urſinus. 2 When the uſe (of ſuch things impoſed) <hi>is urged more, or as
<pb n="24" facs="tcp:170378:22"/>
much as the obſervation of the Lawes and Ordinances of God,</hi> Link. Abridg. <hi>p.</hi> 39. <hi>If thoſe that are willing to doe all neceſſary ſervices tending to the Salvation of man, but cannot conforme, muſt therefore bee turned out of Chriſts ſervice,</hi>
<note place="margin">Brad. 12. Arg. at. 11</note>
<hi>ſuch Conformity is reputed neceſsary to Sal<g ref="char:EOLhyphen"/>vation. When ſo preſſed (ſaith Maſter</hi> Parker) <hi>that the moſt reſpected Preachers ſhall bee utterly caſt away, (themſelves and theirs) &c. How can it bee but wee muſt conceive that the men who bring this wrack, doe hold them</hi> neceſſary <hi>in their judgement, Mr. Par.</hi> of the Croſs, <hi>p.</hi> 2. <hi>cap.</hi> 2. §. 19. 3 We eſteeme that neceſſa<g ref="char:EOLhyphen"/>ry that we judge tends to edifica<g ref="char:EOLhyphen"/>tion, for edification is neceſſary, and all things tending thereto, <hi>ne<g ref="char:EOLhyphen"/>ceſsitate precepti,</hi> ſaith another.</p>
</div>
<div n="4" type="section">
<pb n="25" facs="tcp:170378:22"/>
<head>§. 4.</head>
<p>All or moſt of theſe will bee found the blame of this impoſiti<g ref="char:EOLhyphen"/>on, as,</p>
<p n="1">1 It is by this appointment a part of the <hi>ſet Service</hi> of God to be performed every Lords Day in the Publick Congregation; <hi>this Book</hi> to be inſtituted (and ordained as it were by the laying on of the hands of Authority) and ſet apart from other Books of this kind, to inſtruct and reveale to our people the whole Truth of God neceſſa<g ref="char:EOLhyphen"/>ry to Salvation; it is to be a kind of Curate to officiate with us, and as the mouth of God to our people. A ſet Forme of Prayer, and thus eſtabliſhed, to bee held to by all Miniſters, may with more reaſon bee pleaded for. The Miniſter in the duty of Prayer is the mouth of the people to God, in preaching or inſtructing as the mouth of God
<pb n="26" facs="tcp:170378:23"/>
to the people; it is now more con<g ref="char:EOLhyphen"/>gruous in reaſon, that the people, or their Repreſentatives preſcribe in what words he ſhall bee a mouth for them to God, then that hee by them ſhould bee taught (and words put into his mouth) when he comes as an Ambaſſadour, and from God, or in Chriſts ſtead to teach them. The Biſhops themſelves were aſhamed of their State Homi<g ref="char:EOLhyphen"/>lies, and State Catechiſmes, and quietly permitted the laying them aſide by godly Miniſters, when their State Prayers were kept up in greateſt ſeverity.</p>
<p n="2">2 It is likewiſe impoſed as a means or help in the Service of the Lord, it is clear in thoſe expreſ<g ref="char:EOLhyphen"/>ſions, <hi>a better way for the under<g ref="char:EOLhyphen"/>ſtanding of the Principles,</hi> & ex<g ref="char:EOLhyphen"/>preſſly deſigned <hi>for the propagation of the Goſpel,</hi> and <hi>to prevent the growth of Ignorance & Atheiſm.</hi> It is put as a feſcue in the Mini<g ref="char:EOLhyphen"/>ſters hand, and muſt bee made uſe
<pb n="27" facs="tcp:170378:23"/>
of by all, without reſpect to what they want, or have of ſufficiency for the worke of the Miniſtry,<note place="margin">
<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>x neceſ<g ref="char:EOLhyphen"/>ſitate faci<g ref="char:EOLhyphen"/>endi non facientis.</note> which evidently ſpeakes it a help to the Worſhip, and not to the perſons only: whoſoever he bee that en<g ref="char:EOLhyphen"/>gageth in teaching, and inſtructing work, muſt make uſe of this help, or elſe hee muſt hold his peace and depart; ſurely ſuch a maine beam of the Houſe, ſuch a peice of Archi<g ref="char:EOLhyphen"/>tecture without which it cannot ſtand if it be ſet up, would not have been omitted, or left out by our wiſe Maſter-builder. 3. As ſacred and neceſſary; the former expreſſe; it is termed, not only an <hi>ancient and good;</hi> but alſo <hi>a pious</hi> or holy <hi>way of inſtructing.</hi>
<note place="margin">Perpetua obſerva<g ref="char:EOLhyphen"/>tio.</note> And for the <hi>neceſsity</hi> it is impoſed as a Rite <hi>every Lords Day</hi> to bee performed, as Prayer, or Preaching, or reading the Scrip<g ref="char:EOLhyphen"/>tures, not left to the diſcretion of the Miniſter at any time, or upon any occaſion to bee omitted. With ſuch a penalty alſo, as if it were
<pb n="28" facs="tcp:170378:24"/>
equally neceſſary as any, nay as all other Miniſterial duties put to<g ref="char:EOLhyphen"/>gether. For let the Miniſter bee ever ſo well qualified, and diligent, and faithful in all Miniſterial Servi<g ref="char:EOLhyphen"/>ces appointed by Jeſus Chriſt, in re<g ref="char:EOLhyphen"/>lation to his Flock, if ever ſo peace<g ref="char:EOLhyphen"/>able and deſirous to ſubmit to Su<g ref="char:EOLhyphen"/>periours in all lawful Commands, yet if hee ſcruple obedience in this, he muſt bee thrown out of his Mi<g ref="char:EOLhyphen"/>niſtry, his Wife and Children to beggery; there is no Chriſtian tender-hearted Magiſtrate would make ſuch an impoſition, if he were not perſwaded of it, as a neceſſary help and furtherance of the Service of Chriſt.</p>
<p>And that it was to bee impoſed as tending to edification, and that not only for the matter, but the very <hi>forme and way,</hi> is evident, not only in the title, but throughout the Act.</p>
</div>
</div>
<div n="3" type="chapter">
<pb n="29" facs="tcp:170378:24"/>
<head>
<hi>CHAP. III.</hi> What directions there are in the Scripture for the inſtructing of o<g ref="char:EOLhyphen"/>thers, in reſpect both of matter, method, means, &c.</head>
<p>NOw that there is no ſuch pecu<g ref="char:EOLhyphen"/>liar way or means (as is men<g ref="char:EOLhyphen"/>tioned in the Caſe) for the inſtru<g ref="char:EOLhyphen"/>cting of the ignorant, either from promiſe, or precept, or example, warranted in the Word will ap<g ref="char:EOLhyphen"/>pear, if we conſider what direction we have in the Scripture about this part of Miniſterial Service and Worſhip of God, namely, the in<g ref="char:EOLhyphen"/>ſtructing our people.</p>
<div n="1" type="section">
<head>§. 1.</head>
<p n="1">1 The <hi>matter</hi> to bee taught, <hi>Whatſoever Chriſt hath comman<g ref="char:EOLhyphen"/>ded,</hi> Mat. 28.20. <hi>the Word of the Lord,</hi> 2 <hi>Tim.</hi> 4.2. the whole Coun<g ref="char:EOLhyphen"/>ſel
<pb n="30" facs="tcp:170378:25"/>
of God, <hi>Act.</hi> 20.27, &c.</p>
<p n="2">2 <hi>Method</hi> or way. Taking ſome text of Scripture, and ſo preach<g ref="char:EOLhyphen"/>ing upon it, as <hi>Luke</hi> 4.17.21. or expounding the Scripture all along as we read it, <hi>Neh.</hi> 8.8. or occaſio<g ref="char:EOLhyphen"/>nally diſcourſing as Providence of<g ref="char:EOLhyphen"/>fereth matter, <hi>Joh.</hi> 15.1. <hi>Acts</hi> 10.3, 4. & 13.16, 17. or by Parables, as in the Goſpels; or by reaſoning and diſputing, as <hi>Acts</hi> 9.29. <hi>Mar.</hi> 9.34. <hi>Acts</hi> 17.17. or by reſolving Caſes or Queſtions propoſed by our Children, and ſuch as are de<g ref="char:EOLhyphen"/>ſirous to learn, 1 <hi>Cor.</hi> 10.25. <hi>Exo.</hi> 12.26, 27. <hi>Joſh.</hi> 4.6. <hi>Matth.</hi> 19.16, 17.</p>
<p n="3">3 <hi>The end, to give knowledge of Salvation,</hi> to worke converſion to <hi>ſave our ſelves,</hi> and thoſe that hear us, <hi>Jer.</hi> 23.23. <hi>Acts</hi> 26.18. 1 <hi>Tim.</hi> 4.16.</p>
<p n="4">4 For the <hi>Geſture</hi> and Poſture, ſtanding, or ſitting, wee have ex<g ref="char:EOLhyphen"/>amples of both, <hi>Nehemiah</hi> 8.4. <hi>Matth.</hi> 23.2. higher than the reſt
<pb n="31" facs="tcp:170378:25"/>
of the people in a Pulpit, <hi>Nehem.</hi> 8.4, 5. a chair, or ſeat, <hi>Matthew</hi> 23.2.</p>
</div>
<div n="2" type="section">
<head>§. 2.</head>
<p>But that wee may come yet neerer to our preſent Caſe, we have direction alſo in the Word about the</p>
<p n="5">5 <hi>Manner.</hi> Our inſtructions ought to be,</p>
<p n="1">1 Plaine, and to the loweſt ca<g ref="char:EOLhyphen"/>pacity, <hi>Neh.</hi> 8.8. 1 <hi>Cor.</hi> 14.</p>
<p n="2">2 With authority and com<g ref="char:EOLhyphen"/>mand, <hi>Tit.</hi> 2.15. 1 <hi>Tim.</hi> 4.11. <hi>In demonſtration of the Spirit, and not with the inticing words of mans wiſ<g ref="char:EOLhyphen"/>dome,</hi> 1 Cor. 2.4.</p>
<p n="3">3 With dexterity and skilful<g ref="char:EOLhyphen"/>neſs, 2 <hi>Tim.</hi> 2.15. which ſtandeth much in dividing the word, and re<g ref="char:EOLhyphen"/>ſpective application to each ſoul.</p>
<p>¶ There is a variety in the ca<g ref="char:EOLhyphen"/>pacity and frame of ſpirit found in thoſe under our charge, as <hi>ſimple
<pb n="32" facs="tcp:170378:26"/>
ones,</hi> Babes, weake in faith; o<g ref="char:EOLhyphen"/>thers more knowing, eſtabliſhed, of full age, perfect; there are unruly and ſcandalous, erroneous, and gain<g ref="char:EOLhyphen"/>ſayers, Hereticks, and Apoſtates, Hypocrites, and Diſſemblers; there are alſo ſuch who are found in the faith, ſincere, and upright ſpirits without guile, &c. ſo alſo certaine ſorts of truth, Principles, Funda<g ref="char:EOLhyphen"/>mentals, milk, ſtrong meat, and certaine methods and wayes of ap<g ref="char:EOLhyphen"/>plying our ſelves and truths to ſuch perſons reſpectively; there are Doctrines, Reproofs, Corrections, Conſolations, Rebukes, Diſpu<g ref="char:EOLhyphen"/>tings, &c.</p>
<p n="4">4 With quick and ſuitable affe<g ref="char:EOLhyphen"/>ctions, <hi>ſome ſave with fear,</hi> others with boldneſſe and courage, others to bee treated with in tender<g ref="char:EOLhyphen"/>neſs, compaſſion, love, meek<g ref="char:EOLhyphen"/>neſs, &c.</p>
<p>It is a work requires more than ordinary abilities and watchful<g ref="char:EOLhyphen"/>neſs, to diſtinguiſh the Spiritual
<pb n="33" facs="tcp:170378:26"/>
ſtate of ſouls in their great variety, to collect and gather fit and ſutable matter, dividing and cutting out truths to each ſtate, and to get hearts and affections ſutable. In the laſt place, therefore let it be conſi<g ref="char:EOLhyphen"/>dered, the</p>
</div>
<div n="3" type="section">
<head>§ 3.</head>
<p n="6">6 <hi>Means,</hi> or the helps and provi<g ref="char:EOLhyphen"/>ſion Chriſt hath made for his Mini<g ref="char:EOLhyphen"/>ſters, and what he requires of them that they may bee ſufficiently fur<g ref="char:EOLhyphen"/>niſhed to this great work.</p>
<p n="1">1 The Bible, a book put into our hands by the Lord himſelf, that hath in it up and down all materials and furniture neceſſary to this great work, 1 <hi>Tim.</hi> 3.6. <hi>holding faſt the faithful word that hee may bee able by ſound Doctrin both to exhort and con<g ref="char:EOLhyphen"/>vince the gainſayers,</hi> and 2 Tim. 3.16. <hi>All Scriptures are given</hi> — 17. <hi>that the man of God</hi> (the Miniſter) <hi>may be perfect, throughly furniſhed to all
<pb n="34" facs="tcp:170378:27"/>
good</hi> (Miniſterial) <hi>works.</hi>
</p>
<p n="2">2 Gifts given by Chriſt upon his aſcention to this end, <hi>Eph.</hi> 4.10.12. knowledge and utterance not onely <hi>able</hi> but <hi>apt</hi> to teach, having a ſtock or treaſure, they have a gift alſo to communicate it. Nature giveth Nip<g ref="char:EOLhyphen"/>ples as well as milk to the breaſts. And none to be taken into this bleſ<g ref="char:EOLhyphen"/>ſed work (according to Chriſts Di<g ref="char:EOLhyphen"/>rectory) but ſuch as are ſo qualified.</p>
<p n="3">3 Induſtry and diligence, <hi>ſearch the Scriptures, attend to reading, a giving our ſelves wholly to the work.</hi> Truths are delivered in the Scrip<g ref="char:EOLhyphen"/>tures, not in ſuch a ſorted or metho<g ref="char:EOLhyphen"/>dial way, that you may finde the concernments of each Doctrin or each mans condition, all together in one place, but are let fall here and there in an occaſional way: as in an Epiſtle or ſtory, or Prophecy, or ſong, &c. and not onely in gather<g ref="char:EOLhyphen"/>ing together fit and ſutable matter, but it muſt bee put into a method and order. The Preacher <hi>Eccl:</hi> 12.9.
<pb n="35" facs="tcp:170378:27"/>
did not only <hi>ſeek out</hi> but ſet in order many Proverbs, as the Prieſts, <hi>Lev.</hi> 24.4. were to order their lamps. <hi>Pe<g ref="char:EOLhyphen"/>ter</hi> did not onely ſearch out <hi>matter,</hi> but its ſaid <hi>Act.</hi> 11.4. <hi>he expoun<g ref="char:EOLhyphen"/>ded it in order unto them,</hi>
<note place="margin">Luk. 1.3</note> It muſt bee a part of our induſtry alſo to improve our gift of utterance by ſearching after fit and ſignificant ex<g ref="char:EOLhyphen"/>preſſions, that the <hi>Trumpet</hi> may give a <hi>certain ſound,</hi> that is intelli<g ref="char:EOLhyphen"/>gent and diſtinct, ſweet and plea<g ref="char:EOLhyphen"/>ſant.</p>
<p n="3">3 The bleſſed ſpirit of God; that ſheweth us the things of Chriſt and of God, and hath its fruit in words or utterance, as well as in knowledge and matter as in that antitheſis,<note place="margin">1 Cor. 2.4</note>
<hi>my ſpeech was not</hi> — but <hi>in, &c.</hi>
</p>
<p n="4">4 Stirring affections, (as before) a great help to utterance and elocuti<g ref="char:EOLhyphen"/>on, where clearneſs of knowledge, a gift of expreſſion in the general, matter choſen out and ſorted to ſuch and ſuch perſons, and then af<g ref="char:EOLhyphen"/>fections ſutable, there will bee a
<pb n="36" facs="tcp:170378:28"/>
tongue as the pen of a ready writer: there will be ſuch a ſtirring emphaſis even in the very words,<note place="margin">Interior affectus quaſi natu<g ref="char:EOLhyphen"/>rali impetu movet linguam.</note> and ſo much of the ſimilitude and likeneſs of our affectionate hearts; as tis impoſſible in any form of words compoſed by another, or (it may bee) by our ſelves at another time, or in a cold deliberation, to ſpeak in any meaſure anſwerable, or ſo edifying; who could have taught <hi>Paul,</hi> ſo wel as his ſanctified paſſion taught him to ex<g ref="char:EOLhyphen"/>preſs himſelf, <hi>Phil.</hi> 3.18.</p>
</div>
<div n="4" type="section">
<head>§. 4.</head>
<p>Now for any man to go further, that is, in any of thoſe particulars to bee more particular. When Chriſt hath ſufficiently inſtructed his ſcribe and taken off his hand, as being able now to form his own work, for the Magiſtrate, or a Synod, to take him into tutorage, to adde more ſafe and particular rules and Laws for the direction of the Miniſters of
<pb n="37" facs="tcp:170378:28"/>
Chriſt in their Miniſterial imploy<g ref="char:EOLhyphen"/>ment, what is this but <hi>to doe worke after the King,</hi> Eccleſ. 2.12. wee impoſe theſe Lawes, upon Mini<g ref="char:EOLhyphen"/>ſters, ſuch as are approved both for their grace and gifts, for their Doctrin and Life, as perſons fit and able for this work.</p>
<p>After Chriſt hath given his Mi<g ref="char:EOLhyphen"/>niſters a Book (as before) the Scriptures, and given it to this end that they may be perfect,<note place="margin">1 Tim. 3.16, 17.</note> and tho<g ref="char:EOLhyphen"/>rowly furniſhed to all imploy<g ref="char:EOLhyphen"/>ments; yet others are not ſatisfi<g ref="char:EOLhyphen"/>ed, he muſt have another Book, a <hi>Prayer</hi> book, and another Book, an inſtructing or preaching Book, a <hi>Catechiſme</hi> book; and to the ſame end, that hee may bee better fur<g ref="char:EOLhyphen"/>niſhed for his work, that by this means it may bee done more per<g ref="char:EOLhyphen"/>fectly, more to edification, as the Common Prayer-book formerly. There is <hi>a preciſe appointment with what words and ſentences Gods Name ſhall be called upon, ſaith Mr.</hi> Hooker,
<pb n="38" facs="tcp:170378:29"/>
<hi>that the endleſs and ſenſleſſe effuſions of indigeſted Prayers may not bee, Pol. p.</hi> 239. and another of them, <hi>The end of theſe formes is to bee a meanes to baniſh utterly out of Chriſts Church all extemporal invention of unſound prayer,</hi>
<note place="margin">Covel a<g ref="char:EOLhyphen"/>gainſt Burgis.</note> p. 70, 71. So for the other part of our Miniſterial work, wee have beene furniſhed with a Homily Book, and now a Catechiſme Book, which ſome would have impoſed upon Mini<g ref="char:EOLhyphen"/>ſters, utterly to baniſh out of Chriſts Church all other Cate<g ref="char:EOLhyphen"/>chiſmes, as alſo a more particular help and means then any Chriſt hath furniſhed his Miniſters with, for the <hi>better underſtanding</hi> of <hi>the Principles,</hi> and for the <hi>better propa<g ref="char:EOLhyphen"/>gating</hi> the <hi>Goſpel,</hi> and <hi>preſerving</hi> men ſound in their knowledge, which is to like ends as was thoſe ſet formes formerly impoſed.</p>
</div>
<div n="5" type="section">
<pb n="39" facs="tcp:170378:29"/>
<head>§ 5.</head>
<p>To conclude this Argument, our demand is of thoſe that have ſo zealouſly ſtickled for ſuch an im<g ref="char:EOLhyphen"/>poſition, and have a mind to bring Miniſters to their Books againe, from whoſe necks this yoak hath been (and that by a mighty hand of God) ſo lately taken off, I de<g ref="char:EOLhyphen"/>mand, whether any thing in thoſe reaſonings of our ſuffering Bre<g ref="char:EOLhyphen"/>thren againſt Apocrypha, Common Prayer-books, and Homily-books, he of any conſequence, from this topick: the bringing of other books into the ſolemne Service of God, beſides thoſe of Divine Au<g ref="char:EOLhyphen"/>thority? <hi>Neither the Levites</hi> (ſaith many of our Brethren together in the Abridgement) <hi>nor Chriſt,</hi>
<note place="margin">Abrid p. 6.</note>
<hi>nor his Apoſtles did ever read, preach, or interpret any other writing for the</hi> inſtruction <hi>of the Church, but only the Canonical Scripture;</hi> Againe in
<pb n="40" facs="tcp:170378:30"/>
the ſame place, <hi>It is the proper Of<g ref="char:EOLhyphen"/>fice of Chriſt to be the Teacher of his Church,</hi> and therefore <hi>no writings may bee appointed to bee read in the Congregation for</hi> inſtruction, <hi>but on<g ref="char:EOLhyphen"/>ly ſuch as have been indited by his Spirit.</hi> Mr. <hi>Cartw.</hi> in <hi>Cat.</hi> maketh it a breach of the Second Com<g ref="char:EOLhyphen"/>mandement, and againſt Doctor <hi>Whitg.</hi> about reading of Homilies in the Church hee writeth thus; <hi>Neither the Homilies, nor the Apo<g ref="char:EOLhyphen"/>cripha are to bee read at all in the Church. It is good to conſider the order which God kept with his people in times paſt, when hee commanded that no Veſſel, nor inſtrument, either Beeſome, or Fleſh-hook, &c. ſhould come into the Temple, but thoſe only which were ſanctified, and ſet apart for that uſe. And hee will have no other Trumpets to call the people together, but thoſe only which were ſet apart for that purpoſe, what ſhould the meaning of this Law bee? The matter of other common Veſſels
<pb n="41" facs="tcp:170378:30"/>
and Trumpets was the ſame often<g ref="char:EOLhyphen"/>times which theirs was; the ſame forme alſo and Trumpets, able to ſerve for the uſes of ſounding, &c. as well as thoſe of the Temple, and as thoſe which were ſet apart, wherefore might not theſe as well be uſed in the Temple as others? forſooth, becauſe the Lord would by theſe Rudiments teach that he would have nothing brought into the Church but that which hee had appointed, no not although they ſeemed in the judgement of men as good; the Homilies, be they ever ſo learned and pithy, &c.</hi> ſee <hi>Parker</hi> on the Croſs, 1 part. Doctor <hi>Chad<g ref="char:EOLhyphen"/>derton</hi> on <hi>Rom.</hi> 12. and divers o<g ref="char:EOLhyphen"/>thers to the ſame purpoſe.</p>
<p>I demand againe, what ſhew of Scripture there is for any ſuch me<g ref="char:EOLhyphen"/>thod, or way, as preſcribed by Chriſt, or Authority left (by him) to any other perſon, to pre<g ref="char:EOLhyphen"/>ſcribe any ſuch Utenſile or Inſtru<g ref="char:EOLhyphen"/>ment. What warrant hath any man to carry on the Directory for
<pb n="42" facs="tcp:170378:31"/>
inſtruction, further, and more par<g ref="char:EOLhyphen"/>ticularly than Chriſt himſelf hath thought fit to doe, and thus to eſtabliſh a Humane forme in a ſet<g ref="char:EOLhyphen"/>led, ſtated, Sabbath-ſervice with<g ref="char:EOLhyphen"/>out Scripture warrant. And whe<g ref="char:EOLhyphen"/>ther he may not as lawfully collect matter, and put it in a ſet method, and forme of words, and furniſh the Miniſter with a Booke, as a help or means for the better edi<g ref="char:EOLhyphen"/>fication of the people in any other, or in all other the works and parts of the Miniſterial Function, as in this, and as lawfully impoſe ſuch Books to bee uſed by him and no other, nor any other thing done by him but what is done by Book. If hee may bee by ſuch meanes better enabled for one part of his Miniſtry, he may likewiſe for ano<g ref="char:EOLhyphen"/>ther; and if for all, why ſhould it not be rather choſen.</p>
</div>
</div>
<div n="4" type="chapter">
<pb n="43" facs="tcp:170378:31"/>
<head>
<hi>CHAP. IV.</hi> Divers Objections anſwered, no ſhew of Scripture for it, nor neceſsity, nor requiſite for uniformity, or obliged to it by our Covenant.</head>
<p>I Shall now faithfully give an ac<g ref="char:EOLhyphen"/>count of whatever I have either read or heard, or imagine can be pleaded as a warrant in this caſe.</p>
<div n="1" type="section">
<head>§ 1.</head>
<p>
<hi>Obj.</hi> 1 The notation of the word <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>, to teach by voyce from <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>, and this from <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>
<note n="*" place="margin">
<gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap> autem ſo<g ref="char:EOLhyphen"/>num ſive ſimplicem ſive ex re<g ref="char:EOLhyphen"/>flexa & repercuſſi<g ref="char:EOLhyphen"/>one gemi<g ref="char:EOLhyphen"/>natum ſig<g ref="char:EOLhyphen"/>nificat.</note> and hence wee have our Engliſh word <hi>Eccho,</hi> which is as it were an an<g ref="char:EOLunhyphen"/>ſwering againe.</p>
<p>
<hi>Anſ.</hi> There is no ſuch diſtinct meaning in the Scripture uſe of the word, but moſt ordinarily for preaching or inſtructing by voyce, and ſo interpreted by our Tranſ<g ref="char:EOLhyphen"/>lators,
<pb n="44" facs="tcp:170378:32"/>
1 <hi>Cor.</hi> 14.19. <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap> that by my voyce I might teach others, <hi>Gal.</hi> 6.6. wee doe not be<g ref="char:EOLhyphen"/>leeve the Miniſters maintenance, is to riſe from thoſe that learn Cate<g ref="char:EOLhyphen"/>chiſmes only, ſuch as are unmarri<g ref="char:EOLhyphen"/>ed, and under the age of twenty one years, yet the ſame word there, and is tranſlated teaching, and the Scripture ſpeaking of ſuch to whom this Catechiſtical way ſeems to bee moſt ſutable, it expreſſeth their inſtruction, and teaching by another word, <hi>Heb.</hi> 5.12. <hi>You have need that one teach you the firſt Prin<g ref="char:EOLhyphen"/>ciples of the Oracles of God:</hi> the word there is <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap> not <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>, the word is uſed alſo for a ſtory, or any report by hear-ſay, <hi>Luke</hi> 1.4. <hi>Acts</hi> 21.21, 24.</p>
<p>
<hi>Obj.</hi> 2. Thoſe Scriptures are ob<g ref="char:EOLhyphen"/>jected that mention Principles, Fundamentals, which are reckon<g ref="char:EOLhyphen"/>ed up, <hi>Heb.</hi> 6.1. & Pſal. 34.11. <hi>Come yee children, hearken unto me, and I will teach you the fear of the
<pb n="45" facs="tcp:170378:32"/>
Lord.</hi> And 2 <hi>Tim.</hi> 1.13. <hi>a pattern of ſound words, in faith and love;</hi> and Rom. 2.20. <hi>the forme of the know<g ref="char:EOLhyphen"/>ledge of the truth</hi> is ſpoken of.</p>
<p>
<hi>Anſ.</hi> In none of theſe Scrip<g ref="char:EOLhyphen"/>tures any ſet forme for method and words, and if ſo, yet not with in<g ref="char:EOLhyphen"/>junction to bee held to only, that principles and lower truthes are to bee taught, and to thoſe of a low<g ref="char:EOLhyphen"/>er capacity in a more familiar and plaine method and way; this is confirmed by thoſe Scriptures, and is a duty of that evidence from Scripture, that the Civil Magi<g ref="char:EOLhyphen"/>ſtrate may impoſe and compel Mi<g ref="char:EOLhyphen"/>niſters thus to inſtruct, leaving them as Chriſt hath left them, for choyſe of matter and words accor<g ref="char:EOLhyphen"/>ding to the gifts the Lord hath fur<g ref="char:EOLhyphen"/>niſhed them with for his ſervice.</p>
</div>
<div n="2" type="section">
<head>§. 2.</head>
<p>Obj. 3. <hi>It is ancient, and received by all Churches in all ages ſince the Apoſtles times?</hi>
</p>
<p>
<pb n="46" facs="tcp:170378:33"/>
<hi>Anſ.</hi> If it bee meant inſtructing the ignorant, and younger ſort in Principles, it is not only ſo, but more ancient, even before the A<g ref="char:EOLhyphen"/>poſtles times, and confirmed by them, and is or ought to bee re<g ref="char:EOLhyphen"/>ceived & practiſed by all Churches; But method, words, &c. impoſed as a neceſſary Rite, and Order in the Service of God; this is not ancient, and he that was well skilled in anti<g ref="char:EOLhyphen"/>quity will tell you ſo.<note place="margin">Mr. Parker of Symbo<g ref="char:EOLhyphen"/>lizing with Anti<g ref="char:EOLhyphen"/>chriſt, part 2. p. 19.</note>
<hi>If they ſpeak of Canons inferring neceſsity, they muſt know there were no ſuch Canons in antient time, Chriſtian Liberty was more tendred in thoſe dayes.</hi> Againe, <hi>Antiently</hi> (ſaith the ſame Author) <hi>there was in Rites a liberty permitted, and no neceſsity impoſed, neceſsity in Rites is</hi> jugum papale, <hi>never heard of in the Church till Antichriſt began to uſurp over the liberty of Chriſtian men.</hi>
</p>
<p>
<hi>Anſ.</hi> 2. Suppoſe it had both Antiquity and Univerſality.</p>
<p>Is this a topick more cogent here
<pb n="47" facs="tcp:170378:33"/>
then in former diſputes? as be<g ref="char:EOLhyphen"/>tween Proteſtants and Papiſts, Conformiſts and Non Confor<g ref="char:EOLhyphen"/>miſts;<note place="margin">Caſſander, Anglica. pag. 2.</note> Mr. <hi>Sprint</hi> layeth his moſt weight upon this Argument, <hi>The refuſing of Conformity,</hi> ſaith hee, <hi>tends to condemne all true Churches, all faithful and ſound Teachers of all times and places ſince the time of the Apoſtles of Chriſt.</hi>
</p>
<p>The avouching Antiquity, and U<g ref="char:EOLhyphen"/>niverſality of acceptation, as equiva<g ref="char:EOLhyphen"/>lent in a Diſpute, to Divine Au<g ref="char:EOLhyphen"/>thority (which is, or ought to be the only rule in this matter) is very ſufficiently refuted by <hi>Jewel, Whitakers, Reinolds, Morton,</hi> and the reſt of ours againſt Papiſts, as alſo at large diſputed betweene Doctor <hi>Ames,</hi> in his reply to Mr. <hi>Sprint,</hi> and Doctor <hi>Burgis</hi> his re<g ref="char:EOLhyphen"/>joynder, and then Dr. <hi>Ames</hi> again in his <hi>Freſh ſuit.</hi>
</p>
<p>Obj. 4. <hi>And for any neceſsity, or Arguments drawne from thence?</hi>
</p>
<p>
<hi>Anſ.</hi> There is no Miniſterial
<pb n="48" facs="tcp:170378:34"/>
work in which a neceſſity may not better bee pretended; as</p>
<p n="1">1 In convincing the Gain-ſay<g ref="char:EOLhyphen"/>er, controverſal diſputes, ſuch dif<g ref="char:EOLhyphen"/>ficulty, as for want of help ſome<g ref="char:EOLhyphen"/>times men are diſputed into error.</p>
<p n="2">2 To pitch upon ſuch Chara<g ref="char:EOLhyphen"/>cters and ſignes, by which Sincerity may be diſcerned from Hypocriſie is very difficult, and for want of experience and skilfulneſs in ſuch a work, <hi>the hearts of thoſe have been made ſad whom God would not have made ſad.</hi>
<note place="margin">Ezek. 13.</note> If in ſuch Caſes the Ma<g ref="char:EOLhyphen"/>giſtrate ſhould conſult with a Sy<g ref="char:EOLhyphen"/>nod, and forme certaine wayes of reaſoning for method and words, and impoſe upon the Miniſter in their Diſputes to bee held to, and no other; and the like for the im<g ref="char:EOLhyphen"/>poſing certaine formes of ſignes, and markes, by which Sincerity and Hypocriſie may ſafely bee di<g ref="char:EOLhyphen"/>ſtinguiſhed; or any other difficulty that falls in the way of our Miniſtry: is much more neceſſary and allow<g ref="char:EOLhyphen"/>able.</p>
<p n="3">
<pb n="49" facs="tcp:170378:34"/>3 To be able to ſpeake level, and not over or under in determi<g ref="char:EOLhyphen"/>ning the Magiſtrates power in Ec<g ref="char:EOLhyphen"/>cleſiaſtical matters, is a difficulty, and to what extremities doe good men in their preaching and printing run in the point; upon this conſi<g ref="char:EOLhyphen"/>deration a Homily is compoſed, that is, a certaine forme for matter and words,<note place="margin">Synod 40. Can. 2.</note> and impoſed * upon all Miniſters as followeth, <hi>For the fuller and clearer inſtruction and in<g ref="char:EOLhyphen"/>formation of all Chriſtian people in their duties in this particular, wee doe Ordaine and Decree, That every Parſon, Vicar, Curate, or Preacher, upon ſome Sunday in every quarter of a year, ſhall treatably, and audibly read theſe explanations of the regal Power here inſerted.</hi> and the words are ſet downe. In every of theſe Caſes (and forty more might bee inſtanced) there is more neceſſity of impoſitions than in teaching plaine Principles; Can it bee imagined Miniſters intruſted,
<pb n="50" facs="tcp:170378:35"/>
without any ſuch books or helps, in theſe more difficult points, will need them in the eaſieſt part of his Miniſtry? Is a Miniſter able to feed with ſtrong meat, and not fit to bee truſted with Babes and Lambs?</p>
<p>Obj. 5. <hi>It will conduce</hi> (ſay ſome) <hi>much to uniformity, and ſo to unity and peace, if the ſame order in this matter be obſerved throughout the Na<g ref="char:EOLhyphen"/>tion.</hi>
</p>
<p>
<hi>Anſ.</hi> This is the old Plea, and a means by which the Ceremonies and Common Prayer-book kept their ſtation ſo long amongſt us. There is an uniformity ariſing from the vertue of internal principles, as alſo from an external mould or frame, the one is <hi>free</hi> and natural, the other compelled and <hi>forced.</hi> Uniformity from internal Princi<g ref="char:EOLhyphen"/>ples is an excellency in Nature, and in Grace alſo. That an Acorn, a grain of Corn, a Kernel, a ſeed, from each a Body, and in its kinde the
<pb n="51" facs="tcp:170378:35"/>
like; the like leaf, bark, branch, fruit; it is true, not in ſmaller things ſo exact in likeneſſe as what you caſt in the ſame mould, yet for ſubſtance, and in the maine they are the ſame; all Vines, Cedars, every Plant, and every Herb in its kind, every Beaſt, and every Bird in its kind. And ſo is it with gra<g ref="char:EOLhyphen"/>cious and holy men, being <hi>a holy Seed,</hi> and having this <hi>Seed remai<g ref="char:EOLhyphen"/>ning in them,</hi> their converſation for the ſubſtance is the ſame, and ſo viſibly, <hi>uniforme,</hi> and the ſame, as the blinde World can diſtinguiſh them from other men.</p>
<p>So alſo in this part of their conver<g ref="char:EOLhyphen"/>ſation, their Service of God in his Ordinances; if the inſtitutions of Chriſt, and whatſoever hee in his Word hath preſcribed, as neceſſa<g ref="char:EOLhyphen"/>ry means, and circumſtances from more general Rules bee obſerved, by Miniſters that are gifted, indu<g ref="char:EOLhyphen"/>ſtrious, and gracious, you will have a natural, free, and comely unifor<g ref="char:EOLhyphen"/>mity,
<pb n="52" facs="tcp:170378:36"/>
and more to the glory of God, then to have all by external injunctions, caſt as it were in an artificial mould; ſuch a forced Conformity in all Ages hath been the occaſion of greateſt differences and diſturbances; I ſay, the neg<g ref="char:EOLhyphen"/>lect of Scripture Rules, which guide and direct an uniformity in matters of ſubſtance and greater conſequence, and by Canons and Injunctions erect an uniformity in matters of doubtful Diſpute, and not of much concernment if they were cleared. Thoſe Reverend <hi>N. Conformiſts</hi> that wrote the Ad<g ref="char:EOLhyphen"/>monition ſpoke very prudently to this; <hi>The only cauſe why our Church differeth from the Churches reformed of the Strangers, or among our ſelves, or they among themſelves is, becauſe our Church ſuffereth not it ſelf ſo to bee directed by the courſe of thoſe Scriptures as another doth, except it be in thoſe things of order, wherein one Pariſh may many times differ from
<pb n="53" facs="tcp:170378:36"/>
another without offence, following the general Rules of Scripture for order, as in appointing time, place, and the like,</hi> 2 Ad. pa. 42. The pretence of uniformity, and upon that ac<g ref="char:EOLhyphen"/>count taking liberty to impoſe doubtful Traditions, hath been in all Ages an Utenſile in the hands of Church Governours, by which they have exerciſed the greateſt tyranny, and put themſelves in a capacity to bring Miniſters under what bondage they pleaſe. One <hi>Councel</hi> Decrees, that <hi>all Miniſters must live ſingle lives,</hi> for unifor<g ref="char:EOLhyphen"/>mity. <hi>Bellarmine</hi> diſputes <hi>to have the Service in the ſame Language</hi> in all the Popes Dominions for uni<g ref="char:EOLhyphen"/>formities ſake, and what thing, be it ever ſo abſurd but may bee brought into this Liſt. Where Councels or Convocations have a minde to bee rid of thoſe, of more conſcientious and uncomplying ſpi<g ref="char:EOLhyphen"/>rits (tempting them by this means to that which they will call Schiſme
<pb n="54" facs="tcp:170378:37"/>
and ſeparation) they may thus eaſily compaſs their deſignes.</p>
<p>Ob. 6. <hi>Wee are bound by</hi> Cove<g ref="char:EOLhyphen"/>nant <hi>to uniformity in the Worſhip and Service of God, and in particu<g ref="char:EOLhyphen"/>lar to an uniformity in Catechiſing.</hi>
</p>
<p>
<hi>Anſw.</hi> I doe not beleeve the Covenant did, or doth binde us to any thing in the Worſhip of God, but what in conſcience and pru<g ref="char:EOLhyphen"/>dence we were bound to practice, and doe if there had been no Cove<g ref="char:EOLhyphen"/>nant; neither are wee bound to any other uniformity but what was but even now mentioned.</p>
<p n="2">2 The former part of the Diſ<g ref="char:EOLhyphen"/>pute in this Argument muſt bee refuted, before wee can thus rea<g ref="char:EOLhyphen"/>ſon; for if it bee a ſinful and un<g ref="char:EOLhyphen"/>warrantable addition in the Wor<g ref="char:EOLhyphen"/>ſhip of God <hi>beſides,</hi> or <hi>againſt</hi> the Word of God. The Covenant cannot <hi>make a crooked thing ſtrait,</hi>
<note place="margin">Eccl. 7.13.</note> or an evil thing good; a Cove<g ref="char:EOLhyphen"/>nant brought in ſo lately cannot make voyd any branch of the Co<g ref="char:EOLhyphen"/>venant
<pb n="55" facs="tcp:170378:37"/>
God made with his Church ſo many hundred years before it. And therefore it is added in our Covenant, <hi>according to the Word of God.</hi>
</p>
<p n="3">3 There is no Uniformity in any adminiſtration mentioned there, but ſuch as is neceſſary to ſuch an end as is there alſo propoſed, name<g ref="char:EOLhyphen"/>ly, <hi>that wee and our poſterity after us may as brethren live in faith and love, and the Lord may delight to dwell in the midſt of us;</hi> which cer<g ref="char:EOLhyphen"/>tainly will better bee accompliſhed without ſuch an external mould of conformity then with it. There was faith, and love, and peace a<g ref="char:EOLhyphen"/>mongſt godly Miniſters when Ca<g ref="char:EOLhyphen"/>techiſmes were, and were uſed in greateſt variety.</p>
<p n="4">4 We are bound by the Cove<g ref="char:EOLhyphen"/>nant to no ſtricter uniformity in a Catechiſme then wee are in other parts of Worſhip; now in no part of the Directory, or Worſhip there mentioned, are we bound to me<g ref="char:EOLhyphen"/>thod
<pb n="56" facs="tcp:170378:38"/>
and words, as appeareth evi<g ref="char:EOLhyphen"/>dently throughout the Directory; no nor are wee bound to the Di<g ref="char:EOLhyphen"/>rectory further then is explained in the Preface to it, for that was ſtood upon by a conſiderable party in the Aſſembly, and aſſented unto by the whole (and mentioned in the Committee of Accommodati<g ref="char:EOLhyphen"/>on as a foundation of an agree<g ref="char:EOLhyphen"/>ment, <hi>p.</hi> 4. which Preface profeſ<g ref="char:EOLhyphen"/>ſedly holds forth the intent of the Aſſembly in matters of Uniformity thus; <hi>Our meaning therein being on<g ref="char:EOLhyphen"/>ly that the general Heads, the ſenſe and ſcope of the Prayers, and other parts of Publique Worſhip being knowne to all, there may bee a conſent of all the Churches, in thoſe things that containe the ſubſtance of the Ser<g ref="char:EOLhyphen"/>vice and Worſhip of God; and the Miniſters may bee hereby directed in their Adminiſtrations to keep like ſoundneſſe in Doctrine and Prayer; and may, if need be, have ſome help and furniture: And yet ſo, as they
<pb n="57" facs="tcp:170378:38"/>
become not hereby ſlothful and negli<g ref="char:EOLhyphen"/>gent in ſtirring up the gifts of Chriſt in them: But, that each one, by me<g ref="char:EOLhyphen"/>ditation, by taking heed to himſelf and the Flock of God committed to him, and by wiſe obſerving the wayes of Divine Providence, may be care<g ref="char:EOLhyphen"/>full to furniſh his heart and tongue with further, or other materials of Prayer and</hi> Exhortation, <hi>as ſhall bee needful upon all occaſions.</hi>
</p>
<p n="5">5 It is not to an uniforme Cate<g ref="char:EOLhyphen"/>chiſme, but uniformity <hi>in Catechi<g ref="char:EOLhyphen"/>ſing</hi> in the Covenant, wee may be uniforme in Catechiſing, though we uſe not a Catechiſme, the ſame for matter and words; we may bee uniforme in preaching, though we bee not bound to the ſame Homily, the ſame forme of words; nay, though not uſe the ſame method, as to preach conſtantly by Do<g ref="char:EOLhyphen"/>ctrines, Reaſons, and Uſes, which is expreſly aſſerted in the Directo<g ref="char:EOLhyphen"/>ry for Preaching.</p>
<p>And ſuch were the Directories
<pb n="58" facs="tcp:170378:39"/>
of reformed Churches (as before was inſtanced) where I hope was <hi>Uniformity.</hi> Yea in <hi>Scotland</hi> it ſelf, the Uniformity ſtands not in being held to a ſameneſs of words, <hi>Habe<g ref="char:EOLhyphen"/>mus quidem nos etiam in Eccleſia,</hi> (ſaith a Learned <hi>Scotch-man) a<g ref="char:EOLhyphen"/>gendas & ordinem in ſacris cele<g ref="char:EOLhyphen"/>brandis ſervandum,</hi>
<note place="margin">Alex. D<gap reason="illegible" resp="#PDCC" extent="2 letters">
<desc>••</desc>
</gap>
</note>
<hi>ſed nemo alliga<g ref="char:EOLhyphen"/>tur, &c. proponuntur tantum ut pa<g ref="char:EOLhyphen"/>radgimata quib; precum materia & forma quo ad</hi> ſubſtantialia <hi>indecan<g ref="char:EOLhyphen"/>tur, non ut eiſdem verbis aſtringan<g ref="char:EOLhyphen"/>tur miniſtri; totos ego tredecim an<g ref="char:EOLhyphen"/>nos quibus functus ſum miniſterio ſive in Sacramenta ſive in aliis ſacris celebrandis precib; aut Exhortatio<g ref="char:EOLhyphen"/>nibus quae extant in agenda, unquam uſus ſum, ſic etiam aliis cumplures & omnibus etiam liberum idem fa<g ref="char:EOLhyphen"/>cere.</hi> That this is the uſe of a Di<g ref="char:EOLhyphen"/>rectory in the reformed Churches, appears in the words of Mr. <hi>Hooker</hi> in his Eccl. Pol. <hi>Wee hold it much better with the Church of</hi> Rome <hi>to appoint a preſcript forme, which eve<g ref="char:EOLhyphen"/>ry
<pb n="59" facs="tcp:170378:39"/>
man ſhall be bound to obſerve, then with them</hi> (the reformed Chur<g ref="char:EOLhyphen"/>ches) <hi>to ſet downe a kinde of Di<g ref="char:EOLhyphen"/>rectory, a forme for men to uſe if they liſt, or otherwiſe to change as it pleaſeth themſelves.</hi> There was an uniformity in bleſſing the people, yet if you compare <hi>Numbers</hi> 6.23. 2 <hi>Cor.</hi> 12.13. 2 <hi>Theſs.</hi> 3.17, 18. <hi>Heb.</hi> 13.20, 21. <hi>Jude</hi> 24, 25. together, you ſhall not finde their bleſſings the ſame for matter and words; no, nor in that which you call the Lords Prayer, if you com<g ref="char:EOLhyphen"/>pare <hi>Matthew</hi> 6.9.13. <hi>& Luke</hi> 11.2, 3, 4.</p>
<p>Ob. 7. <hi>It may be yet further argued, it will be an advantage when the younger ſort remove out of one Pariſh into another, as we finde in uſing the ſame Grammer, and other Bookes, it is an advantage when Children re<g ref="char:EOLhyphen"/>move from one Schoole to another.</hi>
</p>
<p>
<hi>Anſ.</hi> Formes beget a <hi>forme,</hi> but as they have little, ſo work little of the <hi>power</hi> of godlineſſe; the
<pb n="60" facs="tcp:170378:40"/>
ſcope of Miniſterial inſtruction is not only to faſten in the Memory, and accordingly by rote to repeat it thence; but to beget a groun<g ref="char:EOLhyphen"/>ded underſtanding, whether wee carry away the words or not, if variety of Catechiſms, and all ſound, and according to the Ana<g ref="char:EOLhyphen"/>logie of Faith, the Doctrine is the ſame though the words be not, and if it be received with underſtan<g ref="char:EOLhyphen"/>ding, wee ſhall acknowledge truth in what method or form of words ſoever wee meet with it; if it be not the ſame, but another Catechiſme, containing ſome few other truthes, yet ſuch poſſibly as are uſeful and neceſſary to be known as thoſe in a former Catechiſme, and ſo a means to increaſe knowledge.</p>
</div>
</div>
<div n="5" type="chapter">
<pb n="61" facs="tcp:170378:40"/>
<head>
<hi>CHAP. V.</hi> The ſecond Argument. Of Chriſtian Liberty, things indifferent, the particular Catechiſme deſigned, not ſo deſirable for this uſe; and how many wayes our Miniſterial Liberty is prejudiced by the impoſi<g ref="char:EOLhyphen"/>tion of it.</head>
<p>SUch an impoſition of a ſet Catechiſme, cannot bee ſub<g ref="char:EOLhyphen"/>mitted unto, and our Chriſtian Liberty preſerved. This was ano<g ref="char:EOLhyphen"/>ther Argument, brought by our ſuffering Brethren againſt former impoſitions, in the Worſhip of God in the Epiſcopal times. How much wee ought to ſtand for the preſervation of ſuch a Liberty they declare from theſe following Scrip<g ref="char:EOLhyphen"/>tures, <hi>Galath.</hi> 5.1. <hi>Col.</hi> 2.20, 21. 1 <hi>Cor.</hi> 7.23. and the like.</p>
<div n="1" type="section">
<pb n="62" facs="tcp:170378:41"/>
<head>§. 1.</head>
<p>For further explication of this argument. The reverend Divines of the Aſſembly in their Preface to the Directory for worſhip, ex<g ref="char:EOLhyphen"/>preſs themſelves thus; <hi>Our care hath been to hold forth,</hi> 1. <hi>Such things as are of Divine inſtitution in every Ordinance.</hi> 2. <hi>And other things wee have endeavoured to ſet forth, according to the rules of Chri<g ref="char:EOLhyphen"/>ſtian Prudence agreeable to the gene<g ref="char:EOLhyphen"/>rall rules of the Word of God.</hi> To theſe two heads therefore in their opinion, the ſubſtance of what Church Governours have either to injoyne, or commend in the Worſhip of God may bee redu<g ref="char:EOLhyphen"/>ced.</p>
<p>For the former, It will I ſup<g ref="char:EOLhyphen"/>poſe bee granted, as wee have al<g ref="char:EOLhyphen"/>ready endeavoured to prove, the particular Catechiſme, or any one forme for method and words is
<pb n="63" facs="tcp:170378:41"/>
not of an expreſs inſtitution; for if it were, it ought to be the ſame in all Churches, and Ages. For the ſecond, it is of ſuch things or circumſtances of Worſhip, as are not abſolutely neceſſary, but (com<g ref="char:EOLhyphen"/>pared with what is expreſly inſti<g ref="char:EOLhyphen"/>tuted) <hi>indifferent</hi> only. This I ſuppoſe to be Mr. <hi>B.</hi> meaning in what hee ſpeaks of ſet Formes of Prayer. <hi>It is granted,</hi> ſaith he,<note place="margin">Mr. <hi>Ball</hi> of Separa<g ref="char:EOLhyphen"/>tion. p. 4</note>
<hi>that no ſet forme of Prayer, or Liturgy it ſimply neceſſary either in publick or private, for then our Saviour Chriſt would by his Apostles have</hi> expreſ<g ref="char:EOLhyphen"/>ly <hi>ſet downe ſuch a one for an exact rule to all Chriſtians and Churches.</hi> And the like may wee ſay, in the words of Reverend Mr. <hi>Cotton,</hi>
<note place="margin">Anſwer to Mr. <hi>B.</hi> p. 3</note> of ſet formes of Catechiſing, <hi>To de<g ref="char:EOLhyphen"/>viſe and preſcribe,</hi> ſaith hee, <hi>a ſet Forme of words, wherein all the que<g ref="char:EOLhyphen"/>ſtions and anſwers ſhall run, and no other, wee know no warrant for that from Scripture. If God would have his people limited to a ſet forms of
<pb n="64" facs="tcp:170378:42"/>
words in Catechiſing, he would him<g ref="char:EOLhyphen"/>ſelf have preſcribed ſome ſet forme of his owne inſpiration, which might be defective in no Principles, nor in<g ref="char:EOLhyphen"/>commodious in any expreſsion.</hi> This Catechiſme then, or any the like, are of no other conſideration as a Catechiſme, or peculiar forme or method of inſtructing, but as ſuch things which are of an indifferent nature (according to the vulgar uſe of the word) and left to Pru<g ref="char:EOLhyphen"/>dence, and the general rules of Scripture, for particular determi<g ref="char:EOLhyphen"/>nation in practice.</p>
<p>Now as Church Governours ought not by a Law to inſtitute or make ſacred, what the Lord hath not conſecrated by ſome word of inſtitution; ſo where the Lord hath left any matters common, or indifferent in Worſhip, wee muſt not impoſe them as neceſſary; for as the former is againſt Chriſtian Piety, ſo is this againſt Chriſtian Liberty. Two particulars here will
<pb n="65" facs="tcp:170378:42"/>
need further explaining, 1. What is meant by things indifferent. 2. What by Chriſtian Liberty.</p>
</div>
<div n="2" type="section">
<head>§. 2.</head>
<p>A thing indifferent is either <hi>ab<g ref="char:EOLhyphen"/>ſolutely</hi> ſo, and ſuch a thing which <hi>ratione objecti nihil includit rectae rationi conforme aut difforme,</hi> that is, it is neither good nor evil: for the Moral goodneſs of Humane action ſtands in its conformity to right reaſon, and the Word of God. <hi>Comparativelie</hi> indifferent may bee explained thus, all deliberate acti<g ref="char:EOLhyphen"/>ons are to an end, what is moſt conformable, or conducing in right reaſon, and the minde of God, to ſuch an end is beſt; but where many things are found equally uſe<g ref="char:EOLhyphen"/>ful for ſuch a purpoſe, ſo that no more reaſon for the one than for the other, though each of theſe hee <hi>neceſſary</hi> in reſpect to the end, yet neither of them neceſſary,
<pb n="66" facs="tcp:170378:43"/>
but each <hi>indifferent</hi> in compariſon, or reſpect one to another.</p>
<p>Againe, we further diſtinguiſh: Humane Actions are conſiderable, either <hi>In actu ſignato & quoad ſpe<g ref="char:EOLhyphen"/>ciem,</hi> or in <hi>actu exercito, quoad in<g ref="char:EOLhyphen"/>dividuum.</hi> An Action hath its ef<g ref="char:EOLhyphen"/>ſence or kind from the object and end, but when it comes to exiſt and in being,<note place="margin">Nulla eſt individua actio Hu<g ref="char:EOLhyphen"/>man<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap> quae eſt indif<g ref="char:EOLhyphen"/>ferens, ſed propter circum<g ref="char:EOLhyphen"/>ſtantias neceſſerio, vel bona vel mala ſi Thomae & omnibus Thoma<g ref="char:EOLhyphen"/>ſtis credi<g ref="char:EOLhyphen"/>mus, cre<g ref="char:EOLhyphen"/>dendum eſt omnino Morton Apol. p. 1. lib. 1. cap 47.</note> there are other Cir<g ref="char:EOLhyphen"/>cumſtances that are inſeparable; as time, place, perſon, &c. wee may conceive or think of an action in our minde, in the bare ſpecifical nature of it without any of theſe, but wee cannot doe, or practiſe, but ſuch Circumſtances (being ne<g ref="char:EOLhyphen"/>ceſſary to all Humane Actions) muſt be taken in likewiſe; which Circumſtances doe not only change the nature of the action by its be<g ref="char:EOLhyphen"/>coming Morally good or evil, which before was indifferent; (hence the School-men aſſert, there is no individual action, or action exiſting, indifferent) but
<pb n="67" facs="tcp:170378:43"/>
ſome one of theſe Circumſtances proves effectual many times,<note place="margin">Humani actu non folum ex objecto ve<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>um ex circum<g ref="char:EOLhyphen"/>ſtantiis boni vel male eſſe dicantur. Aq. p. 2. 918. ar. 3.</note> to change that which was good in the general conſideration into evil, by reaſon of ſuch and ſuch Circum<g ref="char:EOLhyphen"/>ſtances. In the Worſhip and Service of God, thoſe Circumſtances that are not expreſly inſtituted, but in their general nature the ſame as the other Humane actions we term indifferent; but when wee come to practiſe, if the holy Service be<g ref="char:EOLhyphen"/>come leſs decent, orderly, or leſs to edification by reaſon of ſuch Circumſtances, though theſe Circumſtances are indifferent in their general nature, yet as applied to ſuch ſervices and actions they ceaſe to bee indifferent in their uſe, and become evil, and the ſervice it ſelf becomes evil by reaſon thereof.</p>
<p>To Preach, Pray, to give Sa<g ref="char:EOLhyphen"/>craments, theſe are holy duties, yet ſuch may bee the Circumſtan<g ref="char:EOLhyphen"/>ces of time, place, when, and where occaſions, or perſons to
<pb n="68" facs="tcp:170378:44"/>
whom, as theſe ſervices become evil, and to be refuſed if impoſed: as to be at our private Devotion in the Publick Aſſemblie,<note n="*" place="margin">As it is the man<g ref="char:EOLhyphen"/>ner of him that preacheth in Scot<g ref="char:EOLhyphen"/>land ſo ſoon as in the Pulpit. Maſter <hi>Marſhall</hi> when in Scotland refuſed this practice, being intreated to conforme to them; and Maſter <hi>G.</hi> droven out of Edenburgh, and another place after<g ref="char:EOLhyphen"/>wards for ſcrupling this conformity.</note> in the cor<g ref="char:EOLhyphen"/>ner of the ſtreets, <hi>Mat.</hi> 6.5.</p>
<p>To give Sacraments in private Houſes, at the Bed-ſides of ſick Perſons, to ſuch as are notoriouſly ſcandalous; to read Service, or Preach at Funeralls, this alſo hath been eſteemed evil from the Cir<g ref="char:EOLhyphen"/>cumſtance<note n="*" place="margin">Burial Sermons are put in the place of Tren<g ref="char:EOLhyphen"/>tals, whereout ſpring many abuſes, and therefore in the beſt reformed Churches are removed. <hi>Admon.</hi> p. <gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>3. It was ne<g ref="char:EOLhyphen"/>ver recorded or found in the New Teſtament or the Old, that God either appointed, or there was uſed any Service for, or at, and in the Burial of the dead, it is no part of the Mini<g ref="char:EOLhyphen"/>ſters work, it belongeth to him no more than to another; who played the Prieſt when <hi>Abraham</hi> buried his Wife, and <hi>Jacob</hi> his, and <hi>Stephen,</hi> &c. who preached at any of theſe Bu<g ref="char:EOLhyphen"/>rials? <hi>A reproof of the view, par.</hi> 2. <hi>S.</hi> 4. Many both godly and learned conſidering the original of Funeral Sermons from whence they came, and the end for which for the moſt part they are now obſerved, the honour of the dead, and the inriching the Preacher, &c. have no great affection to ſuch Sermons. Mr. <hi>Sherwoods</hi> Anſwer to Doct. <hi>Downham.</hi> Mr. <hi>Cartwright</hi> amongſt <hi>other reaſons</hi> gives this as one, being moſt ordinarily at the Funeral of the rich, and not of the poor; there is brought into the Church contrary to the Word of God an acceptation of perſons which ought not to be, and although the Miniſter may give to one more ho<g ref="char:EOLhyphen"/>nour than to another according as the civil Calling or de<g ref="char:EOLhyphen"/>gree requireth, yet in his Miniſtry, and that which pertain<g ref="char:EOLhyphen"/>eth to his Office, he ought to ſhew himſelfe indifferent, and therefore to preach as well at the death of the poor as the rich, and becauſe he cannot well doe both, it is convenient to leave both, <hi>Rep.</hi> 1. <hi>pa.</hi> 101. the like in the Diſcipline of <hi>Scotland,</hi> Mr. <hi>Hilderſham</hi> (as divers others of our Reverend <hi>N. C.</hi>) took order in his will, that there ſhould bee no Funeral Ser<g ref="char:EOLhyphen"/>mon at his burial. Mr. <hi>Clarks</hi> Martyr, p. 385. it is therefore no new peece of ſingularity in thoſe that ſtill ſcruple this pra<g ref="char:EOLhyphen"/>ctice.</note>
</p>
</div>
<div n="3" type="section">
<pb n="69" facs="tcp:170378:44"/>
<head>§ 3.</head>
<p n="2">2 By Chriſtian Liberty, the li<g ref="char:EOLhyphen"/>berty of our <hi>judgements,</hi> and liberty of <hi>practiſe,</hi> to judge of our Mini<g ref="char:EOLhyphen"/>ſterial work according to light re<g ref="char:EOLhyphen"/>ceived, and to practice according as we judge, <hi>every one is to give an account of himſelf.</hi> It is an abridge<g ref="char:EOLhyphen"/>ment of this liberty.</p>
<p n="1">1 <hi>In practice,</hi> when by reaſon of Humane Lawes or impoſitions,
<pb n="70" facs="tcp:170378:45"/>
I am conſtrained to doe otherwiſe in the Service and Worſhip of God, then in prudence or conſcience I judge my ſelf bound to doe, if there were no ſuch precept or im<g ref="char:EOLhyphen"/>poſition of man. If what Chriſt hath left free doth not ſtill remaine as free as Chriſt hath left it, and we yeeld to it, and comply accor<g ref="char:EOLhyphen"/>dingly; this is not to <hi>ſtand faſt in the liberty where-with Chriſt hath made us free.</hi> Take an inſtance in the loweſt breach upon this liberty in practiſe, as where a variety of things or Circumſtances, each whereof <hi>neceſſary</hi> in reſpect of the act or end, but in ſuch an equality, as in reſpect to each other there is an indifferency in <hi>compariſon:</hi> here now to bee limited to one, though it be equal and indifferent in other reſpects, yet it is a bondage, for it is not indifferent to me to bee free, or to bee limited, in a ſervice in which I promiſe my ſelf (from the dignity and excellency of it) a per<g ref="char:EOLhyphen"/>fect
<pb n="71" facs="tcp:170378:45"/>
freedome. There are divers forms of Prayer in the Scripture, to pitch upon ſome one, and impoſe the uſe of it, and in a greater fre<g ref="char:EOLhyphen"/>quency, as the Lords prayer. This our brethren judged againſt their Chriſtian Liberty, ſo though the reading of one Chapter in the Bi<g ref="char:EOLhyphen"/>ble, may be as edifying as another, and <hi>all Scripture is profitable,</hi> and ought to be read in publike, but to have the chapter for each day im<g ref="char:EOLhyphen"/>poſed, to bee read and no other, is one reaſon our Brethren oppoſed the Common-prayer book.</p>
<p n="2">2 <hi>In Opinion,</hi> thoughts are free, I may meditate and exerciſe my Faith, and reaſon to finde out and judge in any Chriſtian prac<g ref="char:EOLhyphen"/>tice what is good or evil, or good and better. Wee are abridged in this Liberty, more expreſly, when its impoſed upon mee to aſſent or ſubſcribe <hi>ex animo</hi> to the opinions of other men; It is alſo abridged by evident implication or
<pb n="72" facs="tcp:170378:46"/>
conſequence, when in actions leſt to mee in reſpect of circumſtances, to make choice of ſuch as are moſt conducible (as free and maſter of my own doings under Chriſt my Lord) I muſt notwithſtanding do other<g ref="char:EOLhyphen"/>wiſe than what I judge is beſt, becauſe ſome other thing or way is judged better by another, as, if others judge the <hi>Apocripha</hi> in ſome parts of it to bee more edi<g ref="char:EOLhyphen"/>fying than ſome Chapters in the Canonical Scriptures, though I judge otherwiſe, yet this being impoſed, I muſt do it; This the greateſt bondage and moſt ſinful. For in performances wherein I ought to do my beſt, and to that end have from Chriſt both abili<g ref="char:EOLhyphen"/>ty and liberty to do better; yet to pleaſe others in their commands I will comply to do what is worſe; willingly ſuſpending my own judgement, becauſe it ſeems to be better or beſt in theirs; This is either to ſin againſt light, or to
<pb n="73" facs="tcp:170378:46"/>
do away the liberty of my own judgement, and in the moſt ſlaviſh way to become a <hi>Servant to men.</hi>
</p>
<p>Having thus premiſed, I ſhall now lay down more diſtinctly, and enumerate the waies wherein ſuch impoſition being the ſame as in our caſe, is againſt Chriſtian liber<g ref="char:EOLhyphen"/>ty, or rather miniſterial liberty.</p>
</div>
<div n="4" type="section">
<head>§ 4.</head>
<p>In a Miniſterial teaching, or in<g ref="char:EOLhyphen"/>ſtructing of others, there are theſe three things to bee heeded, and that will engage the conſcience of him that inſtructeth.</p>
<p n="1">1 The <hi>Matter,</hi> that it be ſound and ſuitable to the capacity of ſuch who I am to inſtruct, as <hi>Milk for Babes,</hi> &c. Fundamentals and firſt principles to thoſe of a more low, and dull capacity.</p>
<p n="2">2 <hi>Form,</hi> That for method and words our meditations bee fitly carried forth and eaſily underſtood.</p>
<p n="3">
<pb n="74" facs="tcp:170378:47"/>
<note place="margin">1 Cor. 12.7</note>3 That <hi>the Gifts</hi> and Graces gi<g ref="char:EOLhyphen"/>ven in their great <hi>diverſity,</hi> by Je<g ref="char:EOLhyphen"/>ſus Chriſt bee exerciſed according<g ref="char:EOLhyphen"/>ly.</p>
<p n="1">1 For the <hi>Matter,</hi> 1 There are divers Miniſters of piety and worth, and ſuch as the preſent eſtabliſhment alloweth as publike preachers that cannot teach or urge others to beleeve that infants are to bee baptiſed. There are alſo ſome other, the like doubtfull and diſputable points, which we are ingaged to teach or quit our mi<g ref="char:EOLhyphen"/>niſtry. He that hath the charge of ſoules may not upon any con<g ref="char:EOLhyphen"/>ſideration teach another the leaſt matter that hee beleeves not him<g ref="char:EOLhyphen"/>ſelf,<note place="margin">Mat. 5.19</note> ſo that ſuch have not liberty to inſtruct and teach what accord<g ref="char:EOLhyphen"/>ing to their conſciences is judged truth.</p>
<p n="2">2 Though ever ſo ſound and Orthodox, yet its not made up of <hi>principles,</hi> of firſt truths or fun<g ref="char:EOLhyphen"/>damentals, though it bee ſuppoſed
<pb n="75" facs="tcp:170378:47"/>
and was to bee enjoyned as ſuch, for a man may bee ſaved that aſſents not to, nor beleeves many particulars laid down in that Ca<g ref="char:EOLhyphen"/>techiſme.</p>
<p>Again, do but compare <hi>Heb.</hi> 5. the latter end with chap. 6. &c. where is laid down what is fit do<g ref="char:EOLhyphen"/>ctrin, or matter for ſuch inſtructi<g ref="char:EOLhyphen"/>on, you will finde this Catechiſm nothing according to that directo<g ref="char:EOLhyphen"/>ry. There are not higher truths and ſtronger meat through out the whole Epiſtle to the <hi>Hebrews,</hi> or any other Scriptures than neceſ<g ref="char:EOLhyphen"/>ſarily muſt bee explained and taught, for the underſtanding this Catechiſme, which will eaſily ap<g ref="char:EOLhyphen"/>pear if you do but read over the former part of it.</p>
<p n="3">3 Though it were both ſound and ſutable, yet it is not Scripture, its not of <hi>divine inſpiration,</hi> its from a private or common gift, and therefore not to bee of pub<g ref="char:EOLhyphen"/>like interpretation. It is to bring
<pb n="76" facs="tcp:170378:48"/>
into the ſolemn worſhip and ſervice of God, the Compoſures and writings of men, to be of ſtanding uſe there: and in the likeneſſe and ſimilitude of the Scriptures, to be received, read publikely, interpre<g ref="char:EOLhyphen"/>ted and applied; Though the gifts I have received from Chriſt to that purpoſe bee equal, and my own Compoſures more ſutable and uſefull, yet they muſt give place, and all the Miniſters in the Nation, and wee know not for how many ages to come muſt thus ex<g ref="char:EOLhyphen"/>alt it, and do ſpecial reverence to this Catechiſme. Mr. <hi>Heiron,</hi> compoſed a Catechiſme wherein the Anſwers were the very words of Scripture, the like by one Mr. <hi>Scot, Anno</hi> 1642. another in the like way, by <hi>V.P. Anno.</hi> 1647. poſ<g ref="char:EOLhyphen"/>ſibly to preſerve this honour, as peculiar to the Scriptures, to bee as a Text, and the ſubject of our interpretation, and application for inſtruction, &c.</p>
<p n="4">
<pb n="77" facs="tcp:170378:48"/>4 You ſhall finde two third parts of that Catechiſme to bee as a Commentary or Expoſition upon, thoſe portions of Scrip<g ref="char:EOLhyphen"/>ture, in <hi>Exodus</hi> 20. and <hi>Matthew</hi> 6. commonly called the Lords Prayer, and ten Commandements To enjoyn Miniſters to receive into their Congregations for pub<g ref="char:EOLhyphen"/>like uſe Commentaries compoſed by men ſubject to errour, and <hi>ex animo</hi> to ſubſcribe to them (or that which is equivalent) to own them and teach them to others, not on<g ref="char:EOLhyphen"/>ly as truths, but the true meaning of the Spirit in ſuch or ſuch a text, is ſuch an impoſing as in the worſt of times the Miniſters of <hi>England,</hi> or any reformed Church hath not yet been acquainted with.</p>
</div>
<div n="5" type="section">
<pb n="78" facs="tcp:170378:49"/>
<head>§. 5.</head>
<p>The <hi>Form</hi> or <hi>Method</hi> of inſtru<g ref="char:EOLhyphen"/>cting the ignorant by ſet queſtions and anſwers (as in that catechiſm) is not unqueſtionably the beſt, and moſt to edification, in the judge<g ref="char:EOLhyphen"/>ment and experience of many ho<g ref="char:EOLhyphen"/>ly men, who have gone before us in this work.</p>
<p n="1">1 The reading inſtructions out of a Book, or learning and ſay<g ref="char:EOLhyphen"/>ing it by rote, is ſo dead and flat, as ſome godly Miniſters have cho<g ref="char:EOLhyphen"/>ſen (as more edifying;) firſt, to Preach principles and theſe funda<g ref="char:EOLhyphen"/>mental truths, in a more ſtirring and awakning way, as other truths; and then going over the Heads of ſuch a Sermon by queſtions, as Chriſt often dealt with his Diſci<g ref="char:EOLhyphen"/>ples after hee had preached,<note place="margin">Act. 8</note> and <hi>Philip</hi> with the Eunuch. <hi>Paul</hi> ſo inſtructed the ignorant,<note place="margin">1 Cor. 14.25</note> as a ſtir<g ref="char:EOLhyphen"/>ring efficacy did accompany, his
<pb n="79" facs="tcp:170378:49"/>
delivering theſe truths even to the converſion of ſuch as heard him.</p>
<p>Our brethren under Epiſcopacy in like manner ſcrupled, as in their <hi>admonition. Faith</hi> ſay they <hi>cometh by Preaching,</hi> Rom. 10. <hi>and not by reading</hi> in an ordinary way, <hi>it is not ſo much praying as ſaying a prayer, when it is read off from a book, nor ſo much preaching,</hi> or Catechizing as <hi>ſaying a Sermon,</hi> a Catechiſme when all is thus done by book.</p>
<p n="2">2 Some have conceived it moſt to edification, to lay down the principles as ſo many diſtinct The<g ref="char:EOLhyphen"/>ſis or Doctrines one after another, without the forming or interpoſing any ſuch leading queſtion. So Mr. <hi>Nicholas Bifield</hi> in his Prin<g ref="char:EOLhyphen"/>ciples, Biſhop <hi>Andrews</hi> in his Ca<g ref="char:EOLhyphen"/>techiſtical Doctrin and others, there is a Catechiſme Printed <hi>An<g ref="char:EOLhyphen"/>no.</hi> 1649. in this method, and in the preface, a perferring it before any other: as alſo the blame of ſet queſtions.</p>
<p n="3">
<pb n="80" facs="tcp:170378:50"/>3 Mr. <hi>Herbert Palmer,</hi> a holy faithful Paſtor, found it by much experience to bee the beſt way to inſtruct his people, by forming two ſorts of queſtions with two ſorts of Anſwers, whereof the one is a bare affirmative, or Negative, <hi>yea</hi> or <hi>no;</hi> conceiving the ordinary way <hi>not ſufficient to drop knowledge into narrow mouthed veſſels</hi> (as in his preface) <hi>I. W.</hi> now a publike profeſſor in <hi>Oxford</hi> being of the ſame Opinion, beſtowed the pains to put the matter of this Aſſem<g ref="char:EOLhyphen"/>bly Catechiſme into that form, and Printed it <hi>Anno</hi> 1649. who in his Epiſtle to the Reader tells us, this method is of more ad<g ref="char:EOLhyphen"/>vantage to the Learned than the o<g ref="char:EOLhyphen"/>ther, both in reſpect of memory and clearneſs of underſtanding the truths in the Catechiſme.</p>
<p n="4">4 A Godly induſtrious Miniſter, lately compoſed a Catechiſme, in which the childe or learner asked the queſtions, and the Miniſter or
<pb n="81" facs="tcp:170378:50"/>
parent gave the anſwer, which he conceived to be a method or forme more Scripture like than any o<g ref="char:EOLhyphen"/>ther, and for this method urgeth, <hi>Exodus</hi> 12.26, 27. <hi>Joſhua</hi> 4.6. <hi>John</hi> 3.4. <hi>Matthew</hi> 19.16, 17, &c.</p>
<p n="5">5 If the intereſting our memory in this work, if to bee able to re<g ref="char:EOLhyphen"/>taine and repeat the Principles of Chriſtian Religion readily; bee one of our great aimes in this exer<g ref="char:EOLhyphen"/>ciſe, as it is, if not the chiefeſt.<note place="margin">T.D. prin<g ref="char:EOLhyphen"/>ted, Anno 1649.</note> Then ſurely he that put the matter of this Catechiſme into Meeter (a me<g ref="char:EOLhyphen"/>thod warrantable from Scripture, <hi>David</hi> penned a Pſalme to give in<g ref="char:EOLhyphen"/>ſtruction) judged in his Conſci<g ref="char:EOLhyphen"/>ence this to be a forme or method moſt to edification, and if hee might have his liberty, would uſe it before any other.</p>
<p n="6">6 The length and ſhortneſs of a Catechiſme ought to be regarded according to the ſtate of the peo<g ref="char:EOLhyphen"/>ple we have to doe with. To that
<pb n="82" facs="tcp:170378:51"/>
end a larger Catechiſme by the Aſſembly, and received by the general Aſſembly of the Church of <hi>Scotland,</hi>
<note place="margin">Preface to larger Ca<g ref="char:EOLhyphen"/>techiſme.</note> as <hi>ſutable to ſuch as have made ſome proficiency in the know<g ref="char:EOLhyphen"/>ledge of the grounds of Religion,</hi> and this ſhorter which alſo is received by them, <hi>for Catechiſing ſuch as are of weaker capacitie;</hi> if holy expe<g ref="char:EOLhyphen"/>rienced Paſtors finde it expedient, by reaſon of various parts and abi<g ref="char:EOLhyphen"/>lities in the Learner, to compoſe variety of Catechiſme in this re<g ref="char:EOLhyphen"/>ſpect for the ſame place or Pariſh, how much more will it bee incon<g ref="char:EOLhyphen"/>venient to impoſe this one, only, throughout the Nation. Doctor <hi>Gouge,</hi> a diligent Catechiſer all his dayes, and of much experience, had three ſorts of Catechiſmes for length and ſhortneſſe, which hee ordinarily uſed for the inſtruction of his people of <hi>Black Fryers;</hi> Mr. <hi>Painter,</hi> Maſter <hi>Bradſhaw,</hi> Doctor <hi>Twiſs,</hi> and divers Miniſters have done the like; as Mr. <hi>Perkins,</hi> his
<pb n="83" facs="tcp:170378:51"/>
Six Principles, there is two ſorts, a ſhorter and longer, in one; So in a Catechiſme by Maſter <hi>J. Geere.</hi>
</p>
</div>
<div n="6" type="section">
<head>§. 6.</head>
<p>If conſcientiouſly a Miniſter that hath the Charge of Souls bee perſwaded, this forme or method of the Aſſembly bee not ſufficient, as Mr. <hi>Palmer</hi> in his Preface, or not ſo edifying (as others) at leaſt for the people of my charge. If I be<g ref="char:EOLhyphen"/>leeve alſo even in ſuch Circum<g ref="char:EOLhyphen"/>ſtances of methods and formes where is a difference, I am to chuſe what is moſt to edification, and am now limited to ſome one forme, that in my judgement is leſs to edification; I muſt in ſuch a caſe either by an implicite faith beleeve as the impoſers beleeve, which de<g ref="char:EOLhyphen"/>ſtroyes the liberty of my judge<g ref="char:EOLhyphen"/>ment, or bee limited from practi<g ref="char:EOLhyphen"/>ſing according to my judgement,
<pb n="84" facs="tcp:170378:52"/>
which is a greater bondage. The methods, and formes, and circum<g ref="char:EOLhyphen"/>ſtances of Worſhip, and the Ser<g ref="char:EOLhyphen"/>vice of Chriſt, which are left free by him, ought to remaine free, and in our Miniſtry we ought to doe no more, or otherwiſe in this kinde at the command of Church Gover<g ref="char:EOLhyphen"/>nours, then in prudence and con<g ref="char:EOLhyphen"/>ſcience wee judge our ſelves bound to doe if there were no command; where Chriſt hath left a liberty there needs a liberty; though the impoſition of ſome one forme may be ſutable to ſome few, yet the ſame if impoſed upon all, will be<g ref="char:EOLhyphen"/>come prejudicial to many. It is therefore frequently mentioned, (by thoſe that publiſh new Ca<g ref="char:EOLhyphen"/>techiſmes) as a reaſon why they did ſo, <hi>the ſtate of their Congregati<g ref="char:EOLhyphen"/>ons required it,</hi> their owne compo<g ref="char:EOLhyphen"/>ſures were more fit and ſutable in that reſpect then what was done by others. So Maſter <hi>Gataker,</hi> Dr. <hi>Hill,</hi> &c. in their Epiſtles to their Cate<g ref="char:EOLhyphen"/>chiſmes.</p>
</div>
<div n="7" type="section">
<pb n="85" facs="tcp:170378:52"/>
<head>§ 7.</head>
<p>If nothing faulty either in the matter or forme of this Catechiſm, yet wee enjoy not that miniſterial li<g ref="char:EOLhyphen"/>berty Chriſt hath left us, and that which hitherto, and even in the worſt times hath bin enjoyed in this Nation, and hitherto we have not beene ſtraightned or narrowed. It is true, a forme of Catechiſme is mentioned in the Common Prayer-book, but ſo as a liberty left, and taken to compoſe, or chuſe what Catechiſme a man judged more ſutable to his people for their edi<g ref="char:EOLhyphen"/>fication; and few Miniſters of e<g ref="char:EOLhyphen"/>minency in the Land but compoſed a diſtinct Catechiſme, there are I beleeve no leſs then five hundred ſeveral Catechiſmes extant; nay men of the Epiſcopal way, and ſuch as were punctual in obſerving the very hints of what was likely to be pleaſing or diſpleaſing to their
<pb n="86" facs="tcp:170378:53"/>
Lords, compoſed and publiſhed Catechiſmes for matter and me<g ref="char:EOLhyphen"/>thod differing from what was al<g ref="char:EOLhyphen"/>lowed by authority; as Doct. <hi>Hall,</hi> who was afterwards Biſhop, Dr. <hi>Featly,</hi> Dr. <hi>Chitwin,</hi> Dr. <hi>Hill,</hi> Mr. <hi>Pearſton,</hi> who dedicated his Cate<g ref="char:EOLhyphen"/>chiſme to the Biſhop of <hi>London,</hi> Mr. <hi>Vicars</hi> Chap. to Biſhop <hi>Carl<g ref="char:EOLhyphen"/>ton,</hi> and many others.</p>
<p>Neither hath this variety been looked upon as hurtful, for if ſo, then holy men would have kept to what they found, and have made conſcience of increaſing this evil by adding to the number; <hi>I finde</hi> (ſaith Dr. Gouge) <hi>in all ages of the Church,</hi>
<note place="margin">Epiſtle to his Cate<g ref="char:EOLhyphen"/>chiſme.</note>
<hi>God hath ſtirred up many of his Servants to publiſh ſeverall formes, all agreeable in the ſubſtance, and I obſerve among many other, theſe two good uſes to ariſe from thence, &c.</hi> which there hee ſpecifieth; nay, ſince this of the Aſſembly, com<g ref="char:EOLhyphen"/>poſed by a Synod of holy and lear<g ref="char:EOLhyphen"/>ned men, approved of, and com<g ref="char:EOLhyphen"/>mended
<pb n="87" facs="tcp:170378:53"/>
to the Nation by the Par<g ref="char:EOLhyphen"/>liament then ſitting, and received and ſetled in <hi>Scotland;</hi> yet mens Conſciences have not been ſatisfied in this, as the only Catechiſme fit to bee uſed, as appeareth in the great number and variety of Cate<g ref="char:EOLhyphen"/>chiſmes compoſed and printed ſince this was publiſhed, a greater number then in ſo ſhort a time were ever publiſhed before.</p>
<p>But ſuppoſe in all this variety of Catechiſmes there were no diffe<g ref="char:EOLhyphen"/>rence, no one better, but each e<g ref="char:EOLhyphen"/>qually as good, and edifying to my people as other; that which I now further aſſert is this, that in theſe Spiritual affaires, to impoſe or limit to ſome one in ſuch a caſe, is againſt Chriſtian Liberty, and our freedome as Miniſters; if a man hath obtained his Freedome in any Trade, hee is judged fit to ſet up in any part of the City, no man can limit him to any one Pre<g ref="char:EOLhyphen"/>cinct, though hee might drive his
<pb n="88" facs="tcp:170378:54"/>
Trade with as much advantage there as in any other place; nay, if a man ſhall enter into Bond to his Maſter not to ſet up his Trade in ſuch a ſtreet, or within ſuch a di<g ref="char:EOLhyphen"/>ſtance from him, this Bond is voyd in Law, ſo tender are our Lawes of Humane liberty.</p>
<p>The <hi>Lords Prayer,</hi> ſo tearmed, is beyond Controverſie, as edifying as any other Prayer in the Scrip<g ref="char:EOLhyphen"/>ture, yet our Brethren the <hi>N. C.</hi> could not ſubject to ſuch an impo<g ref="char:EOLhyphen"/>ſition, as gave a preheminence, or more ſtated uſe of this one Scrip<g ref="char:EOLhyphen"/>ture Prayer above all the reſt, the refuſal of ſuch an uſe of that Prayer was one thing for which Mr. <hi>Hooker</hi> could not have the liberty of his Miniſtry with Mr. <hi>Paget</hi> at <hi>Amster<g ref="char:EOLhyphen"/>dam,</hi> when for N. Conformity hee was enforced by the Biſhops to make that his refuge. It was an Objection againſt the Common Prayer Book, that in the Calen<g ref="char:EOLhyphen"/>der ſome Scriptures were to bee
<pb n="89" facs="tcp:170378:54"/>
read every year, and ſome oftner, and ſome part of Canonical Scrip<g ref="char:EOLhyphen"/>ture not to be read in publick at all; <hi>â pari ratione</hi> in ordinary gifts, to exalt any one work or compoſition by ſuch a ſolemn ſanction, above all that hath been, or ſhall be, and limit us from the like publick uſe of any other, though from men of equal gifts and graces, is an abridg<g ref="char:EOLhyphen"/>ment of our Liberty, ordinary as well as extraordinary gifts are from <hi>Chriſt,</hi> and for <hi>his</hi> ends.</p>
</div>
<div n="8" type="section">
<head>§ 8.</head>
<p>The third particular by which in ſuch impoſitions wee are abridged of our Liberty, it is in reſpect of the gifts and abilities wee have re<g ref="char:EOLhyphen"/>ceived from Chriſt. It is the pri<g ref="char:EOLhyphen"/>viledge of a Miniſter to have liber<g ref="char:EOLhyphen"/>ty to imploy his owne talent, there is an honour and reward in ſo do<g ref="char:EOLhyphen"/>ing, <hi>Our labour and ſtudy ſhall not bee loſt in the Lord, every man ſhall re<g ref="char:EOLhyphen"/>ceive
<pb n="90" facs="tcp:170378:55"/>
according to his owne work, and the talents hee hath imployed:</hi> the <hi>Diſciples work</hi> hath but a Diſciples reward, but the <hi>Prophets</hi> worke a Prophets reward; If the Lord Chriſt hath put into my hand and truſt, Prophets or Paſtors worke, and gifts and talents ſutable, if I bee faithful, and put my ſelf out accordingly, I ſhall accordingly be <hi>accepted</hi> of the Lord; if I <hi>fulfill my Miniſtry,</hi> I ſhall not come ſhort of a full reward.</p>
<p>Wee are equally intruſted with the <hi>Lambs</hi> as with the Sheep, with the <hi>weake</hi> as with the ſtrong, and to ſhew our love to Chriſt in fee<g ref="char:EOLhyphen"/>ding the one as well as the other; wee are upon this account Debtors, <hi>both to the Greeks and to the Barbari<g ref="char:EOLhyphen"/>ans, both to the wiſe and to the un<g ref="char:EOLhyphen"/>wiſe,</hi> Rom. 1.14.</p>
<p>It is laid on us not only to find out fit & ſutable matter for ſuch inſtru<g ref="char:EOLhyphen"/>ction, but expreſſions and words; to this end Chriſt hath given gifts of
<pb n="91" facs="tcp:170378:55"/>
<hi>utterance</hi> as well as a gift of know<g ref="char:EOLhyphen"/>ledge; and whatſoever gift we have received wee muſt ſtir up and uſe, Eccl. 12.9. <hi>The Preacher was wiſe, hee taught the people knowledge, hee gave good heed, and ſought out, and ſet in order — the Preacher ſought to finde out acceptable words;</hi> ſo that matter, and order, and words, and all is by Chriſt intruſted with the Preacher, it is not for him to en<g ref="char:EOLhyphen"/>quire what the State, or a Synod hath <hi>ſought out and ſet in order.</hi> The truth is, hee who is to be the mouth of God, and to whom it is given to ſpeake from him to the people, to him belongs the find<g ref="char:EOLhyphen"/>ing out both of matter and words, <hi>Pſal.</hi> 19.14. hence thoſe to whom to inſtruct others belongeth, are dealt with by the Apoſtle about the method and forme of words in which that holy duty is to bee ma<g ref="char:EOLhyphen"/>naged, 1 <hi>Cor.</hi> 14.9. <hi>ſo likewiſe ex<g ref="char:EOLhyphen"/>cept you,</hi> even you, <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>, you that are to Prophecy, to inſtruct,
<pb n="92" facs="tcp:170378:56"/>
<hi>utter by the tongue words ſignificant;</hi>
<gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>, (a word well and apt<g ref="char:EOLhyphen"/>ly ſignifying) how ſhall it bee known what is ſpoken, ſaith the Apoſtle. If I had not warrant, if it were not my liberty and priviledge to expreſſe my owne matter in my owne words; faylings and faults in expreſſions would not bee ac<g ref="char:EOLhyphen"/>counted as my ſin, but raſh inapt unſignificant expreſſions, tau<g ref="char:EOLhyphen"/>tologies,<note place="margin">Word or ſpeech, ſo <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>
</note> &c. wee finde in Scrip<g ref="char:EOLhyphen"/>ture charged upon thoſe that pray, or inſtruct,<note place="margin">& non ſim<g ref="char:EOLhyphen"/>plex vox ſeu dictio ſed inte<g ref="char:EOLhyphen"/>gra ſen<g ref="char:EOLhyphen"/>tentia ſeu rei narra<g ref="char:EOLhyphen"/>tio.</note>
<hi>Eccleſ.</hi> 5.2. <hi>Let not thy heart be haſty to utter any</hi> thing; the conceptions of my heart are my charge & to be expreſſed in fit ſigni<g ref="char:EOLhyphen"/>ficant words; whoſoever was the Author of the Jewiſh Leiturgye, the <gap reason="foreign">
<desc>〈 in non-Latin alphabet 〉</desc>
</gap>, and <hi>vaine repetition</hi> is charged upon him that officiates, <hi>Matth.</hi> 6.7.</p>
<p>Now then, to have an imbargo more or leſſe put upon the talents, the ſtock wee are intruſted with from Chriſt, the improvement
<pb n="93" facs="tcp:170378:56"/>
whereof ſhall be ſo richly rewarded, this is directly againſt the liberty and priviledge of a Goſpel Mi<g ref="char:EOLhyphen"/>niſtry.</p>
</div>
<div n="9" type="section">
<head>§ 9.</head>
<p>It is an honourable imployment, the honour and dignity of it is in this, the uſe of his gifts, with in<g ref="char:EOLhyphen"/>duſtry and <hi>labour in the word and Doctrine,</hi> 1 Tim. 5.17. if others ſhare in the work, if they ſhare not in the honour it is a wrong, <hi>Hos ego verſiculos feci tulit alter honorem,</hi> it is a diſhonour to pretend to Poetry, and yet repeat another mans Ver<g ref="char:EOLhyphen"/>ſes as if mine owne;<note place="margin">Adm. p. 10</note> to pretend to bee a Teacher or Leader, and yet not able <hi>to lead but by other mens Lights.</hi> To goe with Crutches, carry my arme in a Skarfe, or uſe Spectacles, when the man is ſound and needs no ſuch helps, it is a diſ<g ref="char:EOLhyphen"/>honour to him, hee goeth in the eſteeme of others as an infirm man,
<pb n="94" facs="tcp:170378:57"/>
infirm in hands, and feet, and eyes. To <hi>uſe</hi> a ſet forme of inſtruction of another mans compoſing, argueth a defect <hi>in ability,</hi> as if not <hi>able</hi> to teach, to <hi>impoſe</hi> it under ſuch pe<g ref="char:EOLhyphen"/>nalties, a defect <hi>in will,</hi> as not <hi>apt</hi> to teach; and what greater diſho<g ref="char:EOLhyphen"/>nour can bee put upon the Miniſtry of the Nation than this, that they are neither <hi>able</hi> nor <hi>willing</hi> to in<g ref="char:EOLhyphen"/>ſtruct the poore ignorant Soules committed to their charge, eſpeci<g ref="char:EOLhyphen"/>ally in an age wherein a more ſtrict way than ever is taken, to keep and caſt out ſuch as are not both for gifts and grace fitly qua<g ref="char:EOLhyphen"/>lified for the Miniſtry. Had it been in the dayes of old, when the Common Prayer-book Catechiſm was formed, when formes for Prayer, Preaching, Sacraments, Marrying, Burying, and all by the Book, ſome more ground for ſuch an impoſition; Upon this account Doctor <hi>Burges,</hi> after hee had ſub<g ref="char:EOLhyphen"/>ſcribed three times, refuſed ſub<g ref="char:EOLhyphen"/>ſcription,
<pb n="95" facs="tcp:170378:57"/>
becauſe not like neceſſity of ſuch helps for Prayer, &c. when a more able Miniſtry. Let an effectual courſe bee taken to bring the ig<g ref="char:EOLhyphen"/>norant of each Pariſh, young and old to a more familiar way of per<g ref="char:EOLhyphen"/>ſonal inſtruction, it will quickly appear there is a greater number of Miniſters throughout the Nati<g ref="char:EOLhyphen"/>on than in former ages, that are both able and willing, without ſuch poor helps, to doe the work in ſome meaſure Chriſt hath intruſted them with; which if they bee, it is an abridgment of their priviledge and honour, to put the worke in part or in whole upon others, as if they were not ſufficient for one of the loweſt performances that be<g ref="char:EOLhyphen"/>longs to their calling.</p>
<p>I ſay, young and old, if igno<g ref="char:EOLhyphen"/>rant, for ſuch was the care former<g ref="char:EOLhyphen"/>ly in our Diſcipline, as appears in the 71. Canon <hi>They ſhall teach the Catechiſme, and therein ſhall in<g ref="char:EOLhyphen"/>ſtruct all their Flock, of what age or
<pb n="96" facs="tcp:170378:58"/>
degree ſoever, not only Maidens and Children, but alſo the elder if need be;</hi> And under moſt ſevere pe<g ref="char:EOLhyphen"/>nalties, whereof this is one, that no Perſons <hi>might bee married; except before they have learned the Princi<g ref="char:EOLhyphen"/>ples of Chriſtian Religion, and can<g ref="char:EOLhyphen"/>not fitly and aptly anſwer to all the parts of the Catechiſme.</hi> And this, will bring us to another particu<g ref="char:EOLhyphen"/>lar, wherein Miniſterial liberty is abridged.</p>
</div>
<div n="10" type="section">
<head>§. 10.</head>
<p>It is certainly the duty of the Miniſter to inſtruct all, with reſpect to their capacity, giving each a portion in due ſeaſon; <hi>ſtrong meat to ſuch whoſe ſenſes are exerciſed,</hi> and <hi>Milk to Babes,</hi> and this with<g ref="char:EOLhyphen"/>out reſpect to their years or age, if for years <hi>fit to bee Teachers</hi> (which according to the manner of the <hi>Jewes,</hi> and ancient Canons ſince, ſuppoſeth perſons to bee above
<pb n="97" facs="tcp:170378:58"/>
one and twenty years) yet if at this age <hi>dull</hi> and ignorant,<note place="margin">Heb. 5.</note> they <hi>ought to bee taught the very Principles of the Oracles of God.</hi> And it is the duty of the Magiſtrate, to cauſe all ſorts to obſerve the Sab<g ref="char:EOLhyphen"/>bath, and come to the publick Aſſemblies, and to ſubmit to inſtru<g ref="char:EOLhyphen"/>ction, as well the <hi>old</hi> as the <hi>young,</hi> the <hi>married</hi> as the <hi>unmarried.</hi> It is true, we are not forbidden to Ca<g ref="char:EOLhyphen"/>techiſe the elder: But to put the younger ſort, and thoſe that are unmarried only, under the edge of the Law, is ſuch a kind of <hi>exemption</hi> as ſecretly will harden the elder, (though ever ſo ignorant) as if <hi>by Law</hi> approved of as leſſe needing to bee taught than o<g ref="char:EOLhyphen"/>thers. It will bee a very hard matter for a Miniſter, to get any that are married, or above one and twenty years of age to ſubmit to ſuch inſtruction. Miniſters are in a better condition for the reducing their people into order and ſubjecti<g ref="char:EOLhyphen"/>on
<pb n="98" facs="tcp:170378:59"/>
in many Caſes, when none at all, than when only a <hi>half proviſion</hi> is made.</p>
<p>The exerciſe of <hi>Diſcipline</hi> in our Congregations, was ordered by the Parliament, but limited likewiſe to an enumeration of the ſins, for which wee might <hi>Excommunicate;</hi> exempting other Sinners that were as much under our charge. This was looked upon by the <hi>Aſſembly</hi> as a great abridgement of their Miniſterial liberry, and ſo great; as they profeſſed it could not with a good Conſcience be ſubmited un<g ref="char:EOLhyphen"/>to, as not being able to performe their truſt which they received from Jeſus Chriſt, and muſt give an account of, to him, reſolving, to <hi>ſtand faſt in the liberty where<g ref="char:EOLhyphen"/>with Chriſt hath made them free.</hi>
</p>
</div>
</div>
<div n="6" type="chapter">
<pb n="99" facs="tcp:170378:59"/>
<head>
<hi>CHAP. VI.</hi> The third Argument: Taken from the impoſition and penalty, the ſe<g ref="char:EOLhyphen"/>verity and inequality of it.</head>
<div n="1" type="section">
<head>§. 1.</head>
<p>A Third Argument is taken from the <hi>impoſition and pe<g ref="char:EOLhyphen"/>nalty.</hi> Since a bleſſed reformation, and ſeaſonable Goſpel-freedom hath been wrought out, for the people of God; this is the firſt im<g ref="char:EOLhyphen"/>poſition, with penalty, that hath been endeavoured upon the Mini<g ref="char:EOLhyphen"/>ſters of Chriſt: Nor hath this work, (the Catechiſing of the younger ſort) by any Parliament as yet been ſo impoſed upon Miniſters.</p>
<p>There was a Catechiſm in the beginning of <hi>Edw.</hi> 6. which after<g ref="char:EOLhyphen"/>wards was enlarged and confirmed
<pb n="100" facs="tcp:170378:60"/>
by authority of Parliament, but the uſe of it, was not enjoyned with a penalty; to be inflicted upon thoſe that ſhould doe otherwiſe, as there was for other matters in the Com<g ref="char:EOLhyphen"/>mon-Prayer book: So that a liber<g ref="char:EOLhyphen"/>ty was generally taken by godly Miniſters, to uſe publickly what form of inſtruction they judged moſt ſuitable to their peoples ca<g ref="char:EOLhyphen"/>pacity.</p>
<p>There hath been <hi>hundreds</hi> of Catechiſms uſed and publiſhed, ac<g ref="char:EOLhyphen"/>cording to the variety of <hi>gifts</hi> in thoſe that compoſed them, and <hi>ca<g ref="char:EOLhyphen"/>pacity</hi> of thoſe that were to be in<g ref="char:EOLhyphen"/>ſtructed. And this liberty was en<g ref="char:EOLhyphen"/>joyed throughout the Nation from the beginning of Reforma<g ref="char:EOLhyphen"/>tion until towards the latter end of the Biſhops reign, and then though they themſelves had been the <hi>Authors</hi> of Catechiſms for<g ref="char:EOLhyphen"/>merly, yet began to bee ſevere a<g ref="char:EOLhyphen"/>gainſt this liberty, and enjoyn the uſe of the <hi>Common-prayer</hi>-Books Catechiſm <hi>only.</hi>
</p>
</div>
<div n="2" type="section">
<pb n="101" facs="tcp:170378:60"/>
<head>§. 2.</head>
<p>There is conſiderable in this im<g ref="char:EOLhyphen"/>poſition and penalty annexed,
<list>
<item>1 <hi>The greatneſſe and inequality of it;</hi> and</item>
<item>2 <hi>The evil conſequences that will follow upon it.</hi>
</item>
</list>
</p>
<p n="1">1 The penalty or puniſhment is expreſſed thus, or to ſuch purpoſe; <q>If any Miniſter receiving the States maintenance, miſſe Cate<g ref="char:EOLhyphen"/>chiſing (a particular Catechiſm is preſcribed) <hi>ten</hi> Sabbath days in a whole year, unleſſe it be upon ſuch cauſe as <hi>two Juſtices</hi> ſhall approve of, ſuch omiſſions being proved by the Oath of any two witneſſes, this perſon is to bee ejected out of his Living, as a negligent and ſcandalous Mini<g ref="char:EOLhyphen"/>ſter.</q>
</p>
<p>Our Reverend <hi>Fathers</hi> (who many years groaned under this pe<g ref="char:EOLhyphen"/>nalty for Epiſcopal or Common-Prayer-Books
<pb n="102" facs="tcp:170378:61"/>
Non Conformity) expreſſe themſelves ſadly thus: <hi>We thought that in equity our fault, and in diſcretion our Calling, is to bee regarded, that puniſhment deſerved, exceed not the fault committed. But</hi> loſs of living <hi>by deprivation or ſuſ<g ref="char:EOLhyphen"/>penſion is the next puniſhment to death;</hi>
<note place="margin">Eccleſ. 34.23.</note>
<hi>therefore wee complain that more than</hi> ſeverity <hi>is done againſt us, for if it bee a grievous puniſhment to fine a</hi> Lay-men <hi>(ſo called) ten, twenty, or thirty pound, may not the grieved ſpirits of faithful Miniſters ſigh, yea cry unto God for that their bondage is ſuch, that only Omiſsion, and that of Conſcience with peace,</hi>
<note place="margin">Trial of Subſ. p. 15</note>
<hi>is corrected with no leſſe puniſhment than</hi> loſs of living.</p>
<p>Through the Biſhops rigour ma<g ref="char:EOLhyphen"/>ny were ejected, about the begin<g ref="char:EOLhyphen"/>ning of K. <hi>James</hi> his Reign: But men were ſo ſenſible of the great diſ<g ref="char:EOLhyphen"/>couragement upon the hearts of godly Miniſters by reaſon thereof, that the Members of the Houſe of
<pb n="103" facs="tcp:170378:61"/>
Commons in the Parliament, <hi>Anno</hi> 1610. thus Petitioned the King; <q>Whereas divers painful and lear<g ref="char:EOLhyphen"/>ned Paſtors, that have long time travelled in the work of the Mi<g ref="char:EOLhyphen"/>niſtry, with good fruit and bleſ<g ref="char:EOLhyphen"/>ſing of their labour, have been <hi>removed</hi> from their Eccleſiaſti<g ref="char:EOLhyphen"/>cal Livings, being their <hi>Free-hold,</hi> and debarred from all means of maintenance, to the great grief of ſundry your Majeſties well-affected Subjects; we therefore humbly beſeech your Majeſty would bee graciouſly pleaſed, that ſuch deprived and ſilenced Miniſters, Living quietly and peaceably, may be reſtored, &c.</q>
</p>
</div>
<div n="3" type="section">
<head>§. 3.</head>
<p>And yet there was a tenderneſs in thoſe Laws, in many reſpects more than would have been found in this. 1 There were <hi>expreſsions</hi> in them whereby the crime is placed in
<pb n="104" facs="tcp:170378:62"/>
ſuch omiſsions only as are from <hi>wil<g ref="char:EOLhyphen"/>fulneſs</hi> and <hi>contempt</hi> to authority; ſo 13. of <hi>Eliz.</hi> cap. 12. <hi>Such as refuſe to uſe the form preſcribed for Prayer and Sacraments, or OBSTINATELY uſe any other, either form or Ceremony;</hi> ſo in the Queens injunctions, <hi>No man ought</hi> obſtinately <hi>and</hi> maliciouſly <hi>to break and violate the laudable Ce<g ref="char:EOLhyphen"/>remonies of the<g ref="char:cmbAbbrStroke">̄</g> Church, commanded by publick authority to be obſerved, Inj.</hi> 22.<note place="margin">Non qua<g ref="char:EOLhyphen"/>liſcun<expan>
<am>
<g ref="char:abque"/>
</am>
<ex>que</ex>
</expan> mandati praeteritio crimina<g ref="char:EOLhyphen"/>lem facit in obedien<g ref="char:EOLhyphen"/>tiam ſed repugnare ſed nolle obedire.</note> But no ſuch indulgence in <hi>THIS CASE.</hi> The penalty falls to the full upon the moſt peaceable, if he refuſe; though his recuſancy be from ever ſo much tenderneſſe or doubtfulneſſe in Conſcience.</p>
<p>Thus our <hi>Brethren</hi> formerly com<g ref="char:EOLhyphen"/>plained of the Biſhops, who were more ſevere than the Law. <hi>If ſuch only are openly to be rebuked as openly break the Traditions of the Church, through private judgement, and</hi> con<g ref="char:EOLhyphen"/>temptuous <hi>wilfulneſſe, then only omiſ<g ref="char:EOLhyphen"/>ſion (and that of Conſcience with peace) deſerves not ſo publick and</hi>
<pb n="105" facs="tcp:170378:62"/>
extreme <hi>puniſhments, as</hi> deprivation <hi>and ſuſpenſion.</hi>
</p>
<p n="2">2 An Eccleſiaſtical Cenſure from the <hi>Ordinary,</hi> prevented the penalty in that ſtatute, for the firſt offence, or if not, it was but the loſſe of one years profits. He was not ejected from all, and for ever, as in <hi>this caſe</hi> for his firſt tranſgreſ<g ref="char:EOLhyphen"/>ſion.</p>
<p n="3">3 Not only two Witneſſes, (which is all required in <hi>this caſe</hi>) but the perſon offending muſt <hi>bee lawfully convicted according to the Lawes of this Realm,</hi>
<note place="margin">Stat. 1. <hi>E<g ref="char:EOLhyphen"/>liz.</hi>
</note> which is <hi>by the Verdict of a ſworn Jury</hi> in <hi>open Court,</hi> before <hi>ſworn Judges;</hi> as the intereſts in other Free-hold States were tried, before he could bee e<g ref="char:EOLhyphen"/>jected. The Statute alſo was pen<g ref="char:EOLhyphen"/>ned with ſo much caution and in<g ref="char:EOLhyphen"/>dulgence to Miniſters,<note place="margin">Certain Conſults, pag. 14.</note>
<hi>That good Lawyers</hi> (ſaith one) <hi>even ſuch as afterwards were Judges; have profeſſed it almoſt impoſsible ſo to frame an</hi> Indictment <hi>upon that Statute a<g ref="char:EOLhyphen"/>gainst
<pb n="106" facs="tcp:170378:63"/>
a Miniſter, that is not tra<g ref="char:EOLhyphen"/>verſable and avoidable.</hi>
</p>
<p n="4">4 If the Miniſter offending bee not indicted for it the very next <hi>general Seſsions</hi> after his treſpaſs committed, or breach of the Law; he could never afterwards bee im<g ref="char:EOLhyphen"/>peached or moleſted for that offence; but there is no ſuch pro<g ref="char:EOLhyphen"/>viſion here, but having once offen<g ref="char:EOLhyphen"/>ded, danger hangs over our heads all our days.</p>
<p n="5">5 And ſuch a penalty threatned as in <hi>THIS CASE</hi> is the more grievous to the Miniſters of the Goſpel; when <hi>others,</hi> farre their inferiours, for the ſame offence are more ten<g ref="char:EOLhyphen"/>derly treated. Caution and provi<g ref="char:EOLhyphen"/>ſion in the ſame Law is made for School-maſters, Parents, &c. (to whom the duty as much appertai<g ref="char:EOLhyphen"/>neth as to Miniſters) that the pu<g ref="char:EOLhyphen"/>niſhment for their omiſſion in any kind <hi>ſhall not exceed a Fine of five ſhillings.</hi>
</p>
</div>
<div n="4" type="section">
<pb n="107" facs="tcp:170378:63"/>
<head>§. 4.</head>
<p>It is evident therefore the pu<g ref="char:EOLhyphen"/>niſhment for this Non-Conformity hath more ſeverity in it, than what was formerly, for <hi>Common-Prayer-Books Non-conformity;</hi> and yet, (w<hi rend="sup">ch</hi> will increaſe the grief of thoſe that ſuffer,) the neceſſity and reaſon of any ſuch impoſition is not ſo evi<g ref="char:EOLhyphen"/>dent, as it was for impoſitions of this nature in former times.</p>
<p n="1">1 The Miniſtry was very low and impotent in thoſe dayes, by reaſon of late Perſecution. Few left of Learning that were ſound, and of the true religion.<note place="margin">8 <hi>Eliz.</hi> Jnj. 33.</note>
<hi>Children and ſuch as were utterly unlearned, if they could read were put into the Mi<g ref="char:EOLhyphen"/>niſtry,</hi> nay ſuch as could not read En<g ref="char:EOLhyphen"/>gliſh perfectly, <hi>Such as were but mean Readers, were enjoyned to peruſe over before, once or twice, the Chapters and Homilies, to the intent they might read to the better underſtanding of the peo<g ref="char:EOLhyphen"/>ple,
<pb n="108" facs="tcp:170378:64"/>
and the more incouragement of godlineſſe.</hi> In the <hi>Arch-Deacons</hi> Vi<g ref="char:EOLhyphen"/>ſitation, the Miniſters had <hi>ſome part of the New Teſtament given un<g ref="char:EOLhyphen"/>to them by him to learn without book,</hi> (ſo mean they were) <hi>and at the next Synod to make repetition of it.</hi>
<note place="margin">
<hi>Marie</hi> Canons of 1571. pag 9.</note>
</p>
<p>Being thus low in their gifts they ſtood in need of ſuch helps, and by holy and learned men the Leitour<g ref="char:EOLhyphen"/>gie and Homilies then impoſed up<g ref="char:EOLhyphen"/>on that account were <hi>ſubſcribed</hi> unto, by ſuch perſons who after<g ref="char:EOLhyphen"/>wards refuſed when there was a more able Miniſtry: theſe helps were looked upon as <hi>fitting,</hi> and in ſome reſpect <hi>neceſſary</hi> for that age, by the ſame perſons who ſuffered for Non-ſubſcription afterwards.</p>
<p n="2">2 There was yet a further and very great conſideration for this ſtrict uniformity, and keeping to a <hi>book appointed;</hi> it being the zeal of that age (which, if not kindled, yet the heat of it very much en<g ref="char:EOLhyphen"/>creaſed by the flames of Perſecu<g ref="char:EOLhyphen"/>tion
<pb n="109" facs="tcp:170378:64"/>
in Queen <hi>Maries</hi> dayes) to root out <hi>Papiſts,</hi> which could not be done without a means to diſco<g ref="char:EOLhyphen"/>ver who were ſuch. One way then judged fit for ſuch a diſcovery was this; their conforming or not, to the ſervice and adminiſtration of Sacra<g ref="char:EOLhyphen"/>ments as then eſtabliſhed; and all therefore about the age of 16 years were injoyned to <hi>receive,</hi> as it was termed, once a year at the leaſt.</p>
<p>Now without ſuch an <hi>expreſſe</hi> and <hi>preciſe</hi> form of words in this adminiſtration as are pleadable in a Court of Juſtice; recuſancy could not legally bee thence adjudged. For if ſuch forms had not been thus <hi>ſtrictly</hi> held to, by little alterati<g ref="char:EOLhyphen"/>ons <hi>backward</hi> (poſſibly no more than what was done in that <hi>Book</hi> ſent to <hi>Scotland</hi>) towards the Maſſe-book, out of which they were taken: the Service and Sacraments might have been ſo ſuperſtitiouſly adminiſtred, as a <hi>Papist</hi> would not ſcruple to be preſent at them.</p>
</div>
<div n="5" type="section">
<pb n="110" facs="tcp:170378:65"/>
<head>§. 5.</head>
<p>There is no ſuch State neceſ<g ref="char:EOLhyphen"/>ſity for this forme, Neither is there ſuch diſability in Mini<g ref="char:EOLhyphen"/>ſters now to <hi>Catechiſe:</hi> as there was then, to <hi>pray</hi> and <hi>preach</hi> from their own gifts, theſe being per<g ref="char:EOLhyphen"/>formances requiring greater ability and learning. For certainly, thus to ask queſtions by the Book, and receive anſwers by the Book re<g ref="char:EOLhyphen"/>quires no great gifts or ſtudy. Pa<g ref="char:EOLhyphen"/>rents, Maſters of Families, and thoſe of loweſt parts or learning may ſufficiently perform it,<note place="margin">Mr. <hi>Baxter</hi> his advice.</note> yea Maſter <hi>Baxter,</hi> and ſo doe others grant, perſons not ſet apart to any Office in the Miniſtry may thus Catechiſe and inſtruct,<note place="margin">Worſterſh. Aſſo.</note> not only their own Families but the whole Pariſh.</p>
<p>Such are the abilities of Mini<g ref="char:EOLhyphen"/>ſters generally (we bleſſe the Lord for it) as they ſtand in as little need of books to Catechiſe and inſtruct
<pb n="111" facs="tcp:170378:65"/>
youth by, as books to ſay prayers by, or to preach by. And it being ſo, it is a very ſad conſideration, that having through mercy per<g ref="char:EOLhyphen"/>ſons qualified, and approved for Miniſterial gifts and graces: Such muſt now in an age of <hi>light</hi> and ex<g ref="char:EOLhyphen"/>perience, be ſilenced and put from the imployment to which Chriſt hath called them: for not ſubmit<g ref="char:EOLhyphen"/>ting to a Form, or Circumſtance, which is neither peculiar, or of ab<g ref="char:EOLhyphen"/>ſolute neceſſity to miniſterial work or ſervice:</p>
</div>
<div n="6" type="section">
<head>§. 6.</head>
<p>The <hi>younger ſort</hi> of a Pariſh may bee inſtructed, according to Scripture direction in the Funda<g ref="char:EOLhyphen"/>mentals of Religion (for ſo are the elder, and many of them as igno<g ref="char:EOLhyphen"/>rant though not in ſuch a <hi>me<g ref="char:EOLhyphen"/>thod</hi> of Catechiſing as is injoy<g ref="char:EOLhyphen"/>ned: This <hi>ſtrict method</hi> may bee practiſed (as it hath been for many
<pb n="112" facs="tcp:170378:66"/>
years) and yet no one particular Catechiſme enjoyned. The crime lieth in the omiſſion only of a <hi>form,</hi> or rather <hi>circumſtance</hi> of ſuch a form; to inſtruct in <hi>ſuch a method</hi> is but a form; but an arbitrary form, ſome other method may bee as good, <hi>this or that</hi> particular Cate<g ref="char:EOLhyphen"/>chiſme is but a <hi>circumſtance</hi> of ſuch a form, the puniſhment is as great as for omiſſion or negligence in the great and eſſential duties of the Miniſtry. This is not equal the Ca<g ref="char:EOLhyphen"/>noniſts ſay,<note place="margin">
<hi>Penor</hi> Cic. de off.</note>
<hi>Poena non debet excedere delictum.</hi> And a Heathen, <hi>Caven<g ref="char:EOLhyphen"/>dum eſt ne poena major ſit quam culpa.</hi>
</p>
<p>
<note place="margin">Mag. Cha. cap. 14.</note>The old Law of <hi>Magna Charta</hi> was this, <hi>Ex quantitate poena cog<g ref="char:EOLhyphen"/>noſcitur quantitas delicti, quia paena debet eſſe commenſurabilis delicto,</hi> and our <hi>ſuffering Brethren</hi> pleaded it againſt the unreaſonableneſſe of the penalties impoſed upon them for omiſſions in <hi>Forms</hi> and <hi>Cere<g ref="char:EOLhyphen"/>monies,</hi> pretending they did it with contempt to <hi>Authority,</hi>
<pb n="113" facs="tcp:170378:66"/>
which is the greateſt aggravation of an omiſſion; <q>No <hi>Free-holder</hi> for contempt of the Kings Com<g ref="char:EOLhyphen"/>mandement may, bee puniſhed with the loſſe of his. Free-hold, when the great Charter of <hi>Eng<g ref="char:EOLhyphen"/>land</hi> telleth us, that a Free-man ſhall not bee amerced for a ſmall fault, but after the quantity of the fault, and for a great fault after the manner thereof, ſaving unto him his <hi>Conteniment</hi> and <hi>Free-hold.</hi> If then unto every Free-man puniſhable by the law, though his fault bee great, his Conteniment or Free-hold ought to be reſerved, it ſeemeth much more reaſonably to follow, that no Church-man being a free-man may ſo be puniſhed, &c.</q>
</p>
<p>
<hi>Certain conſiderations</hi> printed, <hi>anno</hi> 1605. <hi>p.</hi> 43. where the juſtifica<g ref="char:EOLhyphen"/>tion of a more ſevere proceedings againſt Church-men than other Free-holders (becauſe theſe hold <hi>virtute officii</hi> only) is alſo debated
<pb n="114" facs="tcp:170378:67"/>
<q>and concluded, that if the crime of which hee is guilty bee not incon<g ref="char:EOLhyphen"/>ſiſtent with his office, hee ought to enjoy the ſame priviledge gran<g ref="char:EOLhyphen"/>ted to other Free-holders by <hi>Mag<g ref="char:EOLhyphen"/>na Charta.</hi>
</q> So that if the not obſer<g ref="char:EOLhyphen"/>ving a Ceremony or form, or the not owning <hi>Epiſcopacy:</hi> If the not inſtru<g ref="char:EOLhyphen"/>cting in <hi>ſuch</hi> an order, or by ſuch a particular book enjoyned; or not coming up to <hi>ſuch</hi> forms of Diſci<g ref="char:EOLhyphen"/>pline as are eſtabliſhed: Be not a de<g ref="char:EOLhyphen"/>fect, which is in it ſelf deſtructive to the Office of a Miniſter; accor<g ref="char:EOLhyphen"/>ding to our <hi>Brethrens</hi> opinion ſuch ought not to bee put out of their Livings under any ſuch pretence.</p>
</div>
<div n="7" type="section">
<head>§. 7.</head>
<p>Silencing and putting Miniſters from their places, for ſuch matters, was argued formerly by thoſe <hi>ho<g ref="char:EOLhyphen"/>ly men</hi> to be an unjuſt, and unequal kind of puniſhment from another conſideration alſo: namely, that
<pb n="115" facs="tcp:170378:67"/>
ſuch puniſhing of Miniſters is a greater puniſhment upon the peo<g ref="char:EOLhyphen"/>ple. <hi>Such ſtopping of the mouthes of painful and profitable preachers is no leſſe puniſhment to the Church it ſelf than to the Preachers,</hi>
<note place="margin">Prov. 29.18.</note>
<hi>yea farre much the greater: for where there is no viſion the people periſh.</hi> Trial of Sub. p. 18. So in the Petition of the Houſe of Commons to King <hi>James,</hi> Anno 1610. <q>Miniſters being removed from their Ec<g ref="char:EOLhyphen"/>cleſiaſtical Livings for not con<g ref="char:EOLhyphen"/>forming in ſome points, it is a great grief to your Majeſties Subjects, ſeeing the whole peo<g ref="char:EOLhyphen"/>ple that want inſtruction are by this means puniſhed, and through ignorance lye open to the ſeduce<g ref="char:EOLhyphen"/>ments of Popiſh and ill-affected perſons.</q>
</p>
<p>
<q>Congregations <hi>(ſaith one)</hi> in this miſerable condition,<note place="margin">Advertiſe<g ref="char:EOLhyphen"/>ments to the Parlia<g ref="char:EOLhyphen"/>ment, in Anno 23. p. 11.</note> and e<g ref="char:EOLhyphen"/>very member of them, may ſay to you, moſt Honourable high Court of Parliament, as <hi>Job</hi> ſaid
<pb n="116" facs="tcp:170378:68"/>
to his friends,<note place="margin">Job. 19.21</note>
<hi>Have pitty upon us,</hi> oh yee our Honourable and Chriſtian Friends, <hi>for the hand of God hath touched us,</hi> in ſuffe<g ref="char:EOLhyphen"/>ring our Miniſters to bee taken from us, our ſouls are ſtarved by keeping back our Spiritual food.<note place="margin">Job 30.18</note>
<hi>Wee goe mourning without the Sun, for theſe things we weep, our eyes run down with water becauſe the Comforters that ſhould refreſh our ſouls are farre from us.</hi>
<note place="margin">Lam. 1.16</note>
</q>
</p>
<p>Puniſhments of this nature light moſt heavie upon the moſt inno<g ref="char:EOLhyphen"/>cent. The people who are moſt concerned, and for whoſe ſuppo<g ref="char:EOLhyphen"/>ſed good; this puniſhment is infli<g ref="char:EOLhyphen"/>cted upon their Miniſter: but proves indeed a greater evil to them than the evil it ſelf for which hee is puniſhed. For he may bee a perſon well accompliſhed, able and willing to inſtruct the whole Pariſh <hi>Old</hi> and <hi>Young;</hi> To feed with <hi>milk</hi> and <hi>ſtrong meat,</hi> and yet upon
<pb n="117" facs="tcp:170378:68"/>
the reaſons before mentioned ſcru<g ref="char:EOLhyphen"/>ple the ſubmiſſion to ſuch a particu<g ref="char:EOLhyphen"/>lar <hi>method</hi> or <hi>help</hi> where it is need<g ref="char:EOLhyphen"/>leſſe,<note place="margin">Argu<g ref="char:EOLhyphen"/>ments, ch. 2. & 5.</note> or ſome other in <hi>his</hi> Conſci<g ref="char:EOLhyphen"/>ence more uſeful and ſuitable to his charge. Let the perſon bee of e<g ref="char:EOLhyphen"/>ver ſo much worth, and beloved of his people, he and his Miniſtry is wholly taken away from them <hi>Old</hi> and <hi>Young:</hi> for a defect (if it were ſo) in a <hi>part</hi> or circumſtance in his duty, and in reſpect only to a <hi>part</hi> (the <hi>younger ſort</hi>) of his Con<g ref="char:EOLhyphen"/>gregation.</p>
</div>
<div n="8" type="section">
<head>§. 8.</head>
<p>The truth is, this <hi>ſilencing</hi> and <hi>depriving</hi> of Miniſters, for matters of Diſcipline or Worſhip, upon account of their <hi>opinions</hi> or <hi>practi<g ref="char:EOLhyphen"/>ces</hi> if it be in a matter diſputable, and not apparently neceſſary, and theſe Miniſters perſons of Learning and Piety, perſons for Life and Doctrine in other things unblamea<g ref="char:EOLhyphen"/>ble,
<pb n="118" facs="tcp:170378:69"/>
it is and alwaies hath been ſo heavie a load upon the mindes and ſpirits of Gods people, as will ne<g ref="char:EOLhyphen"/>ver bee borne by them, without ſad complaints to God and man, both for their Miniſters ſake, and in their own behalf and loſſe.</p>
<p>With what difficulty and di<g ref="char:EOLhyphen"/>ſturbance doe people bear the eje<g ref="char:EOLhyphen"/>cting of the worſt of Miniſters? Is it not with many Pariſhes, as with <hi>Micha</hi> in his complaint and out-cry to the people of <hi>Dan,</hi> his Idols and Idolatrous <hi>Prieſts being taken away,</hi> Alas, ſaith he, I am undone, <hi>what have I more.</hi>
<note place="margin">Judg. 18</note> But to have ſuch <hi>Teachers removed into corners,</hi> who formerly <hi>our eyes have beheld</hi> with comfort, and their very <hi>feet have been beautiful;</hi> ſuch as from the <hi>feelings</hi> and manifold refreſhings of our ſouls, wee cannot but ho<g ref="char:EOLhyphen"/>nour; and have in great eſtimation for their works ſake; To have ſuch Lights put under a Buſhel, muſt needs leave a ſad and dark houſe.</p>
</div>
<div n="9" type="section">
<pb n="119" facs="tcp:170378:69"/>
<head>§. 9.</head>
<p>The Apoſtle ſpeaking of the Miniſtry, and Miniſterial duties, made this demand,<note place="margin">2 Cor. 2.16.</note>
<hi>Who is ſuffici<g ref="char:EOLhyphen"/>ent for theſe things?</hi> The ſcarcity and <hi>fewneſſe</hi> of ſuch who are able, and conſcientious in this work, is unknown to no man; But in time of reformation, and when ſuch as are found totally unfit are ejected, the want of able perſons to ſupply in their places is much greater, and more felt by the people.</p>
<p>What low and poor work was <hi>Clergie work</hi> in former times? (the ability to read a piece of Latine, be<g ref="char:EOLhyphen"/>ing a ſufficient qualification for it) and yet then that work was ſo much prized by the State, that a crime deſerving death ſhall be par<g ref="char:EOLhyphen"/>doned, rather than a perſon, that could but <hi>legere ut clericus</hi> ſhould be taken from the work.</p>
<p>The higheſt qualifications, and
<pb n="120" facs="tcp:170378:70"/>
ſuch as are according to the Word are now required, and if perſons that are accordingly worthy ſhall bee ejected, for a ſcruple in Con<g ref="char:EOLhyphen"/>ſcience, and not pardoned in what is but Circumſtantial to the work; it cannot bee judged wee are equal in zeal (though wee have more light) for the Miniſtry, with thoſe of darker times.</p>
</div>
</div>
<div n="7" type="chapter">
<head>
<hi>CHAP. VII.</hi> Of the prejudice to the Miniſtry, and evil conſequences of ſuch an Impo<g ref="char:EOLhyphen"/>ſition.</head>
<div n="1" type="section">
<head>§. 1.</head>
<p>
<note place="margin">The for<g ref="char:EOLhyphen"/>mer branch, p. 101.</note>THe ſecond branch of this Ar<g ref="char:EOLhyphen"/>gument is, that ſuch an im<g ref="char:EOLhyphen"/>poſition hath had evil conſequences in former ages, and likely ſo to bee followed ſtill, whereof this is one.</p>
<p>Such great and breaking penal<g ref="char:EOLhyphen"/>ties
<pb n="121" facs="tcp:170378:70"/>
render the <hi>Calling</hi> of the Mi<g ref="char:EOLhyphen"/>niſtry <hi>leſſe deſirable.</hi> Thus our Bre<g ref="char:EOLhyphen"/>thren formerly complained, <hi>The fear of ſuch</hi> RUINING <hi>penal<g ref="char:EOLhyphen"/>ties make many convert their ſtudies to Phyſick, Law, or ſome other profeſsion,</hi> Trial of Sub. p. 19. So the Adverti<g ref="char:EOLhyphen"/>ſer. <hi>How many worthy men</hi> (ſaith hee) <hi>are diſcouraged from the Miniſtry? How many have no uſe of their gifts? How many are turned Lawyers, and Phyſicians,</hi>
<note place="margin">Advert. p. 13.</note>
<hi>or at leaſt are ſuch that otherwiſe would have been Miniſters?</hi>
</p>
<p>Mr. <hi>Parker</hi> (out of <hi>Hyperius</hi>) notes two impediments that hinder from the Miniſtry, whereof this is one, <q>A too ridgid exaction of certain <hi>traditions,</hi> and the obſer<g ref="char:EOLhyphen"/>vation of unprofitable Ceremo<g ref="char:EOLhyphen"/>nies, to which men are tied that are ſet over Charges.</q> He further tells us, being ſenſible how great an evil it is to diſcourage from the Miniſtry out of the <hi>Tripart: Hiſtory.</hi>
</p>
<p>
<pb n="122" facs="tcp:170378:71"/>
<q>
<hi>Valentinian</hi> rejoyced when he heard that <hi>Ambroſe</hi> was made a <hi>Minister,</hi> whom he before had made a <hi>Pretor,</hi> and praiſed God for it: On the other ſide, what loſſe (ſaith he) is there, even in one able Preacher turned to ſome other courſe of life, and how irrecoverable. O take up a lamentation yee that love <hi>Sion,</hi> o<g ref="char:EOLhyphen"/>ver the <hi>MANY</hi> that are gone over; ſome to <hi>Gallen,</hi> ſome to <hi>Juſtinian,</hi> ſome to <hi>Littleton,</hi> whom wee might long ſince have ſeen in <hi>Moſes</hi> Chair, had not the <hi>ſubſcription</hi> like the blade of a <hi>fiery Cherubin</hi> kept them out.</q>
<note place="margin">Of the Croſſe, <hi>cap.</hi> 4. §. 8.</note>
</p>
</div>
<div n="2" type="section">
<head>§. 2.</head>
<p>The Lord himſelf judgeth Mi<g ref="char:EOLhyphen"/>niſters, ſuch as <hi>labour in the Word and Doctrin,</hi> to be worthy not on<g ref="char:EOLhyphen"/>ly of <hi>Hire,</hi>
<note place="margin">1 Tim, 5.17, 18.</note> but in ſuch a proportion as is <hi>Honourable,</hi> and ſomething ſu<g ref="char:EOLhyphen"/>table
<pb n="123" facs="tcp:170378:71"/>
to Houſe-keepers, that are able to keep <hi>Hoſpitality;</hi>
<note place="margin">1 Tim. 3.2</note> A man cannot bee Hoſpitious if hee have not more means, houſe-room, Servants, and a more plentiful Ta<g ref="char:EOLhyphen"/>ble than will barely ſuffice for him<g ref="char:EOLhyphen"/>ſelf and Family. Thoſe that ſerve their Country with their Lives,<note place="margin">2 Cor. 9.7</note> ſuch as goe a <hi>Warfare,</hi> have re<g ref="char:EOLhyphen"/>wards, and a <hi>pay</hi> that is plentiful and honourable. And times have been that even this Calling of a Miniſter in reſpect of the means an<g ref="char:EOLhyphen"/>nexed hath tempted men to <hi>covet it,</hi>
<note place="margin">2 Pet. 5.2</note> for <hi>filthy lucre.</hi> It is utterly other<g ref="char:EOLhyphen"/>wiſe now, not but that there is a very liberal maintenance appertai<g ref="char:EOLhyphen"/>ning to Miniſters (and greater by the bounty of the Honourable Par<g ref="char:EOLhyphen"/>liament, than the preaching Mi<g ref="char:EOLhyphen"/>niſtry have formerly enjoyed.) But the diſcouragement lyeth in this, then ſlender and UNCER<g ref="char:EOLhyphen"/>TAIN TENVRE; It is ſuppo<g ref="char:EOLhyphen"/>ſed in the Law that every <hi>Parſon</hi> and <hi>Vicar</hi> hath the intereſt of a
<pb n="124" facs="tcp:170378:72"/>
<hi>Free-holder,</hi> but it proves no other than <hi>a dum bene ſe geſſerit;</hi> and the Rules and Law of his deportment is ſo <hi>mutable</hi> upon all occaſions, and made up of ſuch ſmall and circum<g ref="char:EOLhyphen"/>ſtantial concernments in reſpect to his high and honourable Calling, that his <hi>tenure</hi> proves to him little better than a holding <hi>at will,</hi> and that upon this account; becauſe ſel<g ref="char:EOLhyphen"/>dome any Lawes or Rules are given in this kind, with a leſſe penalty, (if any) than <hi>ſilencing, depoſing ejection</hi> from his livelihood, and the like. It is not ſo in any other Pro<g ref="char:EOLhyphen"/>feſſion or Calling whatſoever, in ſo much as we are in the eyes of moſt, a generation ſeparated to ſer<g ref="char:EOLhyphen"/>vitude and vaſſalage, and under great contempt; and by nothing more than by the great and pecu<g ref="char:EOLhyphen"/>liar <hi>mulcts</hi> and <hi>puniſhments</hi> upon all occaſions inflicted upon us. Where<g ref="char:EOLhyphen"/>as of all callings, the <hi>hazard</hi> of this is ſuch as it deſerves the greateſt in<g ref="char:EOLhyphen"/>couragement.<note place="margin">Confer at H. p. 53.</note> For,</p>
</div>
<div n="3" type="section">
<pb n="125" facs="tcp:170378:72"/>
<head>§. 3.</head>
<p n="1">1 In the <hi>breeding</hi> up a childe to<g ref="char:EOLhyphen"/>wards the Miniſtry; Beſides the chargeable education for ſome years, and painful induſtry for the obtaining a competency of Learn<g ref="char:EOLhyphen"/>ing: there is over and above (and that which is a hazard to this Cal<g ref="char:EOLhyphen"/>ling) an expectation what the per<g ref="char:EOLhyphen"/>ſon will prove to bee for his <hi>Piety</hi> and <hi>Morals</hi> alſo, of which we are and may bee long uncertain and doubtful.</p>
<p>It is true, in former times be<g ref="char:EOLhyphen"/>fore this bleſſed and happy refor<g ref="char:EOLhyphen"/>mation, the <hi>door</hi> was ſo wide into Chriſts Sheep-fold; the qualifica<g ref="char:EOLhyphen"/>tions, according to the then legal eſtabliſhment, were ſo looſe and uncertain: that the very Biſhops themſelves complained. The Bi<g ref="char:EOLhyphen"/>ſhop of <hi>Wincheſter</hi> in the conference at <hi>Hampton Court</hi> thus informes King <hi>James,</hi>
<q>The inſufficiency of the <hi>Clergy</hi> (ſaith he) comes not
<pb n="126" facs="tcp:170378:73"/>
by the Biſhops fault, but partly by Lay <hi>Patrons,</hi> who preſent ve<g ref="char:EOLhyphen"/>ry mean men to their Cures, partly by the Law of the Land, which admitteth of a very mean ſufficiency in any Clerk, ſo that if the Biſhop ſhould not admit them, then preſently a <hi>Quare impedit</hi> is ſent out againſt him.</q> But now, through the Lords mer<g ref="char:EOLhyphen"/>cy to the poor people of this Na<g ref="char:EOLhyphen"/>tion, and by the zeal and care of our Governours it is otherwiſe; the qualifications of perſons who are now judged fit for this Function, (according to what is eſtabliſhed <hi>by Parliament,</hi> with the advice of the <hi>Aſſembly</hi>) are ſuch as imply grace and holineſſe, ſo farre as man can judge, to be in <hi>truth</hi> and <hi>ſincerity.</hi>
</p>
<p>Before any man be admitted to the Miniſtry,<note place="margin">Ordi<g ref="char:EOLhyphen"/>nance for Ordinati<g ref="char:EOLhyphen"/>on, &c. No<g ref="char:EOLhyphen"/>vem. 8. 1645.</note> there muſt be <hi>inquiry made</hi> (ſaith the Ordinance) <hi>touch<g ref="char:EOLhyphen"/>ing the grace of God in him, and whether hee bee of ſuch holineſs of life as is requiſite in a Miniſter of the
<pb n="127" facs="tcp:170378:73"/>
Goſpel;</hi> A man for his learning and morals may bee fit for any place or ſtation in the Common-wealth, and yet fall ſhort of ſuch a ſtame in re<g ref="char:EOLhyphen"/>ſpect of his Spiritual condition, as is neceſſarily required to this ſacred calling. And the hazard and ven<g ref="char:EOLhyphen"/>ture of his education is the greater, becauſe this is an accompliſhment, or requiſite of ſuch a nature as is not to bee <hi>purchaſed with mony,</hi> or attain<g ref="char:EOLhyphen"/>able by any induſtry of our own; both the <hi>will and the deed is from the meer pleaſure of the Lord.</hi>
</p>
</div>
<div n="4" type="section">
<head>§. 4.</head>
<p n="2">2 After a man hath entred up<g ref="char:EOLhyphen"/>on his calling, and is comfortably diſpoſed of in the work, and hath a ſupport thereby for himſelf and family, yet being a perſon thus holy and gracious, if State impoſiti<g ref="char:EOLhyphen"/>ons in Eccleſiaſtical matters bee at ſuch a rate hee will be upon terms of great uncertainty for his <hi>conti<g ref="char:EOLhyphen"/>nuance,</hi>
<pb n="128" facs="tcp:170378:74"/>
or any conſtant ſettlement in his place, and that upon a two<g ref="char:EOLhyphen"/>fold account.</p>
<p n="1">1 His Conſcience engageth him narrowly to conſider of all the per<g ref="char:EOLhyphen"/>formances his place requireth; the buſineſſe and work of his calling be<g ref="char:EOLhyphen"/>ing more peculiarly the <hi>ſervice</hi> of God, doth lye more directly and dreadfully in view of his conſcience. His calling engageth him to ſearch the Scriptures, and furniſh himſelf thence with <hi>a treaſure</hi> of what is <hi>new and old:</hi> And hence his appre<g ref="char:EOLhyphen"/>henſions may poſſibly (and the more holy and conſciencious the more likely) fall otherwiſe, eſpe<g ref="char:EOLhyphen"/>cially in diſputable matters, then other mens have done formerly; or otherwiſe then the preſent eſta<g ref="char:EOLhyphen"/>bliſhment: which if they happen to doe, hee is undone, and muſt bee turned out of his livelihood, to beggery, or ſome other way to get a poor ſupport for himſelf and fa<g ref="char:EOLhyphen"/>mily.</p>
<p>
<pb n="129" facs="tcp:170378:74"/>Hence it is, that ſome Students, intending the Miniſtry, out of fear how their thoughts may fall, keep off from the ſearch and enquiry, in<g ref="char:EOLhyphen"/>to ſuch concernments, until Con<g ref="char:EOLhyphen"/>ſcience enforce them.<note place="margin">Preface to his Ser. at <hi>Lambeth.</hi>
</note> Doctor <hi>Downham</hi> a learned godly man, tells us it was thus with him, <hi>I ſuſpen<g ref="char:EOLhyphen"/>ded the ſtudy thereof</hi> (meaning Church matters) <hi>for a long time,</hi> and gives this as one reaſon, <hi>if I came to the iſsue of ſuch a ſtudy, it would bee either the diſgrace of my miniſtry, amongſt the forward ſort, if I reſolved for Epiſcopacy: or over<g ref="char:EOLhyphen"/>throw of my Miniſtry, if I ſtand for Diſcipline.</hi> And when we are neceſſitated to the ſetling of our though as in ſuch points. Where the heart is <hi>ſincere</hi> and led by Scripture light, it is hard to ſay upon what wee ſhall pitch at laſt. He further tells us, that <hi>being in the Miniſtry hee was neceſsitated to come to a reſo<g ref="char:EOLhyphen"/>lution for one form of Government or other,</hi> and though <hi>no enemy,</hi> but ra<g ref="char:EOLhyphen"/>ther
<pb n="130" facs="tcp:170378:75"/>
a <hi>Friend</hi> to the Presbyterian way, from <hi>a reverend opinion</hi> (as he ſaith) <hi>I had conceived of Maſter</hi> Calvin, <hi>and Mr.</hi> Beza, <hi>and many other learned men, Patrons and Fa<g ref="char:EOLhyphen"/>ctors of the</hi> DISCIPLINE. But in ſtudying the Controverſie <hi>as one that means to be convicted with truth,</hi> his perſwaſion fell in with <hi>Epiſcopacy,</hi> and ſo hee practiſed. This hath been, and daily is the lot of many Miniſters of the Goſ<g ref="char:EOLhyphen"/>pel, eſpecially in theſe dayes of light, (and ſince Popery which captivated mens conſciences by an implicit faith) in their ſearch after a ſettlement in theſe agitated points of <hi>Worſhip</hi> and <hi>Diſcipline:</hi> their perſwaſions have been fixed other<g ref="char:EOLhyphen"/>wiſe than they poſſibly expected.</p>
</div>
<div n="5" type="section">
<head>§. 5.</head>
<p>Let it bee but ſeriouſly weigh<g ref="char:EOLhyphen"/>ed, 1 What differences of Judg<g ref="char:EOLhyphen"/>ment there are, and alwaies hath
<pb n="131" facs="tcp:170378:75"/>
been amongſt thoſe that are truly <hi>godly,</hi> and of ſome <hi>eminency.</hi> And then, 2 Take the variety of ſuch perſons or <hi>perſwaſions</hi> rather, that are in <hi>this,</hi> or ſome one, or part of an age, and accordingly ſort them, as in a way of ſucceſſion, <hi>five, ten,</hi> or <hi>twenty</hi> years one after another, (ſo providence might have diſpo<g ref="char:EOLhyphen"/>ſed) And if each in its ſucceſſion had been <hi>impoſed,</hi> under this penal<g ref="char:EOLhyphen"/>ty of <hi>ejection,</hi> if not owned. How long or how little time rather could any conſcientious man bee likely to have held his Miniſtry? The variety of apprehenſions amongſt thoſe of the ſame perſwaſion, the <hi>differences</hi> amongſt Independents, as ſome have made them, and how reverend Mr. <hi>Cotton,</hi> now with God, contradicts himſelf, as Mr. <hi>Caudery</hi> would <hi>ſuppoſe</hi> (and it might have been more than his ſuppoſiti<g ref="char:EOLhyphen"/>on) As likewiſe the <hi>greater</hi> varie<g ref="char:EOLhyphen"/>ty amongſt the Presbyterians, and in <hi>greater</hi> matters, as ſet down by
<pb n="132" facs="tcp:170378:76" rendition="simple:additions"/>
Biſhop <hi>Bancroft,</hi> as alſo the <hi>con<g ref="char:EOLhyphen"/>tradictions</hi> of one he mentions <hi>with himſelf</hi> and <hi>others;</hi> (I could give other inſtances) Is of better uſe than I beleeve was intended in <hi>bla<g ref="char:EOLhyphen"/>ſoning</hi> the infirmities of godly men, namely to confirme this ex<g ref="char:EOLhyphen"/>periment, That where the moſt conſcientious ſearch is made, there apprehenſions may fall various in theſe <hi>ſmaller</hi> matters: yea and if a man, differ from <hi>himſelf</hi> alſo in reſpect of his former thoughts, it <gap reason="illegible" resp="#PDCC" extent="1 span">
<desc>〈…〉</desc>
</gap> diſhonour while in that ſtate wherein <hi>he knows but in part.</hi> And few there bee that ſet them<g ref="char:EOLhyphen"/>ſelves to a conſcientious and un<g ref="char:EOLhyphen"/>prejudiced ſearch after truth; but know (comparing what apprehen<g ref="char:EOLhyphen"/>ſions they have had at ſeveral times) and muſt acknowledge, they <hi>have</hi> differed as much with themſelves <hi>at times</hi> as they differ from other godly men at the <hi>pre<g ref="char:EOLhyphen"/>ſent.</hi>
</p>
</div>
<div n="6" type="section">
<pb n="133" facs="tcp:170378:76"/>
<head>§. 6.</head>
<p>IN the ſecond place conſider up<g ref="char:EOLhyphen"/>on what <hi>uncertainties</hi> alſo a con<g ref="char:EOLhyphen"/>ſciencious Miniſter is; in reſpect of the great <hi>unſetledneſſe</hi> and fre<g ref="char:EOLhyphen"/>quent <hi>changes</hi> of the orders and Lawes (upon which the liberty of his Miniſtry depends) by the Civil Magiſtrate, eſpecially when <hi>refor<g ref="char:EOLhyphen"/>mation-work</hi> is in hand: and this, not only from different <hi>apprehen<g ref="char:EOLhyphen"/>ſions,</hi> which are in Governours and Magiſtrates, as well as in Mini<g ref="char:EOLhyphen"/>ſters. But principally, from their coveting to bring Eccleſiaſtical af<g ref="char:EOLhyphen"/>fairs, into a compliance with the Civil. Yea ſuch Magiſtrates as are not with <hi>Erastus;</hi> for the <hi>whole frame</hi> of Church Government to depend upon the prudential for<g ref="char:EOLhyphen"/>mings of Chriſtian Magiſtrates, yea it would have the Circumſtances, and ſuch other things as are not of the <hi>ſubſtance</hi> in Church matters,
<pb n="134" facs="tcp:170378:77"/>
<hi>ſo to bee ordered as may rightly joynt what is to be ſetled with the Laws and government of the Kingdome,</hi>
<note place="margin">Ordi<g ref="char:EOLhyphen"/>nance of <hi>March</hi> 14. 1645. in the Pre<g ref="char:EOLhyphen"/>face.</note>
<hi>the want whereof</hi> (ſay they) <hi>hath cau<g ref="char:EOLhyphen"/>ſed much trouble in this and other States.</hi> This was one conſideration, upon which Epiſcopacy was taken away,<note place="margin">Ordinan. <hi>June</hi> 12. 1643.</note> namely, <hi>becauſe it was very prejudicial to the ſtate and govern<g ref="char:EOLhyphen"/>ment of this Kingdome.</hi>
</p>
<p>Now, if a <hi>ſettlement</hi> in the Church depends thus upon the Lawes and conſtitutions of the Common-wealth, As <hi>they</hi> or <hi>it</hi> ſhall alter and change, there will ordina<g ref="char:EOLhyphen"/>rily (then at furtheſt) bee new mouldings of the Church order in whole; or in ſome parts of it: and if ſo, <hi>experiments</hi> may bee made, of <hi>ſeveral</hi> wayes and impoſitions, before a thorow and fixed ſettle<g ref="char:EOLhyphen"/>ment of any. <hi>It cannot bee expect<g ref="char:EOLhyphen"/>ed</hi> (ſaith the former Ordinance) <hi>a rule in every particular ſhould bee ſetled at once, but that there will bee need of ſuppliment, and additions,
<pb n="135" facs="tcp:170378:77"/>
and happily alſo of alterations; in ſome things as</hi> EXPERIENCE <hi>ſhall bring to light the neceſsity thereof, though the fundamentals and ſubſtan<g ref="char:EOLhyphen"/>tial parts of Church-Government hath been ſetled.</hi>
</p>
<p>And ſo in the firſt reformation, there was a reſerve for alterations. It is ſaid of the <hi>Ceremonies and Church-Order</hi> then determined,<note place="margin">Preface to the Com. Prayer-Book.</note> that <hi>upon juſt cauſes they may bee altered and changed, being not as the Law of God,</hi> and a little after in the ſame <hi>Declaration, That wee ſhould put a<g ref="char:EOLhyphen"/>way ſuch things from time to time, as wee perceive to bee abuſed, as in mans Ordinance it often chanceth.</hi> And it is appointed by the Statute for <hi>Uniformity;</hi> That <hi>the Queens Majeſty, with the advice of her Metropolitan,</hi> might make ſuch alte<g ref="char:EOLhyphen"/>rations, <hi>and ordaine and publiſh ſuch further Rites and Ceremonies of the Church as may bee moſt for Gods glo<g ref="char:EOLhyphen"/>ry, &c.</hi> And what alteration was, in the Common-Prayer Book, in 1<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>
<pb n="136" facs="tcp:170378:78"/>
<hi>Jacobi</hi> was done by Commiſſion under the Great Seal,<note place="margin">Proclama<g ref="char:EOLhyphen"/>tion of <hi>March</hi> 5. 1 <hi>Jaco.</hi>
</note> which is there ſaid to bee <hi>according to the form which the Lawes of this Realm in like caſe preſcribe to be uſed,</hi> ſo that not only in Parliament, but at other times alſo, alterations might be made</p>
</div>
<div n="7" type="section">
<head>§. 7.</head>
<p>
<note place="margin">So they ſay, Ordi. of <hi>March</hi> 14. 1645.</note>THe <hi>great difficulty</hi> which the Ho<g ref="char:EOLhyphen"/>nourable Houſes found, to pitch upon any thing ſuddainly in Church-Government, eſpecially in what they judged not to be <hi>fun<g ref="char:EOLhyphen"/>damental,</hi> and of the <hi>ſubſtance</hi> of it, for that was ſooner ſetled by them: And the poſſibility upon further <hi>experience</hi> to make altera<g ref="char:EOLhyphen"/>tions in <hi>Circumſtantials</hi> and <hi>leſſer</hi> matters. Did beget a tenderneſs in them, and gracious <hi>indulgence</hi> to ſuch as were to ſubmit, in what they then ſetled: as</p>
<p n="1">1 In the eſtabliſhing of matters more doubtful for <hi>three years</hi> only,
<pb n="137" facs="tcp:170378:78"/>
or a ſhorter time. 2 What was to be for a ſtanding Law, or Rule, and for longer time, had no ruining <hi>penalty,</hi> to enforce ſubmiſſion. 3 A forbearance was conſulted, for ſuch as through tenderneſſe of Conſci<g ref="char:EOLhyphen"/>cence could not come up to that rule, <hi>prudently</hi> and <hi>piouſly</hi> conſi<g ref="char:EOLhyphen"/>dering; What was not without ſo much <hi>difficulty</hi> reſolved upon in their own Conſciences to <hi>eſta<g ref="char:EOLhyphen"/>bliſh:</hi> might after eſtabliſhment, finde ſome <hi>difficulty</hi> in other mens Conſciences to be ſubmitted unto.</p>
<p>And the truth is, ſuch matters as Civil Governours and others have looked upon as <hi>ſmall diffe<g ref="char:EOLhyphen"/>rences,</hi> or but <hi>Circumſtances,</hi> or at moſt, not of the <hi>ſubſtance</hi> of Di<g ref="char:EOLhyphen"/>ſcipline or Worſhip: yet it hath fal<g ref="char:EOLhyphen"/>len out otherwiſe, in the <hi>Conſcien<g ref="char:EOLhyphen"/>ces</hi> of thoſe that have been to pra<g ref="char:EOLhyphen"/>ctiſe, knowing their God to bee a <hi>jealous</hi> and ſevere <hi>God,</hi> in mat<g ref="char:EOLhyphen"/>ters wherein his Worſhip and Name is concerned,<note place="margin">Exod. 20.</note>
<hi>Small</hi> things are
<pb n="138" facs="tcp:170378:79"/>
great to a ſearching tender Conſci<g ref="char:EOLhyphen"/>ence, and where doing or not doing, thruſts a man <hi>between</hi> theſe two rocks; the offending of <hi>God</hi> or <hi>man.</hi>
</p>
</div>
<div n="8" type="section">
<head>§. 8.</head>
<p>And that our Governours may ſtill (if it pleaſe the Lord) <hi>continue</hi> this work of reformation, with the like tenderneſs, as it hath bin <hi>begun,</hi> and hitherto <hi>carried</hi> on: let it be ſeriouſ<g ref="char:EOLhyphen"/>ly and ſadly conſidered, how that from time to time the greateſt diffe<g ref="char:EOLhyphen"/>rences and contentions with us in Ec<g ref="char:EOLhyphen"/>cleſiaſtical affairs have riſen: not from what is of the <hi>ſubſtance</hi> or <hi>eſ<g ref="char:EOLhyphen"/>ſence,</hi> either in Diſcipline or Wor<g ref="char:EOLhyphen"/>ſhip; but from <hi>Circumſtances</hi> only, and <hi>leſſer</hi> matters in both. And then eſpecially ſuch things have proved, and will prove occaſions of greateſt ſuffering and diſcouragement to Miniſters; when ſuch <hi>ſmaller</hi> and more <hi>doubtful</hi> matters as theſe, are impoſed under ſuch great and un<g ref="char:EOLhyphen"/>doing penalties, as in THIS CASH.</p>
<p>
<pb n="139" facs="tcp:170378:79"/>Epiſcopal and Common-prayer-Book Conformity, and the con<g ref="char:EOLhyphen"/>tentions and ſufferings upon that account is a ſad inſtance, and may not bee forgotten. The matters controverted were not of the <hi>ſub<g ref="char:EOLhyphen"/>stance</hi> either of <hi>Diſcipline</hi> or <hi>Wor<g ref="char:EOLhyphen"/>ſhip,</hi> in the opinions of thoſe that impoſed them. This appears in the <hi>Preface</hi> to the <hi>Common-Prayer Boo<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>
</hi> and frequent profeſſions of the Bi<g ref="char:EOLhyphen"/>ſhops: Nor were they otherwiſe judged of by thoſe that oppoſed and ſought to have them reformed. It is aſſerted by our <hi>Brethren</hi> in a Treatiſe, that <hi>the Biſhops and Seek<g ref="char:EOLhyphen"/>ers of Reformation are all one</hi> (that is the title of the Book) the drift and ſcope whereof is to ſhew, that <hi>whatſoever is eſſentially of the religi<g ref="char:EOLhyphen"/>on and profeſsion of the Church of</hi> England, <hi>and of the Miniſtry, de<g ref="char:EOLhyphen"/>ſcribed in the Holy Scripture, main<g ref="char:EOLhyphen"/>tained by the Prelates ſtanding for conformity: Wee the Miniſters and People, who</hi> ſeek <hi>reformation, doe
<pb n="140" facs="tcp:170378:80"/>
hold and profeſſe the ſame. And the things wee deſire to bee reformed, and they ſtand earneſtly to maintain, are but Circumſtantial.</hi> Additaments, <hi>brought into the Church by Humane conſtitution.</hi> Which will bee more evident, if wee reduce the Con<g ref="char:EOLhyphen"/>troverſies thereabout to theſe three heads; the Leitourgie, Ce<g ref="char:EOLhyphen"/>remonies, and Epiſcopacy.</p>
<p>For the firſt, <hi>ſtinted</hi> prayers. A formed Leitourgie there was, to be held to for matter and words, by all Miniſters, or to loſe their Livings. Thoſe that were for this, look up<g ref="char:EOLhyphen"/>on ſuch forms impoſed to bee <hi>no matter of Religion,</hi>
<note place="margin">Mr. <hi>B<gap reason="illegible" resp="#PDCC" extent="3 letters">
<desc>•••</desc>
</gap>
</hi> his trial, p. 4.</note> or <hi>ſubſtantial means of Worſhip, nor neceſſary to prayer;</hi> And thoſe againſt it joyn in this, that the Book of Common prayer may bee uſed for the <hi>ſub<g ref="char:EOLhyphen"/>ſtance</hi> thereof.</p>
<p n="2">2 The heats and ſufferings a<g ref="char:EOLhyphen"/>bout the Ceremonies were grea<g ref="char:EOLhyphen"/>ter, the Materials of this Contro<g ref="char:EOLhyphen"/>verſie were but <hi>Circumstantials,</hi>
<pb n="141" facs="tcp:170378:80"/>
ſo granted by both parties; Our <hi>Brethren</hi> diſputed not againſt them,<note place="margin">Br<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>dſh. 12, Arg.</note> but as <hi>in manner and form preſcri<g ref="char:EOLhyphen"/>bed.</hi> Thoſe that preſſed Ceremo<g ref="char:EOLhyphen"/>nies profeſſed as much. <hi>Our Church,</hi> (ſaith Biſhop <hi>Morton) retains them for decency, &c. without making them of the ſubſtance of Gods Service,</hi>
<note place="margin">The 3 <hi>In<g ref="char:EOLhyphen"/>nocent</hi> Ce<g ref="char:EOLhyphen"/>rem p. 45.</note>
<hi>thinking them alterable and change<g ref="char:EOLhyphen"/>able, without opinion of neceſsity.</hi> And of the Croſſe (one of the worſt of them) in the Canons of 1603. <hi>Can.</hi> 30.<note place="margin">The keep<g ref="char:EOLhyphen"/>ing and o<g ref="char:EOLhyphen"/>mitting of a Ceremo<g ref="char:EOLhyphen"/>ny in it ſelf conſidered is but a ſmall thing, <hi>Ed.</hi> 6. Com<g ref="char:EOLhyphen"/>mon Pray<g ref="char:EOLhyphen"/>er Book, Ann. 1549.</note> it is ſaid to be <hi>no part of the</hi> SVBSTANCE <hi>of the Wor<g ref="char:EOLhyphen"/>ſhip. The infant is fully and perfectly Baptized before the ſign of the Croſſe, which being afterwards uſed, doth neither adde any thing, or being o<g ref="char:EOLhyphen"/>mitted doth detract any thing from the effect and</hi> SVBSTANCE <hi>of it,</hi> and in the ſame Can. <hi>It is a thing in it ſelf</hi> INDIFFERENT.</p>
<p n="3">3. Epiſcopacy, and that form of Government, which (ſaith Doct. <hi>Downham is the chief and princi<g ref="char:EOLhyphen"/>pal: though other particulars bee con<g ref="char:EOLhyphen"/>troverted,
<pb n="142" facs="tcp:170378:81"/>
and ſo chief: as that ſome<g ref="char:EOLhyphen"/>times I have thought the reſt to bee but controverſies in pretence,</hi>
<note place="margin">Pref. to his Serm. at <hi>La<gap reason="illegible" resp="#PDCC" extent="2 letters">
<desc>••</desc>
</gap>.</hi>
</note>
<hi>to avoyd the envie of this.</hi> The foundation of this Controverſie alſo is laid in <hi>mat<g ref="char:EOLhyphen"/>ters</hi> of the ſame nature, and ſuch as are not of the <hi>ſubſtance</hi> and <hi>Eſſen<g ref="char:EOLhyphen"/>tials</hi> of Church Government, be<g ref="char:EOLhyphen"/>twixt it and Presbytery, in the proper work and <hi>acts</hi> of either there is not found a <hi>ſubſtantial</hi> dif<g ref="char:EOLhyphen"/>ference. The Parliament gives us an inſtance in one of the higheſt, ORDINATION. Which is aſſerted in the Epiſcopal way <hi>to be for</hi> SVB<g ref="char:EOLhyphen"/>STANCE <hi>valid, and not to be diſclai<g ref="char:EOLhyphen"/>med by any that have received it, and that</hi> Presbyters <hi>ſo ordained may</hi> OR<g ref="char:EOLhyphen"/>DAIN <hi>other Presbyters;</hi> the like may bee ſaid of <hi>Excommunication,</hi> and other Adminiſtrations of either: that they are the ſame for <hi>ſubſtance.</hi> The learned Biſhop of <hi>Armath</hi> in a Treatiſe written by him long ago, ſhewed how without the breach of any Scripture rules, or deſtroying
<pb n="143" facs="tcp:170378:81"/>
any thing eſſential to Church Go<g ref="char:EOLhyphen"/>vernment;<note place="margin">The reduc. of Epiſco. unto a Sy<g ref="char:EOLhyphen"/>nodical form.</note>
<hi>Epiſcopacy and Presby<g ref="char:EOLhyphen"/>tery might be reduced</hi> into one form. And it is the opinion of the moſt of our Non-Conformiſts, in their writings againſt thoſe of the ſepa<g ref="char:EOLhyphen"/>ration;<note place="margin">Bradſh. <hi>a<g ref="char:EOLhyphen"/>gainſt</hi> Johnſon, Hilderſham Jacobs, <hi>and others.</hi>
</note> that the Biſhops of this Nation, and <hi>Presbyters,</hi> according to the inſtitution of Chriſt, differ not in any <hi>eſſential</hi> part or work of the Miniſtry.</p>
<p>I may adde alſo in point of Church Government, that <hi>Preſ<g ref="char:EOLhyphen"/>bytery</hi> and <hi>Independency</hi> is the ſame for <hi>ſubſtance,</hi> and ſo granted by both; <hi>Wee agree</hi> (ſay the diſſen<g ref="char:EOLhyphen"/>ting Brethren) <hi>with them</hi> (Preſ<g ref="char:EOLhyphen"/>byterians) <hi>in Doctrin and Worſhip,</hi>
<note place="margin">Accom<g ref="char:EOLhyphen"/>modation, pa. 29. & 77 Jus di. Min. by the Pro<g ref="char:EOLhyphen"/>vince of Lon.</note>
<hi>and in the moſt</hi> SUBSTANTIAL <hi>things of Church-Government;</hi> our brethren alſo aſſert, that <hi>our diffe<g ref="char:EOLhyphen"/>rences from them are in Circumſtan<g ref="char:EOLhyphen"/>tials, and in leſſer matters</hi> only.</p>
<p>
<hi>If now Presbytery,</hi> and <hi>Independen<g ref="char:EOLhyphen"/>cy</hi>
<pb n="144" facs="tcp:170378:82"/>
be the ſame for <hi>ſubſtance,</hi> and their differences but in <hi>Circumſtan<g ref="char:EOLhyphen"/>ces,</hi> and upon that account the Ma<g ref="char:EOLhyphen"/>giſtrate (in his opinion) hath pow<g ref="char:EOLhyphen"/>er to ſettle <hi>either,</hi> as he ſhall judge moſt ſuitable to the <hi>Civil</hi> eſtate, and when hee findes it <hi>inconvenient</hi> in that reſpect alſo, to alter again any form, as hee did <hi>Epiſcopacy;</hi> if this bee ſuppoſed, and <hi>either</hi> of theſe ſhould bee impoſed to bee owned under the penalty of <hi>ejection,</hi> or ſilencing; (which the Lord in mercy as yet hath prevented) It may be a means in all likelihood, to take from the people of God, as many precious Miniſters of the Goſpel (if it ſhould remain, ſo long) as <hi>Epiſcopacy</hi> when it had its time, and was in the like man<g ref="char:EOLhyphen"/>ner impoſed.</p>
<p>It was looked upon by the Parlia<g ref="char:EOLhyphen"/>ment, as no matter of the <hi>ſubſtance</hi> of Church-government, as they expreſly declare, which was by <hi>Or<g ref="char:EOLhyphen"/>dinance</hi> eſtabliſhed: for the judging
<pb n="145" facs="tcp:170378:82"/>
of <hi>ſcandalous ſinners,</hi> and ſuch as were to bee kept from the Sacra<g ref="char:EOLhyphen"/>ment. They profeſſe alſo in doing this,<note place="margin">Ordinanc. of <hi>March</hi> 14. 1645.</note>
<hi>they had the</hi> COVENANT <hi>which they had ſo ſolemnly taken before their eyes.</hi> And yet thoſe that were to <hi>ſubmit</hi> and obey, complain in their petition to both Houſes, that <hi>there were ſome things eſtabliſhed in thoſe Ordinances, ſo contrary to that way of Government which Chriſt hath ap<g ref="char:EOLhyphen"/>pointed in his Word,</hi>
<note place="margin">Aſſemb. Pet. of <hi>March</hi> 23, 1645.</note>
<hi>and ſo diſagree<g ref="char:EOLhyphen"/>able to the</hi> COVENANT, <hi>that they dare not practiſe according to that pro<g ref="char:EOLhyphen"/>viſion.</hi> And if the penalty of <hi>E<g ref="char:EOLhyphen"/>jection</hi> ſhould have been laid upon thoſe that could not in conſcience ſubmit to that eſtabliſhment; it was profeſſed by the <hi>Aſſembly</hi> in ano<g ref="char:EOLhyphen"/>ther Petition, that <hi>they did evident<g ref="char:EOLhyphen"/>ly fore-ſee, that not only</hi> THEY, <hi>but</hi> MANY <hi>of their godly Brethren, muſt bee put upon ſinning, or the forſaking of their ſtations in the miniſtry.</hi>
</p>
</div>
<div n="9" type="section">
<pb n="146" facs="tcp:170378:83"/>
<head>§. 9.</head>
<p>Thus we ſee what great <hi>diſcou<g ref="char:EOLhyphen"/>ragements</hi> ariſe from ſuch <hi>impoſiti<g ref="char:EOLhyphen"/>ons;</hi> and how not only the WAY is made farre <hi>narrower</hi> to thoſe who <hi>would</hi> come into the Miniſtry, and the STATION more <hi>ſlippery</hi> and uncertain to thoſe that <hi>are</hi> in; which <hi>uncertainty</hi> ariſeth not only from the doubtfulneſſe of our own thoughts in diſputable points, but the changes may happen in a ſtate.</p>
<p>This muſt needes bring a low e<g ref="char:EOLhyphen"/>ſteem upon this way, eſpecially when ſo many other <hi>Callings</hi> and imployments are in our eye, more illuſtrious and creditful, and may bee undertook, and continued in, with much more ſecurity; The <hi>Law, Phyſick, Merchandize, &c.</hi> Callings much more gainful, and may bee had, and practiſed by a <hi>Turk,</hi> or <hi>Jew,</hi> or <hi>Papiſt,</hi> here a<g ref="char:EOLhyphen"/>mongſt us; nor is there any thing
<pb n="147" facs="tcp:170378:83"/>
in point of Religion or Morals more required of them in that re<g ref="char:EOLhyphen"/>ſpect, than in the holding of their Houſes, Lands, or Temporal eſtates.</p>
<p>And let not men deceive them<g ref="char:EOLhyphen"/>ſelves in thinking, that this Cal<g ref="char:EOLhyphen"/>ling hath ſuch a <hi>peculiar ſweetneſſe,</hi> and ſuch encouragements from the Lord, more than other Callings, that there is no fear wee ſhall want Miniſters; Or that the men of this Calling ſhould bee ſo Spiritual, as <hi>revenues</hi> or <hi>reward</hi> in theſe tempo<g ref="char:EOLhyphen"/>ral and carnal things, ſhould, or ought not to be reſpected by them.</p>
<p>
<hi>Anſ.</hi> Though <hi>ſowing of Spiritual things</hi> was, and is, a very <hi>ſweet</hi> and comfortable employment: yet the Apoſtle, 1 <hi>Cor.</hi> 9.11. thought it not equal, wee ſhould therefore <hi>imbitter</hi> it with poverty, but rather <hi>ſweeten</hi> it further, by their <hi>reaping of car<g ref="char:EOLhyphen"/>nal things,</hi>
<note place="margin">Gal. 6.6, 7.</note> and <hi>he that is taught to communicate to him that teacheth,</hi> the good things of this life, elſe but a <hi>mocking</hi> of God.</p>
<p>
<pb n="148" facs="tcp:170378:84"/>If this Calling doe meet with ſuch peculiar encouragements, a<g ref="char:EOLhyphen"/>bove other Callings, from the Lord, this is no argument it may there<g ref="char:EOLhyphen"/>fore bee the more loaded by us; but on the contrary, as he wil <hi>honour them that honour him,</hi> ſo ſhould we honour them that God honours, and encourage them, moſt of any, that the Lord encourageth: You that are <hi>Gods</hi> and <hi>Fathers</hi> here on the earth, with the comforts of the earth, as our heavenly Father doth ſuch with the greater comforts of his Spirit. I anſwer further, and let it be conſidered.</p>
<p>When men take the firſt pro<g ref="char:EOLhyphen"/>ſpect of the calling, they purpoſe themſelves unto, it is at a diſtance, and after this reſolution is taken up (which is but the firſt ſtep) there is a tedious journey to bee made through ſome years educati<g ref="char:EOLhyphen"/>on; ſo that the moſt men that now are in this, or in moſt other cal<g ref="char:EOLhyphen"/>lings, are ſuch who were in their
<pb n="149" facs="tcp:170378:84"/>
Natural ſtate and condition, when they firſt choſe and deſign<g ref="char:EOLhyphen"/>ed their way. And made their choyce with reſpect rather to a <hi>livelihood,</hi> and ſupport in out<g ref="char:EOLhyphen"/>ward things; ſome to raiſe an eſtate, &c. than any thing of more Spiritual conſideration: As the <hi>bread</hi> and <hi>plenty</hi> in his Fathers houſe was to that Son (in the place and diſtance in which hee ſtood) the <hi>firſt,</hi> if not the greateſt <hi>motive,</hi>
<note place="margin">Luk. 15.17</note> in a higher and greater diſpoſe<g ref="char:EOLhyphen"/>ment.</p>
<p>And therefore when thoſe great encouragements, and places of ad<g ref="char:EOLhyphen"/>vancement, as <hi>Biſhopricks, Deane<g ref="char:EOLhyphen"/>ries, double</hi> Benefices, Benefices with <hi>Prebendaries,</hi> and the like: without ſome of which there was never yet any man, though of ever ſo great eminency in <hi>this calling,</hi> hath been able to riſe, to any ſuch e<g ref="char:EOLhyphen"/>ſtate in this world, as almoſt in any <hi>other</hi> profeſſion, ſome that are <hi>ex<g ref="char:EOLhyphen"/>pert</hi> and able in it have done. I
<pb n="150" facs="tcp:170378:85"/>
ſay, when theſe were taken away, a very great incouragement to Lear<g ref="char:EOLhyphen"/>ning was removed, and ſuch as will be felt in the following age. Not that the continuance of ſuch places is in the leaſt deſirable, no, they were ſinful, and ought to bee re<g ref="char:EOLhyphen"/>moved.</p>
<p>But let Gods dealing and pro<g ref="char:EOLhyphen"/>vidence in removing of them, bee remarkably obſerved, and e<g ref="char:EOLhyphen"/>ſpecially in this, namely, That when the Lord took from this <hi>Tribe</hi> thoſe <hi>invitations,</hi> that did ballance the hazard of a long and chargeable education, and other uncertainties, At the ſame time theſe Ceremonies and ſubſcripti<g ref="char:EOLhyphen"/>ons, (the tenure by which they were held) and thoſe great and breaking penalties of <hi>ejection</hi> and <hi>deprivation</hi> for Non-Conformity were alſo happily removed; which was ſo great an incouragement on the other hand; as it held up mens minds to the Miniſtry notwithſtan<g ref="char:EOLhyphen"/>ding.</p>
<p>
<pb n="151" facs="tcp:170378:85"/>But now to ſee theſe <hi>penalties,</hi> up<g ref="char:EOLhyphen"/>on one occaſion or other, <hi>returning</hi> upon us again (but thoſe <hi>encou<g ref="char:EOLhyphen"/>ragements,</hi> or any equivalent, never likely to return) and that after they have been ſo lately, and <hi>twice</hi> taken away, and to return a<g ref="char:EOLhyphen"/>gain in as ſtrict a ſeverity upon this almoſt <hi>ſunk</hi> generation of men as ever they were inflicted; It will cauſe multitudes to turn their backs upon <hi>this Profeſsion</hi> more than upon any other; and more than ever they have done heretofore.</p>
<p>I muſt profeſſe, I <hi>have long</hi> feared, and doe ſtill more than ever, conſi<g ref="char:EOLhyphen"/>dering <hi>theſe things,</hi> and upon what uncertain terms alſo, that <hi>mainte<g ref="char:EOLhyphen"/>nance</hi> depends, which the Law hath allowed for the Miniſters ſupport, and how long <hi>ſtruck</hi> at (I mean Tithes) and <hi>petitioned</hi> againſt, and I doubt had been taken away before this time, were it not for the <hi>Lay-intereſt</hi> (ſo much ſpoken againſt by ſome) of <hi>Appropriators.</hi>
<pb n="152" facs="tcp:170378:86"/>
And alſo with what <hi>difficulty,</hi> ſome Tithes, eſpecially in Cities and Towns, are now recovered and got<g ref="char:EOLhyphen"/>ten in.</p>
<p>I ſay, when I thus conſider and lay all together, I fear this Nation, which hath been worthily <hi>famous</hi> throughout the world, for learned, powerful, able Preachers, In a ſhort time (if ſuch <hi>diſcouragements</hi> ſhould bee brought in again upon the Miniſtry) our Governours will bee conſtrained, either 1 To take the courſe they doe in the <hi>Nether<g ref="char:EOLhyphen"/>lands,</hi> where the Miniſters being low and mean, their <hi>Children</hi> com<g ref="char:EOLhyphen"/>ming to the charity of the State, are bred up to the Miniſtry again for a ſupply when their <hi>Fathers</hi> go off by death. And for their <hi>Profeſſors</hi> pla<g ref="char:EOLhyphen"/>ces, men are called ordinarily from other parts to ſupply them. Or 2 To put into the Miniſtry perſons bred up to ſome other Calling or Trade: who though not able in conſcience to conform to what <hi>is,</hi>
<pb n="153" facs="tcp:170378:86"/>
or what <hi>may bee</hi> impoſed in Diſci<g ref="char:EOLhyphen"/>pline or Worſhip, yet (if it ſo hap<g ref="char:EOLhyphen"/>pen) can take up their Shops or Trades again: Having been ſo pro<g ref="char:EOLhyphen"/>vident, as not to caſt their <hi>youth</hi> into ſuch a way of breeding, as will hang their neceſſary <hi>livelihood</hi> upon ſuch an uncertain, & turning hinge.</p>
</div>
<div n="10" type="section">
<head>§. 10.</head>
<p>And if this alſo be added, the SEA<g ref="char:EOLhyphen"/>SON, and a conſideration of theſe times, in which, 1 <hi>Miniſters work never lay heavier</hi> upon thoſe that are faithful; and 2 <hi>The hands ne<g ref="char:EOLhyphen"/>ver fewer</hi> to bear it up, than at this preſent, which will adde weight and aggravation to our diſcouragement.</p>
<p>For the firſt, when a reformati<g ref="char:EOLhyphen"/>on is made, of what is amiſſe in Re<g ref="char:EOLhyphen"/>ligion; when the Worſhip of God comes to bee <hi>purged</hi> of old <hi>wonts</hi> and <hi>ſuperſtitions,</hi> theſe are ſuch things as the common people are more unwilling to part with than
<pb n="154" facs="tcp:170378:87"/>
their <hi>gold</hi> or <hi>ſilver,</hi>
<note place="margin">1 Pet. 1.18. Judg. 18.24 Jer. 32.35.</note> or any thing elſe they have in this world. A more Spiritual Goſpel Light alſo, in reforming times, breaketh forth upon ſuch as naturally <hi>love darkneſs rather than light.</hi> At ſuch times therefore there hath ever been great ſtirrings, and diſtempers of ſpirit through the <hi>generality</hi> of a whole Nation.</p>
<p>The Miniſters they only ſtand as it were in the <hi>front</hi> of contention, and receive all the <hi>ſhot</hi> of oppoſiti<g ref="char:EOLhyphen"/>on. Though the alterations be by the <hi>Lawes</hi> of the Nation, and the reſolutions of their own <hi>repreſenta<g ref="char:EOLhyphen"/>tives:</hi> yet they are willing to look no further than their Miniſters (in whoſe hands indeed theſe changes firſt appear, as thoſe that make them. Our Miniſter (ſaith one) <hi>will</hi> not uſe the Common-prayer-Book, not Marry, nor Bury, nor Church, as we were wont to have it; our Miniſter will ſet up <hi>Diſci<g ref="char:EOLhyphen"/>pline,</hi> keep us from the Sacrament, ſay others.</p>
<p>
<pb n="155" facs="tcp:170378:87"/>When Miniſters had to doe only with the <hi>Doctrine</hi> of the Goſpel, and diſcharged their Conſciences in a faithful and ſearching application of it to each perſon, ſuch a mans condition was not much better than <hi>Iſhmaels,</hi> of whom it is ſaid,<note place="margin">Gen. 16.12</note>
<hi>His hand is againſt every man, and eve<g ref="char:EOLhyphen"/>ry mans hand againſt him:</hi> But, Goſ<g ref="char:EOLhyphen"/>pel-<hi>Diſcipline</hi> provokes and diſ<g ref="char:EOLhyphen"/>pleaſeth <hi>ten times</hi> more, and this al<g ref="char:EOLhyphen"/>ſo is now Miniſterial work, and it is a <hi>New</hi> work to the common people, eſpecially it being exerciſed by ſo <hi>mean</hi> a hand (as they account it) a <hi>common Miniſter.</hi> Formerly it was done by a <hi>Biſhop,</hi> a Spiritual <hi>Court,</hi> under <hi>Seal,</hi> and by thoſe that exer<g ref="char:EOLhyphen"/>ciſed a great deal of <hi>ſtate</hi> in their Eccleſiaſtical proceedings, like the <hi>Princes</hi> of this world, that have do<g ref="char:EOLhyphen"/>minion over their people.</p>
<p>Thus we ſee Miniſters have diſ<g ref="char:EOLhyphen"/>couragements enough at ſuch a time, from the work it ſelf if per<g ref="char:EOLhyphen"/>formed as it ſhould be, in ſo much
<pb n="156" facs="tcp:170378:88"/>
as in many places they are enforced to ſit down with half the means the Lawes give them; and what they doe get, is with ſuch uncom<g ref="char:EOLhyphen"/>fortable, contentions, as did not neceſſity urge, they were better beſtow their pains amongſt them for nothing. And this hath been the Miniſters condition upon all <hi>changes</hi> and further <hi>reformations;</hi> who being not able in Conſcience to ſatisfie their people in ſuch <hi>ſu<g ref="char:EOLhyphen"/>perſtitious</hi> vanities, as they former<g ref="char:EOLhyphen"/>ly enjoyed; the people put them to the utmoſt extremity and moleſta<g ref="char:EOLhyphen"/>tion in every thing they have to doe with them in.</p>
<p>And ſo it is at this time, in ſo much as his <hi>Highneſſe</hi> commiſera<g ref="char:EOLhyphen"/>ting the ſufferings in this kind.<note place="margin">Procla<g ref="char:EOLhyphen"/>mation for the better en<g ref="char:EOLhyphen"/>courage<g ref="char:EOLhyphen"/>ment of <hi>godly Mi<g ref="char:EOLhyphen"/>niſters.</hi> Nov. 25. 1658.</note> of the moſt conſcientious Miniſters throughout the Nation; was gra<g ref="char:EOLhyphen"/>ciouſly pleaſed with the advice of his <hi>Council:</hi> by a ſeaſonable Procla<g ref="char:EOLhyphen"/>mation, to require all perſons concer<g ref="char:EOLhyphen"/>ned, to deal more <hi>righteouſly</hi> in this matter.</p>
<p>
<pb n="157" facs="tcp:170378:88"/>And it being thus at preſent with the faithful Miniſters of the Goſ<g ref="char:EOLhyphen"/>pel, and eſpecially with thoſe that are moſt zealous to carry on this work of reformation. If to this ſe<g ref="char:EOLhyphen"/>vere Diſcipline of the people, who take from him <hi>half</hi> his means, be<g ref="char:EOLhyphen"/>cauſe he diſchargeth his Conſcience <hi>in ſome things:</hi> ſuch <hi>Diſcipline</hi> of the Magiſtrate bee added; the ta<g ref="char:EOLhyphen"/>king away his <hi>whole</hi> means, becauſe he cannot goe againſt his Conſci<g ref="char:EOLhyphen"/>ence in <hi>ſome other</hi> things. I ſay, if it be thus with <hi>this profeſsion,</hi> and on each hand beſet with ſuch diſcourage<g ref="char:EOLhyphen"/>ments, it is not for us to expect any thing in the future, but a very low Miniſtry through the Nation, ſome few perſons being off the Stage, that more <hi>encouraging</hi> times engaged to come on.</p>
</div>
<div n="11" type="section">
<head>§. 11.</head>
<p>For the Second. As the work it ſelf hath not been ſo troubleſome
<pb n="158" facs="tcp:170378:89"/>
and diſcouraging, in any age: ſo is this a ſeaſon wherein the faithful Orthodox Labourers are <hi>few,</hi> very few in compariſon. The age before this late Reformation, was a very <hi>waſting</hi> age, by reaſon of Epiſcopal tyranny, many that were conſcien<g ref="char:EOLhyphen"/>tious diverted their Studies; of thoſe that engaged in the Miniſtry, multitudes were hunted out of this Nation into forein parts, where half of them loſt their laſt breath, and not half of that half remaining, are returned amongſt us again.</p>
<p>It is alſo with us now, as in the firſt reformation, the <hi>Popiſh</hi> then ſo the <hi>Epiſcopal</hi> diſ-affected Mini<g ref="char:EOLhyphen"/>ſters now, have neceſſarily been tur<g ref="char:EOLhyphen"/>ned out of this imployment: ſo that ſuch is the ſcarcity of well-affected and able men to carry on this work, that many Pariſhes throughout the Nation lye vacant, and are as ſheep without a Shepheard; eſpecially in the remoter parts. And where it is otherwiſe, and places better fur<g ref="char:EOLhyphen"/>niſhed;
<pb n="159" facs="tcp:170378:89"/>
the number is not ſuffici<g ref="char:EOLhyphen"/>ent, no not in the City of <hi>London,</hi> or the <hi>Univerſities,</hi> to preſerve their people to the intreſt of the preſent work of Chriſt: but are more and more prevailed upon, and infected with the old Leaven of Po<g ref="char:EOLhyphen"/>pery and Superſtition, and the wretched Principles of the Epiſco<g ref="char:EOLhyphen"/>pal malignant Party, which daily increaſeth every where.</p>
<p>And the reaſon of ſuch <hi>Apoſtacy</hi> I conceive to be this. Many ſuper<g ref="char:EOLhyphen"/>ſtitious and ill-affected, ſtill hold their places and Livings, by the intreſt of friends, or having been <hi>wary,</hi> and kept without the reach of the Ordinance; and thoſe more <hi>open</hi> who have been ejected, creep into the empty and vacant places, and having no legal maintenance are not (nor are the people that receive and maintain them) within the reach of any Law as yet eſtabliſhed: ſo that it is to be feared, ſuch perſons up<g ref="char:EOLhyphen"/>on one account or other, are a grea<g ref="char:EOLhyphen"/>ter
<pb n="160" facs="tcp:170378:90"/>
number than the ſound and godly, and thoſe that ingage tho<g ref="char:EOLhyphen"/>rowly in this work.</p>
<p>This being ſo, the faithful and well-affected Miniſters of the Goſ<g ref="char:EOLhyphen"/>pel, ſhould not at ſuch a time eſpe<g ref="char:EOLhyphen"/>cially, but for very great unworthi<g ref="char:EOLhyphen"/>neſs, be ejected and put out of their places. There is too much ground to fear, that ſome one ſuch impoſiti<g ref="char:EOLhyphen"/>on as in THIS CASE, and rigo<g ref="char:EOLhyphen"/>rouſly proſecuted upon ſuch as can<g ref="char:EOLhyphen"/>not conform, will give the Malig<g ref="char:EOLhyphen"/>nant party the day they look for; and thoſe that doe conform and keep their places: will be ſo over<g ref="char:EOLhyphen"/>topped by Malignants and their fol<g ref="char:EOLhyphen"/>lowers, as they will not bee able to do much in reforming of their peo<g ref="char:EOLhyphen"/>ple any where. The common ſort of men in all ſuch changes being or<g ref="char:EOLhyphen"/>dinarily found, very brutiſhly to ſtick and hold to old Cuſtoms, and then moſt of all, and with moſt zeal, when there is an endea<g ref="char:EOLhyphen"/>vour by wholſome Laws and con<g ref="char:EOLhyphen"/>ſtitutions
<pb n="161" facs="tcp:170378:90"/>
to direct, and put them on to a more Goſpel and Spiritual way of ſerving the Lord.</p>
</div>
<div n="12" type="section">
<head>§. 12.</head>
<p>It is thought and ſaid, the dif<g ref="char:EOLhyphen"/>ferences and conteſt about <hi>Church-Government,</hi> and the like <hi>mat<g ref="char:EOLhyphen"/>ters,</hi> that have unhappily faln out amongſt thoſe that are well-affect<g ref="char:EOLhyphen"/>ed, hath been a great advantage and ſtrengthning to the other party. And very likely it hath been ſo, and therefore the more heed ought to be, leſt ſome new matter of con<g ref="char:EOLhyphen"/>troverſie be ſtarted, that may oc<g ref="char:EOLhyphen"/>caſion further differences amongſt the godly.</p>
<p>Our adverſaries never have ſuch ad<g ref="char:EOLhyphen"/>vantage of the different opinions or practices that are amongſt our ſelves, as when for ſuch differences wee drive one another out of the field. Though differences are and have bin between Presbyterians and
<pb n="162" facs="tcp:170378:91"/>
Independents, yet each keeps his ſtation, and fights (in different re<g ref="char:EOLhyphen"/>giments, it may bee) againſt the ſame common Enemy. But by ſuch penalties of <hi>ejection</hi> and <hi>ſilen<g ref="char:EOLhyphen"/>cing;</hi> we drive a conſiderable <hi>part</hi> of our own out from us, when our common enemy is already too ſtrong for the whole. The Popiſh party had no ſuch advantage by any diffe<g ref="char:EOLhyphen"/>rences amongſt thoſe that oppoſed them, in the firſt reformation, as when the brethren ſo differing came by the <hi>ſeverity</hi> of Governours, to bee diſtinguiſhed by the ſir-names of <hi>Conformiſts</hi> and <hi>Non-Conformiſts,</hi> and the one upon that account <hi>ca<g ref="char:EOLhyphen"/>ſhiered</hi> and droven out of the <hi>field</hi> by the other.</p>
<p>And I have been very apt to con<g ref="char:EOLhyphen"/>ceive, this to be the cauſe why that firſt reformation proſpered no bet<g ref="char:EOLhyphen"/>ter: we know that in near a hundred years it gained little upon <hi>Popery</hi> and <hi>ſuperſtition</hi> more than was got<g ref="char:EOLhyphen"/>ten by the firſt aſſault, nay it <hi>de<g ref="char:EOLhyphen"/>cayed,</hi>
<pb n="163" facs="tcp:170378:91"/>
and Popery grew under it ſo faſt, as at laſt wee were almoſt returned into the ſame condition that we were reformed from; this I ſay may be the cauſe. There was the like ſevere impoſitions and Lawes made (as in <hi>this caſe</hi>) upon occaſi<g ref="char:EOLhyphen"/>on of differences amongſt themſelvs, and then advantages were taken thereby, and many put out of the Muſter-roll, for <hi>Non-Conformity,</hi> who were of greateſt courage, and moſt faithful reſolution againſt Po<g ref="char:EOLhyphen"/>pery and Superſtition, the then common enemy.</p>
<p>The ſilencing and ejection of Miniſters in Q. <hi>Elizabeths</hi> days, re<g ref="char:EOLhyphen"/>formation being newly begun, & the <hi>enemies</hi> to it <hi>many,</hi> the <hi>friends</hi> and thoſe that faithfully engaged <hi>few:</hi> was looked upon by the godly pru<g ref="char:EOLhyphen"/>dent of that age, as very <hi>unſea<g ref="char:EOLhyphen"/>ſonable;</hi> yea though their crimes had deſerved it, becauſe of the <hi>ſcarcity</hi> of Preachers at that time. There is nothing more frequent in
<pb n="164" facs="tcp:170378:92"/>
our ſuffering Brethrens writings, that were then publiſhed againſt the <hi>Hierarchy,</hi> than a bemoaning the great loſſe to the cauſe and peo<g ref="char:EOLhyphen"/>ple of God thereby. I will mention but one; <hi>Conſidering the ſeaſon</hi> (ſaith Mr. <hi>Parker) though wee were worthy, yet ſhould wee leaſt be deprived now when Popery</hi> (Epiſ<g ref="char:EOLhyphen"/>copacy and malignancy wee may adde) <hi>riſeth like the ſwellings of</hi> Jordan, <hi>yea maketh invaſion like an armed man, when there are wanting many</hi> (this is truly our ſad caſe at preſent) <hi>On the other ſide, in many Pariſhes to ſtand up in the gap againſt it. Doth not the Canon Law it ſelf ſpare depriving for greater faults, when there is</hi> PENVRIA <hi>ſacerdotum & quando utilitas ecceleſiae exigit.</hi> Park. of the Croſſe, <hi>cap.</hi> 5. §. 16.</p>
</div>
</div>
<div n="8" type="chapter">
<pb n="165" facs="tcp:170378:92"/>
<head>
<hi>CHAP. VIII.</hi> Schiſmes and Diviſions amongſt the people of God, occaſioned and con<g ref="char:EOLhyphen"/>tinued thereby, is another fruit,<note place="margin">See Pa. 101, & 120</note> or evil conſequence of ſuch penal<g ref="char:EOLhyphen"/>ties.</head>
<div n="1" type="section">
<head>§. 1:</head>
<p>SUch Impoſitions and Penalties, are a means to fix and hold up the differences that are in mens judgements about the things of Chriſt: and alienate affections in thoſe that differ, and ſo occaſion <hi>Rents</hi> and <hi>Schiſms</hi> amongſt the peo<g ref="char:EOLhyphen"/>ple of God.</p>
<p>Love <hi>is the bond of perfection,</hi> by it the <hi>members</hi> are Spiritually uni<g ref="char:EOLhyphen"/>ted to the <hi>body,</hi> as they are by <hi>faith</hi> to the <hi>Head</hi> Chriſt Jeſus. <hi>Hereſie</hi> divides from the head, <hi>Schiſme</hi> from the members, it being a looſe<g ref="char:EOLhyphen"/>ning, or breach in that <hi>bond,</hi> love
<pb n="166" facs="tcp:170378:93"/>
hath its ſeat and foundation in TRUTH, 2 John. 1. <hi>Whom I love in the truth.</hi> 2. <hi>For the truths ſake which dwelleth in us, and ſhall bee with us for ever.</hi> As Saints, and eſpecially Churches, have their love and compactneſſe maintained, in being of the <hi>ſame</hi> mind and judg<g ref="char:EOLhyphen"/>ment in <hi>Truths:</hi> ſo Schiſms uſually begin from differences in that re<g ref="char:EOLhyphen"/>ſpect, <hi>Rom.</hi> 16.17.</p>
</div>
<div n="2" type="section">
<head>§. 2.</head>
<p>There are truths <hi>known</hi> and ge<g ref="char:EOLhyphen"/>nerally received, there are alſo truths not, or not ſo fully known, but <hi>doubtfully</hi> aſſented to: Truths nouriſh love no further than mutu<g ref="char:EOLhyphen"/>ally beleeved and agreed in; hence <hi>ignorance, weakneſſe</hi> in judgement, <hi>dubiouſneſſe</hi> and the like; or what keeps us from a clear and full cloze with truth, are very prejudicial to love, and <hi>intireneſſe</hi> amongſt bre<g ref="char:EOLhyphen"/>thren.</p>
<p>
<pb n="167" facs="tcp:170378:93"/>Truths alſo are either about what is of <hi>neceſsity</hi> and a Chriſtians <hi>duty,</hi> or what is <hi>indifferent</hi> and a Chriſtians <hi>liberty.</hi> Where theſe are not held diſtinct, and weight laid upon them accordingly: but matters of duty, in a liberty or indifferency; or things left to our liberty, held to and re<g ref="char:EOLhyphen"/>quired in our practice as neceſſary. Herein ſo farre as wee divide from <hi>truth</hi> in our apprehenſions; in like proportion, we are diſpoſed to di<g ref="char:EOLhyphen"/>vide one from another in our <hi>af<g ref="char:EOLhyphen"/>fections.</hi>
</p>
<p>Ignorance, Error, miſ-apprehen<g ref="char:EOLhyphen"/>ſions, alienation in affections; theſe and the like diſpoſe us to Schiſme and Diviſions:<note place="margin">
<hi>Aquinas</hi> 2<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>.2<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>. q. 39.</note> yet <hi>Schiſme</hi> is a ſin diſtinct from each. Wee muſt <hi>pro<g ref="char:EOLhyphen"/>pria ſponte & intentione, ſeparare ab unitate quam</hi> CHARITAS <hi>facit,</hi> before we become Schiſmaticks.</p>
<p>Knowingly and purpoſely, to take up or impoſe that for duty which is not ſo; or to make ſuch things indifferent, that are neceſſa<g ref="char:EOLhyphen"/>ry:
<pb n="168" facs="tcp:170378:94"/>
To bee wilfully ignorant, or (through ſluggiſhneſſe and indiſpo<g ref="char:EOLhyphen"/>ſedneſſe to ſearch) to take up<g ref="char:EOLhyphen"/>on truſt with a party; and there<g ref="char:EOLhyphen"/>upon endeavour a wilfull ſepa<g ref="char:EOLhyphen"/>ration, and dividing from our brethren; this (whatſoever other thing beſides it) may juſtly bee termed Schiſme. And it is then moſt viſibly and properly ſchiſm, when it is a dividing where a more viſible and profeſſed union, as in or from <hi>Churches:</hi> as <hi>Sedition</hi> is moſt apparently ſuch, when it is a facti<g ref="char:EOLhyphen"/>on in a formed <hi>Common-wealth.</hi>
</p>
</div>
<div n="3" type="section">
<head>§. 3.</head>
<p>Theſe and the like Roots of Schiſme, lye many times ſecret and under ground, our <hi>darkneſſe</hi> as well as our <hi>light</hi> may be under a <hi>buſhel;</hi> our <hi>infirmities</hi> and miſ-apprehenſi<g ref="char:EOLhyphen"/>ons, yea want of Love it ſelf is ſometimes <hi>covered with love:</hi> ſo
<pb n="169" facs="tcp:170378:94"/>
that differences break not forth to an open conteſt, and profeſſed diſow<g ref="char:EOLhyphen"/>ning, either of opinion, practices, of perſons. But when the matter of ſuch differences falleth under an IMPO<g ref="char:EOLhyphen"/>SITION, Governours thinking to bring all into <hi>unity,</hi> by an enforced <hi>uniformity.</hi> Theſe differences then that before were private, or in a leſſe compaſſe, are (ſcattered as it were and carried forth by the hand of theſe Lawes and in<g ref="char:EOLhyphen"/>junctions) become more pub<g ref="char:EOLhyphen"/>lick and profeſſed. Yea, what be<g ref="char:EOLhyphen"/>fore was of <hi>infirmity</hi> and weakneſſe, grows up apace to <hi>wilfulneſſe</hi> and ſtifneſſe: at leaſt ſo judged (by <hi>one</hi> of the <hi>other</hi>) in the opinion of each party reſpectively.</p>
<p>In matters that are <hi>indifferent,</hi> and granted to be ſo, by the impo<g ref="char:EOLhyphen"/>ſers: or if <hi>neceſſary,</hi> yet when not evidently ſo, but doubtful and diſ<g ref="char:EOLhyphen"/>putable, let it be in Worſhip or Diſcipline; there is no <hi>ſeverity</hi> of the Civil Magiſtrate, or <hi>Cenſure</hi> of
<pb n="170" facs="tcp:170378:95"/>
the Church, can reduce all, no not all that are holy, ſober, and judi<g ref="char:EOLhyphen"/>cious, into an uniformity. The ex<g ref="char:EOLhyphen"/>perience of many years, and the extremities and ſufferings upon this account of many precious learned men, doe ſufficiently confirm it.</p>
<p>And if by ſuch ſeverity, <hi>unity</hi> and uniformity bee not obtained, diviſions, diſtractions, and differen<g ref="char:EOLhyphen"/>ces will from thence ariſe, and grow more open and fixed, by rea<g ref="char:EOLhyphen"/>ſon of ſuch impoſitions. And this cometh to paſſe many ways.</p>
</div>
<div n="4" type="section">
<head>§. 4.</head>
<p>
<note place="margin">¶ I</note>SUch matters though in them<g ref="char:EOLhyphen"/>ſelves indifferent and arbitrary, or if otherwiſe, yet if not <hi>clearly</hi> but <hi>doubtfully</hi> ſo; by an impoſition of this nature are evidently held forth, and as it were aſſerted to bee both <hi>clear</hi> and <hi>neceſſary,</hi> and this hath ever been a foundation of great breaches.</p>
<p n="1">1 <hi>Neceſſary</hi> and a duty. For
<pb n="171" facs="tcp:170378:95"/>
what is impoſed by wiſe and righteous Governours, with ſuch enforcements; as if it bee not ſub<g ref="char:EOLhyphen"/>mitted unto, the moſt neceſſary duties of the Miniſterial Function, as <hi>Preaching, Sacraments, &c.</hi>
<note place="margin">Abridg. pag. 38.</note> muſt bee omitted: at leaſt by the moſt tender and conſcientious Miniſters, throughout the Nation (it was ſo argued in the Caſe of Cere<g ref="char:EOLhyphen"/>monies) queſtionleſſe whatſoever ſhall bee ſo impoſed,<note place="margin">Bradſh. 12. Arg. arg. 1</note> interprets it ſelf thereby, to be equally neceſ<g ref="char:EOLhyphen"/>ſary, with ſome or all theſe Mini<g ref="char:EOLhyphen"/>ſterial duties. And in my <hi>ſubmiſsion</hi> and <hi>practice,</hi> in reſpect to ſuch im<g ref="char:EOLhyphen"/>poſition, I own them to be of the ſame <hi>neceſsity;</hi> and there is no means to give teſtimony to the contrary, and to what I judge the truth, but by <hi>Non-Conformity,</hi> and ſubmitting ra<g ref="char:EOLhyphen"/>ther to the penalty. For where there is an opinion of neceſſity (ſay our Brethren) known to bee an<g ref="char:EOLhyphen"/>nexed unto that, which in my Con<g ref="char:EOLhyphen"/>ſcience is not ſo; it is a part of <hi>that
<pb n="172" facs="tcp:170378:96"/>
Confeſsion which every Chriſtian is bound to make of his Religion,</hi>
<note place="margin">Abridge<g ref="char:EOLhyphen"/>ment, <hi>pa.</hi> 38.</note>
<hi>to re<g ref="char:EOLhyphen"/>ject them:</hi> and this reaſon for it is given by them. <hi>The yeelding obedi<g ref="char:EOLhyphen"/>ence in uſing ſuch Forms, or Ceremo<g ref="char:EOLhyphen"/>nies, or what is of an indifferent nature in it ſelf,</hi> wherein <hi>others place</hi> holi<g ref="char:EOLhyphen"/>neſſe or <hi>neceſsity,</hi> is an occaſion of confirming and hardning ſuch Go<g ref="char:EOLhyphen"/>vernours or others in their errours. Again,</p>
<p n="2">2 Such a <hi>penalty</hi> as ſilencing or ejection implies theſe commands, to have very <hi>clear evidence,</hi> and un<g ref="char:EOLhyphen"/>doubted warrant from the Scrip<g ref="char:EOLhyphen"/>tures; at leaſt in the opinion of the Governours that inflict it, other<g ref="char:EOLhyphen"/>wiſe it were great injuſtice to re<g ref="char:EOLhyphen"/>quire ſubmiſſion upon <hi>ſuch terms.</hi> He that cannot clearly know his Maſters will, ſhould not be <hi>chaſti<g ref="char:EOLhyphen"/>ſed</hi> with ſuch <hi>ſtripes.</hi> If we refuſe to ſubmit (though it be) out of ten<g ref="char:EOLhyphen"/>derneſſe and fear to offend the Lord; being doubtful: yet ſuch commands, ſpeaking theſe things,
<pb n="173" facs="tcp:170378:96"/>
not only <hi>neceſſary,</hi> but <hi>evidently</hi> ſo; Wee ſhall ſuffer under the repro<g ref="char:EOLhyphen"/>ches (as our Brethren formerly did) of perſons that were proud,<note place="margin">
<hi>Powel</hi> in his Conſider.</note> wilful, obſtinate, diſobedient to Government, diſturbers of the Church, Schiſmaticks, and the like.</p>
</div>
<div n="5" type="section">
<head>§. 5</head>
<p>Our differences being thus heightned by <hi>impoſitions,</hi> and be<g ref="char:EOLhyphen"/>coming greater by prejudice & miſ<g ref="char:EOLhyphen"/>interpretation upon that account; than what indeed they are in themſelves, The perſons enga<g ref="char:EOLhyphen"/>ged are accordingly judged of and Cenſured, and a diſtance kept, as if they were guilty of wilful diſobe<g ref="char:EOLhyphen"/>dience, or neglect in ſome great and neceſſary matters of the Worſhip and Service of God, and accor<g ref="char:EOLhyphen"/>dingly we hold off from one ano<g ref="char:EOLhyphen"/>ther, and abate in affections. When the foundation is removed, when TRUTH hath changed its ſtation,
<pb n="174" facs="tcp:170378:97"/>
LOVE that is built upon it muſt needs vary, if not vaniſh quite a<g ref="char:EOLhyphen"/>way. And that party which ſoever it is, that from any conſideration interprets up, thoſe leſſer matters to ſuch an odious height, will bee judged by the other to be the firſt that declines in affection, and that is the beginning of all breaches and ſchiſms.</p>
<p>The load of that reproach was laid by the <hi>Epiſcopal</hi> Party on the Miniſters that left their Charges, who in Conſcience were not able to conform.<note place="margin">Offer of Conf. p. 5</note> But with a great deal more reaſon our Brethren that ſuf<g ref="char:EOLhyphen"/>fered, charged the Schiſms and di<g ref="char:EOLhyphen"/>ſturbances in the Church upon E<g ref="char:EOLhyphen"/>piſcopal ſeverity, and rigour of their power in keeping on, and heightning penal impoſitions upon Miniſters, and taking advantage thereby to ſuſpend ſome, and wea<g ref="char:EOLhyphen"/>ry others out of their places.</p>
<p>And if then ſuch a deceſſion of Miniſters from their Churches were
<pb n="175" facs="tcp:170378:97"/>
a Schiſme, the Crime of it is moſt juſtly charged by our Brethren up<g ref="char:EOLhyphen"/>on thoſe who were the ſole cauſe of it, and not upon thoſe who with much ſadneſſe and grief of heart left their ſtations.<note place="margin">Ch. Go. with peo<g ref="char:EOLhyphen"/>ples con<g ref="char:EOLhyphen"/>ſent. p. 138</note>
<hi>They themſelves</hi> (ſpeaking of the Prelates) <hi>are the Schiſmaticks, and the makers of the diviſions which are now in</hi> England, <hi>All wiſe men know, that not the dif<g ref="char:EOLhyphen"/>ference, but the cauſe maketh a Schiſ<g ref="char:EOLhyphen"/>matick,</hi> and more fully afterwards, <hi>pag.</hi> 175. <q>The Superiour over<g ref="char:EOLhyphen"/>ruling Miniſter over many di<g ref="char:EOLhyphen"/>ſtinct Congregations which the Word knoweth not. In truth ſuch a one is the proper cauſe of diſſention and Schiſme, for hee not willing to ſubmit to Gods Word, by his power draweth many with him, whereupon fol<g ref="char:EOLhyphen"/>loweth diſſention and ſchiſme. And then he with his Company (being the ſtronger in the world) may cry out loudeſt againſt thoſe fewer that diſſent, that they are
<pb n="176" facs="tcp:170378:98"/>
Schiſmaticks and Peace-breakers, but look to the Word of God, and themſelves will bee found to be the makers of the Schiſme by their traditions.</q>
</p>
<p>
<note place="margin">De. Pol. l. 1. c. 37.</note>Learned <hi>Parker</hi> beſtowes a whole Chapter in proving that, <hi>Epiſcopis non puritanis diſsiaium anglicanum imputandum eſſe.</hi> And in his Trea<g ref="char:EOLhyphen"/>tiſe of the Croſſe, <q>I would (ſaith he) our oppoſites (the Biſhops) were as well able to clear them<g ref="char:EOLhyphen"/>ſelves of Schiſm, as we are able, who run within that Cenſure of <hi>Auguſtine, Quicunq, invident bo<g ref="char:EOLhyphen"/>nis ut quaerant occaſiones excluden<g ref="char:EOLhyphen"/>di eos aut degradandi, &c.</hi> Who<g ref="char:EOLhyphen"/>ſoever ſaith hee envies thoſe that are good, and ſeeks occaſion to exclude and eject them, that ra<g ref="char:EOLhyphen"/>ther than they will leave their own faults they will deviſe how to raiſe up troubles in the Church, and drive men into Conventicles, theſe are Schiſ<g ref="char:EOLhyphen"/>maticks, though they ſtill remain
<pb n="177" facs="tcp:170378:98"/>
in the Church.</q>
</p>
<p>About ſeven or eight and twen<g ref="char:EOLhyphen"/>ty years ſince, Maſter <hi>George Walker</hi> preached a Viſitation Sermon (I have cauſe to remember it, being then <hi>ſuſpended,</hi> and put out of my Miniſtry by the Viſitor) it was up<g ref="char:EOLhyphen"/>on 1 <hi>Cor.</hi> 11.16. <hi>If any man ſeem to be contentious, &c.</hi> hee declared, and with much ſtrength and evi<g ref="char:EOLhyphen"/>dence, aſſerted the <hi>Impoſers,</hi> who (being not neceſſitated,) lay ſuch <hi>ſnares;</hi> and not thoſe that conſci<g ref="char:EOLhyphen"/>entiouſly <hi>ſhun</hi> them, are the CON<g ref="char:EOLhyphen"/>TENTIOUS perſons, For which Sermon he was articled againſt, and moleſted long in the High Com<g ref="char:EOLhyphen"/>miſſion Court.</p>
</div>
<div n="6" type="section">
<head>§. 6.</head>
<p>Theſe penalties and ſevere im<g ref="char:EOLhyphen"/>poſitions are many times laid by the Magiſtrate, when his Conſcience is not by any Scripture-light neceſſi<g ref="char:EOLhyphen"/>tated
<pb n="178" facs="tcp:170378:99"/>
ſo to doe. The matters which the Scriptures have not determined preciſely <hi>one</hi> way or <hi>other,</hi> nor re<g ref="char:EOLhyphen"/>quired any ſuch determination from the Magiſtrate: If ſuch things bee ſtrictly impoſed and bound upon us, Hee doth not <hi>leave</hi> that liberty to others (though it be every mans right as well as <hi>his</hi>) which hee <hi>found</hi> left to him by the Lord. And where it is thus; what was <hi>arbi<g ref="char:EOLhyphen"/>trary</hi> in the Impoſer, becomes <hi>ne<g ref="char:EOLhyphen"/>ceſſary</hi> to the perſons impoſed up<g ref="char:EOLhyphen"/>on, they are neceſſitated either to <hi>ſubmit</hi> or <hi>leave</hi> their places.</p>
<p>And this puts a great difference, as more or leſſe blameable in the parties contending; when the one can plead little but his <hi>will</hi> or <hi>reſo<g ref="char:EOLhyphen"/>lution,</hi> and the other an apparent <q>
<hi>neceſsity.</hi> "Wee doe not <hi>(ſaid our ſuffering Brethren)</hi> ſeparate our ſelves from the Church,<note place="margin">Poſitions Archip. pa. 10. 11.</note> or forſake the Miniſtry of the Goſ<g ref="char:EOLhyphen"/>pel, but are <hi>thruſt</hi> from it; if men driven by <hi>Excommunicati<g ref="char:EOLhyphen"/>on</hi>
<pb n="179" facs="tcp:170378:99"/>
out of the Church bee not Schiſmaticks, much leſſe Mini<g ref="char:EOLhyphen"/>ſters driven by <hi>ſuſpenſion</hi> and <hi>deprivation.</hi> If the Prelates can<g ref="char:EOLhyphen"/>not prove from the Word, the things in queſtion, may be preſcri<g ref="char:EOLhyphen"/>bed by Authority, and yeelded to by the Miniſters without ſin, then are the Prelats <hi>Schiſmatical,</hi> ac<g ref="char:EOLhyphen"/>cording to the judgement of the Apoſtle, who <hi>beſeecheth the Bre<g ref="char:EOLhyphen"/>thren to mark them diligently, who cauſe diviſion and differences,</hi> be<g ref="char:EOLhyphen"/>ſides the Doctrin <hi>which they have learned, and avoyd them,</hi> Rom. 16.17.</q>
</p>
</div>
<div n="7" type="section">
<head>§. 7.</head>
<p>Breaches and Diviſions (ſecond<g ref="char:EOLhyphen"/>ly) are <hi>continued</hi> and <hi>fixed</hi> by ſuch impoſitions upon this account.<note place="margin">¶. II.</note>
</p>
<p>Humble reaſonings about mat<g ref="char:EOLhyphen"/>ters in difference amongſt Brethren, if it be with equal liberty to each, is the ordinary way to reduce into
<pb n="180" facs="tcp:170378:100"/>
peaceable union, perſons of diffe<g ref="char:EOLhyphen"/>rent judgements. But <hi>opinions</hi> or <hi>practices</hi> having obtained an eſta<g ref="char:EOLhyphen"/>bliſhment by Law, are thereby <hi>ex<g ref="char:EOLhyphen"/>empted</hi> from any ſuch Diſputings; or ſo much as being queſtioned, in reſpect either to their <hi>lawfulneſſe</hi> or <hi>expedience.</hi>
<note place="margin">Eccleſiaſt. Pol. p. 26.</note>
<hi>Things were diſputed,</hi> (ſaith <hi>Hooker) before they came to bee determined, men afterwards are not to</hi> DISPVTE <hi>any longer, but obey. Prudentia,</hi> ſay others, <hi>non obedientis ſed imperantis eſt;</hi> it is our part to <hi>obey,</hi> and not to bee ſo wiſe as to diſpute what is eſtabliſhed by pow<g ref="char:EOLhyphen"/>er; and many are the like expreſſi<g ref="char:EOLhyphen"/>ons in Epiſcopal writings.</p>
<p>In ſo much as though our ſilen<g ref="char:EOLhyphen"/>ced Brethren, and thoſe of that party, did all along make it their humble ſute, that they might have liberty and freedom) in a modeſt and Chriſtian way, to <hi>conferre and diſpute</hi> with the Prelatical party, a<g ref="char:EOLhyphen"/>bout the main and principal Con<g ref="char:EOLhyphen"/>troverſies, and differences that
<pb n="181" facs="tcp:170378:100"/>
were betwixt them, This could not bee obtained by all the friends and intereſt thoſe poor men could make. But (upon the like reaſons as are before mentioned) it was conſtant<g ref="char:EOLhyphen"/>ly denied them.</p>
<p>Theſe forms (ſay the <hi>Prelates</hi>) and Ceremonies being <hi>eſtabliſhed</hi> by a Law, <hi>ought not to bee called in que<g ref="char:EOLhyphen"/>ſtion, and diſputed of, as if they were doubtful. It is</hi> preſumption <hi>and arro<g ref="char:EOLhyphen"/>gancy to reaſon againſt what our Supe<g ref="char:EOLhyphen"/>riours have done.</hi>
<note place="margin">Anſw. the Miniſt. of <hi>London,</hi> pa. 17.</note>
<hi>For a Subject to examine the Law of his Magiſtrate</hi> (ſaith another) <hi>is to preſume and u<g ref="char:EOLhyphen"/>ſurp authority above his ſuperiours.</hi> The Governours themſelves have ever been ſufficiently againſt it.<note place="margin">Proclam. 5<hi rend="sup">o</hi> Mar. 1<hi rend="sup">o</hi>
<hi>Jacabi</hi>
</note> King <hi>James</hi> tells us, <hi>it is neceſſary for them to uſe conſtancy in upholding the publick determinations of State, other<g ref="char:EOLhyphen"/>wiſe it will become ridiculous, and that the ſtedfaſt maintaining of things by publick advice eſtabliſhed, is the weal of all Common wealths.</hi> Hee ſpeaks there of Church Lawes. The
<pb n="182" facs="tcp:170378:101"/>
Canons of 1603. which were con<g ref="char:EOLhyphen"/>firmed by <hi>his</hi> authority, threaten thus, Can. 6. <hi>Whoſoever ſhall hereafter</hi> AFFIRM <hi>the Rites and Ceremonies of the Church of</hi> England <hi>by</hi> LAVV ESTABLISHED, <hi>are ſuch as being commanded by lawful authority, men may not with a good conſcience approve, uſe, or if occaſion require ſubſcribe unto them, let him be excommunica<g ref="char:EOLhyphen"/>ted</hi> ipſo facto. (<hi>Can.</hi> 7.) The like for thoſe that owne not <hi>Church-Government by Arch-Biſhops, Biſhops, &c.</hi>
</p>
<p>So that when theſe leſſer, or doubtful matters, come to bee e<g ref="char:EOLhyphen"/>ſtabliſhed by a Law, the ſcruples about them cannot in an ordinary way be brought to any period: the one party being forbidden to <hi>de<g ref="char:EOLhyphen"/>clare</hi> their Conſciences, under as great a penalty, as for the greateſt <hi>Crime</hi> a man can fall into, for ſo is Excommunication <hi>ipſo facto.</hi>
</p>
<p>And if hee eſcape this Thunder<g ref="char:EOLhyphen"/>bolt from <hi>above,</hi> there is a gulf
<pb n="183" facs="tcp:170378:101"/>
provided <hi>beneath</hi> to ſwallow up all his livelihood,<note place="margin">Act for U<g ref="char:EOLhyphen"/>niformity.</note> the Act for <hi>Unifor<g ref="char:EOLhyphen"/>mity,</hi> which is thus: Whoſoever <hi>re<g ref="char:EOLhyphen"/>fuſeth to uſe</hi> the ſaid Common Pray<g ref="char:EOLhyphen"/>ers, &c. or <hi>ſhall preach, declare, or ſpeak any thing in the derogation of the ſaid Book, or any thing therein con<g ref="char:EOLhyphen"/>tained,</hi>
<note place="margin">We are in danger of a premu<g ref="char:EOLhyphen"/>nire, and 12. Mon. impriſon<g ref="char:EOLhyphen"/>ment, if we ſpeak againſt the Book. Ad. pa. 41.</note>
<hi>or of any part thereof — hee ſhall forfeit the profits of all his Spiri<g ref="char:EOLhyphen"/>tual Benefices ariſing in one whole year;</hi> where the penalty for <hi>Diſputing,</hi> or reaſoning againſt the ſuperſtitions of thoſe Forms and Ceremonies, is as great as for the not <hi>uſing</hi> them.</p>
<p>The deprived Miniſters, when they deſired a Conference or Diſ<g ref="char:EOLhyphen"/>pute with the Biſhops, as <hi>the likelieſt and readieſt way both to find out the truth,</hi>
<note place="margin">Per. to K. <hi>James.</hi> anno 1606</note>
<hi>and to put a perpetual end to all thoſe continued Controverſies,</hi> they were fain to make this humble ſute to the King, <hi>That it would pleaſe his Majeſty to weigh the equity and juſtice of their deſires, and the moſt certain advantage the truth (on which ſide ſo<g ref="char:EOLhyphen"/>ever it be) ſhall receive thereby; and to
<pb n="184" facs="tcp:170378:102"/>
ſecure by Royal protection thoſe that ſhall have to doe in this conference.</hi> There is little hope to <hi>end</hi> a Con<g ref="char:EOLhyphen"/>troverſie, when wee muſt not only diſpute and reaſon, for a liberty to diſpute it, but this <hi>liberty</hi> is by Pe<g ref="char:EOLhyphen"/>tition to be <hi>ſought,</hi> of that party on<g ref="char:EOLhyphen"/>ly which hath profeſſedly owned their differences from us, and <hi>fixed</hi> them already by a publick <hi>eſtabliſh<g ref="char:EOLhyphen"/>ment.</hi>
</p>
</div>
<div n="8" type="section">
<head>§. 8.</head>
<p>But ſuppoſe a freedom for Diſ<g ref="char:EOLhyphen"/>pute ſhould be yeelded, and an equal leave and liberty granted to each party, to bring forth their ſtrength, And ſo, weigh and ballance what is ſaid on both ſides. The dif<g ref="char:EOLhyphen"/>ficulty will then be, how to ſet up an even <hi>beam,</hi> while there is any thing weighs with us, but TRUTH it ſelf; yet ſo it is, where there is an <hi>eſtabliſhment,</hi> and with ſuch a <hi>pe<g ref="char:EOLhyphen"/>nalty,</hi> there will bee a two-fold
<pb n="185" facs="tcp:170378:102"/>
WEIGHT, beſides the naked truth of the cauſe, unavoydably caſt in: there will be,
<list>
<item>1 <hi>The authority of the impoſers.</hi>
</item>
<item>2 <hi>Loſſe or gain, according as wee doe conform,</hi> or <hi>otherwiſe.</hi>
</item>
</list>
</p>
<p n="1">1 Lawes are looked upon as <hi>Sa<g ref="char:EOLhyphen"/>cred,</hi> and in things ſacred,<note place="margin">Exam. of the Decla. of the Min. of <hi>London,</hi> pa. 56.</note> as enacted by the ſpecial aſſiſtance of the <hi>Holy Ghoſt;</hi> and ought to be received in ſome ſence as the Commandements of God, ſo they interptet, <hi>to obey in the Lord,</hi> to obey in the Lord ſay they, <hi>is to obey the Magiſtrate, by ac<g ref="char:EOLhyphen"/>knowledging his voyce to be the voyce of God himſelf.</hi> Mr. <hi>Hooker</hi> aſſerts,<note place="margin">Eccleſiaſt. Policy, p. 26</note>
<hi>In litigious and controverted cauſes, when they come by authority to bee de<g ref="char:EOLhyphen"/>termined, it is the will of God that we ſhould doe accordingly, though it ſeems (yea perhaps truly ſeems) in our pri<g ref="char:EOLhyphen"/>vate judgement or opinion, its utterly diſallowed by the Law of God.</hi> Again, <hi>ſuch a determination is a ground ſuffi<g ref="char:EOLhyphen"/>cient for any reaſonable mans Conſci<g ref="char:EOLhyphen"/>ence to build the duties of obedience
<pb n="186" facs="tcp:170378:103"/>
upon, whatſoever his</hi> own opinion <hi>were, as touching the matter before in que<g ref="char:EOLhyphen"/>ſtion.</hi>
</p>
<p>And although ſome <hi>abatement</hi> bee made, of this <hi>over-high</hi> opinion of the Lawes of men, in theſe mat<g ref="char:EOLhyphen"/>ters: yet at the <hi>loweſt</hi> rate, ſuch Lawes will be eſteemed, as the di<g ref="char:EOLhyphen"/>geſted reſults, from moſt ſerious de<g ref="char:EOLhyphen"/>bates of ſuch perſons, who for their <hi>prudence,</hi> and other abilities, are the <hi>choyce</hi> of a whole Nation; and ſuch authority will have great advantage and weight in mens belief, beyond the tenets and aſſertions of a few private men; <hi>what is eſtabliſhed and in being, equity, reaſon, the Law of Nature, God and Man do all</hi> FAVOUR, ſaith <hi>Hooker.</hi>
</p>
<p>There will be a kind of reverence and homage done, even to an <hi>error,</hi> if it be of <hi>Statutable</hi> extraction, and have a Crown upon the head of it: Hence the old ſaying, <hi>Tollatur</hi> LEX <hi>& fiat certamen;</hi> while one party hath a LAVV on their ſide, it is in
<pb n="187" facs="tcp:170378:103"/>
vain to DISPVTE; the odds and difference will not equally bee judged of. It was moved by ſome <hi>Parliament men,</hi> Friends to Epiſco<g ref="char:EOLhyphen"/>pacy, when it was to be removed; that it might remain until a better Government were concluded: but on the other hand,<note place="margin">See the pref. to the Ord. of <hi>Ju.</hi> 12. 1643.</note> it was prudently conſidered, how while <hi>that forme</hi> ſtood, and had the advantage of the <hi>Law,</hi> there would be no free<g ref="char:EOLhyphen"/>dome in arguing about it.</p>
<p>Reaſons will not bee equally weighed, if the prejudice of a Law or Authority be put into one of the ſcales only.<note place="margin">Pref. to Ecc. pol.</note>
<hi>Things eſtabliſhed</hi> (ſaith <hi>Hooker) if it bee but</hi> PROBABLE <hi>they be good, nothing but evident</hi> DE<g ref="char:EOLhyphen"/>MONSTRATION <hi>from private per<g ref="char:EOLhyphen"/>ſons may bee brought against them.</hi> That which is of leſs weight in it ſelf, being made up with autho<g ref="char:EOLhyphen"/>rity, will hold an <hi>aequilibrium</hi> with greater evidence of truth from pri<g ref="char:EOLhyphen"/>vate perſons. So that by this means the <hi>contending parties</hi> will hang
<pb n="188" facs="tcp:170378:104"/>
(as weights equally poyzed upon the beam, perpetually <hi>vying</hi> one with another: whereas if the Law, and prejudice by it, were removed or wholly kept out of the Controver<g ref="char:EOLhyphen"/>ſie; it would quickly appear, which of the Parties contending hath moſt truth and reaſon on their ſide, and ſo <hi>controverſies</hi> would either not riſe, or more eaſily come to a con<g ref="char:EOLhyphen"/>cluſion; or ſuch as ſhall prolong them, diſcover a <hi>contentious</hi> ſpirit, and not at all be regarded.</p>
</div>
<div n="9" type="section">
<head>§. 9.</head>
<p n="2">2 There is a weight of PROFIT, alſo the whole revenue of the Mi<g ref="char:EOLhyphen"/>niſtry, by ſuch a penalty is laid on one <hi>ſide</hi> only. Learned men are apt e<g ref="char:EOLhyphen"/>nough to adhere to an opinion they make their <hi>own,</hi> even upon this ſin<g ref="char:EOLhyphen"/>gle conſideration, it is their <hi>own.</hi> But when this opinion is ſet cloſer, and become more <hi>theirs,</hi> by the en<g ref="char:EOLhyphen"/>gagement of their whole liveli<g ref="char:EOLhyphen"/>hood:
<pb n="189" facs="tcp:170378:104"/>
there will need a <hi>light,</hi> of a very ſtrong <hi>influence,</hi> to attract their judgements from it.</p>
<p>Some perſons I acknowledge will be <hi>tempted,</hi> hereby to the contrary, and engage the more to their opi<g ref="char:EOLhyphen"/>nions, when the tenure is made more noble, by the addition of a kind of Martyrdome, or <hi>aliquid car<g ref="char:EOLhyphen"/>cere dignum:</hi> but this not ſo ordina<g ref="char:EOLhyphen"/>ry, yet where it is, ſuch penal Laws are the <hi>temptors,</hi> and ſo become in a degree <hi>acceſſaries,</hi> in this evil. Perſons of a much more feeble ſpirits there are, who may poſſibly yeeld, with a little of that <hi>light</hi> which ſhi<g ref="char:EOLhyphen"/>neth ſo <hi>warme</hi> upon their outward concernments; eſpecially if nar<g ref="char:EOLhyphen"/>rowed by the neceſſities of a Family-charge, though otherwiſe godly. Either of which (where it ſo falleth out) will be a means to <hi>continue</hi> and fix our <hi>differences.</hi>
</p>
<p>By this <hi>latter,</hi> the hands of others, ſuch as take up their <hi>perſwaſions</hi> upon worſe principles; will come to bee
<pb n="190" facs="tcp:170378:105"/>
<hi>ſtrengthened.</hi> Thoſe alſo that have ſtood out for the truth, will bee <hi>ſtaggered,</hi> yea it may bee change their judgements, and fall off from their former profeſſion. <hi>O quam ſa<g ref="char:EOLhyphen"/>piens argumentatrix</hi> (ſaith one) <hi>ſibi videtur humana ignorantia, praeſertim cum aliquid de gaudiis & fructibus ſeculi, metuit amittere.</hi> The better grounded and reſolved, not being able to bear with ſuch infirmities and <hi>unſteadineſſe,</hi> alienate their affections (more than is brotherly) and ſo, uncomfortable <hi>breaches</hi> are held up amongſt thoſe, that are otherwiſe godly. When differences both in judgement and practice about <hi>greater</hi> matters being but of <hi>pri<g ref="char:EOLhyphen"/>vate Cognizance</hi> never breake forth to any ſuch diſturbance in compariſon. The Ceremonies in <hi>Edw.</hi> 6. firſt reformation were at that time (only commended as it were) and all that while there was no matter of ſtrife about them. The ſad and ſorry contentions came in,
<pb n="191" facs="tcp:170378:105"/>
with thoſe deſtructive <hi>impoſings.</hi> The <hi>Litourgie,</hi> and Rites in the re<g ref="char:EOLhyphen"/>formed Churches, which they term their <hi>Agenda,</hi> are not ſuch bones of Contention any where, as with us; and this is the reaſon: they have not been enforced, under pain of de<g ref="char:EOLhyphen"/>privation, for not conforming.</p>
<p>And in the preſent CASE, what variety of Catechiſms (though a form ſetled by the State) for al<g ref="char:EOLhyphen"/>moſt an age were in uſe, in the ſe<g ref="char:EOLhyphen"/>veral Congregations throughout this Nation, and yet in all that age, neither by Pen, or Pulpit, the leaſt noyſe of contention about it? which could not have been, if that or any one form had ſo ſeverely been im<g ref="char:EOLhyphen"/>poſed.</p>
</div>
<div n="10" type="section">
<head>§. 10.</head>
<p>The malignity and evil of ſuch penal impoſitions, and how preju<g ref="char:EOLhyphen"/>dicial and binding when we would try the truth, and reaſonableneſſe of
<pb n="192" facs="tcp:170378:106"/>
mens aſſertions: is demonſtrated by our ſuffering Brethren (in their Caſe with the Biſhops) thus.</p>
<p>A ſuperſtitious, or ſome doubt<g ref="char:EOLhyphen"/>ful practice, with the Magiſtrates eſtabliſhment, and conſequences of it, put together in one ſcale; and what is evidently a neceſſary Scripture DVTY, into the other: and you you finde that in the common e<g ref="char:EOLhyphen"/>ſteem and judgement of men, this duty is of little weight or conſidera<g ref="char:EOLhyphen"/>tion in compariſon: 2. But on the o<g ref="char:EOLhyphen"/>ther hand, let theſe prejudices and carnal intreſts be removed, and no<g ref="char:EOLhyphen"/>thing but truth, and Scripture grounds, on each ſide weighed one with another, you will hardly find the weight of a feather for <hi>their</hi> Cauſe, or againſt <hi>ours.</hi> 3 Let the ſame impoſitions and penalties bee put into the <hi>other</hi> ſcale, <hi>againſt</hi> E<g ref="char:EOLhyphen"/>piſcopacy and Ceremonies: If the Law had ſaid, it ſhall be the loſſe of a mans Living to practice or preach <hi>for</hi> Epiſcopacy, Common-Prayer-Book,
<pb n="193" facs="tcp:170378:106"/>
or Ceremonies; theſe things <hi>even</hi> in their own <hi>opinions</hi> would <hi>have been light as vanity.</hi> That you may have our Brethrens own words in this experiment: There were preſented certain Propoſitions to King <hi>James,</hi> in <hi>Anno</hi> 1606. as their tenets and opinions againſt Epiſco<g ref="char:EOLhyphen"/>pacy, &c. and for Presbytery, and thereupon they thus write. <q>The former Propoſitions are ſuch as there will not bee found any one <hi>conformable</hi> Miniſter in this King<g ref="char:EOLhyphen"/>dome, except he be a masked Pa<g ref="char:EOLhyphen"/>piſt, that will refuſe to ſubſcribe to any <hi>one</hi> of them, if ſo bee it would pleaſe the King and State, by <hi>Law</hi> to urge them thereupon, under ſuch <hi>penalties</hi> as the Mini<g ref="char:EOLhyphen"/>ſters are urged to ſubſcribe to the Articles deviſed by the Prelats. Yea, we are out of all doubt, that the Prelates themſelves (if it were <hi>preſſed</hi> upon them by the King and State) under paine of <hi>deprivation</hi> from their Biſhopricks,
<pb n="194" facs="tcp:170378:107"/>
would not ſtick to avouch upon their oathes, that the Ceremo<g ref="char:EOLhyphen"/>nies and ſubſcription for which the Miniſters ſtand <hi>ſuſpended,</hi> and <hi>deprived,</hi> are wicked and ungod<g ref="char:EOLhyphen"/>ly, and ſuch as no good Chriſti<g ref="char:EOLhyphen"/>an ought to yeeld unto. Nay, if the caſe ſtood but upon the ſa<g ref="char:EOLhyphen"/>ving of their <hi>temporalties</hi> there<g ref="char:EOLhyphen"/>by (which elſe they ſhould loſe) wee doubt not but with heart and hand to ſubſcribe to any one of the aforeſaid Propoſitions.</q>
</p>
<p>The conjecture or gheſſe our Brethren made of the Epiſcopal party, wee have found very true, having been ſo happy as to ſee ſome comfortable changes, and the trials of their ſpirits in them. For when the <hi>authority</hi> and countenance of our ſuperiours came to bee ſet as much <hi>againſt</hi> theſe ſuperſtitions as it was formerly <hi>for them,</hi> how eaſi<g ref="char:EOLhyphen"/>ly were they laid down by thoſe that were moſt zealous for them before? And we find very <hi>few</hi> (tru<g ref="char:EOLhyphen"/>ly
<pb n="195" facs="tcp:170378:107"/>
conſcientious) if any, ſilenced, rather than not to uſe the Ceremo<g ref="char:EOLhyphen"/>nies: whereas formerly of thoſe that were againſt the uſe of them, near three hundred eminently godly were deprived in the ſpace of a year.</p>
<p>All which declares in effect, that the <hi>Ceremonies</hi> and theſe <hi>forms</hi> are not of any ſuch neceſſity or real worth <hi>in themſelves:</hi> It is <hi>that</hi> to which they are <hi>raiſed,</hi> by the Ma<g ref="char:EOLhyphen"/>giſtrates authority and <hi>ſettlement,</hi> that hath rendered them the matter of ſuch contention; the impoſers themſelves doe in a manner ſay ſo, <hi>The keeping or omitting of a Ceremo<g ref="char:EOLhyphen"/>ny in it ſelf conſidered,</hi>
<note place="margin">Preface to Com. Pr. Book.</note>
<hi>is but a</hi> SMALL THING, <hi>yet the tranſgreſſion of a Common Order is no ſmall offence before God.</hi> There is nothing in the <hi>Service</hi> and <hi>Worſhip</hi> of God <hi>offenſive</hi> to him, but the omiſſion of ſome <hi>DVTY,</hi> or the tranſgreſſion of ſome <hi>Commandement</hi> about it. And therefore when ſuch <hi>ſmall</hi>
<pb n="196" facs="tcp:170378:108"/>
things as are neither of theſe, come to be thus <hi>greatned,</hi> and more <hi>of<g ref="char:EOLhyphen"/>fences</hi> againſt God in his ſervice, by reaſon of Human impoſitions then God himſelf hath made, and the faithful <hi>Labourers</hi> of Chriſt turned out of his <hi>Vineyard</hi> for ſuch offences only, this is the <hi>Gravamen.</hi>
</p>
<p>And againſt this <hi>thraldome</hi> and bondage, our Brethren the Ser<g ref="char:EOLhyphen"/>vants of God in the former age, did humbly <hi>contend</hi> in their generati<g ref="char:EOLhyphen"/>on: that is, to have no more, nor other things <hi>impoſed,</hi> or <hi>received</hi> as <hi>neceſſary,</hi> and <hi>duties</hi> in the ſervice of God, but what hee in his Word hath made ſo. And this is the great felicity and happineſſe (through their prayers and ſufferings) the Lord by the preſent reformation hath reſtored unto us.</p>
<p>And we have been poſſeſſed now ſome years with the ſweet fruition of <hi>that</hi> liberty, thoſe our Brethren <hi>ſaw only afarre of, rejoycing</hi> in the <hi>hopes</hi> of it, and ſo fell aſleep
<pb n="197" facs="tcp:170378:108"/>
in the Lord. I ſay, to ſuffer our ſelves again to bee brought into bondage, and not to ſtirre and doe our duty, and what belongs to each in our places for the preventing hereof, is to degenerate in reſpect of the courage our Fathers had for the Lord in their times. Had they prevailed for themſelves, by their conteſts with the Epiſcopal party, and enjoyed ten or twelve years freedom as grear, or greater than was hoped for; and taſted the ſweetneſſe of it in the purity of Or<g ref="char:EOLhyphen"/>dinances for ſuch a time: would they have been the <hi>more,</hi> or <hi>leſſe</hi> patient in being brought again to their former thraldome? Can any reaſonable man imagine then, that the returning of like <hi>impoſitions</hi> in as great <hi>ſeverity</hi> again as ever for<g ref="char:EOLhyphen"/>merly, and for the like matters, will not occaſion greater contenti<g ref="char:EOLhyphen"/>ons, and differences, Schiſms, and diſtractions amongſt the people of God, than ever was heretofore;
<pb n="198" facs="tcp:170378:109"/>
eſpecially when beſides Scripture-light, that laies it upon our Con<g ref="char:EOLhyphen"/>ſciences thus to <hi>contend,</hi>
<note place="margin">Jude 3. Gal. 5.1</note> and <hi>ſtand faſt</hi> in our liberty, wee have had alſo the experience (which our Fa<g ref="char:EOLhyphen"/>thers never had) that ſuch hum<g ref="char:EOLhyphen"/>ble, yet zealous contendings and ſtrivings for <hi>truth</hi> and <hi>purity</hi> of Or<g ref="char:EOLhyphen"/>dinances, hath been bleſſed and made ſucceſſeful?</p>
<p>There have not been any refor<g ref="char:EOLhyphen"/>med Churches in the world more <hi>oppreſſed</hi> in this kind; or any that have <hi>prayed,</hi> and ſought God more in their ſufferings; no people that have <hi>obtained</hi> of the Lord a more full deliverance, and greater Goſ<g ref="char:EOLhyphen"/>pel liberty, than the godly people of <hi>England</hi> this day enjoy, <hi>abroad</hi> formerly, but at <hi>home</hi> alſo now. Can it bee imagined that a people, after an age of praying and ſuffer<g ref="char:EOLhyphen"/>ings, after part of an age, in ha<g ref="char:EOLhyphen"/>zarding their Eſtates and Lives, and for ſo conſiderable a time now enjoying the fruit of it, can with
<pb n="199" facs="tcp:170378:109"/>
an eaſier and quieter mind, dwell in a houſe of bondage again: than their predeceſſors, that never had a taſt of ſuch manifeſtations of the Lord, in owning his oppreſſed ones, as we have had in theſe late years.</p>
</div>
<div n="12" type="section">
<head>§. 12.</head>
<p>And it is a mercy of the Lord never to bee forgotten, the taking off all ſuch <hi>burthens</hi> from the <hi>Mi<g ref="char:EOLhyphen"/>niſtry;</hi> and that a different judge<g ref="char:EOLhyphen"/>ment in ſmaller matters, ſhall nei<g ref="char:EOLhyphen"/>ther <hi>keep,</hi> nor <hi>caſt out</hi> (as former<g ref="char:EOLhyphen"/>ly) ſuch as are learned, and faith<g ref="char:EOLhyphen"/>ful in their places.</p>
<p>This is effectually done by the <hi>Petition and advice</hi> preſented to his late Highneſſe by the Parliament, <hi>Anno</hi> 1656. a work and <hi>favour</hi> to the people of God, doubtleſs very acceptable to Jeſus Chriſt. And I doe moſt humbly beſeech our Bre<g ref="char:EOLhyphen"/>thren, and whomſoever they are that pretend to the furtherance of
<pb n="200" facs="tcp:170378:110"/>
reformation, not to ſuffer <hi>their eye</hi> to bee <hi>evil,</hi> becauſe the Ma<g ref="char:EOLhyphen"/>giſtrate hath been ſo <hi>good;</hi> but if ſtill we will be ſo inconſiderate, as to be calling for <hi>fire from Heaven</hi> a<g ref="char:EOLhyphen"/>gainſt thoſe that in ſmaller matters of <hi>Diſcipline,</hi> or <hi>Worſhip</hi> differ from us; the Lord I hope will keep the heart of our Governours <hi>ſtedy,</hi> to what hath been ſo happily by them<g ref="char:EOLhyphen"/>ſelves <hi>eſtabliſhed,</hi> and not eaſily be prevailed upon, by perſons of any perſwaſion, that make it the matter of their <hi>ſute,</hi> and <hi>ſollicitati<g ref="char:EOLhyphen"/>ons,</hi> not ſo much the <hi>enjoying</hi> of liberty to <hi>themſelves,</hi> as the <hi>re<g ref="char:EOLhyphen"/>ſtraining</hi> of it, from <hi>others</hi> as holy & Orthodox as themſelves, eſpeci<g ref="char:EOLhyphen"/>ally when nothing will ſerve their turn, but ſuch penalties as will ut<g ref="char:EOLhyphen"/>terly ruine thoſe that differ from them.</p>
</div>
<div n="13" type="section">
<head>§. 13.</head>
<p>Doth not this <hi>preſent age</hi> look upon
<pb n="201" facs="tcp:170378:110"/>
the ſeverity of the <hi>former age</hi> as very ſtrange and unwarrantable. If not ſuch a <hi>garment,</hi> ſuch a <hi>geſture,</hi> ſuch a <hi>form</hi> of words as others ſhall direct; you muſt out of your Living, out of your <hi>Miniſtry. It is thought</hi> VERY NECESSARY (ſaith the Injunction) <hi>that no manner of Prieſt or Deacon ſhall hereafter take to his Wife any manner of Woman,</hi>
<note place="margin">Injuncti<g ref="char:EOLhyphen"/>ons of Q. <hi>Eli.</hi> An. 1559. Injunct. 2 9</note>
<hi>without the</hi> advice <hi>and</hi> allowance <hi>firſt had by the Biſhop of the Dioceſs, and two Juſtices of Peace next to the place of her abode, &c. and if any ſhall doe otherwiſe they ſhall not bee permitted to preach the Word, or give Sacraments, nor hee capable of any Eccleſiaſtical Benefice,</hi> doth this ſeem ſtrange to us <hi>now?</hi> it ſeemed <hi>very neceſſary</hi> in the judgement of our Governours <hi>then;</hi> and why may not the injunctions, wee make of ſo much neceſſity now (as that a Miniſter ſhall not without the <hi>ad<g ref="char:EOLhyphen"/>vice</hi> and <hi>allowance</hi> of others CHVS<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap> his own words) look as ſtrange in
<pb n="202" facs="tcp:170378:111"/>
the eyes of the godly prudent, in an after age; and if it ſhould doe ſo, it is but a juſt recompence of our ſluggiſhneſſe, in lingring and hanging back on <hi>former</hi> Cuſtoms, and letting the <hi>preſent</hi> light and manifeſtations of the Lord ſo farre out-goe us. The truth is, whatſo<g ref="char:EOLhyphen"/>ever is adhered to, of <hi>Human</hi> in<g ref="char:EOLhyphen"/>vention, let it ſeem ever ſo ſpeci<g ref="char:EOLhyphen"/>ous, and uſeful in the ſervice of God for the preſent: yet the <hi>glory of the fleſh</hi> is but as the <hi>flower of graſs,</hi>
<note place="margin">1 Pet. 1.24, 25</note> which will fade away, <hi>The Word</hi> and wiſdome <hi>of the Lord</hi> only, is that which will be <hi>the ſame to day, yeſterday, and for ever.</hi>
</p>
</div>
<div n="14" type="section">
<head>§. 14.</head>
<p>It is a ſtrange unhappineſſe, that Miniſters only of all other perſons are found to be of ſuch an unwhol<g ref="char:EOLhyphen"/>ſome <hi>temperature,</hi> that their infir<g ref="char:EOLhyphen"/>mities (if ſuch) can no way bee cured, but <hi>(igne & ferro)</hi> by ab<g ref="char:EOLhyphen"/>ciſſion,
<pb n="203" facs="tcp:170378:111"/>
no puniſhment ſufficient (al<g ref="char:EOLhyphen"/>moſt) for any fault, but <hi>ſilencing,</hi> ejection, and the like.<note place="margin">
<hi>Gild. Sil<g ref="char:EOLhyphen"/>vianus,</hi> pa. 214</note>
<hi>I confeſſe</hi> (ſaith Mr. <hi>B.) if I had my will the man ſhould be</hi> EjECTED <hi>as a negli<g ref="char:EOLhyphen"/>gent Paſtor, that will not rule his people by Diſcipline.</hi> 2 Others,<note place="margin">
<hi>London</hi> Petition, Mr. <hi>P.</hi> and Mr. <hi>M.</hi> in their wri<g ref="char:EOLhyphen"/>tings, with others.</note> if not <hi>Conform to the Diſcipline</hi> (in particular) eſtabliſhed. 3 There are others on the other hand, if they <hi>had their will,</hi> thoſe that doe exerciſe Diſcipline, and ſuſpend from the Sacrament upon that ac<g ref="char:EOLhyphen"/>count, ſhould in like manner be pu<g ref="char:EOLhyphen"/>niſhed. And <hi>in this caſe</hi> thoſe that doe not inſtruct in a <hi>Homily</hi> form,<note place="margin">An Act preſented to his late Highneſs which was refuſed by him, which hath occa<g ref="char:EOLhyphen"/>ſioned this diſcourſe.</note> ſhould have been ejected as a <hi>neg<g ref="char:EOLhyphen"/>ligent</hi> Miniſter. If in a Civil State there ſhould bee but one kind of puniſhment, and for every Crime a man be made a <hi>Felon,</hi> or <hi>Traytor;</hi> it will argue in ſuch a Common-Wealth, there are more people than they can tell what to doe with, and their <hi>Lawes</hi> are bent ra<g ref="char:EOLhyphen"/>ther to rid the Country of <hi>men,</hi>
<pb n="204" facs="tcp:170378:112"/>
than of their <hi>Crimes;</hi> it were <hi>un<g ref="char:EOLhyphen"/>charitable</hi> to think there is ſuch a ſpirit in <hi>all</hi> that have thus by Peti<g ref="char:EOLhyphen"/>tion, or otherwiſe <hi>provoked</hi> Parlia<g ref="char:EOLhyphen"/>ments and Magiſtrates to ſuch a <hi>ſe<g ref="char:EOLhyphen"/>verity:</hi> yet this we know, there was ſuch a <hi>Root of bitterneſſe</hi> found a<g ref="char:EOLhyphen"/>mongſt the perſecuting Biſhops, in ſo much as conformity to all their <hi>drudgeries</hi> would not ſerve at laſt; but (<hi>Conformist,</hi> or <hi>Non-con<g ref="char:EOLhyphen"/>formiſt</hi>) if he were a conſcienti<g ref="char:EOLhyphen"/>ous Miniſter, they would <hi>worme</hi> him out one way or other. And it was the conſtant profeſſion, ſome of them were not aſhamed to make; that they <hi>hated</hi> a confor<g ref="char:EOLhyphen"/>ming <hi>Puritan</hi> more than a <hi>Papiſt,</hi> or a <hi>Drunkard;</hi> which ſhewed plainly, they brought in, and kept up ſuch <hi>penalties,</hi> to rid themſelves of a party, which by the <hi>dint of truth</hi> and reaſon they could not ſubdue. This <hi>Height</hi> and <hi>Hypocriſie</hi> was the evident fore-runner of their <hi>fall,</hi> the Lord in mercy grant wee may
<pb n="205" facs="tcp:170378:112"/>
be warned thereby. I hope it is the ſpirit of <hi>very few,</hi> if any amongſt us; nor did this evil diſeaſe cleave to <hi>all</hi> the Biſhops, ſome of them did more tender the Goſpels pro<g ref="char:EOLhyphen"/>greſs, than to deſire the outing of ſuch as differed from them. I will conclude this Diſcourſe with the <hi>Speech</hi> of one of them (it being pertinent to our purpoſe) whoſe <hi>moderation</hi> and prudence is worthy our imitation. It was ſpoken in the Convocation Houſe, <hi>May</hi> 23. <hi>anno</hi> 1604. by the Biſhop of St. <hi>Davids,</hi> to the reſt of the Biſhops (and it is the ſum of what I aime at in this third Argument) his words are theſe:</p>
<p>
<q>I put great difference between <hi>Quod liceat,</hi> and <hi>Quid expediat,</hi> and likewiſe between them that are Schiſmatical, or open diſtur<g ref="char:EOLhyphen"/>bers of the State Eccleſiaſtical eſtabliſhed, and them that are <hi>ſcrupulous only</hi> upon ſome Cere<g ref="char:EOLhyphen"/>monies, and other Circumſtances,
<pb n="206" facs="tcp:170378:113"/>
being otherwiſe <hi>learned,</hi> ſtudious, <hi>grave,</hi> and honeſt men, whoſe labours have been both <hi>painful</hi> in the Church, and <hi>profitable</hi> to their ſeveral Congregations.</q>
</p>
<p>
<q>Concerning thoſe Preachers laſt mentioned, I ſuppoſe that if upon urging of them to the uſe of <hi>Ceremonies,</hi> and <hi>attire preſcri<g ref="char:EOLhyphen"/>bed,</hi> they ſhould ſtand out ſtifly, and chuſe rather to forgoe their Livings, and the exerciſe of their Miniſtery, and though I doe not juſtifie their doings therein, yet ſurely their <hi>ſervice</hi> would be <hi>miſſed,</hi> at ſuch <hi>time,</hi> as need ſhall require them and us, to give the right hand of fellowſhip one to another, and to goe arme in arme againſt the <hi>Common Ad<g ref="char:EOLhyphen"/>verſary,</hi> that ſo there might bee, <hi>Vis unita fortior.</hi> In which caſe of want of their joynt labours with ours, there might ariſe cauſe of ſome ſuch <hi>doleful complaint,</hi> as fell out upon an accident of ano<g ref="char:EOLhyphen"/>ther
<pb n="207" facs="tcp:170378:113"/>
nature in the Book of <hi>Judg.</hi> 5.15. where it is ſaid, that <hi>for the diviſions of</hi> Reuben <hi>there were great thoughts of heart.</hi>
</q>
</p>
<p>
<q>Alſo remember,<note place="margin">Judg. 20.12, 13, 14.46, 47, & 21.1.6. &c.</note> that when the <hi>Benjamites,</hi> though for their deſert in maintaining of a bad cauſe were all deſtroyed ſaving ſix hundred, and the men of <hi>Iſ<g ref="char:EOLhyphen"/>rael ſware in their fury,</hi> that none of them would give his Daugh<g ref="char:EOLhyphen"/>ter to the <hi>Benjamites</hi> to Wife, yet when their <hi>hot bloud</hi> was over, they lamented, and ſaid, <hi>There is one Tribe cut off from Iſrael this day,</hi> and they uſed all their <hi>wits</hi> to the uttermoſt of their policy to reſtore that <hi>Tribe</hi> again. In like ſort, if theſe our Brethren a<g ref="char:EOLhyphen"/>foreſaid ſhould bee <hi>deprived</hi> of their places for the <hi>matters</hi> pre<g ref="char:EOLhyphen"/>miſed, I think wee ſhould finde cauſe to bend our wits to the ut<g ref="char:EOLhyphen"/>termoſt extent of our skill to <hi>provide</hi> ſome Cure of Souls for them, where they may <hi>exerciſe</hi> their talents.</q>
</p>
<p>
<pb n="208" facs="tcp:170378:114"/>
<q>Furthermore, if theſe men, be<g ref="char:EOLhyphen"/>ing <hi>divers hundreds</hi> (as it is brui<g ref="char:EOLhyphen"/>ted abroad) ſhould forſake their <hi>Charges</hi> (as ſome doe preſuppoſe they will) who I pray you ſhould <hi>ſucceed</hi> them? Verily I know not where to finde ſo many able Preachers within this Realm un<g ref="char:EOLhyphen"/>provided for. But be it that ſo many may bee found to ſupply thoſe empty roomes, yet they might more conveniently bee ſet<g ref="char:EOLhyphen"/>led in the Seates of <hi>unpreaching</hi> Miniſters, and ſo the number of Preachers ſhould be much increa<g ref="char:EOLhyphen"/>ſed. But if they ſhould bee put into the <hi>places</hi> of <hi>theſe men</hi> being <hi>diſpoſſeſſed,</hi> thereupon would fol<g ref="char:EOLhyphen"/>low; Firſt, That the number of preaching Incumbents ſhould not be multiplied by their ſupply; and Secondly, The Churches could not in likelihood be ſo <hi>well</hi> and <hi>fitly</hi> furniſhed on the ſuddain; for that though happily the new ſupply ſhould bee of men as lear<g ref="char:EOLhyphen"/>ned
<pb n="209" facs="tcp:170378:114"/>
as the former, yet is it not probable that they ſhould bee at their firſt coming from the Uni<g ref="char:EOLhyphen"/>verſities, or in a good while after, ſo <hi>ready Preachers,</hi> ſo experimen<g ref="char:EOLhyphen"/>ted <hi>in Paſtoral Government,</hi> ſo well acquainted with the man<g ref="char:EOLhyphen"/>ners, and uſage of the people, and ſo <hi>diſcreet</hi> every way in the car<g ref="char:EOLhyphen"/>riage of themſelves, as the o<g ref="char:EOLhyphen"/>thers, who have ſpent already <hi>many years</hi> abroad in their Mini<g ref="char:EOLhyphen"/>ſterial charges. Beſides this, for ſo much as in the life time of the late Arch-Biſhop of <hi>Canterbury,</hi> theſe things were not <hi>ſo extreamly urged,</hi> but that many learned Preachers enjoyed <hi>their liberty</hi> herein, conditionally that they did not by word or deed openly diſgrace, or diſturb the State e<g ref="char:EOLhyphen"/>ſtabliſhed; I would know a rea<g ref="char:EOLhyphen"/>ſon, why it ſhould <hi>now</hi> be ſo ge<g ref="char:EOLhyphen"/>nerally and exceeding ſtrictly cal<g ref="char:EOLhyphen"/>led upon, eſpecially ſeeing that thoſe men are now the more
<pb n="210" facs="tcp:170378:115"/>
<hi>neceſſary,</hi> by ſo much as wee ſee <hi>greater increaſe of Papiſts</hi> to bee now of late than were before. To conclude, I wiſh, that if by <hi>Pe<g ref="char:EOLhyphen"/>tition</hi> made to the Kings <hi>Majeſty,</hi> there cannot be obtained a quite remove of the premiſes, which ſeem <hi>ſo grievous</hi> to divers,<note place="margin">The Bi<g ref="char:EOLhyphen"/>ſhops themſelves ſome of them were not ſo zea<g ref="char:EOLhyphen"/>lous a<g ref="char:EOLhyphen"/>gainſt tol<g ref="char:EOLhyphen"/>leration as ſome of our Bre<g ref="char:EOLhyphen"/>thren are.</note> nor yet a TOLLERATION for them, w<hi rend="sup">ch</hi> be of the more <hi>ſtayed,</hi> and <hi>tempe<g ref="char:EOLhyphen"/>rate</hi> carriage; yet at the leaſt, there might be procured a <hi>miti<g ref="char:EOLhyphen"/>gation</hi> of the <hi>penalty,</hi> if they can<g ref="char:EOLhyphen"/>not be drawn by other reaſons to a conformity with us.</q>
</p>
</div>
</div>
<div n="9" type="chapter">
<pb n="211" facs="tcp:170378:115"/>
<head>
<hi>CHAP. IX.</hi> The Fourth Argument. It is deſtru<g ref="char:EOLhyphen"/>ctive to that <hi>Independency</hi> which hath been antiently claimed and profeſſed, by our brethren the Non-Conformiſts.</head>
<div n="1" type="section">
<head>§. 1.</head>
<p>THere is an exemption, or <hi>In<g ref="char:EOLhyphen"/>dependency,</hi> in the manage of Eccleſiaſtical matters, pleaded for by thoſe our Brethren, as an im<g ref="char:EOLhyphen"/>munity or peculiar of the Church and Miniſters (being a Body or Corporation diſtinct from the Civil State) which is utterly over<g ref="char:EOLhyphen"/>thrown by ſuch an impoſition, as in THIS CASE. A ſole power to determine and order all matters ap<g ref="char:EOLhyphen"/>pertaining to the Worſhip and Ser<g ref="char:EOLhyphen"/>vice of God: Such <hi>methods</hi> and forms alſo, with the <hi>uſage</hi> of them, and other circumſtances as are per<g ref="char:EOLhyphen"/>tinent
<pb n="212" facs="tcp:170378:116"/>
to the ſame; is placed <hi>pri<g ref="char:EOLhyphen"/>marily</hi> and <hi>independently</hi> in Miniſters of the Goſpel, and not in <hi>Parlia<g ref="char:EOLhyphen"/>ments</hi> or <hi>Princes.</hi> This hath been conſtantly aſſerted by our Brethren of the Presbyterian perſwaſion, an<g ref="char:EOLhyphen"/>tient and modern, thoſe that have ſuffered, and thoſe that have reign<g ref="char:EOLhyphen"/>ed.<note place="margin">Diſcip. of <hi>Scot.</hi> p. 73</note>
<hi>As the Magiſtrate</hi> (ſaith the Diſcipline of the Church of <hi>Scot<g ref="char:EOLhyphen"/>land) ought not to preach, Miniſter Sacraments, or Excommunicate; ſo he ought not to preſcribe any</hi> rule how <hi>it ſhould bee done, but command the Miniſters to obſerve the Rules com<g ref="char:EOLhyphen"/>manded in the Word.</hi>
<note place="margin">
<hi>Cartwright</hi> againſt <hi>Whitg.</hi> lib. 1 p. 192</note>
<q>As Miniſters meddle not (ſaith Maſter <hi>Cart<g ref="char:EOLhyphen"/>wright</hi>) with making of Civil Lawes, and Lawes for the Com<g ref="char:EOLhyphen"/>mon Wealth; ſo the Civil Ma<g ref="char:EOLhyphen"/>giſtrate is not to ORDER mat<g ref="char:EOLhyphen"/>ters of the Church.<note place="margin">
<hi>Eng.</hi> po. Cerem. p. 148</note>
</q>
<hi>The Civil Magiſtrate</hi> (ſaith a Modern Au<g ref="char:EOLhyphen"/>thor) <hi>may not by himſelf, define and</hi> direct <hi>ſuch matters as appertain to Divine Worſhip, or make</hi> any Lawes
<pb n="213" facs="tcp:170378:116"/>
<hi>thereabout; it belongeth not to Prin<g ref="char:EOLhyphen"/>ces to govern and direct things of this nature, even as it belongeth not to Paſtors to govern and direct earthly things, and civil ſocieties of men. The Officers of Chriſt</hi> qua-<hi>Officers, are not directly and properly</hi> (ſay our <hi>London</hi> Miniſters) <hi>ſubject to the Civil power;</hi> to whom then?<note place="margin">Jus di. re<g ref="char:EOLhyphen"/>gim. <hi>p. 89</hi>
</note> It is told us, <hi>pa.</hi> 90. <hi>the ſpirits of the Prophets are ſubject to the Prophets, not to the Civil power as ſuch.</hi>
<note place="margin">Argument againſt Cer. &c. Arg. 4.</note>
<q>And long before, <hi>viz.</hi> in <hi>Anno</hi> 1570. it was aſſerted, that Miniſters ought not to obey Princes when they command Ceremonies and forms, &c. it doth diminiſh (ſaith the Author) the authority of his Of<g ref="char:EOLhyphen"/>fice, which is to <hi>govern</hi> the Church of God, <hi>Acts</hi> 20. but in this he himſelf and the Church of God is <hi>governed</hi> by the will of the Prince.</q> This Eccleſiaſtical power (according to them) is in every particular Officer, derived immediately from the Lord Jeſus
<pb n="214" facs="tcp:170378:117"/>
Chriſt; and to be exerciſed by the <hi>Coetus Presbyterorum,</hi> which they call the Church. <hi>The Synod hath to de<g ref="char:EOLhyphen"/>termine the time, place, and</hi> FORM <hi>of preaching and praying,</hi> &c. <hi>for who ſhould be able to know theſe things beſt, according to Gods Word, but they that be Preachers of the ſame unto o<g ref="char:EOLhyphen"/>thers?</hi> Dr. <hi>Fulk</hi> his diſc. of Diſci<g ref="char:EOLhyphen"/>pline, <hi>p.</hi> 117. <hi>If Diſcipline were ſet<g ref="char:EOLhyphen"/>led</hi> (ſaith Mr. <hi>Knox) there would need no coming to the Parliament for matters of Religion.</hi>
<note place="margin">Exhor. to <hi>Eng.</hi> p. 99</note>
<hi>If the Convoca<g ref="char:EOLhyphen"/>tion houſe</hi> (ſay others) <hi>were ſuch as it ought to be,</hi>
<note place="margin">Sup. to Q. <hi>Eliz.</hi> p. 45</note>
<hi>then were it not LAW<g ref="char:EOLhyphen"/>FUL for the Parliament to eſtabliſh any thing</hi> appertaining <hi>to the Worſhip of God.</hi>
</p>
<p>If this be ſo, ſuch a determinati<g ref="char:EOLhyphen"/>on as in <hi>this caſe</hi> cannot be made by the Civil Magiſtrate, without an incroachment upon the priviledges and intruſtments of the Church; contained in the Charter, by which we are <hi>Officers</hi> and Miniſters of Jeſus Chriſt. For if <hi>all queſtions,</hi>
<pb n="215" facs="tcp:170378:117"/>
(as our Brethren of <hi>Scotland</hi> affirm) <hi>about Religion,</hi>
<note place="margin">Declar. of the Com. of the Gen. Aſ<g ref="char:EOLhyphen"/>ſemb. p. 26</note>
<hi>and matters Eccleſi<g ref="char:EOLhyphen"/>aſtical ought to be determined by the aſſemblies of the Church, as matters Civil by the Parliament</hi> (a Parlia<g ref="char:EOLhyphen"/>ment is <hi>abſolute</hi> and <hi>independent</hi> in its determinations) Then this que<g ref="char:EOLhyphen"/>ſtion, whether ſtinted Forms of Prayer, or <hi>inſtruction</hi> compoſed by men ought to have a conſtant ſet<g ref="char:EOLhyphen"/>led uſe, and how frequent or ſel<g ref="char:EOLhyphen"/>dome to be uſed in the Worſhip of God, and of the ſufficiency or inſuf<g ref="char:EOLhyphen"/>ficiency of a Miniſter in any ſuch re<g ref="char:EOLhyphen"/>ſpect: being undoubtedly queſti<g ref="char:EOLhyphen"/>ons of that nature: ſhould firſt have been determined by the Church, (which hath not been done) before the Parliament had medled with it.</p>
</div>
<div n="2" type="section">
<head>§. 2.</head>
<p>Obj. <hi>If it be ſaid, the</hi> Aſſembly of Divines, <hi>diſpoſed & put the principles of Religion into this form or mould, and fitted it for ſuch a method and way
<pb n="216" facs="tcp:170378:118"/>
of inſtruction, and commended this Catechiſm to the Parliament.</hi>
</p>
<p>
<hi>A.</hi> 1. So were the forms of Prayer and Homilies compoſed by learned godly men, and out of a good in<g ref="char:EOLhyphen"/>tention, <hi>thoſe firſt reformers are ac<g ref="char:EOLhyphen"/>knowledged to be excellent inſtruments raiſed of God,</hi>
<note place="margin">The Pre<g ref="char:EOLhyphen"/>face to the Direct.</note>
<hi>&c.</hi> it is not the mat<g ref="char:EOLhyphen"/>ter (in thoſe Prayers and Homi<g ref="char:EOLhyphen"/>lies) that was ſo much blamed; but the end and uſe for which, and the authority by which they were brought into the Church: they are impoſed (ſaith the <hi>Admonition</hi> to the Parliament) <hi>as a ſet ſervice to God,</hi>
<note place="margin">Adm. p. 9</note>
<hi>though the</hi> words <hi>or</hi> matter <hi>be good, the</hi> uſe <hi>is naught. Our Suppli<g ref="char:EOLhyphen"/>cations, Remonſtrances</hi> (ſay our Bre<g ref="char:EOLhyphen"/>thren of <hi>Scotland,</hi> in the afore<g ref="char:EOLhyphen"/>ſaid Declaration) <hi>Acts of aſſembly and Parliament, and our defenſive armes in</hi> Anno 1630. and 1640. <hi>were not only againſt the Book of Ca<g ref="char:EOLhyphen"/>nons,</hi>
<note place="margin">
<hi>Pag</hi> 26.</note>
<hi>Service-book, &c. for the</hi> evil matter <hi>there contained, but the</hi> man<g ref="char:EOLhyphen"/>ner of <hi>introducing the ſame;</hi> that
<pb n="217" facs="tcp:170378:118"/>
is, by a Civil, and not by a Church power.</p>
<p>
<hi>Anſ.</hi> 2. The Aſſembly did never intend ſuch a ſtinted ſtated uſe of it in the ſolemn Worſhip of God, as in the Caſe; according to which a Sabbath is not judged well ſpent wherein the words of this Cate<g ref="char:EOLhyphen"/>chiſm, or ſome part of them are not read or ſaid. And that the not ſub<g ref="char:EOLhyphen"/>miſſion hereunto upon any account, ſhould be a ſufficient teſt of a per<g ref="char:EOLhyphen"/>ſons unfitneſſe to enjoy a place or ſtation in the Miniſtry. Such a ſe<g ref="char:EOLhyphen"/>vere ſtrict uſe of it was never advi<g ref="char:EOLhyphen"/>ſed by that Aſſembly; but rather condemned by them, in condem<g ref="char:EOLhyphen"/>ning the like uſe made formerly of ſet forms of the ſame nature.<note place="margin">Preface to the Dire<g ref="char:EOLhyphen"/>ctory.</note>
<q>The Liturgy (ſay they) hath been a great meanes, as on the one hand to make and increaſe an idle and unedifying Miniſtry, which contented it ſelf with <hi>ſet forms</hi> made to their hands <hi>by others,</hi> &c. ſo on the other ſide, it hath
<pb n="218" facs="tcp:170378:119"/>
been, and ever would be (if con<g ref="char:EOLhyphen"/>tinued) a matter of <hi>endleſs ſtrife</hi> and contention in the Church, and a <hi>ſnare</hi> both to many godly and faithful Miniſters, who have been perſecuted and <hi>ſilenced</hi> upon that occaſion: and to others of hopeful parts, many of which have been, and more ſtill would be diverted from all thoughts of the Miniſtry, to other Studies; eſpecially in theſe latter times, wherein a grea<g ref="char:EOLhyphen"/>ter <hi>diſcovery</hi> of error and <hi>ſuperſti<g ref="char:EOLhyphen"/>tion,</hi> and more <hi>knowledge</hi> in the Myſteries of godlineſs, and <hi>gifts</hi> in preaching and prayer.</q> In another place wee are told in the ſame pre<g ref="char:EOLhyphen"/>face, how <hi>by reaſon of ſuch forms, and the not ſubmitting to them, divers able and faithful Miniſters are debarred from the exerciſe of their Miniſtry, to the indangering of many thouſand ſouls in a time of ſuch ſcarcity of faithful Paſtors, and ſpoyled of their livelihood, to the undoing of them and their families.</hi>
</p>
</div>
<div n="3" type="section">
<pb n="219" facs="tcp:170378:119"/>
<head>§. 3.</head>
<p>Theſe were the evils of ſuch a ſtated authoritative uſe of ſet forms in the ſolemn Worſhip of God, obſerved by the Reverend Divines of that Synod. <q>And there<g ref="char:EOLhyphen"/>fore they adviſe, there may be no more ſuch ſevere injunctions; but inſtead of them a <hi>Directory</hi> for all parts of Worſhip, in which the Mi<g ref="char:EOLhyphen"/>niſter is left at <hi>more freedom;</hi>
<note place="margin">Preface to the Direct.</note> ha<g ref="char:EOLhyphen"/>ving liberty to furniſh both his heart and <hi>tongue</hi> with <hi>further,</hi> or OTHER <hi>materials</hi> of Prayer and exhortation as ſhall bee needful upon all occaſions.</q> Theſe words of the Aſſembly contain the true nature and notion of a <hi>Directory,</hi> as it differs from a <hi>ſtinted form,</hi> and is the ſame with <hi>Hookers</hi> diſtinction before mentioned.<note place="margin">Pa. 58, 59.</note> A preſcript form is ſuch an appointment as every man <hi>muſt</hi> obſerve. A Directory is a form men <hi>may</hi> uſe if they pleaſe, or
<pb n="220" facs="tcp:170378:120"/>
change it and pleaſe themſelves in ſome other if there bee juſt reaſon. Now it is profeſſed by the Aſſem<g ref="char:EOLhyphen"/>bly of <hi>Scotland,</hi>
<note place="margin">Act of the Gen. Aſſ. for appro. the Cat.</note> that they receive this Catechiſm under no other no<g ref="char:EOLhyphen"/>tion but as a DIRECTORY for CATECHISING, and not as a ſtinted Catechiſm. And thus the <hi>Parliament</hi> underſtood the Aſſem<g ref="char:EOLhyphen"/>bly, in all the forms they preſented to them; and condeſcended ſo far as to reaſon with our Brethren of <hi>Scotland,</hi> and juſtifie the liberty and freedom they had given by the Di<g ref="char:EOLhyphen"/>rectory, as being according to the judgement of moderate Presbyte<g ref="char:EOLhyphen"/>rians here in <hi>England,</hi>
<q>When we conſider, ſaith the Parliament, what ſome Miniſters of the Presbyteri<g ref="char:EOLhyphen"/>an judgement (and members of that Aſſembly) in their book ſub<g ref="char:EOLhyphen"/>ſcribed, <hi>Smectimnius,</hi> dedicated to the Parliament, ſay of the Litour<g ref="char:EOLhyphen"/>gy then eſtabliſhed by Law [<hi>it was never eſtabliſhed to be ſo punctu<g ref="char:EOLhyphen"/>ally obſerved, ſo rigorouſly preſ<g ref="char:EOLhyphen"/>ſed
<pb n="221" facs="tcp:170378:120"/>
to the caſting out of all that ſcruple it,</hi>
<note place="margin">Declar. of the Lords and Com. in anſw. to the <hi>Scot,</hi> Papers.</note>
<hi>or any thing in it</hi>] wee have reaſon well to conſider what we put the ſtamp of publick autho<g ref="char:EOLhyphen"/>rity upon, for if this uniformity of the Directory, Church-Govern<g ref="char:EOLhyphen"/>ment, Confeſſion of Faith and CATECHISE, ſhould produce ſuch a rigid Conformity unto them, it is not eaſie to fore-ſee all the miſ<g ref="char:EOLhyphen"/>chiefs and inconveniences it would beget, though we may eaſily gueſs they would not be ſmall, by what we have felt in the like kind.</q>
</p>
<p>
<hi>Anſ.</hi> 3. Wee are told,<note place="margin">Eng. po. Cer. p. 154</note> before Princes Ordinances can bee ſaid to <hi>bind us, it must firſt bee ſhewed they have been preſcribed by a lawful Sy<g ref="char:EOLhyphen"/>nod of the Church.</hi> The Magiſtrates power is only <hi>Cumulative,</hi> ſo that an Eccleſiaſtical power is firſt to be put forth, by a <hi>lawful Synod of the Church.</hi> The Aſſembly called by the Par<g ref="char:EOLhyphen"/>liament was no ſuch Synod, be<g ref="char:EOLhyphen"/>ing, 1 Not made up of perſons <hi>delegated from the Churches by the
<pb n="222" facs="tcp:170378:121"/>
intrinſical power received from Chriſt;</hi>
<note place="margin">
<gap reason="illegible" resp="#PDCC" extent="1 letter">
<desc>•</desc>
</gap>en. Aſ<g ref="char:EOLhyphen"/>
<gap reason="illegible" resp="#PDCC" extent="3 letters">
<desc>•••</desc>
</gap>b. of <gap reason="illegible" resp="#PDCC" extent="1 word">
<desc>〈◊〉</desc>
</gap>. Anno 1647. Seſ. 23.</note> nor, 2 Any power of ſuffrage; for the <hi>minor</hi> part preſented their reſo<g ref="char:EOLhyphen"/>lutions as well, and with as much au<g ref="char:EOLhyphen"/>thority as the <hi>major.</hi> 3 Nor had they liberty to debate of any thing, but what was propoſed by the Parlia<g ref="char:EOLhyphen"/>ment. Hence thoſe Ordinances were examined, and <hi>owned</hi> by the general aſſembly in <hi>Scotland,</hi> before they had any ſanction of that State, or reception in their Churches. And we in <hi>England</hi> having no ge<g ref="char:EOLhyphen"/>neral Aſſembly ſo eſtabliſhed, the <hi>Provincial</hi> aſſembly of <hi>London</hi> took it upon themſelves, and after the Parliament had injoyned us <hi>forth<g ref="char:EOLhyphen"/>with</hi> to practiſe <hi>according to their Or<g ref="char:EOLhyphen"/>dinances:</hi> they added <hi>conſiderations</hi> and <hi>cautions</hi> before they would re<g ref="char:EOLhyphen"/>ceive them. And by conſequence, if no Provincial, a Claſſical Aſſembly may doe the like; and if no Claſ<g ref="char:EOLhyphen"/>ſis, each Congregation being fur<g ref="char:EOLhyphen"/>niſhed with a Presbytery, ought to make (if not afore Judgement by
<pb n="223" facs="tcp:170378:121"/>
their Delegates in ſome greater Aſſembly, yet) an after Judge<g ref="char:EOLhyphen"/>ment (and to accept or refuſe what a Parliament ſhall doe in this kind) by their Presbytery, according to Presbyterial principles: which li<g ref="char:EOLhyphen"/>berty cannot be enjoyed where Ci<g ref="char:EOLhyphen"/>vil powers impoſe with ſuch pe<g ref="char:EOLhyphen"/>nalties, as in <hi>the caſe.</hi>
</p>
</div>
</div>
<div n="10" type="chapter">
<head>
<hi>CHAP. X.</hi> The Fifth Argument. It is difficult in Eccleſiaſtical matters, to obtain reformation of what is amiſs. Theſe things are preſſed with greateſt ſe<g ref="char:EOLhyphen"/>verity upon the moſt conſcienti<g ref="char:EOLhyphen"/>ous.</head>
<p>WHen any <hi>change</hi> happens in Eccleſiaſtical affairs, it is long before wee can come to a ſettle<g ref="char:EOLhyphen"/>ment, as we have formerly ſhewed: This <hi>ſettlement</hi> being made, and munited with penal Lawes by the
<pb n="224" facs="tcp:170378:122"/>
Civil Magiſtrate: it is difficult, if not impoſſible, in an ordinary way, to get any thing reformed; though it bee ever ſo inconvenient, and burdenſome to mens Conſciences. <hi>Repeals</hi> and changes are made fre<g ref="char:EOLhyphen"/>quently of Lawes about <hi>Civil af<g ref="char:EOLhyphen"/>fairs,</hi> and our evils cured as they come to bee diſcerned: but <hi>Church</hi> grievances, like diſeaſes in the ſpirits, are in a manner incura<g ref="char:EOLhyphen"/>ble. 1 There are but a <hi>few</hi> in com<g ref="char:EOLhyphen"/>pariſon, and thoſe more <hi>ſtrict</hi> and conſcientious (who are ordinarily the worſt beloved, and leaſt regar<g ref="char:EOLhyphen"/>ded) that feel the pain of ſuch di<g ref="char:EOLhyphen"/>ſtempers. 2 By ſuch impoſitions we rid our ſelves of thoſe Miniſters, whom wee eſteem moſt trouble<g ref="char:EOLhyphen"/>ſome; and have great advantage to faſhion, the reſt (I mean the leſs conſcientious) to a ſtate guiſe. The ſad experience we have had former<g ref="char:EOLhyphen"/>ly, and what great and conſtant en<g ref="char:EOLhyphen"/>deavours after reformation have been many years proſecuted, with
<pb n="225" facs="tcp:170378:122"/>
little or no fruit, may be a proof ſuf<g ref="char:EOLhyphen"/>ficient hereof.</p>
<p>In the Reformation began with <hi>Edward</hi> the Sixth, ſuch <hi>reliques of Popery</hi> were left in the Church, as did much <hi>offend</hi> divers godly lear<g ref="char:EOLhyphen"/>ned, even in thoſe dayes. Theſe <hi>Superſtitions</hi> coming to a <hi>ſettlement,</hi> and by penal Lawes <hi>fixed</hi> in the Worſhip and Service of God, they held their ſtation neer a <hi>hundred years,</hi> notwithſtanding the <hi>teſtimonies</hi> at ſeveral times given all along a<g ref="char:EOLhyphen"/>gainſt them. In the beginning of Queen <hi>Maries</hi> dayes, thoſe learned men that left their own Coun<g ref="char:EOLhyphen"/>try, and went into <hi>Germany,</hi> where this <hi>reformation,</hi> and the ſu<g ref="char:EOLhyphen"/>perſtitions ſetled in it, being <hi>ſtuck</hi> to by <hi>ſome</hi> amongſt them, there was then a <hi>very great</hi> teſtimony, and in the eye of the Churches of Chriſt, given againſt thoſe evils by <hi>others</hi> of them, better affected to a thorow reformation, of which more afterwards. Theſe endea<g ref="char:EOLhyphen"/>vours
<pb n="226" facs="tcp:170378:123"/>
and witneſſings did not in the leaſt <hi>looſen</hi> the hold thoſe corrupti<g ref="char:EOLhyphen"/>ons had gotten by their firſt eſta<g ref="char:EOLhyphen"/>bliſhment, but were continued ſtill, as will appear in what follow<g ref="char:EOLhyphen"/>eth.</p>
<div n="2" type="section">
<head>§. 2.</head>
<p>Thoſe Brethren, and ſuch o<g ref="char:EOLhyphen"/>thers as deſired further reformati<g ref="char:EOLhyphen"/>on, conceived great hope to them<g ref="char:EOLhyphen"/>ſelves, upon Queen <hi>Elizabeths</hi> coming to the Crown, who was a <hi>Sufferer</hi> with them; SHEE by <hi>Impriſonment,</hi> as <hi>they</hi> by <hi>Baniſh<g ref="char:EOLhyphen"/>ment.</hi> Application was made be<g ref="char:EOLhyphen"/>times, and with much zeal, and ſo it was continued all her days. There were Petitions preferred to her <hi>Majeſty,</hi> to the <hi>Parliament,</hi> to the <hi>Council,</hi> to the <hi>Biſhops,</hi> to the <hi>Con<g ref="char:EOLhyphen"/>vocation,</hi> Pleas, Admonitions, Ad<g ref="char:EOLhyphen"/>vertiſements, Conſiderations, and the like to the Common people. Multitudes of <hi>Books</hi> daily, and
<pb n="227" facs="tcp:170378:123"/>
profers of <hi>Diſputation</hi> againſt thoſe forms, and impoſitions; as alſo <hi>Aſſertions & Demonſtrations,</hi> wher<g ref="char:EOLhyphen"/>in a more ſavoury <hi>Diſcipline</hi> in the Church, and <hi>order</hi> in the Worſhip of God is held forth; and in ſo much evidence of Scripture light, as they were not able to put it under a buſhel; much out of our Brethrens Writings might bee brought forth to this purpoſe, and of the great <hi>actings,</hi> and <hi>ſufferings,</hi> by the god<g ref="char:EOLhyphen"/>ly party all her reign; and yet all this obtained not the leaſt altera<g ref="char:EOLhyphen"/>tion, or to have the lighteſt penal<g ref="char:EOLhyphen"/>ty taken off from ſuch as could not conform, though ſome of them ſealed their teſtimony with their bloud.</p>
<p>Greater hopes by farre were conceived upon King <hi>James</hi> his coming to the Crown, whoſe <hi>bree<g ref="char:EOLhyphen"/>ding</hi> ſeemed to ſet him fair for the deſired reformation; as alſo the <hi>Oathes, Covenants,</hi> and other en<g ref="char:EOLhyphen"/>gagements that were upon him;
<pb n="228" facs="tcp:170378:124"/>
his ſeeming diſlike alſo of our Bi<g ref="char:EOLhyphen"/>ſhops, and Ceremonies, expreſſed frequently.</p>
<p>As a preparation hereunto there were repreſentations, and applica<g ref="char:EOLhyphen"/>tions made to him, while in <hi>Scot<g ref="char:EOLhyphen"/>land,</hi> and ſpeedily at his firſt com<g ref="char:EOLhyphen"/>ming into <hi>England.</hi> There were by a diſcreet and moderate Pen, ſome <hi>conſiderations</hi> put into his hand, a<g ref="char:EOLhyphen"/>bout this work of reformation; And to make way hereunto, in the firſt place the <hi>Author</hi> endeavours to repreſent, the <hi>ſlowneſſe</hi> and <hi>neg<g ref="char:EOLhyphen"/>lect</hi> of States, in altering what hath gotten any ſettlement in <hi>Eccleſiaſti<g ref="char:EOLhyphen"/>cal affaires;</hi> though matters bee ever ſo much amiſſe; his words are theſe, <hi>I ask, why the Civil State ſhould be purged and reſtored, by good and wholſome Lawes made in every third or fourth year in Parliament, providing remedies as faſt as time breedeth miſchiefs; and contrariwiſe, the Eccleſiaſtical ſtate ſhould ſtill con<g ref="char:EOLhyphen"/>tinue upon the dreggs of time, and
<pb n="229" facs="tcp:170378:124"/>
receive no alterations, now for this five and forty years and more;</hi>
<note place="margin">It is above five and forty years ſince.</note>
<hi>Wee have heard</hi> (ſaith he) <hi>of no offer of Bills in Parliament; Is nothing a<g ref="char:EOLhyphen"/>miſſe?</hi>
</p>
<p>The <hi>pretenſions</hi> for not making <hi>alterations</hi> in Churches ſetled, are mentioned by the ſame Honoura<g ref="char:EOLhyphen"/>ble Pen, in page 29. <hi>Tares, ſay they,</hi>
<note place="margin">Diſcourſe concer<g ref="char:EOLhyphen"/>ning Church affairs by the L. <hi>Ba<g ref="char:EOLhyphen"/>con.</hi>
</note>
<hi>muſt not bee plucked up, leſt you ſup<g ref="char:EOLhyphen"/>plant the good Corn, but let them grow together; they ſtiffly hold, that nothing may bee innovated, becauſe it would make a breach upon the reſt,</hi> which hee reaſoneth againſt thus: <hi>Qui mala non permutat, in bonis non perſeverat, Without change of ill a man cannot continue in good; to take away abuſes, ſupplanteth not good or<g ref="char:EOLhyphen"/>ders, but eſtabliſhes them,</hi> Moroſa moris retentio, res turbulata aeque ac novitas eſt, <hi>Contentious retaining of Cuſtom is a turbulent thing, as well as innovation.</hi> pag. 32.</p>
<p>There were <hi>ſolicitations</hi> by the godly Miniſters and people of both
<pb n="230" facs="tcp:170378:125"/>
Kingdoms, the ſuffering of good Miniſters all Queen <hi>Elizabeths</hi> days were repreſented to him, which before hee came to <hi>this</hi> Crown hee ſeemed much to reſent.</p>
<p>Theſe hopes were ſtrengthned by his <hi>Majeſties</hi> condeſcenſion to a <hi>Conference,</hi> which could never bee obtained before, in which hee was preſent in his own perſon. And what was the iſſue of all thoſe hopes and endeavours? It is ſtrange to conſider, 1 Not one grievance, (<hi>ſome ſmall things</hi> only, <hi>explained rather than changed</hi>) or impoſition removed, or penalty leſſened, but advantage taken to lay the <hi>yoke</hi> heavier upon thoſe that deſired re<g ref="char:EOLhyphen"/>formation, in repreſenting them to the Nation, as perſons <hi>Schiſma<g ref="char:EOLhyphen"/>tical,</hi> and troubleſome in the Church. 2 A <hi>Proclamation</hi> was ſent abroad immediately,<note place="margin">March the 5. in 1 <hi>Jacobi.</hi>
</note> to let all men know, that <hi>whatſoever was preſumed upon, of his Majeſties in<g ref="char:EOLhyphen"/>tentions,</hi> to further reformation,
<pb n="231" facs="tcp:170378:125"/>
<hi>was without cauſe given by him.</hi> All former Lawes and penalties are anew enforced (thus the Proclama<g ref="char:EOLhyphen"/>tion concludeth.) <hi>And laſt of all, we doe admoniſh all men, that hereafter they ſhall not expect or attempt any further alteration in the common and publick form of Gods ſervice, from this which is now eſtabliſhed;</hi> ſuch a reſolution, in reſpect to Lawes and Statutes made about Civil affairs hath not been known.</p>
<p>In King <hi>Charls</hi> his time the like endeavours continued, yet Mini<g ref="char:EOLhyphen"/>ſters daily ſilenced, and being ut<g ref="char:EOLhyphen"/>terly wearied with expectation, Multitudes, Miniſters and others, (being hopeleſſe) as their laſt teſti<g ref="char:EOLhyphen"/>mony againſt thoſe evils, <hi>ſeparated themſelves</hi> from the Congregations here in <hi>England,</hi> and went to the utmoſt ends of the earth, and into a Wilderneſſe ſome of them, and others into other parts beyond the Seas, that they might enjoy Ordi<g ref="char:EOLhyphen"/>nances in purity. None of all theſe
<pb n="232" facs="tcp:170378:126"/>
endeavours moved the State to re<g ref="char:EOLhyphen"/>move the leaſt thing offenſive ei<g ref="char:EOLhyphen"/>ther in Diſcipline or Worſhip, nor at all to bear with thoſe that could not ſubmit.</p>
</div>
<div n="3" type="section">
<head>§. 3.</head>
<p>Let it be everlaſtingly a Caution to Governours, that they doe not impoſe ſmaller matters, and ſuch as themſelves judge but Circumſtan<g ref="char:EOLhyphen"/>ces, under ſuch ruining penalties. It is a wretched policy (and too much practiſed by Stateſ-men) where there is want of light or reaſon to enforce, to ſupply it by the ſeve<g ref="char:EOLhyphen"/>rity of Lawes and penalties. And let not Miniſters, or Churches, which ſhould bee as <hi>pillars</hi> to hold forth, and as an <hi>Army with banners</hi> to contend for <hi>Truth,</hi>
<note place="margin">Can. 6.4</note> and <hi>Liberty,</hi> according to Chriſt; I ſay, let not ſuch be wanting, in all humility to uſe indeavours to hinder ſuch ſet<g ref="char:EOLhyphen"/>tlements.</p>
<p>
<pb n="233" facs="tcp:170378:126"/>It is not for us to ſay, <hi>light</hi> is growing, and <hi>knowledge</hi> in theſe matters increaſeth every day more and more; and therefore, ſuch e<g ref="char:EOLhyphen"/>vils & Law reſtraints will fall off of themſelves. I confeſſe, if any thing doe it, one would think the break<g ref="char:EOLhyphen"/>ing forth of Scripture light ſhould; it being the property of that light to <hi>burn</hi> up, and <hi>conſume Wood, Hay,</hi>
<note place="margin">1 Cor. 3.13.</note>
<hi>Stubble,</hi> and the like mixtures <hi>with,</hi> or additions <hi>to,</hi> the Doctrine and Worſhip of God. But yet let it be conſidered, where <hi>Forms</hi> and <hi>Ce<g ref="char:EOLhyphen"/>remonies</hi> have once gotten a foot<g ref="char:EOLhyphen"/>ing; how long they have been able to keep their ſtations, after their evil and offenſiveneſſe, by moſt e<g ref="char:EOLhyphen"/>vident <hi>light</hi> and <hi>demonſtration</hi> on every ſide, have been diſcovered to all men.</p>
<p>It was written by Maſter <hi>Udal,</hi> Mr. <hi>Cartwright,</hi> and others in an Epiſtle to the Biſhops, as follow<g ref="char:EOLhyphen"/>eth. <q>Many and moſt evident have our Declarations been, &c. ne<g ref="char:EOLhyphen"/>ver
<pb n="234" facs="tcp:170378:127"/>
have any one of you taken in hand to ſay any thing againſt it, but it hath made his eyes to dazle as the cleareſt Sun-ſhine, where<g ref="char:EOLhyphen"/>by hee hath been driven hither and thither, groping for evaſi<g ref="char:EOLhyphen"/>ons, and yet could not eſcape, but hath fallen into infinite, moſt monſtrous abſurdities, and blaſ<g ref="char:EOLhyphen"/>phemous aſſertions; ſo forceable is the truth to amaze the gain-ſayers thereof: yet ſtill you con<g ref="char:EOLhyphen"/>tinue in your courſe, is it becauſe you ſee not what you ſhould do? It cannot bee ſo — unleſſe you have <hi>eyes and ſee not:</hi> for the <hi>cauſe</hi> hath been (by the bleſſing of God) ſo managed, that many Plow-men, Artificers, and Chil<g ref="char:EOLhyphen"/>dren doe ſee it, and know it, and are able by the Word of God to juſtifie it, and condemn you to bee adverſaries to the Goſpel, &c.</q> Doe not perſwade your ſelves therefore, that further light, and a greater ſuffrage hereafter will be
<pb n="235" facs="tcp:170378:127"/>
able to remove what things for the preſent ſeem not ſo allowable; its true, God can doe any thing; But it is evident there hath been light, light ſealed with ſufferings, ſealed with the eſtates, liberties, and lives of as gracious, holy, learned men as any the World had, and that for the ſpace of near a hundred years, and yet theſe abuſes and impoſitions remained, in as great vigour and freſhneſſe, to run their race, oppreſſe, and deſtroy, for a hundred years more, had not a hand from Heaven prevented it; the Lord did <hi>ſhake Heaven and earth, the ſea and dry land,</hi> that thoſe ſhaken things might be removed, and ſuch things only <hi>that cannot bee ſhaken may remain.</hi>
</p>
</div>
<div n="4" type="section">
<head>§. 4.</head>
<p>The ſharpeſt edge of ſuch Laws while unreformed, verging about from their firſt pious and righteous
<pb n="236" facs="tcp:170378:128"/>
intentions (if any ſuch were) will bee ſet, and in the greateſt rigour againſt the moſt conſcientious and holy Miniſters, and others. Some<g ref="char:EOLhyphen"/>thing, and ſome <hi>instances</hi> that bear a proportion to this obſervation may bee given, from former act<g ref="char:EOLhyphen"/>ings, not yet quite out of me<g ref="char:EOLhyphen"/>mory.</p>
<p>In <hi>Edward</hi> the ſixths reformati<g ref="char:EOLhyphen"/>on, <hi>Common-Prayers,</hi> and the lea<g ref="char:EOLhyphen"/>ving of a Prayer-Book as a help to the Miniſter in officiating, &c. was for <hi>a good purpoſe,</hi>
<note place="margin">Preface to C. P.</note>
<hi>and great ad<g ref="char:EOLhyphen"/>vancement of godlineſſe,</hi> as is pro<g ref="char:EOLhyphen"/>feſſed by the Compoſers of it. As alſo the <hi>Ceremonies</hi> to bee obſerved in officiating according to that Book,<note place="margin">Of Cere<g ref="char:EOLhyphen"/>monies why be<g ref="char:EOLhyphen"/>fore the C. Prayer Book.</note>
<hi>they were of a godly intent and purpoſe formerly deviſed,</hi> they <hi>are reſerved for a decent order in the Church, for which they were firſt de<g ref="char:EOLhyphen"/>viſed, and becauſe they appertain to edification, &c.</hi> and upon this good meaning, that <hi>without ſome Cere<g ref="char:EOLhyphen"/>monies it is not poſsible to keep any
<pb n="237" facs="tcp:170378:128"/>
order, or quiet Diſcipline in the Church.</hi> It was farre from the thoughts of thoſe good men, (who afterwards were Martyrs ſome of them,) it would ever have been wrought about, to become a mat<g ref="char:EOLhyphen"/>ter of ſuch high contention, and made uſe of (as it was in a few years) to eject from the Miniſtry, ſo many hundreds of the choyceſt perſons that ever had ſtation a<g ref="char:EOLhyphen"/>mongſt us.<note place="margin">Dr. <hi>Burges</hi> Apol. on K. <hi>James.</hi>
</note> This Doctor <hi>Burges</hi> gives as one reaſon why he could not yield to <hi>ſubſcription</hi> though he had formerly ſubſcribed; becauſe hee perceived by the Book of <hi>Ca<g ref="char:EOLhyphen"/>nons,</hi> publiſhed in 1603. the <hi>inten<g ref="char:EOLhyphen"/>tion</hi> of the Leitourgy and Ceremo<g ref="char:EOLhyphen"/>nies, was to <hi>another</hi> purpoſe than what the Church aimed at in the <hi>firſt</hi> impoſition.</p>
<p n="2">2 The not ſuffering Miniſters to preach without a <hi>Licence</hi> from the Biſhop had a good riſe in that age,<note place="margin">See In<g ref="char:EOLhyphen"/>jon in 1. <hi>Eliz.</hi> N. 8</note> when moſt places were ſupplied with Readers, and thoſe found
<pb n="238" facs="tcp:170378:129"/>
able to preach, Popiſh and corrupt in their judgements. In proceſſe of time it became a barre only to the moſt holy and eminent Prea<g ref="char:EOLhyphen"/>chers.</p>
<p n="3">3 Three or four men that <hi>ten<g ref="char:EOLhyphen"/>der Gods glory,</hi>
<note place="margin">Injunct. of <hi>Eliz.</hi> N. 46.</note>
<hi>and his true religion,</hi> were to be appointed by the <hi>Ordi<g ref="char:EOLhyphen"/>nary,</hi> as informers, to obſerve that men kept their own Pariſh Chur<g ref="char:EOLhyphen"/>ches, and to preſent ſuch as were negligent, into the Spiritual Court: this was intended againſt the Po<g ref="char:EOLhyphen"/>piſhly affected; but not long after thoſe Informers appointed by the Ordinary, were the vileſt of men, and few Popiſhly affected, but the holieſt and moſt conſciencious per<g ref="char:EOLhyphen"/>ſons preſented and moleſted by them, and the neglect of Common Prayer became the Character of a <hi>Puritan;</hi> ſo were they deſcribed to King <hi>James</hi> in the Conference at <hi>Hampton Court,</hi> by the Biſhop of <hi>London.</hi>
</p>
<p n="4">4 In the Articles appointed by
<pb n="239" facs="tcp:170378:129"/>
Queen <hi>Elizabeth,</hi>
<note place="margin">Artic. 51.</note> to bee inquired of in the Viſitation, this is one, <hi>I<g ref="char:EOLhyphen"/>tem, Whether doe you know any man in your Pariſh, ſecretly, or in unlawful Conventicles, ſay, or hear Maſſe? &c.</hi> but in after times, ſuch as met to<g ref="char:EOLhyphen"/>gether to faſt and pray, to repeat Sermons, and edifie one another with good conference, were theſe Conventiclers, and puniſhed accor<g ref="char:EOLhyphen"/>dingly.</p>
</div>
<div n="5" type="section">
<head>§. 5.</head>
<p>In ſome Dioceſſes, where the Biſhop (being mindful of that wholſome exhortation to mercy in his Conſecration) was more ten<g ref="char:EOLhyphen"/>der to his Clergie:<note place="margin">Book of Ordinati<g ref="char:EOLhyphen"/>on, pa. penult.</note> there more in<g ref="char:EOLhyphen"/>dulgence was exerciſed, and not ſuch wreſting former Injunctions, and Articles, or perverting them againſt the godly ſober Miniſters. Hence Viſitation Articles and In<g ref="char:EOLhyphen"/>quiries were of different ſtrains, according to the ſpirit of the Dio<g ref="char:EOLhyphen"/>ceſſan:
<pb n="240" facs="tcp:170378:130"/>
which being obſerved, and that there was more liberty given in one Dioceſs than in another <hi>from the inadvertency</hi> (as his Majeſty ter<g ref="char:EOLhyphen"/>med it) <hi>of ſome in authority:</hi> By the ninth Can. of the Synod in the year 1640. It was <hi>ordained for the better ſetling of uniformity in the out<g ref="char:EOLhyphen"/>ward</hi> government <hi>& adminiſtration of the Church as followeth, This Synod,</hi> (ſaith the Canon) <hi>hath now cauſed a ſummary of</hi> Viſitatory Articles — <hi>and wee doe Decree and Ordain, that no Biſhop — ſhall cauſe to be printed or publiſhed any other Articles, or forms of enquiry, &c.</hi> So that the edge of thoſe former Injunctions, which was intentionally ſet againſt Popery and Prophaneneſs, by this new Book of Articles, and enqui<g ref="char:EOLhyphen"/>ries, is fixedly ſet (and without all hope of indulgence from any bet<g ref="char:EOLhyphen"/>ter-minded Biſhop) to wound the peace and comfort, of the beſt af<g ref="char:EOLhyphen"/>fected Miniſters and People throughout the Nation, and for
<pb n="241" facs="tcp:170378:130"/>
all times to come. It being now not left in the power, or to the diſcretion of any Biſhop without hazard of a Months ſuſpenſion <hi>ipſo facto</hi> from his Biſhoprick, to bee more favourable than another, or leſs ſevere and rigorous than the major part of that Synod; a Synod that mounted their Canons to a greater height againſt the purity and ſimplicity of Goſpel-Worſhip, than any at any time before them ſince the reformation.</p>
</div>
</div>
<trailer>FINIS.</trailer>
</div>
</body>
<back>
<div type="table_of_contents">
<pb facs="tcp:170378:131"/>
<head>The Contents.</head>
<list>
<item>THe Uſefulneſs of Catechi<g ref="char:EOLhyphen"/>zing, and the prejudice to the people for want of it. <hi>Pref.</hi>
</item>
<item>
<label>CHAP. I.</label>
A Caſe; With an explication of ſome terms, and the State of the Queſtion. <hi>Pag. 1</hi>
</item>
<item>
<label>CHAP. II.</label>
The firſt Argument. Rites and Forms that have a Stated Uſe, and to Spiritual ends, in the Worſhip of God, ought to have Scripture war<g ref="char:EOLhyphen"/>rant for their eſtabliſhment. <hi>p. 16</hi>
</item>
<item>
<label>CHAP. III.</label>
What directions there are in the Scripture for the instructing of o<g ref="char:EOLhyphen"/>thers, in reſpect both of matter, me<g ref="char:EOLhyphen"/>thod,
<pb facs="tcp:170378:131"/>
and means, &c. <hi>p. 29</hi>
</item>
<item>
<label>CHAP. IV.</label>
Divers Objections anſwered, no ſhew of Scripture for it, nor neceſſity, nor requiſite for Uniformity, or ob<g ref="char:EOLhyphen"/>liged to it by our Covenant. <hi>p. 43</hi>
</item>
<item>
<label>CHAP. V.</label>
The ſecond Argument. Of Chri<g ref="char:EOLhyphen"/>ſtian Liberty, things indifferent, the particular Catechiſm deſigned, not ſo deſirable for this Uſe; and how many waies our Miniſterial liberty is prejudiced by the impoſition of it. <hi>p. 61</hi>
</item>
<item>
<label>CHAP. VI.</label>
The third Argument: Taken from the impoſition and penalty, the ſeve<g ref="char:EOLhyphen"/>rity and inequality of it. <hi>p. 99</hi>
</item>
<item>
<label>CHAP. VII.</label>
Of the prejudice to the Miniſtry, and evil conſequences of ſuch an im<g ref="char:EOLhyphen"/>poſition. <hi>p. 120</hi>
</item>
<item>
<label>
<pb facs="tcp:170378:132"/>
<hi>CHAP. VIII.</hi>
</label>
Schiſms and Diviſions amongſt the People of God, occaſioned and continued thereby, is another fruit, or evil conſequence of ſuch penal<g ref="char:EOLhyphen"/>ties. <hi>p. 165</hi>
</item>
<item>
<label>CHAP. IX.</label>
The fourth Argument. It is de<g ref="char:EOLhyphen"/>ſtructive to that Independency which hath been anciently claimed and profeſſed by our brethren the Non<g ref="char:EOLhyphen"/>conformiſts. <hi>p. 211</hi>
</item>
<item>
<label>CHAP. X.</label>
The fifth Argument. It is diffi<g ref="char:EOLhyphen"/>cult in Eccleſiaſtical matters, to ob<g ref="char:EOLhyphen"/>tain reformation of what is amiſs. Theſe things are preſſed with greateſt ſeverity upon the most conſcienti<g ref="char:EOLhyphen"/>ous. <hi>p. 233</hi>
</item>
</list>
</div>
<div type="publishers_advertisement">
<pb facs="tcp:170378:132"/>
<head>Courteous Reader, Theſe Books following are printed or ſold by <hi>Adoniram Byfield,</hi> at the three <hi>Bibles</hi> in <hi>Cornhil,</hi> next door to <hi>Popes-head</hi> Alley.</head>
<list>
<item>
<seg rend="decorInit">T</seg>HE <hi>Hiſtory</hi> of the <hi>Evangeli<g ref="char:EOLhyphen"/>cal Churches</hi> of the Valies of <hi>Piedmont,</hi> containing a moſt exact Geographical deſcrip<g ref="char:EOLhyphen"/>tion of the place, and a faithful account of the Doctrine, Life, and Preſervation of the Ancient Inhabitants, together with a moſt naked and punctual rela<g ref="char:EOLhyphen"/>tion of the late bloody Maſſacre, 1655. And a Narrative of all the following tranſactions to 1658. Juſtified partly by divers Ancient Manuſcripts written many hundred years before <hi>Calvin</hi> or <hi>Luther,</hi> by <hi>Samuel Monland</hi> Eſq. in fol.</item>
<item>
<hi>Divine Characters,</hi> in two parts, a<g ref="char:EOLhyphen"/>cutely diſtinguiſhing the more ſecret and undiſcerned differences between the hypocrite in his beſt dreſs of ſeem<g ref="char:EOLhyphen"/>ing virtues, and form of duties, and the true Chriſtian in his real graces, and ſincere obedience, by Mr. <hi>Samuel Crook,</hi> in fol.</item>
<item>
<pb facs="tcp:170378:133"/>
<hi>A Commentary</hi> upon the three firſt Chapters of <hi>Geneſis,</hi> by that Reverend Divine Mr. <hi>John White,</hi> late of <hi>Dorche<g ref="char:EOLhyphen"/>ſter,</hi> in ſol.</item>
<item>
<hi>An Expoſition</hi> upon <hi>Ezekiel,</hi> by Mr. <hi>William Greenhill,</hi> in <hi>quarto.</hi>
</item>
<item>
<hi>The Humble Sinner</hi> reſolved what hee ſhould do to bee ſaved, or Faith in the Lord Jeſus Chriſt the onely way of Salvation, by Mr. <hi>Obadiah Sedgwick,</hi> in <hi>quarto.</hi>
</item>
<item>
<hi>The Riches of Grace diſplayed</hi> in the offer and tender of <hi>Salvation to poor Sin<g ref="char:EOLhyphen"/>ners,</hi> by Mr. <hi>Obadiah Sedgwick,</hi> in 12<hi rend="sup">o</hi>.</item>
<item>
<hi>The Fountain opened,</hi> and the water of Life flowing forth, for the refreſh<g ref="char:EOLhyphen"/>ing of thirſty Sinners, wherein is ſet out Chriſts earneſt and gracious Invitation of poor Sinners to come unto the wa<g ref="char:EOLhyphen"/>ters: His complaining Expoſtulation, with the ingratitude and folly of thoſe who neglect ſo great Salvation. His renewed <hi>Solicitation,</hi> with all earneſt<g ref="char:EOLhyphen"/>neſs, and the moſt perſwaſive <hi>Argu<g ref="char:EOLhyphen"/>ments</hi> to allure thirſty Sinners to come to Chriſt, by Mr. <hi>Obadiah Sedgwick,</hi> in <hi>quarto.</hi>
</item>
<item>The <hi>Anatomy</hi> of Secret ſins, Preſump<g ref="char:EOLhyphen"/>tuous ſins, ſins in Dominion, and Up<g ref="char:EOLhyphen"/>rightneſs, wherein divers Caſes are re<g ref="char:EOLhyphen"/>ſolved; with the Remiſſibleneſs of all
<pb facs="tcp:170378:133"/>
ſin, and the Irremiſſibleneſs of the ſin againſt the Holy Ghoſt, by Mr. <hi>Oba<g ref="char:EOLhyphen"/>diah Sedgwick.</hi>
</item>
<item>The <hi>Plain Doctrine</hi> of the Juſtifica<g ref="char:EOLhyphen"/>tion of a Sinner in the ſight of God, ju<g ref="char:EOLhyphen"/>ſtified by the God of Truth in his holy Word, and the cloud of witneſſes in all ages, wherein are handled the Cau<g ref="char:EOLhyphen"/>ſes of the Sinners Juſtification, explain<g ref="char:EOLhyphen"/>ed and applied in a plain doctrinal and familiar way, for the capacity and un<g ref="char:EOLhyphen"/>derſtanding of the weak and ignorant, by Mr. <hi>Charls Chauncy,</hi> in <hi>quarto.</hi>
</item>
<item>The <hi>Goſpels Glory,</hi> without preju<g ref="char:EOLhyphen"/>dice to the Law, ſhining forth in the glory of God, the Father, Son, and Holy Ghoſt, for the Salvation of Sin<g ref="char:EOLhyphen"/>ners, who through Grace do beleeve, by <hi>Richard By field,</hi> in <hi>octavo.</hi>
</item>
<item>A <hi>Declaration</hi> of the Faith and Or<g ref="char:EOLhyphen"/>der owned and practiſed in the Con<g ref="char:EOLhyphen"/>gregational Churches in <hi>England,</hi> a<g ref="char:EOLhyphen"/>greed upon, and conſented unto by their Elders and Meſſengers in their meeting at the <hi>Savoy,</hi> in <hi>quarto.</hi>
</item>
<item>
<hi>Habbakkuks</hi> Prayer applied to the Churches preſent occaſion, and Chriſts Counſel to the Church of <hi>Philadelphia,</hi> very ſeaſonable and uſeful for theſe times, by Mr. <hi>Samuel Balmford,</hi> in 8<hi rend="sup">o</hi>.</item>
<item>A Short <hi>Catechiſm,</hi> by Mr. <hi>Obadiah Sedgwick.</hi>
</item>
<item>
<pb facs="tcp:170378:134"/>
<hi>Hidden Manna,</hi> by Mr. <hi>Fenner,</hi> in 12<hi rend="sup">o</hi>.</item>
<item>
<hi>Safe Conduct,</hi> or the Saints guidance to glory, by Mr. <hi>Ralph Robinſon,</hi> in <hi>quarto.</hi>
</item>
<item>The <hi>Saints Longing</hi> after their hea<g ref="char:EOLhyphen"/>venly Country, by Mr. <hi>Ralph Robinſon,</hi> in <hi>quarto.</hi>
</item>
<item>A <hi>Sermon</hi> at a Faſt, by Mr. <hi>Nathaniel Ward,</hi> in <hi>quarto.</hi>
</item>
<item>
<hi>Moſes</hi> his Death, a Sermon at the Fu<g ref="char:EOLhyphen"/>neral of Mr. <hi>Edward Bright</hi> Miniſter, by Mr. <hi>Samuel Jacomb,</hi> in <hi>quarto.</hi>
</item>
<item>A ſhort and plain <hi>Catechiſm,</hi> inſtru<g ref="char:EOLhyphen"/>cting a learner of Chriſtian Religion what he is to believe, and what he is to practiſe, by Mr. <hi>Samuel Jacomb,</hi> in <hi>octo.</hi>
</item>
<item>
<hi>The Hypocritical Nation</hi> deſcribed, with an Epiſtle prefixed by Mr. <hi>Samuel Jacomb,</hi> in <hi>quarto.</hi>
</item>
<item>A <hi>Sermon</hi> of the baptizing of infants, by Mr. <hi>Stephen Marſhal,</hi> in <hi>quarto.</hi>
</item>
<item>
<hi>The unity of the Saints</hi> with Chriſt the head, by Mr. <hi>Stephen Marſhal.</hi>
</item>
<item>There is now in the preſs that long expected book, <hi>The bowels of tender mercy ſealed in the everlaſting Covenant,</hi> by Mr. <hi>Obadiah Sedgwick,</hi> in <hi>fol.</hi>
</item>
</list>
<trailer>FINIS.</trailer>
</div>
</back>
</text>
</TEI>
| 199.309681 | 1,990 | 0.691666 |
ddde5458f9ac64b1e72b46c3893fcb01604d1857 | 801 | xaml | XML | WorkloadViewer/View/ConnectionInfoDialog.xaml | shellninja/WorkloadTools | 0958cc7493c430c1da7933befd19c659961b610f | [
"MIT"
] | 189 | 2018-07-25T13:35:39.000Z | 2022-03-18T12:30:01.000Z | WorkloadViewer/View/ConnectionInfoDialog.xaml | hajerty/WorkloadTools | d21caa78d96f93dc9585514888f2fa56b4363ee9 | [
"MIT"
] | 107 | 2018-07-25T08:31:35.000Z | 2022-03-25T15:56:50.000Z | WorkloadViewer/View/ConnectionInfoDialog.xaml | hajerty/WorkloadTools | d21caa78d96f93dc9585514888f2fa56b4363ee9 | [
"MIT"
] | 47 | 2018-07-30T08:22:26.000Z | 2022-02-19T16:13:25.000Z | <Dialog:CustomDialog x:Class="WorkloadViewer.View.ConnectionInfoDialog"
xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"
xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"
xmlns:d="http://schemas.microsoft.com/expression/blend/2008"
xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"
xmlns:local="clr-namespace:WorkloadViewer.View"
mc:Ignorable="d"
xmlns:Controls="clr-namespace:MahApps.Metro.Controls;assembly=MahApps.Metro"
xmlns:Dialog="clr-namespace:MahApps.Metro.Controls.Dialogs;assembly=MahApps.Metro"
d:DesignWidth="641"
Style="{StaticResource NewCustomDialogStyle}">
<StackPanel>
<local:ConnectionInfoEditor />
</StackPanel>
</Dialog:CustomDialog>
| 36.409091 | 90 | 0.707865 |
62c636596ea3ce519baf0e5a45dbe97351d7e053 | 1,474 | csproj | XML | Frends.Community.Oracle/Frends.Community.Oracle.csproj | CommunityHiQ/Frends.Community.Oracle | c0376680ab93f9801e6bf14016b8ec3ce3e442fa | [
"MIT"
] | null | null | null | Frends.Community.Oracle/Frends.Community.Oracle.csproj | CommunityHiQ/Frends.Community.Oracle | c0376680ab93f9801e6bf14016b8ec3ce3e442fa | [
"MIT"
] | 1 | 2021-05-04T07:54:00.000Z | 2021-05-04T07:54:00.000Z | Frends.Community.Oracle/Frends.Community.Oracle.csproj | CommunityHiQ/Frends.Community.Oracle | c0376680ab93f9801e6bf14016b8ec3ce3e442fa | [
"MIT"
] | null | null | null | <Project Sdk="Microsoft.NET.Sdk">
<PropertyGroup>
<TargetFrameworks>netstandard2.0;net471</TargetFrameworks>
<Company>HiQ Finland</Company>
<Description>Tasks for performing queries to Oracle database</Description>
<GeneratePackageOnBuild>false</GeneratePackageOnBuild>
<copyright>HiQ Finland</copyright>
<PackageLicenseExpression>MIT</PackageLicenseExpression>
<PackageProjectUrl>https://github.com/CommunityHiQ/Frends.Community.Oracle</PackageProjectUrl>
<IncludeSource>true</IncludeSource>
<PackageTags>Frends</PackageTags>
<GenerateDocumentationFile>true</GenerateDocumentationFile>
<Version>3.1.1</Version>
</PropertyGroup>
<ItemGroup>
<None Include="FrendsTaskMetadata.json" Pack="true" PackagePath="/">
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
</None>
</ItemGroup>
<ItemGroup>
<PackageReference Include="Dapper" Version="2.0.35" />
<PackageReference Include="Newtonsoft.Json" Version="10.0.3" />
<PackageReference Include="Oracle.ManagedDataAccess.Core" Version="2.19.80" />
<PackageReference Include="System.ComponentModel.Annotations" Version="4.5.0" />
<PackageReference Include="System.Data.Common" Version="4.3.0" />
<PackageReference Include="System.Threading" Version="4.3.0" />
<PackageReference Include="System.Threading.Tasks" Version="4.3.0" />
<PackageReference Include="System.Xml.XmlDocument" Version="4.3.0" />
</ItemGroup>
</Project> | 42.114286 | 98 | 0.74559 |
d56131d77c40e8b34be4fe74722193f098cb91b8 | 6,263 | xml | XML | isis/src/docsys/documents/HowToApplicationExamples/assets/examples/crop.xml | ihumphrey-usgs/ISIS3_old | 284cc442b773f8369d44379ee29a9b46961d8108 | [
"Unlicense"
] | 134 | 2018-01-18T00:16:24.000Z | 2022-03-24T03:53:33.000Z | isis/src/docsys/documents/HowToApplicationExamples/assets/examples/crop.xml | ihumphrey-usgs/ISIS3_old | 284cc442b773f8369d44379ee29a9b46961d8108 | [
"Unlicense"
] | 3,825 | 2017-12-11T21:27:34.000Z | 2022-03-31T21:45:20.000Z | isis/src/docsys/documents/HowToApplicationExamples/assets/examples/crop.xml | jlaura/isis3 | 2c40e08caed09968ea01d5a767a676172ad20080 | [
"CC0-1.0"
] | 164 | 2017-11-30T21:15:44.000Z | 2022-03-23T10:22:29.000Z | <?xml version="1.0" encoding="UTF-8"?>
<application name="crop" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="http://isis.astrogeology.usgs.gov/Schemas/Application/application.xsd">
<brief>
Crops a cube
</brief>
<description>
This program can be used to crop or select a sub-area from a cube. The user
can select to crop in any or all dimensions: sample, line, and band. The
crop parameter selection requires that the area of interest be contiguous.
That is, the program will not allow non-continuous cropping such as lines
1-5, 10-30, and 80-100.
</description>
<category>
<categoryItem>Trim and Mask</categoryItem>
</category>
<history>
<change name="Jim Mathews" date="1994-04-20">
Original version
</change>
<change name="Jeff Anderson" date="2002-08-05">
Converted to Isis 3.0
</change>
<change name="K Teal Thompson" date="2002-11-18">
Added examples
</change>
<change name="Jeff Anderson" date="2003-01-28">
Removed crop from the Utility category
</change>
<change name="K Teal Thompson" date="2003-02-03">
Make images smaller
</change>
<change name="K Teal Thompson" date="2003-02-04">
Added red rectangle to input image of example to illustrate crop area.
</change>
<change name="K Teal Thompson" date="2003-03-19">
Moved images to /assets/image directory and thumbnails to /assets/thumb directory.
</change>
<change name="Stuart Sides" date="2003-04-04">
Fixed problem with isiscvs not checking in the thumb and image directories.
</change>
</history>
<oldName>
<item>dsk2dsk</item>
</oldName>
<groups>
<group name="Files">
<parameter name="FROM">
<type>filename</type>
<fileMode>input</fileMode>
<brief>
Input cube
</brief>
<description>
The cube which will be cropped.
</description>
<filter>
*.cub
</filter>
</parameter>
<parameter name="TO">
<type>filename</type>
<fileMode>output</fileMode>
<brief>
Output cropped cube
</brief>
<description>
The smaller output cube containing the results of the crop.
</description>
<filter>
*.cub
</filter>
</parameter>
</group>
<group name="Starting Coordinate">
<parameter name="SAMPLE">
<type>integer</type>
<brief>Starting Sample</brief>
<description>
The starting sample to extract. It must be inside
the cube.
</description>
<minimum inclusive="yes">1</minimum>
</parameter>
<parameter name="LINE">
<type>integer</type>
<brief>Starting Line</brief>
<description>
The starting line to extract. It must be inside
the cube.
</description>
<minimum inclusive="yes">1</minimum>
</parameter>
<parameter name="BAND">
<type>integer</type>
<brief>Starting Band</brief>
<description>
The starting band to extract. It must be inside
the cube.
</description>
<minimum inclusive="yes">1</minimum>
</parameter>
</group>
<group name="Output Dimensions">
<parameter name="NSAMPLES">
<type>integer</type>
<brief>Number of Samples</brief>
<description>
The number of samples to extract. It must stay
inside the input cube.
</description>
<minimum inclusive="yes">1</minimum>
</parameter>
<parameter name="NLINES">
<type>integer</type>
<brief>Number of Lines</brief>
<description>
The number of lines to extract. It must stay
inside the input cube.
</description>
<minimum inclusive="yes">1</minimum>
</parameter>
<parameter name="NBANDS">
<type>integer</type>
<brief>Number of Bands</brief>
<description>
The number of bands to extract. It must stay
inside the input cube.
</description>
<minimum inclusive="yes">1</minimum>
</parameter>
</group>
</groups>
<examples>
<example>
<brief>200x300 sub-area</brief>
<description>
Extracting a 200x300 sub-area
</description>
<terminalInterface>
<commandLine> f=peaks.cub t=crop.cub samp=100 line=200 band=1 nsamp=200 nline=300 nbands=1
</commandLine>
<description>
In this example crop will extract a 200x300 sub-area that starts at sample 100 and line 200
</description>
</terminalInterface>
<inputImages>
<image src="assets/image/peaks.1.jpg" width="500" height="500">
<brief> Input image for crop</brief>
<description>This is the input image for the 200x300 example of crop. The area to be "cropped" is shown in red.
</description>
<thumbnail caption=" Input image" src="assets/thumb/peaks.1.jpg" width="200" height="200"/>
<parameterName>FROM</parameterName>
</image>
</inputImages>
<outputImages>
<image src="assets/image/peaks.crop.jpg" width="200" height="300">
<brief> Output image for crop</brief>
<description> This is the output image for the 200x300 example of crop
</description>
<thumbnail caption="Output image showing results of the crop application with 200 by 300 input." src="assets/thumb/peaks.crop.jpg" width="133" height="200"/>
<parameterName>TO</parameterName>
</image>
</outputImages>
<guiInterfaces>
<guiInterface>
<image width="472" height="388" src="assets/image/cropgui.jpg">
<brief>Example Gui</brief>
<description>Screenshot of GUI with parameters filled in to perform a 200 pixel by 300 pixel crop of the input image. </description>
<thumbnail width="200" height="165" caption="Crop Gui" src="assets/thumb/cropgui.jpg" />
</image>
</guiInterface>
</guiInterfaces>
</example>
</examples>
</application>
| 30.110577 | 181 | 0.604982 |
a7a43c3c08756175c5705e1691fb070e1aeb94ec | 186 | xml | XML | spec/fixtures/eccu/parser/recursive_extension.xml | teamlakana/akamai_api | a6bc1369e118bb298c71019c9788e5c9bd1753c8 | [
"MIT"
] | 22 | 2015-02-11T03:18:35.000Z | 2019-06-13T16:08:00.000Z | spec/fixtures/eccu/parser/recursive_extension.xml | teamlakana/akamai_api | a6bc1369e118bb298c71019c9788e5c9bd1753c8 | [
"MIT"
] | 9 | 2015-03-31T00:04:43.000Z | 2017-08-16T07:23:45.000Z | spec/fixtures/eccu/parser/recursive_extension.xml | teamlakana/akamai_api | a6bc1369e118bb298c71019c9788e5c9bd1753c8 | [
"MIT"
] | 8 | 2015-04-07T18:07:12.000Z | 2021-11-09T05:41:36.000Z | <?xml version="1.0"?>
<eccu>
<match:recursive-dirs value="eccu_test">
<match:ext value="txt">
<revalidate>now</revalidate>
</match:ext>
</match:recursive-dirs>
</eccu>
| 20.666667 | 42 | 0.629032 |
441cf490474c142e5a4627eed33005a848a95961 | 262 | xml | XML | app/src/main/res/values/styles.xml | ii887522/snake-android | 948e8047a888e1ec9f14e7178bc5f6f97e3c17b9 | [
"MIT"
] | 1 | 2021-04-05T05:28:46.000Z | 2021-04-05T05:28:46.000Z | app/src/main/res/values/styles.xml | ii887522/snake-android | 948e8047a888e1ec9f14e7178bc5f6f97e3c17b9 | [
"MIT"
] | null | null | null | app/src/main/res/values/styles.xml | ii887522/snake-android | 948e8047a888e1ec9f14e7178bc5f6f97e3c17b9 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<resources>
<style name="AppTheme" parent="@style/Theme.AppCompat.NoActionBar">
<item name="android:windowEnableSplitTouch">false</item>
<item name="android:splitMotionEvents">false</item>
</style>
</resources>
| 32.75 | 69 | 0.71374 |
2670203d77d785c8143e0706fbe1dd23f8cf7531 | 2,759 | xml | XML | GDO.Apps.Bitcoin/Web/Bitcoin/data/input738.xml | bkavuncu/GDO | d3225660af2b8151eccdb52238cbc51bf2005c3e | [
"MIT"
] | null | null | null | GDO.Apps.Bitcoin/Web/Bitcoin/data/input738.xml | bkavuncu/GDO | d3225660af2b8151eccdb52238cbc51bf2005c3e | [
"MIT"
] | 1 | 2019-10-09T08:50:15.000Z | 2019-10-09T08:50:15.000Z | GDO.Apps.Bitcoin/Web/Bitcoin/data/input738.xml | bkavuncu/GDO | d3225660af2b8151eccdb52238cbc51bf2005c3e | [
"MIT"
] | 2 | 2019-10-02T20:35:22.000Z | 2021-05-17T00:56:45.000Z | {
"op":"utx",
"x":{
"lock_time":0,
"ver":1,
"size":520,
"inputs":[
{
"sequence":4294967295,
"prev_out":{
"spent":true,
"tx_index":112953207,
"type":0,
"addr":"1JGYAV3jjc8dFrcQzzhUHjrUeR2372VCZE",
"value":13127038,
"n":0,
"script":"76a914bd6a64490277dcf4819ed9b5584cd691ce808ee288ac"
},
"script":"483045022100efea37920fc9f15e83eed3aafec72173482638fc8abd2d089e8f7877c83cb35b022013818b80039258ca344e60a47b2b9e6878c671887d7fc74e77cd05df8039a5730121034becb8fa66d3f1e2078d17dc41ac712696322ddaa9beac744d40515df5463b9c"
},
{
"sequence":4294967295,
"prev_out":{
"spent":true,
"tx_index":113001962,
"type":0,
"addr":"1JGYAV3jjc8dFrcQzzhUHjrUeR2372VCZE",
"value":2524126,
"n":1,
"script":"76a914bd6a64490277dcf4819ed9b5584cd691ce808ee288ac"
},
"script":"47304402207cd0b6c0859d004e68a985b3d1febde45f90f51a771fd1777f9fc8498328ab20022001d8aa5f276bf24e902e28149170564ac42cfedce1196fb538048c9ba5357ca00121034becb8fa66d3f1e2078d17dc41ac712696322ddaa9beac744d40515df5463b9c"
},
{
"sequence":4294967295,
"prev_out":{
"spent":true,
"tx_index":113002719,
"type":0,
"addr":"1JGYAV3jjc8dFrcQzzhUHjrUeR2372VCZE",
"value":19454507,
"n":1,
"script":"76a914bd6a64490277dcf4819ed9b5584cd691ce808ee288ac"
},
"script":"47304402204efad3d7cafec1b1e586cff91ddd9146d705c27adcdcfcc4d02d3e60b158ae12022037f8795dc6ab374f8b84132e0198e33e250d15916c84239662c29fce86a022840121034becb8fa66d3f1e2078d17dc41ac712696322ddaa9beac744d40515df5463b9c"
}
],
"time":1448548083,
"tx_index":113002964,
"vin_sz":3,
"hash":"f082fe7c40d63b1957c1d2c6c9b86c2a16f46a292169bb07f957039bdcc60a10",
"vout_sz":2,
"relayed_by":"127.0.0.1",
"out":[
{
"spent":false,
"tx_index":113002964,
"type":0,
"addr":"1Htkmia9HNrZ7zGXBpQbvsvkvNNGC8AYxF",
"value":24129862,
"n":0,
"script":"76a914b94bc3c79a20f7046a646c037937debc80f9d1d888ac"
},
{
"spent":false,
"tx_index":113002964,
"type":0,
"addr":"1JGYAV3jjc8dFrcQzzhUHjrUeR2372VCZE",
"value":10965809,
"n":1,
"script":"76a914bd6a64490277dcf4819ed9b5584cd691ce808ee288ac"
}
]
}
} | 36.786667 | 237 | 0.580283 |
5a11c9cbe340a5b235104daa9fe4333f57a2e214 | 139 | xml | XML | test/i18n/translation.ja.xml | alpinegizmo/xslt_render | 63eeb5779d39bf3593e39ec465e189d08b5f2c7d | [
"MIT"
] | 1 | 2016-05-09T03:29:27.000Z | 2016-05-09T03:29:27.000Z | test/i18n/translation.ja.xml | alpinegizmo/xslt_render | 63eeb5779d39bf3593e39ec465e189d08b5f2c7d | [
"MIT"
] | null | null | null | test/i18n/translation.ja.xml | alpinegizmo/xslt_render | 63eeb5779d39bf3593e39ec465e189d08b5f2c7d | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<terms lang="ja">
<term name="HELLO">hola</term>
<term name="GOODBYE">adiós</term>
</terms>
| 23.166667 | 38 | 0.611511 |
e0bdcce19bdbabbb20f512639ebcaa48fc545e78 | 8,126 | xml | XML | input/2155.xml | opencultureconsulting/noah-siegen-opus | f7519c01fd26c1ae4744bf9ad90c8541dacb6ffb | [
"MIT"
] | null | null | null | input/2155.xml | opencultureconsulting/noah-siegen-opus | f7519c01fd26c1ae4744bf9ad90c8541dacb6ffb | [
"MIT"
] | null | null | null | input/2155.xml | opencultureconsulting/noah-siegen-opus | f7519c01fd26c1ae4744bf9ad90c8541dacb6ffb | [
"MIT"
] | null | null | null | <xMetaDiss:xMetaDiss xmlns:xMetaDiss="http://www.d-nb.de/standards/xmetadissplus/" xmlns:cc="http://www.d-nb.de/standards/cc/" xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:dcmitype="http://purl.org/dc/dcmitype/" xmlns:dcterms="http://purl.org/dc/terms/" xmlns:pc="http://www.d-nb.de/standards/pc/" xmlns:urn="http://www.d-nb.de/standards/urn/" xmlns:hdl="http://www.d-nb.de/standards/hdl/" xmlns:doi="http://www.d-nb.de/standards/doi/" xmlns:thesis="http://www.ndltd.org/standards/metadata/etdms/1.0/" xmlns:ddb="http://www.d-nb.de/standards/ddb/" xmlns:dini="http://www.d-nb.de/standards/xmetadissplus/type/" xmlns="http://www.d-nb.de/standards/subject/" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:doc="http://www.lyncode.com/xoai" xsi:schemaLocation="http://www.d-nb.de/standards/xmetadissplus/ http://files.dnb.de/standards/xmetadissplus/xmetadissplus.xsd"><id>2155</id>
<dc:title xsi:type="ddb:titleISO639-2" lang="eng">Corona pandemic</dc:title>
<dc:title xsi:type="ddb:titleISO639-2" ddb:type="translated" lang="ger">Die Corona-Pandemie : ein Positionspapier der BMBF Nachwuchsforschergruppe KONTIKAT 2020</dc:title>
<dcterms:alternative xsi:type="ddb:talternativeISO639-2" lang="eng">position paper of the BMBF Junior research group KONTIKAT</dcterms:alternative>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Marén</pc:foreName>
<pc:surName>Schorch</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Sohaib S.</pc:foreName>
<pc:surName>Hassan</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Hussain A.</pc:foreName>
<pc:surName>Syed</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Margarita</pc:foreName>
<pc:surName>Grinko</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Amanda</pc:foreName>
<pc:surName>Langer</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Fabienne</pc:foreName>
<pc:surName>Seifert</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Sascha</pc:foreName>
<pc:surName>Skudelny</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:creator xsi:type="pc:MetaPers">
<pc:person>
<pc:name type="nameUsedByThePerson">
<pc:foreName>Thea</pc:foreName>
<pc:surName>Riebe</pc:surName>
</pc:name>
</pc:person>
</dc:creator>
<dc:subject xsi:type="xMetaDiss:SWD">COVID-19</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Covid19</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Pandemic</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Covid19 pandemic</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Crisis</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Crisis management</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Information science</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Business continuity management</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Vontinuity</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Sociology</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Covid19</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Pandemie</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Covid19-Pandemie</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Krise</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Krisenmanagement</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Informationswissenschaft</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Business Continuity Management</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Kontinuität</dc:subject>
<dc:subject xsi:type="xMetaDiss:noScheme">Soziologie</dc:subject>
<dc:subject xsi:type="xMetaDiss:DDC-SG">330</dc:subject>
<dcterms:abstract xsi:type="ddb:contentISO639-2" lang="eng">Under the direction of the leader, Dr Marén Schorch (sociology and socio-informatics), seven members of the junior research group KONTIKAT (funded by the Federal Ministry for Research and Education (BMBF, 2017-2021)) present their reflections on the Covid19 pandemic and its implications for our research after the first months of the pandemic (in August 2020) from multiple disciplinary perspectives: sociology, economics, information science, and media studies. Our research focuses on investigating „civil and business continuity by means of socio-technical networking in crisis“. The group is one out of five groups in the BMBF funding program under „Civil Security – Promoting young researchers and their interdisciplinary competencies“. Find more information and recent publications on our website: https://kontikat.de/en/</dcterms:abstract>
<dcterms:abstract xsi:type="ddb:contentISO639-2" lang="ger">Unter der Leitung von Dr. Marén Schorch (Soziologie und Sozio-Informatik) reflektieren Mitglieder der BMBF Nachwuchswuchsforschergruppe KONTIKAT ihre Erkenntnisse nach den ersten Monaten der Covid19 Pandemie im August 2020 aus den jeweiligen disziplinären Perspektiven: der Soziologie, (Sozio-)Informatik, Medienwissenschaft und Ökonomie. Unsere Forschung fokussiert auf die „zivilgesellschaftliche und betriebliche Kontinuität durch sozio-technische Vernetzung in Katastrophenlagen“. KONTIKAT ist eine von fünf Forschungsgruppen aus dem BMBF Programm „Zivile Sicherheit - Nachwuchsförderung durch interdisziplinären Kompetenzaufbau“. Ausführliche Informationen zu den Forschungsaktivitäten der Gruppe und Publikationen finden Sie auf unserer Website: https://kontikat.de/</dcterms:abstract>
<dc:publisher xsi:type="cc:Publisher" type="dcterms:ISO3166" countryCode="DE">
<cc:universityOrInstitution cc:GKD-Nr="509551-7">
<cc:name>Universitätsbibliothek der Universität Siegen</cc:name>
<cc:place>Siegen</cc:place>
</cc:universityOrInstitution>
<cc:address cc:Scheme="DIN5008">Adolf-Reichweinstr. 2, 57068 Siegen</cc:address>
</dc:publisher>
<dcterms:issued xsi:type="dcterms:W3CDTF">2020</dcterms:issued>
<dc:type xsi:type="dini:PublType">Other</dc:type>
<dc:type xsi:type="dcterms:DCMIType">Text</dc:type>
<dini:version_driver>publishedVersion</dini:version_driver>
<dc:identifier xsi:type="urn:nbn">urn:nbn:de:hbz:467-21559</dc:identifier>
<dc:source xsi:type="dcterms:URI">https://kontikat.de/wp-content/uploads/2022/01/Corona_position_paper_KONTIKAT_2020.pdf</dc:source>
<dc:language xsi:type="dcterms:ISO639-2">eng</dc:language>
<dc:rights xsi:type="dcterms:URI">http://creativecommons.org/publicdomain/zero/1.0/</dc:rights>
<ddb:contact ddb:contactID="L6000-0732"/>
<ddb:fileNumber>1</ddb:fileNumber>
<ddb:fileProperties ddb:fileName="Corona_position_paper_KONTIKAT.pdf" ddb:fileSize="1031846"/>
<ddb:checksum ddb:type="MD5">dc748e68cb036fd2e36d3c61a31ea000</ddb:checksum>
<ddb:transfer ddb:type="dcterms:URI">https://dspace.ub.uni-siegen.de/bitstream/ubsi/2155/4/Corona_position_paper_KONTIKAT.pdf</ddb:transfer>
<ddb:identifier ddb:type="URL">https://dspace.ub.uni-siegen.de/handle/ubsi/2155</ddb:identifier>
<ddb:rights ddb:kind="free"/>
<ddb:server>Universitätsbibliothek Siegen</ddb:server>
</xMetaDiss:xMetaDiss> | 71.280702 | 910 | 0.715973 |
6fcfd96d448a6c088edce7b2403d724b627ad51b | 5,373 | xml | XML | Metadata/FpML.V5r10/FpML.V5r10.ConfigData/Config/FpMLCodes/scheduled-date-type-1-0.xml | mmrath/Highlander.Net | 578eadc2aa9e4c85838751d9d102c1b5bd4c5d71 | [
"BSD-3-Clause"
] | null | null | null | Metadata/FpML.V5r10/FpML.V5r10.ConfigData/Config/FpMLCodes/scheduled-date-type-1-0.xml | mmrath/Highlander.Net | 578eadc2aa9e4c85838751d9d102c1b5bd4c5d71 | [
"BSD-3-Clause"
] | null | null | null | Metadata/FpML.V5r10/FpML.V5r10.ConfigData/Config/FpMLCodes/scheduled-date-type-1-0.xml | mmrath/Highlander.Net | 578eadc2aa9e4c85838751d9d102c1b5bd4c5d71 | [
"BSD-3-Clause"
] | 1 | 2021-10-02T09:53:21.000Z | 2021-10-02T09:53:21.000Z | <?xml version="1.0" encoding="UTF-8"?>
<gcl:CodeList xmlns:gcl="http://xml.genericode.org/2004/ns/CodeList/0.2/" xmlns:doc="http://www.fpml.org/coding-scheme/documentation" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://xml.genericode.org/2004/ns/CodeList/0.2/ CodeList.xsd">
<Annotation>
<Description>
<doc:definition>Defines the type of each scheduled date that is reported.</doc:definition>
</Description>
</Annotation>
<Identification>
<ShortName>scheduledDateTypeScheme</ShortName>
<Version>1-0</Version>
<CanonicalUri>http://www.fpml.org/coding-scheme/scheduled-date-type</CanonicalUri>
<CanonicalVersionUri>http://www.fpml.org/coding-scheme/scheduled-date-type-1-0</CanonicalVersionUri>
<LocationUri>http://www.fpml.org/coding-scheme/scheduled-date-type-1-0.xml</LocationUri>
</Identification>
<ColumnSet>
<Column Id="Code" Use="required">
<ShortName>Code</ShortName>
<Data Type="token">
<Parameter ShortName="maxLength">63</Parameter>
</Data>
</Column>
<Column Id="Source" Use="optional">
<ShortName>Source</ShortName>
<Data Type="string"/>
</Column>
<Column Id="Description" Use="optional">
<ShortName>Description</ShortName>
<Data Type="string"/>
</Column>
<Key Id="PrimaryKey">
<ShortName>key</ShortName>
<ColumnRef Ref="Code"/>
</Key>
</ColumnSet>
<SimpleCodeList>
<Row>
<Value>
<SimpleValue>Effective</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The effective date of the swap leg. This is useful when the information is not directly included in the swap stream (for example, in certain equity swaps).</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>Termination</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The termination date of the swap leg. This is useful when the information is not directly included in the swap stream (for example, in certain equity swaps).</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>FirstPayment</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The date of the first payment defined by this asset. The amount of the payment, if known, could be represented by an associated value of measure type “Cash”.</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>PreviousPayment</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The date of the most recent payment defined by this asset prior to the valuation date. The amount of the payment could be represented by an associated value of measure type “Cash”.</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>NextPayment</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The date of the next upcoming payment defined by this asset, on or after the valuation date. The amount of the payment, if known, could be represented by an associated value of measure type “Cash”.</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>FinalPayment</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The date of the final payment defined by this asset. The amount of the payment, if known, could be represented by an associated value of measure type “Cash”.</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>PreviousReset</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The date of the most recent reset in this stream, on or before the valuation date. The reset rate could be represented by an associated value of measure type “MarketQuote” (for an untreated rate), and/or one of measure type “TreatedRate” (for a treated rate).</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>NextReset</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>The date of the next upcoming reset in this stream, after the valuation date.</SimpleValue>
</Value>
</Row>
<Row>
<Value>
<SimpleValue>AccrualStart</SimpleValue>
</Value>
<Value>
<SimpleValue>FpML</SimpleValue>
</Value>
<Value>
<SimpleValue>Date interest first starts accruing. In most cases, this will be the effective date.</SimpleValue>
</Value>
</Row>
</SimpleCodeList>
</gcl:CodeList> | 39.507353 | 298 | 0.596873 |
ee1db2bf08d37a4bae24c82bb83d82e87a2bb8e0 | 1,763 | xml | XML | verb-inspector/corpora/ontonotes/sense-inventories/copy-v.xml | mijaelb/verb-inspector | 274c3a8934b81a0208dec9bd246ef41e0c880800 | [
"MIT"
] | null | null | null | verb-inspector/corpora/ontonotes/sense-inventories/copy-v.xml | mijaelb/verb-inspector | 274c3a8934b81a0208dec9bd246ef41e0c880800 | [
"MIT"
] | null | null | null | verb-inspector/corpora/ontonotes/sense-inventories/copy-v.xml | mijaelb/verb-inspector | 274c3a8934b81a0208dec9bd246ef41e0c880800 | [
"MIT"
] | null | null | null | <?xml version="1.0" ?>
<!DOCTYPE inventory SYSTEM "inventory.dtd">
<inventory lemma="copy-v">
<commentary>
</commentary>
<sense group="1" n="1" name="replicate in writing or a written document" type="">
<commentary>
Includes COPY OUT, COPY DOWN
NOTE: Includes 'send a copy (of a written document to)' as in an
email or a memo. See sentence 5.
</commentary>
<examples>
The students were made to copy the alphabet over and over again.
Copy the notes on the board.
Copy the information in the cell.
He copied the classified documents word for word.
Will you copy me on your response to the boss about annoying e-memos?
</examples>
<mappings>
<gr_sense></gr_sense>
<wn version="23.0">1,3</wn>
<wn lemma="copy_out" version="3.0">1</wn>
<omega></omega><pb>copy.01,copy.02</pb>
<vn>scribble-25.2,transcribe-25.4</vn><fn>Duplication</fn>
</mappings><SENSE_META clarity=""/>
</sense>
<sense group="1" n="2" name="replicate an item or one's behavior/looks." type="">
<commentary>
NOTE: Replicating ANY written document does not go in this
sense. Tag as sense 1.
</commentary>
<examples>
She's copying me!
The mime copied the passers-by.
Children often copy their parents or older siblings.
</examples>
<mappings>
<gr_sense></gr_sense>
<wn version="3.0">2,4</wn>
<wn lemma="" version=""></wn>
<omega></omega><pb>copy.01</pb>
<vn>scribble-25.2</vn><fn>Imitating,Duplication</fn>
</mappings><SENSE_META clarity=""/>
</sense>
<WORD_META authors="corvey,clarklm" sample_score="-"/>
</inventory>
| 37.510638 | 86 | 0.604651 |
2dc04330b50261547e5d8041fc0e60849c90a834 | 5,380 | xml | XML | test_data/musicbrainz.org/ws/2/artist/1d93c839-22e7-4f76-ad84-d27039efc048_quest_inc=url-rels.xml | thomasregnet/kleinodien | 638713075dea743093752aba0ee1b8ca5161d065 | [
"MIT"
] | null | null | null | test_data/musicbrainz.org/ws/2/artist/1d93c839-22e7-4f76-ad84-d27039efc048_quest_inc=url-rels.xml | thomasregnet/kleinodien | 638713075dea743093752aba0ee1b8ca5161d065 | [
"MIT"
] | 13 | 2019-12-18T19:59:58.000Z | 2022-02-02T18:07:59.000Z | test_data/musicbrainz.org/ws/2/artist/1d93c839-22e7-4f76-ad84-d27039efc048_quest_inc=url-rels.xml | thomasregnet/kleinodien | 638713075dea743093752aba0ee1b8ca5161d065 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?><metadata xmlns="http://musicbrainz.org/ns/mmd-2.0#"><artist type="Group" id="1d93c839-22e7-4f76-ad84-d27039efc048" type-id="e431f5f6-b5d2-343d-8b36-72607fffb74b"><name>Sepultura</name><sort-name>Sepultura</sort-name><isni-list><isni>0000000115439903</isni></isni-list><country>BR</country><area id="f45b47f8-5796-386e-b172-6c31b009a5d8"><name>Brazil</name><sort-name>Brazil</sort-name><iso-3166-1-code-list><iso-3166-1-code>BR</iso-3166-1-code></iso-3166-1-code-list></area><begin-area id="208e783b-661d-4164-935a-90f9e7937195"><name>Belo Horizonte</name><sort-name>Belo Horizonte</sort-name></begin-area><life-span><begin>1984</begin></life-span><relation-list target-type="url"><relation type="lyrics" type-id="e4d73442-3762-45a8-905c-401da65544ed"><target id="51b3f155-d94d-4f87-b6db-39d950207ca1">http://decoda.com/sepultura-lyrics</target></relation><relation type-id="e4d73442-3762-45a8-905c-401da65544ed" type="lyrics"><target id="1c6c0353-f647-4138-8613-231f4c1235e3">http://genius.com/artists/Sepultura</target></relation><relation type-id="e4d73442-3762-45a8-905c-401da65544ed" type="lyrics"><target id="ae20a584-c8a9-44a5-be6d-fa165cc6dc9a">http://lyrics.wikia.com/wiki/Sepultura</target></relation><relation type-id="e4d73442-3762-45a8-905c-401da65544ed" type="lyrics"><target id="9fbbff45-98a3-40ff-a5e3-c2d743564460">http://muzikum.eu/en/122-5419/sepultura/lyrics.html</target></relation><relation type="other databases" type-id="d94fb61c-fa20-4e3c-a19a-71a949fb2c55"><target id="808b6d6d-9f30-4cf7-b997-3c83757b3e47">http://rateyourmusic.com/artist/sepultura</target></relation><relation type="VIAF" type-id="e8571dcc-35d4-4e91-a577-a3382fd84460"><target id="8960948c-6333-4fd3-98df-0dbced49d1e2">http://viaf.org/viaf/125109150</target></relation><relation type="allmusic" type-id="6b3e3c85-0002-4f34-aca6-80ace0d7e846"><target id="5b6335b9-1434-4875-a5bc-f75b333ab03a">http://www.allmusic.com/artist/mn0000741746</target></relation><relation type-id="94c8b0cc-4477-4106-932c-da60e63de61c" type="IMDb"><target id="13642cdb-c1e4-4bf5-b0fa-4e0d5f910efb">http://www.imdb.com/name/nm1962665/</target></relation><relation type-id="08db8098-c0df-4b78-82c3-c8697b4bba7f" type="last.fm"><target id="58ee762f-adf4-4c21-909d-030f864db247">http://www.last.fm/music/Sepultura</target></relation><relation type-id="d94fb61c-fa20-4e3c-a19a-71a949fb2c55" type="other databases"><target id="a2e3df0c-0e70-41ce-9c56-bb74195aa8b3">http://www.metal-archives.com/bands/Sepultura/78</target></relation><relation type="other databases" type-id="d94fb61c-fa20-4e3c-a19a-71a949fb2c55"><target id="9d77c132-4334-448f-b928-005428049523">http://www.musik-sammler.de/artist/161</target></relation><relation type-id="f484f897-81cc-406e-96f9-cd799a04ee24" type="fanpage"><target id="fce5bd80-ff9a-4a34-8096-f9e76c99fb34">http://www.sepultribe.com/</target></relation><relation type-id="fe33d22f-c3b0-4d68-bd53-a856badf2b15" type="official homepage"><target id="5569c2cf-939e-48b7-b8dc-b0679618163b">http://www.sepultura.com.br/</target></relation><relation type-id="29651736-fa6d-48e4-aadc-a557c6add1cb" type="wikipedia"><target id="7243b499-3ce6-4d43-a663-833576135c44">https://en.wikipedia.org/wiki/Sepultura</target></relation><relation type="purchase for download" type-id="f8319a2f-f824-4617-81c8-be6560b3b203"><target id="b0ef4db0-cd6b-4ead-a88d-6ec3b36cb407">https://itunes.apple.com/br/artist/id918092</target></relation><relation type-id="bac47923-ecde-4b59-822e-d08f0cd10156" type="myspace"><target id="7a7fbf9f-e9d1-4d7d-8926-2f0ef8c69322">https://myspace.com/sepultura</target></relation><relation type="streaming music" type-id="769085a1-c2f7-4c24-a532-2375a77693bd"><target id="a829712c-d461-4797-8c05-2381aa3f0a1f">https://open.spotify.com/artist/6JW8wliOEwaDZ231ZY7cf4</target></relation><relation type-id="f8319a2f-f824-4617-81c8-be6560b3b203" type="purchase for download"><target id="d9c28d43-a378-43a0-809a-c48003e2796b">https://play.google.com/store/music/artist?id=Ashwjhgp3otl2ao37w62nwyzrhu</target></relation><relation type="social network" type-id="99429741-f3f6-484b-84f8-23af51991770"><target id="7c19aa97-d553-41d8-82a7-76754a32e477">https://twitter.com/sepulturacombr</target></relation><relation type-id="04a5b104-a4c2-4bac-99a1-7b837c37d9e4" type="discogs"><target id="8898d9f1-e6a0-40ad-b420-4d7a03342ba5">https://www.discogs.com/artist/34058</target></relation><relation type-id="99429741-f3f6-484b-84f8-23af51991770" type="social network"><target id="2c4dcb17-260d-4f58-be66-c809c355dc7c">https://www.facebook.com/sepultura</target></relation><relation type="social network" type-id="99429741-f3f6-484b-84f8-23af51991770"><target id="1a8fa8d4-a0ca-4a48-9354-b30d9b4b2063">https://www.flickr.com/photos/sepulturacombr</target></relation><relation type-id="99429741-f3f6-484b-84f8-23af51991770" type="social network"><target id="cca25810-cb6b-4ebc-a818-46c4c78618ea">https://www.instagram.com/sepultura/</target></relation><relation type-id="689870a4-a1e4-4912-b17f-7b2664215698" type="wikidata"><target id="c3bd3a04-ae7c-4268-9a24-968250dd83c2">https://www.wikidata.org/wiki/Q239074</target></relation><relation type-id="6a540e5b-58c6-4192-b6ba-dbc71ec8fcf0" type="youtube"><target id="beaded5c-ce53-460e-a31b-9581d200a3b1">https://www.youtube.com/user/sepulturacombr</target></relation></relation-list></artist></metadata> | 5,380 | 5,380 | 0.785502 |
e133dc9183d9f40cd1b58c0fcfe5e59dd2d1a9f8 | 308 | xml | XML | test/jaxp/javax/xml/jaxp/unittest/validation/files/JDK8176447a.xml | 1690296356/jdk | eaf668d1510c28d51e26c397b582b66ebdf7e263 | [
"Apache-2.0"
] | null | null | null | test/jaxp/javax/xml/jaxp/unittest/validation/files/JDK8176447a.xml | 1690296356/jdk | eaf668d1510c28d51e26c397b582b66ebdf7e263 | [
"Apache-2.0"
] | null | null | null | test/jaxp/javax/xml/jaxp/unittest/validation/files/JDK8176447a.xml | 1690296356/jdk | eaf668d1510c28d51e26c397b582b66ebdf7e263 | [
"Apache-2.0"
] | null | null | null | <test xmlns="http://openjdk_java_net/test.xml"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xsi:schemaLocation="JDK8176447a.xsd">
<innerObject>
<innerInnerObject test-unique-attribute="1" />
<innerInnerObject test-unique-attribute="1" />
</innerObject>
</test>
| 34.222222 | 60 | 0.668831 |
07a8f117ca8342e18b6710ff3a75bb56293151c0 | 1,617 | xml | XML | .idea/dataSources.xml | carlosezeta/ezeta | 9db310b6c4fa5b6f8dc30f8a098d4390bab9225d | [
"MIT"
] | 1 | 2019-01-01T18:06:44.000Z | 2019-01-01T18:06:44.000Z | .idea/dataSources.xml | carlosezeta/ezeta | 9db310b6c4fa5b6f8dc30f8a098d4390bab9225d | [
"MIT"
] | null | null | null | .idea/dataSources.xml | carlosezeta/ezeta | 9db310b6c4fa5b6f8dc30f8a098d4390bab9225d | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<project version="4">
<component name="DataSourceManagerImpl" format="xml" multifile-model="true">
<data-source source="LOCAL" name="asgardcms@localhost" uuid="5d9de31c-1c99-497a-9105-876512f97a12">
<driver-ref>mysql</driver-ref>
<synchronize>true</synchronize>
<jdbc-driver>com.mysql.jdbc.Driver</jdbc-driver>
<jdbc-url>jdbc:mysql://localhost:3307/asgardcms</jdbc-url>
<driver-properties>
<property name="autoReconnect" value="true" />
<property name="zeroDateTimeBehavior" value="convertToNull" />
<property name="tinyInt1isBit" value="false" />
<property name="characterEncoding" value="utf8" />
<property name="characterSetResults" value="utf8" />
<property name="yearIsDateType" value="false" />
</driver-properties>
</data-source>
<data-source source="LOCAL" name="ezeta@localhost" uuid="db73e22e-1330-493c-9518-d9f22e5c7177">
<driver-ref>mysql</driver-ref>
<synchronize>true</synchronize>
<jdbc-driver>com.mysql.jdbc.Driver</jdbc-driver>
<jdbc-url>jdbc:mysql://localhost:3306/ezeta</jdbc-url>
<driver-properties>
<property name="autoReconnect" value="true" />
<property name="zeroDateTimeBehavior" value="convertToNull" />
<property name="tinyInt1isBit" value="false" />
<property name="characterEncoding" value="utf8" />
<property name="characterSetResults" value="utf8" />
<property name="yearIsDateType" value="false" />
</driver-properties>
</data-source>
</component>
</project> | 49 | 103 | 0.667904 |
2a725a467f8bf6d04ec852a6d6e11727a8f17ed7 | 579 | xml | XML | data/Aidea/Annotations/2010081722.xml | musigm/107-2DL-Final_period | 91fe69651c098640c060177ba856221e53059ae4 | [
"MIT"
] | null | null | null | data/Aidea/Annotations/2010081722.xml | musigm/107-2DL-Final_period | 91fe69651c098640c060177ba856221e53059ae4 | [
"MIT"
] | null | null | null | data/Aidea/Annotations/2010081722.xml | musigm/107-2DL-Final_period | 91fe69651c098640c060177ba856221e53059ae4 | [
"MIT"
] | null | null | null | <annotation>
<filename>2010081722.jpg</filename>
<size>
<width>800</width>
<height>600</height>
<depth>3</depth>
</size>
<object>
<name>bottle</name>
<bndbox>
<xmin>282</xmin>
<ymin>265</ymin>
<xmax>433</xmax>
<ymax>381</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<bndbox>
<xmin>1</xmin>
<ymin>178</ymin>
<xmax>108</xmax>
<ymax>311</ymax>
</bndbox>
</object>
<object>
<name>bottle</name>
<bndbox>
<xmin>184</xmin>
<ymin>263</ymin>
<xmax>293</xmax>
<ymax>372</ymax>
</bndbox>
</object>
</annotation> | 16.542857 | 36 | 0.587219 |
f365fc97b9a9ef828ae063aa0ff0d8b9964bb841 | 729 | xml | XML | data/projects/vim-fuzzyfinder/Enlistments.xml | martyn82/OhlohAnalytics | de302f9ddd9071af967d6dd897b33bf20a179e40 | [
"CC-BY-3.0"
] | null | null | null | data/projects/vim-fuzzyfinder/Enlistments.xml | martyn82/OhlohAnalytics | de302f9ddd9071af967d6dd897b33bf20a179e40 | [
"CC-BY-3.0"
] | null | null | null | data/projects/vim-fuzzyfinder/Enlistments.xml | martyn82/OhlohAnalytics | de302f9ddd9071af967d6dd897b33bf20a179e40 | [
"CC-BY-3.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<response>
<status>success</status>
<items_returned>1</items_returned>
<items_available>1</items_available>
<first_item_position>0</first_item_position>
<result>
<enlistment>
<id>94000</id>
<project_id>337332</project_id>
<repository_id>92464</repository_id>
<repository>
<id>92464</id>
<type>HgRepository</type>
<url>https://bitbucket.org/ns9tks/vim-fuzzyfinder/</url>
<username></username>
<password></password>
<logged_at>2013-07-05T14:16:21Z</logged_at>
<commits>330</commits>
<ohloh_job_status>success</ohloh_job_status>
</repository>
</enlistment>
</result>
</response>
| 29.16 | 64 | 0.644719 |
9e2765883b1a78dd6872e7d3a875fbfa70b152a7 | 842 | xml | XML | trainingdata/cache/21/27800621.xml | jremillard/osm-changeset-classification | 61b21d526300c1152f7b29c0c93f2953dd1cd323 | [
"MIT"
] | 16 | 2018-03-05T14:21:53.000Z | 2021-07-11T23:16:21.000Z | trainingdata/cache/21/27800621.xml | jremillard/osm-changeset-classification | 61b21d526300c1152f7b29c0c93f2953dd1cd323 | [
"MIT"
] | 2 | 2018-03-05T16:33:10.000Z | 2018-04-13T01:15:11.000Z | trainingdata/cache/21/27800621.xml | jremillard/osm-changeset-classification | 61b21d526300c1152f7b29c0c93f2953dd1cd323 | [
"MIT"
] | 2 | 2018-03-14T13:06:34.000Z | 2020-09-12T01:50:21.000Z | <changeset id="27800621" schema="2">
<counts nodesAdded="2" nodesDeleted="0" nodesModified="0" relationsAdded="0" relationsDeleted="0" relationsModified="0" waysAdded="1" waysDeleted="0" waysModified="1" />
<meta>
<tag k="comment" v="mapping with bing " />
<tag k="created_by" v="iD 1.6.2" />
<tag k="imagery_used" v="Bing" />
</meta>
<body>
<tag id="149339334" k="area" o="none" type="way" v="yes" />
<tag id="149339334" k="name" o="none" type="way" v="Jordan River Diversion Dam" />
<tag id="149339334" k="source" o="none" type="way" v="NRCan-CanVec-8.0" />
<tag id="149339334" k="building" o="add" type="way" v="industrial" />
<tag id="319562791" k="name" o="add" type="way" v="Jordan River Diversion Dam" />
<tag id="319562791" k="waterway" o="add" type="way" v="dam" />
</body>
</changeset>
| 49.529412 | 171 | 0.619952 |
ada3dd7b7bd6f729081beb6e968cc6bd1cf5058c | 3,558 | xml | XML | doc/site/src/documentation/content/xdocs/Java/interop.xml | douglascrp/xmlsec-mityc-sinadura | cf63024481914be33ae3a06ef1cc7629dd59aa0f | [
"Apache-2.0"
] | null | null | null | doc/site/src/documentation/content/xdocs/Java/interop.xml | douglascrp/xmlsec-mityc-sinadura | cf63024481914be33ae3a06ef1cc7629dd59aa0f | [
"Apache-2.0"
] | null | null | null | doc/site/src/documentation/content/xdocs/Java/interop.xml | douglascrp/xmlsec-mityc-sinadura | cf63024481914be33ae3a06ef1cc7629dd59aa0f | [
"Apache-2.0"
] | 2 | 2018-08-10T18:54:23.000Z | 2018-08-10T18:56:27.000Z | <?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE document PUBLIC "-//APACHE//DTD Documentation V1.1//EN" "document-v11.dtd"
[
<!ENTITY % xmlsec_entities SYSTEM "../xmlsec_entities.ent">
%xmlsec_entities;
]>
<!--
Copyright 2003-2004 The Apache Software Foundation
Licensed under the Apache License, Version 2.0 (the "License");
you may not use this file except in compliance with the License.
You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
-->
<document>
<header>
<title>Java Interoperability</title>
</header>
<body>
<section>
<title>Problems</title>
<p>In Version v1.0.4, there is one test case which fails (interop test
for exclusive c14n). This is related to very esoteric node sets (The Y4
test vector from
<jump
href="http://www.w3.org/Signature/2002/02/01-exc-c14n-interop.html">
the interop matrix
</jump>).
</p>
</section>
<section>
<title>Interoperability issues</title>
<p>
As it can be seen on the
<jump href="ext:w3c/xmldsig">working group homepage</jump>,
there are some interoperability reports, namely for
<jump href="http://www.w3.org/Signature/2000/10/10-c14n-interop.html">
Canonical XML
</jump>,
<jump
href="http://www.w3.org/Signature/2002/02/01-exc-c14n-interop.html">
Exclusive Canonical XML
</jump>
and
<jump
href="http://www.w3.org/TR/xmldsig-core/2001/04/05-xmldsig-interop.html">
XML Signature
</jump>.
</p>
<p>
Interoperability depends heavily on test vectors, this means that
implementation A has to check whether the signatures from
implementation B can be verified. For this purpose, we have a
collection of different test vectors in our <code>data/</code>
directory. The directory includes test vectors from
</p>
<ul>
<li><jump href="http://www.baltimore.com/keytools/xml/index.html">
Baltimore KeyTools XML</jump>
</li>
<li><jump href="http://jcewww.iaik.at/products/ixsil/index.php">IAIK IXSIL</jump></li>
<li><jump
href="http://www.rsasecurity.com/products/bsafe/certj.html">
RSA Security Cert-J</jump>
</li>
<li>The vectors from the
<jump
href="http://www.alphaworks.ibm.com/tech/xmlsecuritysuite">
IBM alphaWorks XML Security suite
</jump> could not been included in this distribution because of
licensing issues. For some reasons which I do not understand, they
copyrighted their test signatures which they have bundled with
xss4j. If you want to include interop testing against IBM in your
unit tests, simply do the following:
Download <code>xss4j-20030127.zip</code> from the
<jump
href="http://www.alphaworks.ibm.com/aw.nsf/download/xmlsecuritysuite">
alphaWorks download page
</jump>.
Copy all files from the <code>xss4j-20030127.zip#/xss4j/data</code>
directory into the
<code>xml-security/data/com/ibm/xss4j-20030127/</code>
directory. If the
<jump href="api/org/apache/xml/security/test/InteropTest.html">
Interop
</jump> class finds these files, the
<code>org.apache.xml.security.test.interop.IBMTest</code> class is
also executed during unit interop tests.
</li>
</ul>
</section>
</body>
</document>
| 32.642202 | 87 | 0.705734 |
c54051f28e56ff217f2d18a3dd185bda12f50860 | 1,242 | xml | XML | skin.quartz/1080i/DialogKaiToast.xml | mrstealth/kodi-isengard | 2f37ba5320c1618fbe635f5683e7329a63195c16 | [
"MIT"
] | null | null | null | skin.quartz/1080i/DialogKaiToast.xml | mrstealth/kodi-isengard | 2f37ba5320c1618fbe635f5683e7329a63195c16 | [
"MIT"
] | null | null | null | skin.quartz/1080i/DialogKaiToast.xml | mrstealth/kodi-isengard | 2f37ba5320c1618fbe635f5683e7329a63195c16 | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<window type="dialog">
<zorder>2</zorder>
<animation effect="slide" start="0,-150" end="0,0" time="400" easing="inout">WindowOpen</animation>
<animation effect="slide" start="0,0" end="0,-150" time="400" easing="inout">WindowClose</animation>
<controls>
<control type="group">
<control type="image">
<posx>0</posx>
<posy>0</posy>
<width>1920</width>
<height>96</height>
<texture>HUD/Notification.png</texture>
</control>
<control type="label" id="401" description="Heading">
<top>6</top>
<left>0</left>
<width>930</width>
<height>60</height>
<align>right</align>
</control>
<control type="label" description="Spacer">
<top>6</top>
<centerleft>960</centerleft>
<width>40</width>
<height>60</height>
<align>center</align>
<textcolor>HL</textcolor>
<label>•</label>
</control>
<control type="label" id="402" description="Message">
<top>6</top>
<right>0</right>
<width>930</width>
<height>60</height>
<align>left</align>
</control>
</control>
</controls>
</window>
| 30.292683 | 102 | 0.557971 |
c57b4ab9c929ba7e714ec52a699edf9a97312842 | 76 | xml | XML | sample/src/main/res/values/strings.xml | samruston/squigglyspans | 49fd7a3e3b36bbe22a51ff0e0b1a51c6afe2a671 | [
"Apache-2.0"
] | 14 | 2021-02-05T03:42:06.000Z | 2022-02-02T00:14:55.000Z | sample/src/main/res/values/strings.xml | samruston/squigglyspans | 49fd7a3e3b36bbe22a51ff0e0b1a51c6afe2a671 | [
"Apache-2.0"
] | null | null | null | sample/src/main/res/values/strings.xml | samruston/squigglyspans | 49fd7a3e3b36bbe22a51ff0e0b1a51c6afe2a671 | [
"Apache-2.0"
] | null | null | null | <resources>
<string name="app_name">Squiggly Spans</string>
</resources> | 25.333333 | 51 | 0.723684 |
1615824c2f885fa0b2226caceae8888d4df87a6b | 1,963 | xml | XML | code/..data/images/417019441.xml | rrrrhys/blackjack | 800514e54d8392bf335844e724ab8d55dcee8e3d | [
"MIT"
] | 2 | 2020-09-17T23:18:38.000Z | 2020-09-17T23:18:39.000Z | code/..data/images/417019441.xml | rrrrhys/blackjack | 800514e54d8392bf335844e724ab8d55dcee8e3d | [
"MIT"
] | null | null | null | code/..data/images/417019441.xml | rrrrhys/blackjack | 800514e54d8392bf335844e724ab8d55dcee8e3d | [
"MIT"
] | null | null | null | <annotation>
<folder>FOLDER</folder>
<filename>417019441.jpg</filename>
<path>..data/images/417019441.jpg</path>
<source>
<database>Unknown</database>
</source>
<size>
<width>608</width>
<height>608</height>
<depth>3</depth>
</size>
<object>
<name>s05</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>529</xmin>
<ymin>259</ymin>
<xmax>565</xmax>
<ymax>322</ymax>
</bndbox>
</object>
<object>
<name>s05</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>308</xmin>
<ymin>119</ymin>
<xmax>343</xmax>
<ymax>182</ymax>
</bndbox>
</object>
<object>
<name>d02</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>227</xmin>
<ymin>298</ymin>
<xmax>255</xmax>
<ymax>359</ymax>
</bndbox>
</object>
<object>
<name>d02</name>
<pose>Unspecified</pose>
<truncated>0</truncated>
<difficult>0</difficult>
<bndbox>
<xmin>425</xmin>
<ymin>475</ymin>
<xmax>454</xmax>
<ymax>535</ymax>
</bndbox>
</object>
</annotation>
| 31.66129 | 48 | 0.367804 |
5b3f569a5e9b63674ee3131b63354d8db95c4d56 | 868,569 | osm | XML | LShape.osm | nmattise/bldr | a0003d7a6e0aa41c6256033d30c0d9b9bac14f7d | [
"MIT"
] | null | null | null | LShape.osm | nmattise/bldr | a0003d7a6e0aa41c6256033d30c0d9b9bac14f7d | [
"MIT"
] | null | null | null | LShape.osm | nmattise/bldr | a0003d7a6e0aa41c6256033d30c0d9b9bac14f7d | [
"MIT"
] | null | null | null |
OS:Version,
{ed3caba5-6f5a-455d-ad7d-4185758fb636}, !- Handle
1.7.0; !- Version Identifier
OS:BuildingStory,
{dac488e6-c7cf-4ed2-a092-02c13a412deb}, !- Handle
Story 1, !- Name
0, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{3a72332a-07f9-437e-a02e-feee48831931}; !- Group Rendering Name
OS:Space,
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Handle
0 Core Space, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
0, !- Z Origin {m}
{dac488e6-c7cf-4ed2-a092-02c13a412deb}, !- Building Story Name
{cbae8917-ab5f-4689-8533-96e007c32818}; !- Thermal Zone Name
OS:Surface,
{bdf7b8bf-172a-40eb-9983-9029e2dc59e9}, !- Handle
Surface 1, !- Name
Floor, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Ground, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
NoSun, !- Sun Exposure
NoWind, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 4 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 5 {m}
-1.4210854715202e-14, -3.19744231092045e-14, 0; !- X,Y,Z Vertex 6 {m}
OS:Surface,
{f72392e3-2dbe-41e5-aac0-e3362eec1a28}, !- Handle
Surface 2, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{54c42fe8-db56-49b6-9a67-714504982e62}, !- Handle
Surface 3, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fe9e9c78-c5ec-4eb9-932c-17ead1041c3c}, !- Handle
Surface 4, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{96dc9c34-a006-4fc4-b42c-63ccd20833d1}, !- Handle
Surface 5, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{06943104-e806-431b-9d4c-343823802b63}, !- Handle
Surface 6, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2435be26-5b12-4be2-bc49-3593f29b1266}, !- Handle
Surface 7, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9016db2d-3c99-49a5-90b1-ec7d2c63d059}, !- Handle
Surface 8, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0f6fdf86-d82e-41e6-97c8-c4034f34f6b6}, !- Handle
Surface 9, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e62fafea-8a1a-4662-b525-72481ea2f849}, !- Handle
Surface 10, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3d557bbe-028f-400c-8f5c-f91c5bee2008}, !- Handle
Surface 11, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c37e85b4-bcf4-4cfc-a2aa-453b7c147da3}, !- Handle
Surface 12, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a7ed0ef3-9572-4cc3-9642-f39f920ac887}, !- Handle
Surface 13, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{49afede6-1a90-4d53-8c85-9bcb44b7b4b5}, !- Handle
Surface 14, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4f28a0f8-c096-4f19-972a-3fc51b8511dd}, !- Handle
Surface 15, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{501156b4-8c38-4efe-8b9c-ff18f2f2f19f}, !- Handle
Surface 16, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a1ee8347-7227-453d-80d2-9efa85b2ef8f}, !- Handle
Surface 17, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2322ef3a-d459-4ed6-ae62-fdc409b1f3f9}, !- Handle
Surface 18, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c50c9687-c99b-413f-afc3-b5fcd5f54579}, !- Handle
Surface 19, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{cc189c5a-cbeb-420e-9e10-0ed78b6e3ce8}, !- Handle
Surface 20, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bdda574d-b021-47aa-af18-62dadf90a1c8}, !- Handle
Surface 21, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b6cc0ef5-52cc-4201-a792-a3723395f167}, !- Handle
Surface 22, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0a7dfead-f125-4381-8d76-a8dc0f91318c}, !- Handle
Surface 23, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4dae2f51-690d-471c-baab-bfdf0fa0ba6f}, !- Handle
Surface 24, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e574fe34-ffab-4a6d-85a3-59ffa8556870}, !- Handle
Surface 25, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4ac7a7c5-e5ba-48e1-9216-803d6357a50d}, !- Handle
Surface 26, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e61a5e08-86a6-4a2c-ae2b-516d20c29fc3}, !- Handle
Surface 27, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1fd99a32-8176-4f73-905a-c846a5b5302a}, !- Handle
Surface 28, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{97106068-880c-4e81-863f-d883b5f3eb72}, !- Handle
Surface 29, !- Name
Wall, !- Surface Type
, !- Construction Name
{4797ee7f-d404-404f-9a9f-26780013f168}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{b35ab270-6b08-442b-b7d8-27640a041630}, !- Handle
Story 2, !- Name
3.75, !- Nominal Z Coordinate {m}
2.5, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{f65ad43d-a097-415e-820c-5254c4b4ce2c}; !- Group Rendering Name
OS:Space,
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Handle
0 Core Space 1, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
3.75, !- Z Origin {m}
{b35ab270-6b08-442b-b7d8-27640a041630}, !- Building Story Name
{164ffe5d-033c-4a1d-899a-52e7420c8660}; !- Thermal Zone Name
OS:Surface,
{8882907b-64ba-4b23-b573-e5d69b8d9f98}, !- Handle
Surface 32, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 2.5, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4b0aac5d-98f3-48bd-8b2d-28e49ce737e4}, !- Handle
Surface 33, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 2.5, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e78b03bb-0261-45fc-b252-b1ef390485fc}, !- Handle
Surface 34, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 2.5, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9b42f1ec-2e77-4f9c-8dfb-f3904e9b39bd}, !- Handle
Surface 35, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 2.5, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{76fc7c6b-d2bf-4c2e-8011-251892d52768}, !- Handle
Surface 36, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 2.5, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{219aa704-5354-4178-8161-67b5fc97f6ae}, !- Handle
Surface 37, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 2.5, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c526b226-588e-4d92-a069-433b29c8b3c3}, !- Handle
Surface 38, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 2.5, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5c7c47d3-1ebc-4b4b-aa32-8d5627689cb1}, !- Handle
Surface 39, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 2.5, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0a33a0d8-ff64-4988-bfe5-fe65a14b2dc8}, !- Handle
Surface 40, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 2.5, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ca498fb1-3781-453d-a053-b5b08c7240ff}, !- Handle
Surface 41, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 2.5, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{55c98a54-6f16-4201-83f1-8065b3a6df9a}, !- Handle
Surface 42, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 2.5, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2414d9de-df37-4429-8af9-7777fd77137a}, !- Handle
Surface 43, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 2.5, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d4cf876c-59ba-4a5b-a902-c005cb1cb1b3}, !- Handle
Surface 44, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 2.5, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0f35225e-cdba-49dc-aa11-79dbfda16068}, !- Handle
Surface 45, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 2.5, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f5b963d8-38c7-4642-8543-b1f0da11cf63}, !- Handle
Surface 46, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 2.5, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{83d0b76c-9457-4b1f-b806-a13a5452cf26}, !- Handle
Surface 47, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 2.5, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{df0fc3f5-5369-472a-a770-891953ed0fc7}, !- Handle
Surface 48, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 2.5, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{945a8d00-6237-4231-a544-427d18f93dca}, !- Handle
Surface 49, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 2.5, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{093f9e50-8415-4e59-887e-ae33353398d6}, !- Handle
Surface 50, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 2.5, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9d3876c1-3414-4f9b-ad74-e3013b60a782}, !- Handle
Surface 51, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 2.5, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1aa79c2f-7ad1-4f4a-a404-e3171ffb9b89}, !- Handle
Surface 52, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 2.5, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d1622813-7129-467d-9178-297a251095b0}, !- Handle
Surface 53, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 2.5, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f3c24296-dcde-4d3e-b4cd-575c4e9637f1}, !- Handle
Surface 54, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 2.5, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2c0ee4c6-84e9-4ad6-b549-c6a86e46cc69}, !- Handle
Surface 55, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 2.5, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1cd792a3-3533-4191-80b2-a1ec478a71b9}, !- Handle
Surface 56, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 2.5, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{73d3a197-2e1d-4926-981a-1784fa7f8bdd}, !- Handle
Surface 57, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 2.5, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3121b4a4-95df-4e80-b0a3-af21f5517164}, !- Handle
Surface 58, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 2.5, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{16078bf2-6784-42c9-b8c2-1d7510870219}, !- Handle
Surface 59, !- Name
Wall, !- Surface Type
, !- Construction Name
{571c11e8-ca9a-4d1f-bc41-2d8e79cb8f1c}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.43445307406095e-14, -3.2108099134612e-14, 2.5, !- X,Y,Z Vertex 1 {m}
-1.43445307406095e-14, -3.2108099134612e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 2.5; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{339c0ae3-9d6e-4593-9c2b-b8e73961765b}, !- Handle
Sub Surface 1, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{093f9e50-8415-4e59-887e-ae33353398d6}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
64.7510800716917, -48.7651870862429, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
64.7510800716917, -48.7651870862429, 0.0254, !- X,Y,Z Vertex 2 {m}
72.6901450276898, -40.8261221302449, 0.0254, !- X,Y,Z Vertex 3 {m}
72.6901450276898, -40.8261221302449, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{6a54e061-f321-4b5a-aca5-4ad2bda5947d}, !- Handle
Sub Surface 2, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{0a33a0d8-ff64-4988-bfe5-fe65a14b2dc8}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
67.5071640921518, -20.1490162998991, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
67.5071640921518, -20.1490162998991, 0.0254, !- X,Y,Z Vertex 2 {m}
59.4921246251276, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 3 {m}
59.4921246251276, -28.1640557669233, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ddbf91b1-87be-4ca7-affa-1d61b64059b0}, !- Handle
Sub Surface 3, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{0f35225e-cdba-49dc-aa11-79dbfda16068}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
104.590088949619, -8.89025718383162, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
104.590088949619, -8.89025718383162, 0.0254, !- X,Y,Z Vertex 2 {m}
98.1609882826323, -2.4611565168449, 0.0254, !- X,Y,Z Vertex 3 {m}
98.1609882826323, -2.4611565168449, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{b459cb0c-f0f1-4402-8f24-011f0ea5c242}, !- Handle
Sub Surface 4, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{16078bf2-6784-42c9-b8c2-1d7510870219}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
0.0179605122421472, -0.0179605122421471, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
0.0179605122421472, -0.0179605122421471, 0.0254, !- X,Y,Z Vertex 2 {m}
7.07680618512877, -7.07680618512876, 0.0254, !- X,Y,Z Vertex 3 {m}
7.07680618512877, -7.07680618512876, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{e2a8c56f-5423-4cda-9012-9a2751ad05b7}, !- Handle
Sub Surface 5, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{1aa79c2f-7ad1-4f4a-a404-e3171ffb9b89}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
49.681327393839, -49.6813273938382, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
49.681327393839, -49.6813273938382, 0.0254, !- X,Y,Z Vertex 2 {m}
56.7401730667257, -56.7401730667248, 0.0254, !- X,Y,Z Vertex 3 {m}
56.7401730667257, -56.7401730667248, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{105c8cc1-1fb9-4512-be6b-b854c21343c8}, !- Handle
Sub Surface 6, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{1cd792a3-3533-4191-80b2-a1ec478a71b9}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
21.3022606043551, -21.3022606043547, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
21.3022606043551, -21.3022606043547, 0.0254, !- X,Y,Z Vertex 2 {m}
28.3611062772418, -28.3611062772413, 0.0254, !- X,Y,Z Vertex 3 {m}
28.3611062772418, -28.3611062772413, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f1bb4918-74e1-49c8-b0c6-88a41de45a5e}, !- Handle
Sub Surface 7, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{219aa704-5354-4178-8161-67b5fc97f6ae}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
44.8468402019682, -13.5546923682482, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
44.8468402019682, -13.5546923682482, 0.0254, !- X,Y,Z Vertex 2 {m}
37.5780795271148, -6.28593169339485, 0.0254, !- X,Y,Z Vertex 3 {m}
37.5780795271148, -6.28593169339485, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{28974835-3d6a-4aef-af64-b7427e2c4ca9}, !- Handle
Sub Surface 8, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{2414d9de-df37-4429-8af9-7777fd77137a}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
91.660045566677, 4.00386517462606, 2.4489632283292, !- X,Y,Z Vertex 1 {m}
91.660045566677, 4.00386517462606, 0.0254, !- X,Y,Z Vertex 2 {m}
83.6450060996528, -4.01117429239806, 0.0254, !- X,Y,Z Vertex 3 {m}
83.6450060996528, -4.01117429239806, 2.4489632283292; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c1683500-cae0-4be6-aef4-4dd49ce6d3e4}, !- Handle
Sub Surface 9, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{2c0ee4c6-84e9-4ad6-b549-c6a86e46cc69}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
28.3970273017255, -28.397027301726, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
28.3970273017255, -28.397027301726, 0.0254, !- X,Y,Z Vertex 2 {m}
35.4558729746122, -35.4558729746128, 0.0254, !- X,Y,Z Vertex 3 {m}
35.4558729746122, -35.4558729746128, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{57b47036-833a-4b65-a62f-20112d70b195}, !- Handle
Sub Surface 10, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{3121b4a4-95df-4e80-b0a3-af21f5517164}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.11272720961311, -7.11272720961298, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
7.11272720961311, -7.11272720961298, 0.0254, !- X,Y,Z Vertex 2 {m}
14.1715728824999, -14.1715728824996, 0.0254, !- X,Y,Z Vertex 3 {m}
14.1715728824999, -14.1715728824996, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{afe3c01b-b434-42d4-acbb-a737e5f8c309}, !- Handle
Sub Surface 11, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{4b0aac5d-98f3-48bd-8b2d-28e49ce737e4}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
15.6281134046179, 15.6281134046179, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
15.6281134046179, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 2 {m}
7.84099747067211, 7.84099747067213, 0.0254, !- X,Y,Z Vertex 3 {m}
7.84099747067211, 7.84099747067213, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{950db545-86ac-475b-aa01-5a4d8c58e044}, !- Handle
Sub Surface 12, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{55c98a54-6f16-4201-83f1-8065b3a6df9a}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
83.6090850751686, -4.04709531688232, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
83.6090850751686, -4.04709531688232, 0.0254, !- X,Y,Z Vertex 2 {m}
75.5940456081444, -12.0621347839064, 0.0254, !- X,Y,Z Vertex 3 {m}
75.5940456081444, -12.0621347839064, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{61e36445-7a33-4627-a255-c599dbd76586}, !- Handle
Sub Surface 13, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{5c7c47d3-1ebc-4b4b-aa32-8d5627689cb1}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
59.4562036006434, -28.1640557669233, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
59.4562036006434, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 2 {m}
52.18744292579, -20.89529509207, 0.0254, !- X,Y,Z Vertex 3 {m}
52.18744292579, -20.89529509207, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{cda0ce53-8dc0-44a9-8d02-e82853e16d6f}, !- Handle
Sub Surface 14, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{73d3a197-2e1d-4926-981a-1784fa7f8bdd}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
14.2074939069838, -14.2074939069841, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
14.2074939069838, -14.2074939069841, 0.0254, !- X,Y,Z Vertex 2 {m}
21.2663395798706, -21.2663395798708, 0.0254, !- X,Y,Z Vertex 3 {m}
21.2663395798706, -21.2663395798708, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d97c51dd-5e17-47ee-9580-3276ffdc94d7}, !- Handle
Sub Surface 15, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{76fc7c6b-d2bf-4c2e-8011-251892d52768}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
37.5421585026306, -6.25001066891061, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
37.5421585026306, -6.25001066891061, 0.0254, !- X,Y,Z Vertex 2 {m}
30.2733978277773, 1.01875000594275, 0.0254, !- X,Y,Z Vertex 3 {m}
30.2733978277773, 1.01875000594275, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d2d03bc3-0bf1-450d-bfa2-a6ec39c249e1}, !- Handle
Sub Surface 16, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{83d0b76c-9457-4b1f-b806-a13a5452cf26}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
88.6760380131386, -24.8402291447961, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
88.6760380131386, -24.8402291447961, 0.0254, !- X,Y,Z Vertex 2 {m}
96.6151029691367, -16.9011641887981, 0.0254, !- X,Y,Z Vertex 3 {m}
96.6151029691367, -16.9011641887981, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4a4517a5-f9ea-4979-85dc-3a080cfaba2a}, !- Handle
Sub Surface 17, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{8882907b-64ba-4b23-b573-e5d69b8d9f98}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.80507644618784, 7.80507644618784, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
7.80507644618784, 7.80507644618784, 0.0254, !- X,Y,Z Vertex 2 {m}
0.0179605122421167, 0.0179605122421167, 0.0254, !- X,Y,Z Vertex 3 {m}
0.0179605122421167, 0.0179605122421167, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{25d3455e-d289-46ae-b8d8-f7b44e300e03}, !- Handle
Sub Surface 18, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{945a8d00-6237-4231-a544-427d18f93dca}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
72.726066052174, -40.7902011057607, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
72.726066052174, -40.7902011057607, 0.0254, !- X,Y,Z Vertex 2 {m}
80.6651310081721, -32.8511361497626, 0.0254, !- X,Y,Z Vertex 3 {m}
80.6651310081721, -32.8511361497626, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{7a63805a-8c32-4faa-a216-22716c74522f}, !- Handle
Sub Surface 19, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{9b42f1ec-2e77-4f9c-8dfb-f3904e9b39bd}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
30.2374768032931, 1.05467103042699, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
30.2374768032931, 1.05467103042699, 0.0254, !- X,Y,Z Vertex 2 {m}
22.9687161284397, 8.32343170528035, 0.0254, !- X,Y,Z Vertex 3 {m}
22.9687161284397, 8.32343170528035, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f0e017b9-ded0-475d-b05f-24bb3e728af8}, !- Handle
Sub Surface 20, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{9d3876c1-3414-4f9b-ad74-e3013b60a782}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
56.7760940912095, -56.7401730667252, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
56.7760940912095, -56.7401730667252, 0.0254, !- X,Y,Z Vertex 2 {m}
64.7151590472075, -48.8011081107271, 0.0254, !- X,Y,Z Vertex 3 {m}
64.7151590472075, -48.8011081107271, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{7e3cc170-79fd-4552-bcd0-cccd84d3124c}, !- Handle
Sub Surface 21, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c526b226-588e-4d92-a069-433b29c8b3c3}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
52.1515219013058, -20.8593740675858, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
52.1515219013058, -20.8593740675858, 0.0254, !- X,Y,Z Vertex 2 {m}
44.8827612264525, -13.5906133927325, 0.0254, !- X,Y,Z Vertex 3 {m}
44.8827612264525, -13.5906133927325, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{fb581731-93ec-45b1-bdfe-db3b3b788c4e}, !- Handle
Sub Surface 22, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{ca498fb1-3781-453d-a053-b5b08c7240ff}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
75.5581245836602, -12.0980558083907, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
75.5581245836602, -12.0980558083907, 0.0254, !- X,Y,Z Vertex 2 {m}
67.543085116636, -20.1130952754149, 0.0254, !- X,Y,Z Vertex 3 {m}
67.543085116636, -20.1130952754149, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{23aff09a-71c5-4335-9160-a6aed419d6cc}, !- Handle
Sub Surface 23, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{d1622813-7129-467d-9178-297a251095b0}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
42.5865606964676, -42.5865606964676, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
42.5865606964676, -42.5865606964676, 0.0254, !- X,Y,Z Vertex 2 {m}
49.6454063693543, -49.6454063693543, 0.0254, !- X,Y,Z Vertex 3 {m}
49.6454063693543, -49.6454063693543, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ed57ce85-3a17-4ec2-a94d-e2845ada6ba2}, !- Handle
Sub Surface 24, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{d4cf876c-59ba-4a5b-a902-c005cb1cb1b3}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
98.125067258148, -2.42523549236062, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
98.125067258148, -2.42523549236062, 0.0254, !- X,Y,Z Vertex 2 {m}
91.6959665911612, 4.00386517462605, 0.0254, !- X,Y,Z Vertex 3 {m}
91.6959665911612, 4.00386517462605, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d13eb47d-1522-4211-8ca9-e5181a01e57d}, !- Handle
Sub Surface 25, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{df0fc3f5-5369-472a-a770-891953ed0fc7}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
80.7010520326563, -32.8152151252784, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
80.7010520326563, -32.8152151252784, 0.0254, !- X,Y,Z Vertex 2 {m}
88.6401169886544, -24.8761501692803, 0.0254, !- X,Y,Z Vertex 3 {m}
88.6401169886544, -24.8761501692803, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f78eecd0-7da8-4fc3-ae4d-004754d01673}, !- Handle
Sub Surface 26, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{e78b03bb-0261-45fc-b252-b1ef390485fc}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
22.9327951039555, 8.35935272976459, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
22.9327951039555, 8.35935272976459, 0.0254, !- X,Y,Z Vertex 2 {m}
15.6640344291021, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 3 {m}
15.6640344291021, 15.6281134046179, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f0e98b3d-dac9-442e-b1d9-255d9559ff7d}, !- Handle
Sub Surface 27, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{f3c24296-dcde-4d3e-b4cd-575c4e9637f1}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
35.4917939990967, -35.4917939990967, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
35.4917939990967, -35.4917939990967, 0.0254, !- X,Y,Z Vertex 2 {m}
42.5506396719834, -42.5506396719834, 0.0254, !- X,Y,Z Vertex 3 {m}
42.5506396719834, -42.5506396719834, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4f6d0a44-a07f-46cf-92fd-db3ed2039ab0}, !- Handle
Sub Surface 28, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{f5b963d8-38c7-4642-8543-b1f0da11cf63}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
96.6510239936209, -16.8652431643139, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
96.6510239936209, -16.8652431643139, 0.0254, !- X,Y,Z Vertex 2 {m}
104.590088949619, -8.92617820831575, 0.0254, !- X,Y,Z Vertex 3 {m}
104.590088949619, -8.92617820831575, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{4a303b3b-b346-42f4-904f-8ed87c2031aa}, !- Handle
Story 3, !- Name
6.25, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{e3a4314d-23da-4456-9868-49b72ccd632d}; !- Group Rendering Name
OS:Space,
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Handle
0 Core Space 2, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
6.25, !- Z Origin {m}
{4a303b3b-b346-42f4-904f-8ed87c2031aa}, !- Building Story Name
{f920cf53-056f-488a-9a3f-a262ee732231}; !- Thermal Zone Name
OS:Surface,
{9bde7d41-86ca-4bf7-8966-789a02fb9a8e}, !- Handle
Surface 62, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{df49e419-9174-49be-9f11-e83d599595d3}, !- Handle
Surface 63, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ae4978cc-6ed2-48b1-aec1-b66a85b4dc78}, !- Handle
Surface 64, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{975c1443-164d-4c2b-b056-077ca02b0e7c}, !- Handle
Surface 65, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{36626ae2-8ee4-42bc-9ba4-5e8639771ca1}, !- Handle
Surface 66, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d4bd3765-1476-4a9c-a684-29e7e2296458}, !- Handle
Surface 67, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c408fa97-9ddd-47e6-90cc-b65c729b2c74}, !- Handle
Surface 68, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1b4a04db-6f57-4cb1-9c34-21b9b70027c8}, !- Handle
Surface 69, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{df3724e6-88ce-4cf8-91af-f3eaa3b15515}, !- Handle
Surface 70, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8609ff3e-01a7-46f8-b092-9df5356db1b8}, !- Handle
Surface 71, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{80816c70-e51f-48fd-b340-ec54978aab1b}, !- Handle
Surface 72, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{43a2c88a-86be-4706-acc6-54f4a4956d8f}, !- Handle
Surface 73, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e19f1242-38dd-4dd1-83db-668e7471f367}, !- Handle
Surface 74, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{dc90c574-fc53-4c4a-8568-89f3fbecdb15}, !- Handle
Surface 75, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5f8794af-0a18-4711-afbd-fc092c82c8eb}, !- Handle
Surface 76, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f1dcb7be-8031-4d68-8f7f-d3d95af01dd6}, !- Handle
Surface 77, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4403a513-a80a-470c-8830-348e28de0c0f}, !- Handle
Surface 78, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f0ca1e4d-7ad4-4db2-9f41-0253d2b2ec15}, !- Handle
Surface 79, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{00659ba6-b331-4758-a06c-9532c5b244de}, !- Handle
Surface 80, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4c473abf-eb8f-48fa-b92d-31edac10daad}, !- Handle
Surface 81, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0b596d65-fdf4-4044-a730-38c32a371d00}, !- Handle
Surface 82, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ddec1837-d158-43fd-bb24-5ef1401ffb8f}, !- Handle
Surface 83, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6f8782ec-7f9e-4805-a18f-b3aa39791ba9}, !- Handle
Surface 84, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c62a666e-e749-44dc-85b6-9998fd24f643}, !- Handle
Surface 85, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fd0ef877-2368-453a-8567-a5e256386bfa}, !- Handle
Surface 86, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9d7c8053-5188-4481-a397-b2f0ee73664b}, !- Handle
Surface 87, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{385fa6f9-03f7-4312-ad05-5b0d0e60d505}, !- Handle
Surface 88, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e94279a6-1624-417f-b1a5-b0149bd212fb}, !- Handle
Surface 89, !- Name
Wall, !- Surface Type
, !- Construction Name
{0d9843dc-987e-4d31-8f0b-f5ac366381f1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{da420b95-ce72-45db-852f-38c4bea38f73}, !- Handle
Story 4, !- Name
10, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{3e24dc20-e245-4ef3-a768-5a3777c19cdd}; !- Group Rendering Name
OS:Space,
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Handle
1 Core Space, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
10, !- Z Origin {m}
{da420b95-ce72-45db-852f-38c4bea38f73}, !- Building Story Name
{7b1ae352-4877-4a47-b315-a76e2a37d7b2}; !- Thermal Zone Name
OS:Surface,
{62050d54-555f-4f77-93ff-f61ac3e45524}, !- Handle
Surface 92, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8259d190-cb70-44aa-b85a-88b6dce0deb1}, !- Handle
Surface 93, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9aaee171-1f15-44ed-85ad-bfc0a4c60782}, !- Handle
Surface 94, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ca9f169b-0774-4b25-b368-1849fc4179f8}, !- Handle
Surface 95, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{109e72ee-ce02-47de-a3c7-f235b0864705}, !- Handle
Surface 96, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2c256d0b-a4e1-456b-975c-bcbb19d6fdcb}, !- Handle
Surface 97, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{29a934f3-d48e-49ee-9bf3-4019aba35345}, !- Handle
Surface 98, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{427a4059-d3ff-4b42-bf8b-ecb45a4846a0}, !- Handle
Surface 99, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{95809d67-c9c3-4faf-9c2f-68d75e92caf4}, !- Handle
Surface 100, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{dcb0f9ff-2613-4059-a338-11da91cd01f4}, !- Handle
Surface 101, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f3be2fee-f1f3-43d9-a8dc-ff51142229d7}, !- Handle
Surface 102, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9fe8a3c5-22fa-4b2f-8fa3-dc07b75a9837}, !- Handle
Surface 103, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{787a4832-9f8a-462c-9ad9-dc8c5c6bea6a}, !- Handle
Surface 104, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1877f8ce-0079-4286-9bff-a1c9fd0a77d9}, !- Handle
Surface 105, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ee328f72-ecbc-4244-99c6-86f0a3a9ea23}, !- Handle
Surface 106, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4573fa53-a16e-4ae7-95a9-363763fd78f9}, !- Handle
Surface 107, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b3c2ad21-d1ab-48dd-9e29-f7b252998fcb}, !- Handle
Surface 108, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{71c28ca7-f638-4a4e-bff8-90adc2ce9b99}, !- Handle
Surface 109, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{853863b2-8412-412a-bf57-eceae74dca6f}, !- Handle
Surface 110, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7ba3eb71-d06a-4f57-88f8-abaf8a364ddc}, !- Handle
Surface 111, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b2143a5b-9b90-4129-9276-d79871aebcdb}, !- Handle
Surface 112, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{de3195d4-2a4e-45df-aa00-8de068f39487}, !- Handle
Surface 113, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{528ea78d-88b5-4fcf-96f7-03963d3dcf45}, !- Handle
Surface 114, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a5db1860-5676-45b9-b196-d6d81317e36a}, !- Handle
Surface 115, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{27344391-7426-4c3c-8ed5-456cfbbe2188}, !- Handle
Surface 116, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a5501b25-5957-4bc2-8761-a4f59a564077}, !- Handle
Surface 117, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c829c858-5830-4b18-8145-827bbaae7876}, !- Handle
Surface 118, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7e1832ea-068e-427d-beee-bd2d184041c5}, !- Handle
Surface 119, !- Name
Wall, !- Surface Type
, !- Construction Name
{ec39e0e2-d1bf-46db-80f3-f328c2688685}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{d71c4b8f-c1a4-4407-8a2a-3896f014bded}, !- Handle
Story 5, !- Name
13.75, !- Nominal Z Coordinate {m}
2.5, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{7d4c4029-be19-4b39-b0e4-87559fbb0d20}; !- Group Rendering Name
OS:Space,
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Handle
1 Core Space 1, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
13.75, !- Z Origin {m}
{d71c4b8f-c1a4-4407-8a2a-3896f014bded}, !- Building Story Name
{98b6d3f3-d842-4343-8082-0fc26793f5ab}; !- Thermal Zone Name
OS:Surface,
{4e9d5e6d-0b0d-4559-82f8-c62df24bb4eb}, !- Handle
Surface 122, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 2.5, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d6df9589-8da9-46a8-befa-63c7a66ba1a4}, !- Handle
Surface 123, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 2.5, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{53dae5ff-0a20-4045-8a11-58dcb589243b}, !- Handle
Surface 124, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 2.5, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e82ea59b-0c72-463d-8ee9-abd32614c4c0}, !- Handle
Surface 125, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 2.5, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f2eb7b54-725e-4049-a7f3-f2c16800d92e}, !- Handle
Surface 126, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 2.5, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{304ce7a4-ca51-4bee-86ab-e0e417d2cba6}, !- Handle
Surface 127, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 2.5, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c34a4f76-905c-4efa-aaf5-9646aee23a6d}, !- Handle
Surface 128, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 2.5, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5a54a190-b9fd-4d44-b5b6-8b5d5972ba3e}, !- Handle
Surface 129, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 2.5, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c012a3fc-1bbc-4a72-bcfa-6748574ebf3f}, !- Handle
Surface 130, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 2.5, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5942feb1-5ace-4f6e-97c3-6e6260982cfa}, !- Handle
Surface 131, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 2.5, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{13b582fd-f5e7-40b4-a1b2-2cb97b670181}, !- Handle
Surface 132, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 2.5, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{67e214d6-53c2-4503-bfe2-fbe104325634}, !- Handle
Surface 133, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 2.5, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4fdf029e-ee2e-4901-a975-50ad4e17e512}, !- Handle
Surface 134, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 2.5, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fd6ef0ae-c24d-4afb-9888-1952cd034067}, !- Handle
Surface 135, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 2.5, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6f4f7bf6-c879-4b65-a154-4bc1468a3a5e}, !- Handle
Surface 136, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 2.5, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{947e871d-530a-4e7e-befb-68d651d3bb1b}, !- Handle
Surface 137, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 2.5, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3efc5a5f-27a9-42f0-9c0a-1b06a9be199d}, !- Handle
Surface 138, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 2.5, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8b376053-f3a5-4cca-860f-5e135031ddcd}, !- Handle
Surface 139, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 2.5, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7b601797-fd1d-492f-a148-bdbe62e1e111}, !- Handle
Surface 140, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 2.5, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ba36d6ee-50b2-490e-8e31-98ca2b65ef8e}, !- Handle
Surface 141, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 2.5, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e35e7620-9272-4555-9e05-1f10a7706e21}, !- Handle
Surface 142, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 2.5, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a956f884-51ca-4469-b5e2-d3c98c04a963}, !- Handle
Surface 143, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 2.5, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ae863d9c-df6f-450b-9f4c-fcc9e4687ece}, !- Handle
Surface 144, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 2.5, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{12ddf399-a838-488a-a50b-37464ec114e8}, !- Handle
Surface 145, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 2.5, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7c88d111-5745-43a6-9887-73b5fe685d08}, !- Handle
Surface 146, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 2.5, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bd53dcf0-797d-4f81-9f20-0bc4a5b63b51}, !- Handle
Surface 147, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 2.5, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bfef7626-f682-4929-9504-455d54139154}, !- Handle
Surface 148, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 2.5, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{94aa07fe-1d98-4634-b7fd-d3d827b94c10}, !- Handle
Surface 149, !- Name
Wall, !- Surface Type
, !- Construction Name
{4f1240a9-0de7-41f7-ad26-140c362ec422}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.43445307406095e-14, -3.2108099134612e-14, 2.5, !- X,Y,Z Vertex 1 {m}
-1.43445307406095e-14, -3.2108099134612e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 2.5; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{df03a4a4-6ab5-43ce-98c3-f88c9bbb2738}, !- Handle
Sub Surface 29, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{12ddf399-a838-488a-a50b-37464ec114e8}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
28.3970273017255, -28.397027301726, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
28.3970273017255, -28.397027301726, 0.0254, !- X,Y,Z Vertex 2 {m}
35.4558729746122, -35.4558729746128, 0.0254, !- X,Y,Z Vertex 3 {m}
35.4558729746122, -35.4558729746128, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{192fc23d-7a53-4c85-8ff8-d38b3a4f741d}, !- Handle
Sub Surface 30, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{13b582fd-f5e7-40b4-a1b2-2cb97b670181}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
83.6090850751686, -4.04709531688232, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
83.6090850751686, -4.04709531688232, 0.0254, !- X,Y,Z Vertex 2 {m}
75.5940456081444, -12.0621347839064, 0.0254, !- X,Y,Z Vertex 3 {m}
75.5940456081444, -12.0621347839064, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{eea99a10-9556-45d0-ad6b-1ec8c8cd4f95}, !- Handle
Sub Surface 31, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{304ce7a4-ca51-4bee-86ab-e0e417d2cba6}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
44.8468402019682, -13.5546923682482, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
44.8468402019682, -13.5546923682482, 0.0254, !- X,Y,Z Vertex 2 {m}
37.5780795271148, -6.28593169339485, 0.0254, !- X,Y,Z Vertex 3 {m}
37.5780795271148, -6.28593169339485, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{b250b699-4ecb-4d03-89ab-cb54cc12be06}, !- Handle
Sub Surface 32, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{3efc5a5f-27a9-42f0-9c0a-1b06a9be199d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
80.7010520326563, -32.8152151252784, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
80.7010520326563, -32.8152151252784, 0.0254, !- X,Y,Z Vertex 2 {m}
88.6401169886544, -24.8761501692803, 0.0254, !- X,Y,Z Vertex 3 {m}
88.6401169886544, -24.8761501692803, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4840d49c-3994-452d-8f7f-6adca736f89a}, !- Handle
Sub Surface 33, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{4e9d5e6d-0b0d-4559-82f8-c62df24bb4eb}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.80507644618784, 7.80507644618784, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
7.80507644618784, 7.80507644618784, 0.0254, !- X,Y,Z Vertex 2 {m}
0.0179605122421167, 0.0179605122421167, 0.0254, !- X,Y,Z Vertex 3 {m}
0.0179605122421167, 0.0179605122421167, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{291c7489-811a-44ea-90cd-56c53ade9191}, !- Handle
Sub Surface 34, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{4fdf029e-ee2e-4901-a975-50ad4e17e512}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
98.125067258148, -2.42523549236062, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
98.125067258148, -2.42523549236062, 0.0254, !- X,Y,Z Vertex 2 {m}
91.6959665911612, 4.00386517462605, 0.0254, !- X,Y,Z Vertex 3 {m}
91.6959665911612, 4.00386517462605, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{19300d9f-d62d-4b88-b8c6-58f6c3e8e84f}, !- Handle
Sub Surface 35, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{53dae5ff-0a20-4045-8a11-58dcb589243b}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
22.9327951039555, 8.35935272976459, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
22.9327951039555, 8.35935272976459, 0.0254, !- X,Y,Z Vertex 2 {m}
15.6640344291021, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 3 {m}
15.6640344291021, 15.6281134046179, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{2caf6b3c-b51a-4a6d-ad80-7bba150ae9f6}, !- Handle
Sub Surface 36, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{5942feb1-5ace-4f6e-97c3-6e6260982cfa}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
75.5581245836602, -12.0980558083907, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
75.5581245836602, -12.0980558083907, 0.0254, !- X,Y,Z Vertex 2 {m}
67.543085116636, -20.1130952754149, 0.0254, !- X,Y,Z Vertex 3 {m}
67.543085116636, -20.1130952754149, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{70c3dc4e-eb07-4584-ae41-70a5d59ad3c1}, !- Handle
Sub Surface 37, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{5a54a190-b9fd-4d44-b5b6-8b5d5972ba3e}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
59.4562036006434, -28.1640557669233, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
59.4562036006434, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 2 {m}
52.18744292579, -20.89529509207, 0.0254, !- X,Y,Z Vertex 3 {m}
52.18744292579, -20.89529509207, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{6ee23474-c11c-4d6f-ac77-0b5a1139667a}, !- Handle
Sub Surface 38, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{67e214d6-53c2-4503-bfe2-fbe104325634}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
91.660045566677, 4.00386517462606, 2.4489632283292, !- X,Y,Z Vertex 1 {m}
91.660045566677, 4.00386517462606, 0.0254, !- X,Y,Z Vertex 2 {m}
83.6450060996528, -4.01117429239806, 0.0254, !- X,Y,Z Vertex 3 {m}
83.6450060996528, -4.01117429239806, 2.4489632283292; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{3f6a8e8f-f811-4d3f-a71e-7e3471cbf9db}, !- Handle
Sub Surface 39, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{6f4f7bf6-c879-4b65-a154-4bc1468a3a5e}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
96.6510239936209, -16.8652431643139, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
96.6510239936209, -16.8652431643139, 0.0254, !- X,Y,Z Vertex 2 {m}
104.590088949619, -8.92617820831575, 0.0254, !- X,Y,Z Vertex 3 {m}
104.590088949619, -8.92617820831575, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{a68afe47-6ea7-41a7-a10c-953ef8e61672}, !- Handle
Sub Surface 40, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{7b601797-fd1d-492f-a148-bdbe62e1e111}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
64.7510800716917, -48.7651870862429, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
64.7510800716917, -48.7651870862429, 0.0254, !- X,Y,Z Vertex 2 {m}
72.6901450276898, -40.8261221302449, 0.0254, !- X,Y,Z Vertex 3 {m}
72.6901450276898, -40.8261221302449, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d55cbb01-3b92-4eef-ac23-13ed5d980d5b}, !- Handle
Sub Surface 41, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{7c88d111-5745-43a6-9887-73b5fe685d08}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
21.3022606043551, -21.3022606043547, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
21.3022606043551, -21.3022606043547, 0.0254, !- X,Y,Z Vertex 2 {m}
28.3611062772418, -28.3611062772413, 0.0254, !- X,Y,Z Vertex 3 {m}
28.3611062772418, -28.3611062772413, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{a880479d-9dc2-40a0-b7dc-f8c7c85ce63a}, !- Handle
Sub Surface 42, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{8b376053-f3a5-4cca-860f-5e135031ddcd}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
72.726066052174, -40.7902011057607, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
72.726066052174, -40.7902011057607, 0.0254, !- X,Y,Z Vertex 2 {m}
80.6651310081721, -32.8511361497626, 0.0254, !- X,Y,Z Vertex 3 {m}
80.6651310081721, -32.8511361497626, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{0e3d44c9-2f0f-496d-a0eb-5b51f2928896}, !- Handle
Sub Surface 43, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{947e871d-530a-4e7e-befb-68d651d3bb1b}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
88.6760380131386, -24.8402291447961, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
88.6760380131386, -24.8402291447961, 0.0254, !- X,Y,Z Vertex 2 {m}
96.6151029691367, -16.9011641887981, 0.0254, !- X,Y,Z Vertex 3 {m}
96.6151029691367, -16.9011641887981, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{849cc54c-0f6b-412e-87f0-e93512402f4c}, !- Handle
Sub Surface 44, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{94aa07fe-1d98-4634-b7fd-d3d827b94c10}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
0.0179605122421472, -0.0179605122421471, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
0.0179605122421472, -0.0179605122421471, 0.0254, !- X,Y,Z Vertex 2 {m}
7.07680618512877, -7.07680618512876, 0.0254, !- X,Y,Z Vertex 3 {m}
7.07680618512877, -7.07680618512876, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{bd0eb3b0-1681-4a2a-b4a1-9fa13649ea24}, !- Handle
Sub Surface 45, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{a956f884-51ca-4469-b5e2-d3c98c04a963}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
42.5865606964676, -42.5865606964676, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
42.5865606964676, -42.5865606964676, 0.0254, !- X,Y,Z Vertex 2 {m}
49.6454063693543, -49.6454063693543, 0.0254, !- X,Y,Z Vertex 3 {m}
49.6454063693543, -49.6454063693543, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{e38f38d6-4264-40fe-a0a3-0a53835c2e1b}, !- Handle
Sub Surface 46, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{ae863d9c-df6f-450b-9f4c-fcc9e4687ece}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
35.4917939990967, -35.4917939990967, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
35.4917939990967, -35.4917939990967, 0.0254, !- X,Y,Z Vertex 2 {m}
42.5506396719834, -42.5506396719834, 0.0254, !- X,Y,Z Vertex 3 {m}
42.5506396719834, -42.5506396719834, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{2dc5e13d-bfbc-42ec-ae21-4d5eb11f4662}, !- Handle
Sub Surface 47, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{ba36d6ee-50b2-490e-8e31-98ca2b65ef8e}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
56.7760940912095, -56.7401730667252, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
56.7760940912095, -56.7401730667252, 0.0254, !- X,Y,Z Vertex 2 {m}
64.7151590472075, -48.8011081107271, 0.0254, !- X,Y,Z Vertex 3 {m}
64.7151590472075, -48.8011081107271, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{3e7ac6e6-240c-40dd-9b3d-63fe9e69af3c}, !- Handle
Sub Surface 48, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{bd53dcf0-797d-4f81-9f20-0bc4a5b63b51}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
14.2074939069838, -14.2074939069841, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
14.2074939069838, -14.2074939069841, 0.0254, !- X,Y,Z Vertex 2 {m}
21.2663395798706, -21.2663395798708, 0.0254, !- X,Y,Z Vertex 3 {m}
21.2663395798706, -21.2663395798708, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f63a3b46-5c2a-4f8c-9701-8f5d170401f0}, !- Handle
Sub Surface 49, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{bfef7626-f682-4929-9504-455d54139154}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.11272720961311, -7.11272720961298, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
7.11272720961311, -7.11272720961298, 0.0254, !- X,Y,Z Vertex 2 {m}
14.1715728824999, -14.1715728824996, 0.0254, !- X,Y,Z Vertex 3 {m}
14.1715728824999, -14.1715728824996, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{b6069b27-7720-4c1c-9c4a-4e8f1bd97f00}, !- Handle
Sub Surface 50, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c012a3fc-1bbc-4a72-bcfa-6748574ebf3f}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
67.5071640921518, -20.1490162998991, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
67.5071640921518, -20.1490162998991, 0.0254, !- X,Y,Z Vertex 2 {m}
59.4921246251276, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 3 {m}
59.4921246251276, -28.1640557669233, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4f2cfd04-a513-47e4-b1ab-3ae059f92694}, !- Handle
Sub Surface 51, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c34a4f76-905c-4efa-aaf5-9646aee23a6d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
52.1515219013058, -20.8593740675858, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
52.1515219013058, -20.8593740675858, 0.0254, !- X,Y,Z Vertex 2 {m}
44.8827612264525, -13.5906133927325, 0.0254, !- X,Y,Z Vertex 3 {m}
44.8827612264525, -13.5906133927325, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{2f9abbfc-7ea3-4891-aa2e-9ba5483fda12}, !- Handle
Sub Surface 52, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{d6df9589-8da9-46a8-befa-63c7a66ba1a4}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
15.6281134046179, 15.6281134046179, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
15.6281134046179, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 2 {m}
7.84099747067211, 7.84099747067213, 0.0254, !- X,Y,Z Vertex 3 {m}
7.84099747067211, 7.84099747067213, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4e5e5294-3421-4663-9622-99479cad92f4}, !- Handle
Sub Surface 53, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{e35e7620-9272-4555-9e05-1f10a7706e21}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
49.681327393839, -49.6813273938382, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
49.681327393839, -49.6813273938382, 0.0254, !- X,Y,Z Vertex 2 {m}
56.7401730667257, -56.7401730667248, 0.0254, !- X,Y,Z Vertex 3 {m}
56.7401730667257, -56.7401730667248, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{6e5c0710-74e6-4803-a749-751fc67de9a2}, !- Handle
Sub Surface 54, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{e82ea59b-0c72-463d-8ee9-abd32614c4c0}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
30.2374768032931, 1.05467103042699, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
30.2374768032931, 1.05467103042699, 0.0254, !- X,Y,Z Vertex 2 {m}
22.9687161284397, 8.32343170528035, 0.0254, !- X,Y,Z Vertex 3 {m}
22.9687161284397, 8.32343170528035, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{64cdca57-8e30-4a30-b501-ba5febb5275c}, !- Handle
Sub Surface 55, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{f2eb7b54-725e-4049-a7f3-f2c16800d92e}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
37.5421585026306, -6.25001066891061, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
37.5421585026306, -6.25001066891061, 0.0254, !- X,Y,Z Vertex 2 {m}
30.2733978277773, 1.01875000594275, 0.0254, !- X,Y,Z Vertex 3 {m}
30.2733978277773, 1.01875000594275, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{68090b93-e604-4ba1-bbc6-3731a2119dda}, !- Handle
Sub Surface 56, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{fd6ef0ae-c24d-4afb-9888-1952cd034067}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
104.590088949619, -8.89025718383162, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
104.590088949619, -8.89025718383162, 0.0254, !- X,Y,Z Vertex 2 {m}
98.1609882826323, -2.4611565168449, 0.0254, !- X,Y,Z Vertex 3 {m}
98.1609882826323, -2.4611565168449, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{60680538-6a53-4770-a386-33571295dae5}, !- Handle
Story 6, !- Name
16.25, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{7432bc3e-13a1-45a3-a1ba-9c692cf505f8}; !- Group Rendering Name
OS:Space,
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Handle
1 Core Space 2, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
16.25, !- Z Origin {m}
{60680538-6a53-4770-a386-33571295dae5}, !- Building Story Name
{d12de6d0-2bdd-404b-bc71-d921897d3652}; !- Thermal Zone Name
OS:Surface,
{8f203abd-0204-45cf-b873-39a0e2514b25}, !- Handle
Surface 152, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{722d0891-9cca-46e7-be8b-5c8f52357989}, !- Handle
Surface 153, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e635267a-c445-424f-8c42-6cf1f8a43a91}, !- Handle
Surface 154, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{72d888b0-ff29-4ff5-bb3c-6ffb93442e90}, !- Handle
Surface 155, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{65c91fef-ab51-41bc-a02d-eab7e2ad9788}, !- Handle
Surface 156, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5c7fdda4-841d-4bb6-8a35-f5b5571ea591}, !- Handle
Surface 157, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{195325b9-456d-4d6d-985f-80685f1ebda7}, !- Handle
Surface 158, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7786857a-eefd-4ffe-b242-a7193da40dd3}, !- Handle
Surface 159, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b2dab6a0-4d96-4fc2-a1e1-1b6db3819d16}, !- Handle
Surface 160, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{38f4e69e-8a9d-47a6-a448-a847c4923bc2}, !- Handle
Surface 161, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{14535f47-f7d8-4a9a-9a71-b2fc91b4c70a}, !- Handle
Surface 162, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fd007881-6905-4fde-8ea4-1def753f27b3}, !- Handle
Surface 163, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{332df08b-78ae-4adb-ad93-60b5513d4cdd}, !- Handle
Surface 164, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ddf01ac0-62e0-48b4-bd7f-d203735dad65}, !- Handle
Surface 165, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d3253e14-d904-4f65-a1ae-3532386d539d}, !- Handle
Surface 166, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d73819cd-614d-4549-a045-338489e62017}, !- Handle
Surface 167, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{dd04990c-0fb8-4559-83f3-bc0255ad8e37}, !- Handle
Surface 168, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0b499c60-3657-4335-8276-f7f214aff790}, !- Handle
Surface 169, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{46b9af03-b751-4118-91ad-ec8edf020871}, !- Handle
Surface 170, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{46fc7270-1693-419d-9042-ade5fec6d638}, !- Handle
Surface 171, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{cb3c1719-7669-4291-8816-4358dbcee28a}, !- Handle
Surface 172, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9d836faa-9808-4519-a41e-2fded6571a5a}, !- Handle
Surface 173, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d1a66d6f-519d-4139-8444-80891581144c}, !- Handle
Surface 174, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{329ca08a-eae5-46e4-86da-a3277c3a2201}, !- Handle
Surface 175, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bb52903c-d69d-4277-aa9c-ca907e330b83}, !- Handle
Surface 176, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4ad94827-4e05-4d92-8848-beac0c2c194c}, !- Handle
Surface 177, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{572cb01c-bb0f-4784-9387-9c62602b0ec1}, !- Handle
Surface 178, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{80d8b018-0d64-42d2-aa54-a88b933f291a}, !- Handle
Surface 179, !- Name
Wall, !- Surface Type
, !- Construction Name
{2738cdc3-8e19-4aba-8be3-54c045bbea53}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{9c5d1478-7eab-4b4b-a8b1-8a8585027894}, !- Handle
Story 7, !- Name
20, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{7d4f0994-d55b-46f1-90df-b0054a044975}; !- Group Rendering Name
OS:Space,
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Handle
2 Core Space, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
20, !- Z Origin {m}
{9c5d1478-7eab-4b4b-a8b1-8a8585027894}, !- Building Story Name
{dafc4f4f-8afe-45c6-8e8b-f80fbb2bc5f2}; !- Thermal Zone Name
OS:Surface,
{95de335f-9e50-4805-8046-7bf231d07edb}, !- Handle
Surface 182, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{db547e2e-b02b-480c-a3b0-673a4e665a72}, !- Handle
Surface 183, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{30dea01c-772b-4a44-92bf-2c6c59d1307f}, !- Handle
Surface 184, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{821a7905-5420-41d3-8289-2e063122e4b3}, !- Handle
Surface 185, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f3f7f0a7-b406-4173-9c13-27ba7d17ad35}, !- Handle
Surface 186, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0ee4a09f-2810-4505-bdc8-1228c8ea4844}, !- Handle
Surface 187, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9a2c4b52-f100-4e6b-b7dc-6dc68da48cbb}, !- Handle
Surface 188, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2bf24b87-8694-43d3-a2c9-52cefaf10a7e}, !- Handle
Surface 189, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6f77a62e-3502-4ce9-963d-22fa27c9c3ff}, !- Handle
Surface 190, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{38770b25-c653-4322-8ca3-5faf512f1e98}, !- Handle
Surface 191, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b848e436-f69f-46c7-b036-1f6df1d3a79a}, !- Handle
Surface 192, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7e9a6761-14ab-4e25-951b-43f2832f3478}, !- Handle
Surface 193, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{17a73cb8-f06a-4770-b65d-3db944f01f65}, !- Handle
Surface 194, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d2938b06-169f-48a5-a4a5-7d1037d43ac8}, !- Handle
Surface 195, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bc956a56-b058-461f-a97c-81cd71f5004e}, !- Handle
Surface 196, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{060fd9a6-73e4-4203-a95e-e5f0dd6c020a}, !- Handle
Surface 197, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{700a36a6-4e98-4842-a1ca-e0c995bdbc53}, !- Handle
Surface 198, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bced59c6-c280-4962-b556-7c0183f4e57f}, !- Handle
Surface 199, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1258b697-fa57-4461-85f8-129b5bd59099}, !- Handle
Surface 200, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ae119ebb-49a9-4bbf-80ef-77ea4e023fa4}, !- Handle
Surface 201, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{dc3d1833-2a85-4e5e-98f4-678599089a4b}, !- Handle
Surface 202, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b910aae6-a1d6-46e0-b2ef-0160b8dc2d85}, !- Handle
Surface 203, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5048e6af-d942-4ff0-b001-ec065fa4c327}, !- Handle
Surface 204, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bada83ac-84a9-47e8-aceb-c906940defd5}, !- Handle
Surface 205, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{50429b7b-d3ad-4ceb-a2ea-5468f56d3707}, !- Handle
Surface 206, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0305af0f-5240-4e25-8e74-cfda38f34f98}, !- Handle
Surface 207, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c51d8cac-e5f8-47d5-b799-b97022fd1c19}, !- Handle
Surface 208, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d8471626-d9f2-49ba-8cdc-504141e88ff0}, !- Handle
Surface 209, !- Name
Wall, !- Surface Type
, !- Construction Name
{45ea23ac-a36d-4fda-9180-00b43a0c4b5a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{56b2bad2-0a66-420a-b40c-6e3aef638f79}, !- Handle
Story 8, !- Name
23.75, !- Nominal Z Coordinate {m}
2.5, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{a44fbc64-cfe3-4f86-86d6-df0ae9c7b238}; !- Group Rendering Name
OS:Space,
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Handle
2 Core Space 1, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
23.75, !- Z Origin {m}
{56b2bad2-0a66-420a-b40c-6e3aef638f79}, !- Building Story Name
{044e5a07-bfbd-4a18-a3eb-fc6a98cf0269}; !- Thermal Zone Name
OS:Surface,
{fa6e62e3-98e7-4dd2-b847-a762ed51a978}, !- Handle
Surface 212, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 2.5, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d5f4bdc9-622e-4c80-bb7b-3540a1adf0fc}, !- Handle
Surface 213, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 2.5, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{cf33c0b0-6560-4b6f-9f05-163bae65d62f}, !- Handle
Surface 214, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 2.5, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ae06bceb-a262-49c7-9345-2d40dc33eb03}, !- Handle
Surface 215, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 2.5, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f22436cd-5522-4622-ab40-f05540868c51}, !- Handle
Surface 216, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 2.5, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{73ecbf61-dce2-4670-a7be-04fcec918388}, !- Handle
Surface 217, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 2.5, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{47478e4f-79f2-488b-a9bd-665b71f0e72a}, !- Handle
Surface 218, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 2.5, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b54239ba-2f2d-4492-9560-62316d3aebb7}, !- Handle
Surface 219, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 2.5, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{726f5e2a-2c90-44b7-9d4b-7cf90afbd2ba}, !- Handle
Surface 220, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 2.5, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{46f11ea3-d20a-47bd-883c-29405cccb96c}, !- Handle
Surface 221, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 2.5, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a2d92cf6-322d-43c8-b1e3-7a4781534c0b}, !- Handle
Surface 222, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 2.5, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a5a13f18-9e12-478b-8cdb-4d12b8a73431}, !- Handle
Surface 223, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 2.5, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b85f43dd-ce21-43ff-838d-45f13fb422f1}, !- Handle
Surface 224, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 2.5, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a5106f07-40c8-45b6-b144-326ce0e6e516}, !- Handle
Surface 225, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 2.5, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{51a9c89d-6220-4476-be72-a74a4db1035c}, !- Handle
Surface 226, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 2.5, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bfb3a557-4fb7-4e67-8cdd-918b1e49f2d2}, !- Handle
Surface 227, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 2.5, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2319296f-403b-46cf-9121-e3503d3f5db9}, !- Handle
Surface 228, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 2.5, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{216d9ebc-53a0-40d0-a76a-07b5cab3370d}, !- Handle
Surface 229, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 2.5, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0f6f8adb-b86c-42c6-8e67-3b30ef67312d}, !- Handle
Surface 230, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 2.5, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3d68b124-2488-4982-a284-506d553d5988}, !- Handle
Surface 231, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 2.5, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{47281117-43a8-40c4-af99-b7ac6a649269}, !- Handle
Surface 232, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 2.5, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ae620909-6bff-436c-af0b-64c1c41d5b3b}, !- Handle
Surface 233, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 2.5, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e5a90b4b-ee3e-4c09-a2b2-7928132cada5}, !- Handle
Surface 234, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 2.5, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9bab3959-cd14-4401-89ec-5bb7c0fd0134}, !- Handle
Surface 235, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 2.5, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{73f398ee-0a8b-4545-a484-22118f85e269}, !- Handle
Surface 236, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 2.5, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f2d4a192-fd6d-4e4c-b674-3f5ea52838a5}, !- Handle
Surface 237, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 2.5, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{82efd0d9-737d-4b4f-8169-4e366f555299}, !- Handle
Surface 238, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 2.5, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{eba45685-6049-4a89-b7c6-4aee805f92bb}, !- Handle
Surface 239, !- Name
Wall, !- Surface Type
, !- Construction Name
{54807906-95b5-4a3c-af8c-b462c2c09fab}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.43445307406095e-14, -3.2108099134612e-14, 2.5, !- X,Y,Z Vertex 1 {m}
-1.43445307406095e-14, -3.2108099134612e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 2.5; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{5b1e4077-6cb0-4183-ad05-6263ba19f147}, !- Handle
Sub Surface 57, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{0f6f8adb-b86c-42c6-8e67-3b30ef67312d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
64.7510800716917, -48.7651870862429, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
64.7510800716917, -48.7651870862429, 0.0254, !- X,Y,Z Vertex 2 {m}
72.6901450276898, -40.8261221302449, 0.0254, !- X,Y,Z Vertex 3 {m}
72.6901450276898, -40.8261221302449, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{b0f14a67-96e1-4d5a-b4bd-7998ea03a991}, !- Handle
Sub Surface 58, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{216d9ebc-53a0-40d0-a76a-07b5cab3370d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
72.726066052174, -40.7902011057607, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
72.726066052174, -40.7902011057607, 0.0254, !- X,Y,Z Vertex 2 {m}
80.6651310081721, -32.8511361497626, 0.0254, !- X,Y,Z Vertex 3 {m}
80.6651310081721, -32.8511361497626, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{5097f552-27cd-4df3-a76e-002415e86b16}, !- Handle
Sub Surface 59, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{2319296f-403b-46cf-9121-e3503d3f5db9}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
80.7010520326563, -32.8152151252784, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
80.7010520326563, -32.8152151252784, 0.0254, !- X,Y,Z Vertex 2 {m}
88.6401169886544, -24.8761501692803, 0.0254, !- X,Y,Z Vertex 3 {m}
88.6401169886544, -24.8761501692803, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f49017e4-e7b1-4ee1-912d-fa968fcce9e4}, !- Handle
Sub Surface 60, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{3d68b124-2488-4982-a284-506d553d5988}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
56.7760940912095, -56.7401730667252, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
56.7760940912095, -56.7401730667252, 0.0254, !- X,Y,Z Vertex 2 {m}
64.7151590472075, -48.8011081107271, 0.0254, !- X,Y,Z Vertex 3 {m}
64.7151590472075, -48.8011081107271, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ab80b59f-8f06-4dac-af9a-3692d0bf3f40}, !- Handle
Sub Surface 61, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{46f11ea3-d20a-47bd-883c-29405cccb96c}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
75.5581245836602, -12.0980558083907, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
75.5581245836602, -12.0980558083907, 0.0254, !- X,Y,Z Vertex 2 {m}
67.543085116636, -20.1130952754149, 0.0254, !- X,Y,Z Vertex 3 {m}
67.543085116636, -20.1130952754149, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{45177c9d-89a2-496a-81ad-f80ef0500e93}, !- Handle
Sub Surface 62, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{47281117-43a8-40c4-af99-b7ac6a649269}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
49.681327393839, -49.6813273938382, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
49.681327393839, -49.6813273938382, 0.0254, !- X,Y,Z Vertex 2 {m}
56.7401730667257, -56.7401730667248, 0.0254, !- X,Y,Z Vertex 3 {m}
56.7401730667257, -56.7401730667248, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ee0db336-c58b-4395-a6ee-aad9989791c2}, !- Handle
Sub Surface 63, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{47478e4f-79f2-488b-a9bd-665b71f0e72a}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
52.1515219013058, -20.8593740675858, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
52.1515219013058, -20.8593740675858, 0.0254, !- X,Y,Z Vertex 2 {m}
44.8827612264525, -13.5906133927325, 0.0254, !- X,Y,Z Vertex 3 {m}
44.8827612264525, -13.5906133927325, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{b535ed29-782a-48d9-ac34-a4aae0225660}, !- Handle
Sub Surface 64, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{51a9c89d-6220-4476-be72-a74a4db1035c}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
96.6510239936209, -16.8652431643139, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
96.6510239936209, -16.8652431643139, 0.0254, !- X,Y,Z Vertex 2 {m}
104.590088949619, -8.92617820831575, 0.0254, !- X,Y,Z Vertex 3 {m}
104.590088949619, -8.92617820831575, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{fb6361a1-9f86-4d7d-ba1a-1167f6d07bae}, !- Handle
Sub Surface 65, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{726f5e2a-2c90-44b7-9d4b-7cf90afbd2ba}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
67.5071640921518, -20.1490162998991, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
67.5071640921518, -20.1490162998991, 0.0254, !- X,Y,Z Vertex 2 {m}
59.4921246251276, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 3 {m}
59.4921246251276, -28.1640557669233, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{143c83a3-ce6f-4e55-90b9-0607b3c6a5bd}, !- Handle
Sub Surface 66, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{73ecbf61-dce2-4670-a7be-04fcec918388}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
44.8468402019682, -13.5546923682482, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
44.8468402019682, -13.5546923682482, 0.0254, !- X,Y,Z Vertex 2 {m}
37.5780795271148, -6.28593169339485, 0.0254, !- X,Y,Z Vertex 3 {m}
37.5780795271148, -6.28593169339485, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{cd6bcd1f-7e95-4416-9984-54e4e4f8f2dd}, !- Handle
Sub Surface 67, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{73f398ee-0a8b-4545-a484-22118f85e269}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
21.3022606043551, -21.3022606043547, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
21.3022606043551, -21.3022606043547, 0.0254, !- X,Y,Z Vertex 2 {m}
28.3611062772418, -28.3611062772413, 0.0254, !- X,Y,Z Vertex 3 {m}
28.3611062772418, -28.3611062772413, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{27f378a4-168d-4efc-9c33-9af4aa17a698}, !- Handle
Sub Surface 68, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{82efd0d9-737d-4b4f-8169-4e366f555299}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.11272720961311, -7.11272720961298, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
7.11272720961311, -7.11272720961298, 0.0254, !- X,Y,Z Vertex 2 {m}
14.1715728824999, -14.1715728824996, 0.0254, !- X,Y,Z Vertex 3 {m}
14.1715728824999, -14.1715728824996, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d639cf0f-da47-46b2-a613-650ff098c76c}, !- Handle
Sub Surface 69, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{9bab3959-cd14-4401-89ec-5bb7c0fd0134}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
28.3970273017255, -28.397027301726, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
28.3970273017255, -28.397027301726, 0.0254, !- X,Y,Z Vertex 2 {m}
35.4558729746122, -35.4558729746128, 0.0254, !- X,Y,Z Vertex 3 {m}
35.4558729746122, -35.4558729746128, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{cd53f996-4111-401e-be2c-5403eb501ad1}, !- Handle
Sub Surface 70, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{a2d92cf6-322d-43c8-b1e3-7a4781534c0b}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
83.6090850751686, -4.04709531688232, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
83.6090850751686, -4.04709531688232, 0.0254, !- X,Y,Z Vertex 2 {m}
75.5940456081444, -12.0621347839064, 0.0254, !- X,Y,Z Vertex 3 {m}
75.5940456081444, -12.0621347839064, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{94451670-8aca-42ad-b969-efb37c6d99ea}, !- Handle
Sub Surface 71, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{a5106f07-40c8-45b6-b144-326ce0e6e516}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
104.590088949619, -8.89025718383162, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
104.590088949619, -8.89025718383162, 0.0254, !- X,Y,Z Vertex 2 {m}
98.1609882826323, -2.4611565168449, 0.0254, !- X,Y,Z Vertex 3 {m}
98.1609882826323, -2.4611565168449, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{23aec185-ad1b-49ae-8699-dd7e5902464c}, !- Handle
Sub Surface 72, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{a5a13f18-9e12-478b-8cdb-4d12b8a73431}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
91.660045566677, 4.00386517462606, 2.4489632283292, !- X,Y,Z Vertex 1 {m}
91.660045566677, 4.00386517462606, 0.0254, !- X,Y,Z Vertex 2 {m}
83.6450060996528, -4.01117429239806, 0.0254, !- X,Y,Z Vertex 3 {m}
83.6450060996528, -4.01117429239806, 2.4489632283292; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{693ec369-334f-4130-b8b8-7d937be1a868}, !- Handle
Sub Surface 73, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{ae06bceb-a262-49c7-9345-2d40dc33eb03}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
30.2374768032931, 1.05467103042699, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
30.2374768032931, 1.05467103042699, 0.0254, !- X,Y,Z Vertex 2 {m}
22.9687161284397, 8.32343170528035, 0.0254, !- X,Y,Z Vertex 3 {m}
22.9687161284397, 8.32343170528035, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{2faac0a2-b351-404f-a90a-af3527e1bd3d}, !- Handle
Sub Surface 74, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{ae620909-6bff-436c-af0b-64c1c41d5b3b}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
42.5865606964676, -42.5865606964676, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
42.5865606964676, -42.5865606964676, 0.0254, !- X,Y,Z Vertex 2 {m}
49.6454063693543, -49.6454063693543, 0.0254, !- X,Y,Z Vertex 3 {m}
49.6454063693543, -49.6454063693543, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4a7f8777-03e9-4c14-b4b9-272fab565dc2}, !- Handle
Sub Surface 75, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{b54239ba-2f2d-4492-9560-62316d3aebb7}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
59.4562036006434, -28.1640557669233, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
59.4562036006434, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 2 {m}
52.18744292579, -20.89529509207, 0.0254, !- X,Y,Z Vertex 3 {m}
52.18744292579, -20.89529509207, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ff5ae2f2-54bd-4fe3-a6c3-e31179549750}, !- Handle
Sub Surface 76, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{b85f43dd-ce21-43ff-838d-45f13fb422f1}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
98.125067258148, -2.42523549236062, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
98.125067258148, -2.42523549236062, 0.0254, !- X,Y,Z Vertex 2 {m}
91.6959665911612, 4.00386517462605, 0.0254, !- X,Y,Z Vertex 3 {m}
91.6959665911612, 4.00386517462605, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{da72e5ed-32cf-4422-992f-562729a57111}, !- Handle
Sub Surface 77, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{bfb3a557-4fb7-4e67-8cdd-918b1e49f2d2}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
88.6760380131386, -24.8402291447961, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
88.6760380131386, -24.8402291447961, 0.0254, !- X,Y,Z Vertex 2 {m}
96.6151029691367, -16.9011641887981, 0.0254, !- X,Y,Z Vertex 3 {m}
96.6151029691367, -16.9011641887981, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{a713a344-0598-4377-bb9c-025a0514e76e}, !- Handle
Sub Surface 78, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{cf33c0b0-6560-4b6f-9f05-163bae65d62f}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
22.9327951039555, 8.35935272976459, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
22.9327951039555, 8.35935272976459, 0.0254, !- X,Y,Z Vertex 2 {m}
15.6640344291021, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 3 {m}
15.6640344291021, 15.6281134046179, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{888d887e-457c-4467-870c-b0abde852c75}, !- Handle
Sub Surface 79, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{d5f4bdc9-622e-4c80-bb7b-3540a1adf0fc}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
15.6281134046179, 15.6281134046179, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
15.6281134046179, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 2 {m}
7.84099747067211, 7.84099747067213, 0.0254, !- X,Y,Z Vertex 3 {m}
7.84099747067211, 7.84099747067213, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{e0eb0e8a-ca21-4916-953b-e2d1decde8ab}, !- Handle
Sub Surface 80, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{e5a90b4b-ee3e-4c09-a2b2-7928132cada5}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
35.4917939990967, -35.4917939990967, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
35.4917939990967, -35.4917939990967, 0.0254, !- X,Y,Z Vertex 2 {m}
42.5506396719834, -42.5506396719834, 0.0254, !- X,Y,Z Vertex 3 {m}
42.5506396719834, -42.5506396719834, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{9c84827e-0ba0-4e9b-97a7-e9d43789717a}, !- Handle
Sub Surface 81, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{eba45685-6049-4a89-b7c6-4aee805f92bb}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
0.0179605122421472, -0.0179605122421471, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
0.0179605122421472, -0.0179605122421471, 0.0254, !- X,Y,Z Vertex 2 {m}
7.07680618512877, -7.07680618512876, 0.0254, !- X,Y,Z Vertex 3 {m}
7.07680618512877, -7.07680618512876, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c6d936b7-bc06-4263-ace5-13ac398065d3}, !- Handle
Sub Surface 82, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{f22436cd-5522-4622-ab40-f05540868c51}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
37.5421585026306, -6.25001066891061, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
37.5421585026306, -6.25001066891061, 0.0254, !- X,Y,Z Vertex 2 {m}
30.2733978277773, 1.01875000594275, 0.0254, !- X,Y,Z Vertex 3 {m}
30.2733978277773, 1.01875000594275, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{45ee41cd-9e5e-416c-8f4a-16abafc4f61d}, !- Handle
Sub Surface 83, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{f2d4a192-fd6d-4e4c-b674-3f5ea52838a5}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
14.2074939069838, -14.2074939069841, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
14.2074939069838, -14.2074939069841, 0.0254, !- X,Y,Z Vertex 2 {m}
21.2663395798706, -21.2663395798708, 0.0254, !- X,Y,Z Vertex 3 {m}
21.2663395798706, -21.2663395798708, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f11fe79f-59ac-4690-be6f-7c13d4193796}, !- Handle
Sub Surface 84, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{fa6e62e3-98e7-4dd2-b847-a762ed51a978}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.80507644618784, 7.80507644618784, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
7.80507644618784, 7.80507644618784, 0.0254, !- X,Y,Z Vertex 2 {m}
0.0179605122421167, 0.0179605122421167, 0.0254, !- X,Y,Z Vertex 3 {m}
0.0179605122421167, 0.0179605122421167, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{a2a8e6b7-5575-44db-9c2a-c799b1131c96}, !- Handle
Story 9, !- Name
26.25, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{50b21793-7472-497c-9e2a-3c804cc6de0d}; !- Group Rendering Name
OS:Space,
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Handle
2 Core Space 2, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
26.25, !- Z Origin {m}
{a2a8e6b7-5575-44db-9c2a-c799b1131c96}, !- Building Story Name
{9b692068-cc48-4195-9a90-6cc681fb4340}; !- Thermal Zone Name
OS:Surface,
{2badcf54-4a3e-4820-ad4c-3fd180d814b1}, !- Handle
Surface 242, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0b0453c5-8718-411d-9244-a2fdfe8ac4c2}, !- Handle
Surface 243, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{88f593b4-6de0-4cac-9817-7e77da19d18d}, !- Handle
Surface 244, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4d69ae36-0997-40fd-8084-c6e671996f2a}, !- Handle
Surface 245, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4867c269-8406-4ade-b2b2-d7a7807b820b}, !- Handle
Surface 246, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{84a9e65f-09fb-418c-82e7-c9095bb4b5b2}, !- Handle
Surface 247, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3552e96f-91d5-424f-b245-75076dc6ce8e}, !- Handle
Surface 248, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c09ce1bd-2326-43ab-a033-817da77e2603}, !- Handle
Surface 249, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{678a32e1-213e-4513-8022-fb2ae57b1f95}, !- Handle
Surface 250, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8200b055-1471-4af3-ba39-a99f6f9e9858}, !- Handle
Surface 251, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ec834934-fa06-437d-b102-2fb62120f7ae}, !- Handle
Surface 252, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{eca177f3-a568-4bc7-a5ab-afdc65e5e4ef}, !- Handle
Surface 253, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ee34343e-3201-4069-b596-4b4dbea0d71e}, !- Handle
Surface 254, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5000220d-0060-4a81-aa9f-9bbfc826c284}, !- Handle
Surface 255, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{14ec2d87-e23f-477a-a4c0-17e4d078b1f3}, !- Handle
Surface 256, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c64b0ec2-3934-4d9e-b0f6-8a02dc17f27c}, !- Handle
Surface 257, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7496842a-a38c-441c-b29e-359e28a3fdcc}, !- Handle
Surface 258, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0e3de6c9-41ae-4e97-a3fb-900691f372ac}, !- Handle
Surface 259, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7fec1e21-bde1-40e9-aadc-9bc6c4521bed}, !- Handle
Surface 260, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9f05d0e6-3f36-49a9-b24f-7685609596ae}, !- Handle
Surface 261, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{874ee807-734b-4862-b82e-0bbc0e59c048}, !- Handle
Surface 262, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{efa705d8-963d-4f95-b5c2-2ae924b4deb0}, !- Handle
Surface 263, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2d652ae3-95ef-40b8-9067-0368ab5a4e22}, !- Handle
Surface 264, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ed47f7a3-e211-46e3-bf9f-2d01c381ff72}, !- Handle
Surface 265, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{31c4435d-8d4a-4d91-8f91-2d87490874d7}, !- Handle
Surface 266, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bf38e4cc-3e00-4ed6-9106-e2da6011e7cb}, !- Handle
Surface 267, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{24044f58-dbfc-47b6-a70f-e3d8b195dde4}, !- Handle
Surface 268, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{71f0e36b-f6b0-4e66-bc7e-c27467b4c153}, !- Handle
Surface 269, !- Name
Wall, !- Surface Type
, !- Construction Name
{462cfe92-e414-4c5b-b242-a2015e1888b3}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{454d0f13-27b2-47c9-a93e-8a004c979aee}, !- Handle
Story 10, !- Name
30, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{1eb19908-2a44-4b06-b3e3-0487a7da34fa}; !- Group Rendering Name
OS:Space,
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Handle
3 Core Space, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
30, !- Z Origin {m}
{454d0f13-27b2-47c9-a93e-8a004c979aee}, !- Building Story Name
{ca9eedfe-f9f0-4208-ac9d-5aef0b58f49c}; !- Thermal Zone Name
OS:Surface,
{194029ec-ff03-49a7-a384-671cca5d3498}, !- Handle
Surface 272, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fb340467-69d9-4d03-82f0-6995b2e6a53c}, !- Handle
Surface 273, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f0e84e0e-fd75-4445-8cf4-78bf24740e53}, !- Handle
Surface 274, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2a6e91b1-d91e-4485-b192-4945e8dd2fc7}, !- Handle
Surface 275, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{933ac03b-d599-4b1e-bdfd-d5475b3abf5c}, !- Handle
Surface 276, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{add539de-dbf5-4f39-91cb-c58568d2dcf3}, !- Handle
Surface 277, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6afa3214-45da-4606-99ca-df4c77fb29e1}, !- Handle
Surface 278, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d7979bf6-ce76-4013-a17a-65d4ce0c900a}, !- Handle
Surface 279, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{84443b4a-df17-42e7-9b8a-d8c1eda5269b}, !- Handle
Surface 280, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4c69adcd-0674-4b1c-aa3c-46a8d440ee80}, !- Handle
Surface 281, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{20b982ca-34c2-4ef9-807f-47a0e52519ca}, !- Handle
Surface 282, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a71e9cd6-c507-400b-add9-4bcf96ecc0d6}, !- Handle
Surface 283, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e6cf1003-9229-45e7-875d-7dae1615344e}, !- Handle
Surface 284, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{026f8bdb-905b-400e-908b-40ffd94a9dcd}, !- Handle
Surface 285, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{771c9cfd-5532-49e7-b068-dd0cb8e7c9dd}, !- Handle
Surface 286, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1cc4086d-a312-41b3-a930-dcd6555ed743}, !- Handle
Surface 287, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d61c2ba4-3ac2-40d9-99dd-008d338b9ad1}, !- Handle
Surface 288, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d262f00c-0dba-403c-8072-be512832fd4c}, !- Handle
Surface 289, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{62412b1b-6935-4bc7-b932-89e86c4f87b7}, !- Handle
Surface 290, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{aa800c79-abf5-440c-a2e5-301c8cdb97e4}, !- Handle
Surface 291, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8f8f051b-7e25-4b0f-91fc-153724581f18}, !- Handle
Surface 292, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{81437541-76dd-46e9-ac5b-237ad175d87c}, !- Handle
Surface 293, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8965037f-9dd8-4cc8-9d5e-2b56ae39bf51}, !- Handle
Surface 294, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0f3759e2-cf23-4f4d-ac0a-d5947621db6c}, !- Handle
Surface 295, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{94344faf-f6ee-4dae-890e-ae0457ca0496}, !- Handle
Surface 296, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{12ef5813-4b6b-4fe7-856e-eb53ac2bddc3}, !- Handle
Surface 297, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{91b91f5d-48a4-46b9-9ba9-a017862e7039}, !- Handle
Surface 298, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ccca6fd9-f969-4af5-abe8-559824bd1e59}, !- Handle
Surface 299, !- Name
Wall, !- Surface Type
, !- Construction Name
{5a1de241-30f7-4c84-9b5c-fe57b9817725}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{dc7e0cb0-4335-4379-8817-eefafc0bfde9}, !- Handle
Story 11, !- Name
33.75, !- Nominal Z Coordinate {m}
2.5, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{b2a3a71e-0fe5-4bfa-afa4-d8de0b2ddd29}; !- Group Rendering Name
OS:Space,
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Handle
3 Core Space 1, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
33.75, !- Z Origin {m}
{dc7e0cb0-4335-4379-8817-eefafc0bfde9}, !- Building Story Name
{9fbdefda-041c-43c6-89dd-dccc5d048445}; !- Thermal Zone Name
OS:Surface,
{0ba5682e-e804-4e2c-bbdc-c318cc091561}, !- Handle
Surface 302, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 2.5, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e4c0ed1c-8bb3-4dce-b80a-c17436f07bfb}, !- Handle
Surface 303, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 2.5, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fd0995ae-185c-43b5-b068-f8e1f9a1119d}, !- Handle
Surface 304, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 2.5, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{490ce0af-3d8c-4ef4-84c9-ad2730fd338f}, !- Handle
Surface 305, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 2.5, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{26309499-3618-4353-a63b-a55e53cf5be8}, !- Handle
Surface 306, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 2.5, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{54f36def-7383-45f2-abfd-edf5e3388906}, !- Handle
Surface 307, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 2.5, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{28fb3e3e-f573-467d-bfb0-c660ebe93640}, !- Handle
Surface 308, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 2.5, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{28a6812a-dd17-4f08-a743-e7a71576e509}, !- Handle
Surface 309, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 2.5, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1866a6de-7233-4697-846d-78e950a90b1d}, !- Handle
Surface 310, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 2.5, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b13a0159-c36d-49b3-ad75-06de384cde3d}, !- Handle
Surface 311, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 2.5, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{719ba3a4-ff3d-4ad1-921d-984cff0d8cf5}, !- Handle
Surface 312, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 2.5, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{393721d5-45d2-4b59-ac93-2b9e1eaaa641}, !- Handle
Surface 313, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 2.5, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{430477fa-1cf0-4e91-944f-1424a48662d0}, !- Handle
Surface 314, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 2.5, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5b7d5457-86b2-4680-9774-9d14ac84b346}, !- Handle
Surface 315, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 2.5, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{90d15287-8fb9-4907-ab1a-a05c9769200c}, !- Handle
Surface 316, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 2.5, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bc0237e6-edf7-4b03-a858-fbc400b3b0db}, !- Handle
Surface 317, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 2.5, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{430757c8-53c2-49b4-b893-77827e64c4c9}, !- Handle
Surface 318, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 2.5, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{65f1e0e7-679c-4508-8bc9-02c09d724c32}, !- Handle
Surface 319, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 2.5, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b4e0d250-0d78-4500-8831-b500caca3949}, !- Handle
Surface 320, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 2.5, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{34a8b36c-1cc1-4912-b7f5-e67ca40959b8}, !- Handle
Surface 321, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 2.5, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c0b5d76e-2487-46ba-9c10-de3cf1707910}, !- Handle
Surface 322, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 2.5, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{93566c73-82de-46e5-939a-520564e8982b}, !- Handle
Surface 323, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 2.5, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c752b63c-a2e2-495e-bbc3-13a5482848d8}, !- Handle
Surface 324, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 2.5, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0a65413d-7911-4a99-8a8c-975f62ff259f}, !- Handle
Surface 325, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 2.5, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8f0fb987-ff66-495e-aaec-d6f616060444}, !- Handle
Surface 326, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 2.5, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0556ee1e-4bcb-4f48-8efa-cea4f94e5d69}, !- Handle
Surface 327, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 2.5, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c3ca00e3-c434-4fcd-a8e5-ce95bc6b675a}, !- Handle
Surface 328, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 2.5, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{37cd4ed9-0ccb-4fd6-bd2f-7fd5422d047d}, !- Handle
Surface 329, !- Name
Wall, !- Surface Type
, !- Construction Name
{e91ef600-27f2-4488-bcba-59c698dab4ac}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.43445307406095e-14, -3.2108099134612e-14, 2.5, !- X,Y,Z Vertex 1 {m}
-1.43445307406095e-14, -3.2108099134612e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 2.5; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ea3e8be2-a8c2-42e9-957c-bc9f1782abee}, !- Handle
Sub Surface 85, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{0556ee1e-4bcb-4f48-8efa-cea4f94e5d69}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
14.2074939069838, -14.2074939069841, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
14.2074939069838, -14.2074939069841, 0.0254, !- X,Y,Z Vertex 2 {m}
21.2663395798706, -21.2663395798708, 0.0254, !- X,Y,Z Vertex 3 {m}
21.2663395798706, -21.2663395798708, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{aab23df2-c6b6-4726-bf0e-c34977b15c75}, !- Handle
Sub Surface 86, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{0a65413d-7911-4a99-8a8c-975f62ff259f}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
28.3970273017255, -28.397027301726, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
28.3970273017255, -28.397027301726, 0.0254, !- X,Y,Z Vertex 2 {m}
35.4558729746122, -35.4558729746128, 0.0254, !- X,Y,Z Vertex 3 {m}
35.4558729746122, -35.4558729746128, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{2fa2d289-6a22-4423-9eaa-ee099827edfe}, !- Handle
Sub Surface 87, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{0ba5682e-e804-4e2c-bbdc-c318cc091561}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.80507644618784, 7.80507644618784, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
7.80507644618784, 7.80507644618784, 0.0254, !- X,Y,Z Vertex 2 {m}
0.0179605122421167, 0.0179605122421167, 0.0254, !- X,Y,Z Vertex 3 {m}
0.0179605122421167, 0.0179605122421167, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c933af24-0bae-4e54-9879-23577831a6bb}, !- Handle
Sub Surface 88, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{1866a6de-7233-4697-846d-78e950a90b1d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
67.5071640921518, -20.1490162998991, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
67.5071640921518, -20.1490162998991, 0.0254, !- X,Y,Z Vertex 2 {m}
59.4921246251276, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 3 {m}
59.4921246251276, -28.1640557669233, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{7d399aaf-3eb3-4196-9eaa-faa3e05c84dc}, !- Handle
Sub Surface 89, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{26309499-3618-4353-a63b-a55e53cf5be8}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
37.5421585026306, -6.25001066891061, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
37.5421585026306, -6.25001066891061, 0.0254, !- X,Y,Z Vertex 2 {m}
30.2733978277773, 1.01875000594275, 0.0254, !- X,Y,Z Vertex 3 {m}
30.2733978277773, 1.01875000594275, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{3f46ff2c-9e0d-429a-9955-4693f6a904cf}, !- Handle
Sub Surface 90, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{28a6812a-dd17-4f08-a743-e7a71576e509}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
59.4562036006434, -28.1640557669233, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
59.4562036006434, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 2 {m}
52.18744292579, -20.89529509207, 0.0254, !- X,Y,Z Vertex 3 {m}
52.18744292579, -20.89529509207, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d0fbbc1a-42ef-45da-8049-3d5becd5a2b8}, !- Handle
Sub Surface 91, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{28fb3e3e-f573-467d-bfb0-c660ebe93640}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
52.1515219013058, -20.8593740675858, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
52.1515219013058, -20.8593740675858, 0.0254, !- X,Y,Z Vertex 2 {m}
44.8827612264525, -13.5906133927325, 0.0254, !- X,Y,Z Vertex 3 {m}
44.8827612264525, -13.5906133927325, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4e4ffedf-c8d6-41c3-b787-a45a8d537790}, !- Handle
Sub Surface 92, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{34a8b36c-1cc1-4912-b7f5-e67ca40959b8}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
56.7760940912095, -56.7401730667252, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
56.7760940912095, -56.7401730667252, 0.0254, !- X,Y,Z Vertex 2 {m}
64.7151590472075, -48.8011081107271, 0.0254, !- X,Y,Z Vertex 3 {m}
64.7151590472075, -48.8011081107271, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{cb6338be-543e-4dd4-8db6-6e1965532165}, !- Handle
Sub Surface 93, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{37cd4ed9-0ccb-4fd6-bd2f-7fd5422d047d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
0.0179605122421472, -0.0179605122421471, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
0.0179605122421472, -0.0179605122421471, 0.0254, !- X,Y,Z Vertex 2 {m}
7.07680618512877, -7.07680618512876, 0.0254, !- X,Y,Z Vertex 3 {m}
7.07680618512877, -7.07680618512876, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{839c4dd4-a0cd-4a94-929d-e5bee82e0c0d}, !- Handle
Sub Surface 94, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{393721d5-45d2-4b59-ac93-2b9e1eaaa641}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
91.660045566677, 4.00386517462606, 2.4489632283292, !- X,Y,Z Vertex 1 {m}
91.660045566677, 4.00386517462606, 0.0254, !- X,Y,Z Vertex 2 {m}
83.6450060996528, -4.01117429239806, 0.0254, !- X,Y,Z Vertex 3 {m}
83.6450060996528, -4.01117429239806, 2.4489632283292; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4925db21-d7f0-462b-820a-8c991e828712}, !- Handle
Sub Surface 95, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{430477fa-1cf0-4e91-944f-1424a48662d0}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
98.125067258148, -2.42523549236062, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
98.125067258148, -2.42523549236062, 0.0254, !- X,Y,Z Vertex 2 {m}
91.6959665911612, 4.00386517462605, 0.0254, !- X,Y,Z Vertex 3 {m}
91.6959665911612, 4.00386517462605, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{3ecb56ec-9cf9-4c6f-b6d4-b1822254a38b}, !- Handle
Sub Surface 96, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{430757c8-53c2-49b4-b893-77827e64c4c9}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
80.7010520326563, -32.8152151252784, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
80.7010520326563, -32.8152151252784, 0.0254, !- X,Y,Z Vertex 2 {m}
88.6401169886544, -24.8761501692803, 0.0254, !- X,Y,Z Vertex 3 {m}
88.6401169886544, -24.8761501692803, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{9561a53d-dad1-48cb-a10f-c07b4581fef6}, !- Handle
Sub Surface 97, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{490ce0af-3d8c-4ef4-84c9-ad2730fd338f}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
30.2374768032931, 1.05467103042699, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
30.2374768032931, 1.05467103042699, 0.0254, !- X,Y,Z Vertex 2 {m}
22.9687161284397, 8.32343170528035, 0.0254, !- X,Y,Z Vertex 3 {m}
22.9687161284397, 8.32343170528035, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{254534b6-434c-47f7-b060-5c9edac6461f}, !- Handle
Sub Surface 98, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{54f36def-7383-45f2-abfd-edf5e3388906}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
44.8468402019682, -13.5546923682482, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
44.8468402019682, -13.5546923682482, 0.0254, !- X,Y,Z Vertex 2 {m}
37.5780795271148, -6.28593169339485, 0.0254, !- X,Y,Z Vertex 3 {m}
37.5780795271148, -6.28593169339485, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c60aba11-5205-4438-a4db-c587e555d024}, !- Handle
Sub Surface 99, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{5b7d5457-86b2-4680-9774-9d14ac84b346}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
104.590088949619, -8.89025718383162, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
104.590088949619, -8.89025718383162, 0.0254, !- X,Y,Z Vertex 2 {m}
98.1609882826323, -2.4611565168449, 0.0254, !- X,Y,Z Vertex 3 {m}
98.1609882826323, -2.4611565168449, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{3f7773dd-e7cb-4309-b558-96c42ae7f8b4}, !- Handle
Sub Surface 100, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{65f1e0e7-679c-4508-8bc9-02c09d724c32}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
72.726066052174, -40.7902011057607, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
72.726066052174, -40.7902011057607, 0.0254, !- X,Y,Z Vertex 2 {m}
80.6651310081721, -32.8511361497626, 0.0254, !- X,Y,Z Vertex 3 {m}
80.6651310081721, -32.8511361497626, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{2cd23d72-1321-487e-bae5-385391bbb603}, !- Handle
Sub Surface 101, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{719ba3a4-ff3d-4ad1-921d-984cff0d8cf5}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
83.6090850751686, -4.04709531688232, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
83.6090850751686, -4.04709531688232, 0.0254, !- X,Y,Z Vertex 2 {m}
75.5940456081444, -12.0621347839064, 0.0254, !- X,Y,Z Vertex 3 {m}
75.5940456081444, -12.0621347839064, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c68cfc38-84aa-4bf2-b637-70e0a88f1993}, !- Handle
Sub Surface 102, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{8f0fb987-ff66-495e-aaec-d6f616060444}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
21.3022606043551, -21.3022606043547, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
21.3022606043551, -21.3022606043547, 0.0254, !- X,Y,Z Vertex 2 {m}
28.3611062772418, -28.3611062772413, 0.0254, !- X,Y,Z Vertex 3 {m}
28.3611062772418, -28.3611062772413, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{19d95012-924b-4738-8915-adcd8bb3e6b6}, !- Handle
Sub Surface 103, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{90d15287-8fb9-4907-ab1a-a05c9769200c}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
96.6510239936209, -16.8652431643139, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
96.6510239936209, -16.8652431643139, 0.0254, !- X,Y,Z Vertex 2 {m}
104.590088949619, -8.92617820831575, 0.0254, !- X,Y,Z Vertex 3 {m}
104.590088949619, -8.92617820831575, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{bb85feaf-649f-4f5f-ac5f-e7285261a377}, !- Handle
Sub Surface 104, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{93566c73-82de-46e5-939a-520564e8982b}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
42.5865606964676, -42.5865606964676, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
42.5865606964676, -42.5865606964676, 0.0254, !- X,Y,Z Vertex 2 {m}
49.6454063693543, -49.6454063693543, 0.0254, !- X,Y,Z Vertex 3 {m}
49.6454063693543, -49.6454063693543, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f24b68bf-59b2-41fc-9400-c3d291624468}, !- Handle
Sub Surface 105, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{b13a0159-c36d-49b3-ad75-06de384cde3d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
75.5581245836602, -12.0980558083907, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
75.5581245836602, -12.0980558083907, 0.0254, !- X,Y,Z Vertex 2 {m}
67.543085116636, -20.1130952754149, 0.0254, !- X,Y,Z Vertex 3 {m}
67.543085116636, -20.1130952754149, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{85fdd331-c5a6-46ca-b721-73832ff2c318}, !- Handle
Sub Surface 106, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{b4e0d250-0d78-4500-8831-b500caca3949}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
64.7510800716917, -48.7651870862429, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
64.7510800716917, -48.7651870862429, 0.0254, !- X,Y,Z Vertex 2 {m}
72.6901450276898, -40.8261221302449, 0.0254, !- X,Y,Z Vertex 3 {m}
72.6901450276898, -40.8261221302449, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d20e6045-d851-4850-8d4e-bd7c0104dccf}, !- Handle
Sub Surface 107, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{bc0237e6-edf7-4b03-a858-fbc400b3b0db}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
88.6760380131386, -24.8402291447961, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
88.6760380131386, -24.8402291447961, 0.0254, !- X,Y,Z Vertex 2 {m}
96.6151029691367, -16.9011641887981, 0.0254, !- X,Y,Z Vertex 3 {m}
96.6151029691367, -16.9011641887981, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{1f15390e-770e-450d-bbc9-4de171498aec}, !- Handle
Sub Surface 108, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c0b5d76e-2487-46ba-9c10-de3cf1707910}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
49.681327393839, -49.6813273938382, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
49.681327393839, -49.6813273938382, 0.0254, !- X,Y,Z Vertex 2 {m}
56.7401730667257, -56.7401730667248, 0.0254, !- X,Y,Z Vertex 3 {m}
56.7401730667257, -56.7401730667248, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{38a4d1c9-f511-403a-b10e-f661210d3828}, !- Handle
Sub Surface 109, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c3ca00e3-c434-4fcd-a8e5-ce95bc6b675a}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.11272720961311, -7.11272720961298, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
7.11272720961311, -7.11272720961298, 0.0254, !- X,Y,Z Vertex 2 {m}
14.1715728824999, -14.1715728824996, 0.0254, !- X,Y,Z Vertex 3 {m}
14.1715728824999, -14.1715728824996, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{d76e5b33-b299-48cd-955d-15d5aba596d4}, !- Handle
Sub Surface 110, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c752b63c-a2e2-495e-bbc3-13a5482848d8}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
35.4917939990967, -35.4917939990967, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
35.4917939990967, -35.4917939990967, 0.0254, !- X,Y,Z Vertex 2 {m}
42.5506396719834, -42.5506396719834, 0.0254, !- X,Y,Z Vertex 3 {m}
42.5506396719834, -42.5506396719834, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{8dc3db46-d140-4fed-9fed-fcb4ae6fd915}, !- Handle
Sub Surface 111, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{e4c0ed1c-8bb3-4dce-b80a-c17436f07bfb}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
15.6281134046179, 15.6281134046179, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
15.6281134046179, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 2 {m}
7.84099747067211, 7.84099747067213, 0.0254, !- X,Y,Z Vertex 3 {m}
7.84099747067211, 7.84099747067213, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c7cc701b-7567-4f24-9a86-32b29701129a}, !- Handle
Sub Surface 112, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{fd0995ae-185c-43b5-b068-f8e1f9a1119d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
22.9327951039555, 8.35935272976459, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
22.9327951039555, 8.35935272976459, 0.0254, !- X,Y,Z Vertex 2 {m}
15.6640344291021, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 3 {m}
15.6640344291021, 15.6281134046179, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{d804b9b0-94e7-431e-ba89-961d7b10b21b}, !- Handle
Story 12, !- Name
36.25, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{33ca113c-b065-465a-88b4-7fdf089503f5}; !- Group Rendering Name
OS:Space,
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Handle
3 Core Space 2, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
36.25, !- Z Origin {m}
{d804b9b0-94e7-431e-ba89-961d7b10b21b}, !- Building Story Name
{738a93b1-4c5d-4d0c-ad69-59ecf0073bb7}; !- Thermal Zone Name
OS:Surface,
{ec14ef9c-d305-4a46-abd2-a0b77c052b9c}, !- Handle
Surface 332, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{32730261-608d-483d-a5c0-2aeb441310de}, !- Handle
Surface 333, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ef6ab41b-a245-41ea-9ae7-f104fafea14a}, !- Handle
Surface 334, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{2ac1573e-d423-46c5-b8de-cd0465e8f095}, !- Handle
Surface 335, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{100a3c01-5ea3-459d-ad10-6a70686a10f1}, !- Handle
Surface 336, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b5bd035f-c520-451b-b36f-a80ee10e38e4}, !- Handle
Surface 337, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{364db45d-556a-450f-8bcf-551372c76da7}, !- Handle
Surface 338, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d6426998-0789-4cb5-8e86-d52ea0c8277f}, !- Handle
Surface 339, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6484474c-4a9f-42f7-9815-882592862df4}, !- Handle
Surface 340, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{984735ab-2bc8-42c2-a207-a007f1eefcb6}, !- Handle
Surface 341, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{713f9e89-5d21-48c0-945c-d15087f82bd6}, !- Handle
Surface 342, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{82b04d78-079c-42f9-8ae4-93cd8a5e8073}, !- Handle
Surface 343, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{367d65b0-7702-4e36-ab1f-12babf964102}, !- Handle
Surface 344, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a3fa0aa6-d1e0-40f2-82ec-c33eeb9a864d}, !- Handle
Surface 345, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{41c1b183-4373-4c48-972f-3abd46206a49}, !- Handle
Surface 346, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1c2a6d55-4fa6-4dc4-b50f-8bee635ff361}, !- Handle
Surface 347, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{56ab76b9-efd1-4730-b117-af1c539e4df2}, !- Handle
Surface 348, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d1a15f4b-ae49-44c8-b7f3-61a86d370975}, !- Handle
Surface 349, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f9742271-bdfa-4ded-a23c-76e7aa9bb4d2}, !- Handle
Surface 350, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{431c240a-9fe9-4c0d-b7b8-67462b8704c6}, !- Handle
Surface 351, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8d435f71-6926-41de-aced-bb96c3fc2cd6}, !- Handle
Surface 352, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6af8a18f-c33a-41ba-84c6-d28eb14a8d1b}, !- Handle
Surface 353, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{eed7f008-9cad-4ab1-a7dc-4d09b5c01a00}, !- Handle
Surface 354, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c1305a1b-4337-4523-90a1-bd4b80573f2d}, !- Handle
Surface 355, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{57677328-abe1-4000-b748-1cae3a82ee34}, !- Handle
Surface 356, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bfa52142-ea71-4874-bcc7-95041d81d63e}, !- Handle
Surface 357, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{544a0bd9-6170-4c50-b6fd-f61161858868}, !- Handle
Surface 358, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{39a3cc31-3e55-4bee-b671-1d0bf310f79f}, !- Handle
Surface 359, !- Name
Wall, !- Surface Type
, !- Construction Name
{208fc051-64a6-4e86-a8e9-387b038da299}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{aecc37ac-af34-411b-a76c-a863d12104f2}, !- Handle
Story 13, !- Name
40, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{edebb6b3-1b6c-49bb-a572-e9268317c20f}; !- Group Rendering Name
OS:Space,
{068137c8-9c73-4317-975e-2c598761c72e}, !- Handle
4 Core Space, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
40, !- Z Origin {m}
{aecc37ac-af34-411b-a76c-a863d12104f2}, !- Building Story Name
{f8cb6b18-9deb-4bdd-aeb7-984111dede65}; !- Thermal Zone Name
OS:Surface,
{033cc5f8-a937-47f8-8b24-82e55f380919}, !- Handle
Surface 362, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{58c5ad92-136c-408d-b9f6-09d09ad613a2}, !- Handle
Surface 363, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3124a37c-c19c-4081-ae13-d9eff2a4786c}, !- Handle
Surface 364, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c381a8cf-28a7-4021-b25a-b6547ae38e85}, !- Handle
Surface 365, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a219c908-b747-4491-a739-748079ae0a89}, !- Handle
Surface 366, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c489b188-6e76-4700-91a5-300fe20df6ec}, !- Handle
Surface 367, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{73ae930d-1ef7-4c2a-8867-f5f4cf947883}, !- Handle
Surface 368, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4f23f47f-a899-457f-948b-99f2944b7edb}, !- Handle
Surface 369, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5b834b79-181f-4cca-a6c1-09b842ee5a27}, !- Handle
Surface 370, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0b721206-8d54-4a73-9688-e8f4bf905c1e}, !- Handle
Surface 371, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{08c24246-964f-4e71-8002-405783f3a6e4}, !- Handle
Surface 372, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6772d590-a8e7-4d3a-be8e-85eddaa6aa42}, !- Handle
Surface 373, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3ec32d8f-4b31-4523-8908-dab738d1bba1}, !- Handle
Surface 374, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b6106347-44b5-4b88-9d02-b8fc351925a2}, !- Handle
Surface 375, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ee12e9df-1f46-4ede-b78d-5bed5269e9d2}, !- Handle
Surface 376, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{75367fd6-d0ab-4299-aaef-4f0a6581db18}, !- Handle
Surface 377, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9a1a329a-94b1-4068-aed4-ff260f319d85}, !- Handle
Surface 378, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a35910f9-6379-4bd0-a354-08ecabab2466}, !- Handle
Surface 379, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{13caffb0-a574-4074-95c0-e880feba8e5e}, !- Handle
Surface 380, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{571a65d4-0a78-4264-a4b8-047eb2e42e59}, !- Handle
Surface 381, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e2e28dc9-9925-45d0-84a7-ca713be56c2a}, !- Handle
Surface 382, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a184db62-1b3e-4c83-8540-ab016c0d7809}, !- Handle
Surface 383, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{35598e29-8456-46b4-a8e6-3eaf5a1a0aca}, !- Handle
Surface 384, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{863fca47-ceaf-4ee3-8c5b-712af64a5fc8}, !- Handle
Surface 385, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a929c75b-d041-4ace-bd08-423f6a58bd46}, !- Handle
Surface 386, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e9cab850-0dec-48a8-b8e6-33ef6d7cb5c8}, !- Handle
Surface 387, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{46247946-7281-4157-aa2e-b09da049f141}, !- Handle
Surface 388, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6cf4e502-8b94-4b6c-8447-941a2449e6ee}, !- Handle
Surface 389, !- Name
Wall, !- Surface Type
, !- Construction Name
{068137c8-9c73-4317-975e-2c598761c72e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{0c326c50-1b24-411f-b44b-ffab1c37193f}, !- Handle
Story 14, !- Name
43.75, !- Nominal Z Coordinate {m}
2.5, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{277a878d-730b-48cc-869a-5e5d7b3f363a}; !- Group Rendering Name
OS:Space,
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Handle
4 Core Space 1, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
43.75, !- Z Origin {m}
{0c326c50-1b24-411f-b44b-ffab1c37193f}, !- Building Story Name
{eedf7d3c-d949-479d-a778-d3fc1108b17b}; !- Thermal Zone Name
OS:Surface,
{1c17b362-468b-42e0-bbcb-192776ff33f1}, !- Handle
Surface 392, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 2.5, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.46699093194433e-14, -3.15153685049632e-14, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b03cb684-2b36-4ada-8abb-21590e9616e2}, !- Handle
Surface 393, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 2.5, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ef68619b-d967-47f3-80d1-7f54bb64313c}, !- Handle
Surface 394, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 2.5, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9806ca68-c238-4025-abc3-709b79353d63}, !- Handle
Surface 395, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 2.5, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{26c90a1c-2f71-4968-abce-d9f088bbbbd9}, !- Handle
Surface 396, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 2.5, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{3cc37232-3096-4b97-a882-dafa62c40c06}, !- Handle
Surface 397, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 2.5, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c4aca2c9-69ea-4035-97df-4e657f4cad39}, !- Handle
Surface 398, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 2.5, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f4e4c427-6d3a-4879-aceb-50d971e4cf26}, !- Handle
Surface 399, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 2.5, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{96033517-545f-4553-8664-05ea6db3eced}, !- Handle
Surface 400, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 2.5, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{cf9b5d6a-9b30-45c4-952d-d9e1b1785780}, !- Handle
Surface 401, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 2.5, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{eaa6296f-2250-4781-8f08-4dbcf21ad8af}, !- Handle
Surface 402, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 2.5, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{60cc9e46-6877-4947-8ce4-425b12734b6f}, !- Handle
Surface 403, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 2.5, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{4d7f810e-3083-4fa0-b909-5e1f35cd5f0b}, !- Handle
Surface 404, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 2.5, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a9843fe5-e0f0-43e0-983c-849c229b7e7c}, !- Handle
Surface 405, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 2.5, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f0f5f0e7-15a6-4b9c-9790-31331f443c9e}, !- Handle
Surface 406, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 2.5, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{54706484-1acc-4a8c-868d-98c50d84e4a5}, !- Handle
Surface 407, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 2.5, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{c41f5042-6f1e-42ee-81eb-3c2ab6cfeda5}, !- Handle
Surface 408, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 2.5, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{73725577-7825-45f8-a3db-52295981531d}, !- Handle
Surface 409, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 2.5, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{e3fe5426-1957-47d1-9143-a006825f74b3}, !- Handle
Surface 410, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 2.5, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9e6277b7-338e-4a73-9061-684aa39f2aa6}, !- Handle
Surface 411, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 2.5, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5a067155-41b8-4039-8aa2-ca1e651790be}, !- Handle
Surface 412, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 2.5, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{93265fdd-d043-44d9-acf6-206f48860b68}, !- Handle
Surface 413, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 2.5, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fbfc5cc4-d648-4df1-8fd5-44d17c8e8766}, !- Handle
Surface 414, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 2.5, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{fab80349-35be-4558-a332-bcee2fefef8d}, !- Handle
Surface 415, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 2.5, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8c550be8-65eb-4f7f-90c6-5753ababac53}, !- Handle
Surface 416, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 2.5, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{dd8053f2-ae48-40c0-9ac3-26e4493088c1}, !- Handle
Surface 417, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 2.5, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{eb494f1b-e4a9-4456-a87a-fc934ed123e5}, !- Handle
Surface 418, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 2.5, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 2.5; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{61970278-5245-4d55-ba86-a2a883f3a891}, !- Handle
Surface 419, !- Name
Wall, !- Surface Type
, !- Construction Name
{ebd949dd-6fc6-4690-a778-704e2ac8402a}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.43445307406095e-14, -3.2108099134612e-14, 2.5, !- X,Y,Z Vertex 1 {m}
-1.43445307406095e-14, -3.2108099134612e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 2.5; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{8e9e39ff-4063-4997-aebe-191963d1c037}, !- Handle
Sub Surface 113, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{1c17b362-468b-42e0-bbcb-192776ff33f1}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.80507644618784, 7.80507644618784, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
7.80507644618784, 7.80507644618784, 0.0254, !- X,Y,Z Vertex 2 {m}
0.0179605122421167, 0.0179605122421167, 0.0254, !- X,Y,Z Vertex 3 {m}
0.0179605122421167, 0.0179605122421167, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{a87f2b99-682f-4a4a-9e86-2262cd7a2fb5}, !- Handle
Sub Surface 114, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{26c90a1c-2f71-4968-abce-d9f088bbbbd9}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
37.5421585026306, -6.25001066891061, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
37.5421585026306, -6.25001066891061, 0.0254, !- X,Y,Z Vertex 2 {m}
30.2733978277773, 1.01875000594275, 0.0254, !- X,Y,Z Vertex 3 {m}
30.2733978277773, 1.01875000594275, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{02c487b0-006d-4c64-89de-c2f3551b9de6}, !- Handle
Sub Surface 115, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{3cc37232-3096-4b97-a882-dafa62c40c06}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
44.8468402019682, -13.5546923682482, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
44.8468402019682, -13.5546923682482, 0.0254, !- X,Y,Z Vertex 2 {m}
37.5780795271148, -6.28593169339485, 0.0254, !- X,Y,Z Vertex 3 {m}
37.5780795271148, -6.28593169339485, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{dba0ca38-d650-4a70-b81c-c1fea387b229}, !- Handle
Sub Surface 116, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{4d7f810e-3083-4fa0-b909-5e1f35cd5f0b}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
98.125067258148, -2.42523549236061, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
98.125067258148, -2.42523549236061, 0.0254, !- X,Y,Z Vertex 2 {m}
91.6959665911612, 4.00386517462604, 0.0254, !- X,Y,Z Vertex 3 {m}
91.6959665911612, 4.00386517462604, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{5491b2a8-696c-47d9-a481-0d0b587d8ed0}, !- Handle
Sub Surface 117, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{54706484-1acc-4a8c-868d-98c50d84e4a5}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
88.6760380131386, -24.8402291447961, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
88.6760380131386, -24.8402291447961, 0.0254, !- X,Y,Z Vertex 2 {m}
96.6151029691367, -16.9011641887981, 0.0254, !- X,Y,Z Vertex 3 {m}
96.6151029691367, -16.9011641887981, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{2aec9fec-480b-4645-926f-cda29728c5d0}, !- Handle
Sub Surface 118, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{5a067155-41b8-4039-8aa2-ca1e651790be}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
49.681327393839, -49.6813273938382, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
49.681327393839, -49.6813273938382, 0.0254, !- X,Y,Z Vertex 2 {m}
56.7401730667257, -56.7401730667248, 0.0254, !- X,Y,Z Vertex 3 {m}
56.7401730667257, -56.7401730667248, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{e73ad47c-ff41-4c88-bd80-e883aeba603a}, !- Handle
Sub Surface 119, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{60cc9e46-6877-4947-8ce4-425b12734b6f}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
91.660045566677, 4.00386517462606, 2.4489632283292, !- X,Y,Z Vertex 1 {m}
91.660045566677, 4.00386517462606, 0.0254, !- X,Y,Z Vertex 2 {m}
83.6450060996528, -4.01117429239806, 0.0254, !- X,Y,Z Vertex 3 {m}
83.6450060996528, -4.01117429239806, 2.4489632283292; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{7f0aa5b3-fcd9-475c-9a2b-243d66074d1b}, !- Handle
Sub Surface 120, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{61970278-5245-4d55-ba86-a2a883f3a891}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
0.0179605122421472, -0.0179605122421471, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
0.0179605122421472, -0.0179605122421471, 0.0254, !- X,Y,Z Vertex 2 {m}
7.07680618512877, -7.07680618512876, 0.0254, !- X,Y,Z Vertex 3 {m}
7.07680618512877, -7.07680618512876, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{aa6dcbfe-8240-4504-8ac3-899a4aba6145}, !- Handle
Sub Surface 121, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{73725577-7825-45f8-a3db-52295981531d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
72.726066052174, -40.7902011057607, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
72.726066052174, -40.7902011057607, 0.0254, !- X,Y,Z Vertex 2 {m}
80.6651310081721, -32.8511361497626, 0.0254, !- X,Y,Z Vertex 3 {m}
80.6651310081721, -32.8511361497626, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{19e05703-d9db-45df-b545-2af64ebbf998}, !- Handle
Sub Surface 122, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{8c550be8-65eb-4f7f-90c6-5753ababac53}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
21.3022606043551, -21.3022606043547, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
21.3022606043551, -21.3022606043547, 0.0254, !- X,Y,Z Vertex 2 {m}
28.3611062772418, -28.3611062772413, 0.0254, !- X,Y,Z Vertex 3 {m}
28.3611062772418, -28.3611062772413, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{4d844118-25f9-44cb-8809-95ffa6dbc4d1}, !- Handle
Sub Surface 123, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{93265fdd-d043-44d9-acf6-206f48860b68}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
42.5865606964676, -42.5865606964676, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
42.5865606964676, -42.5865606964676, 0.0254, !- X,Y,Z Vertex 2 {m}
49.6454063693543, -49.6454063693543, 0.0254, !- X,Y,Z Vertex 3 {m}
49.6454063693543, -49.6454063693543, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{1a284e52-9eab-467d-a8a3-1368bb1570cc}, !- Handle
Sub Surface 124, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{96033517-545f-4553-8664-05ea6db3eced}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
67.5071640921518, -20.1490162998991, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
67.5071640921518, -20.1490162998991, 0.0254, !- X,Y,Z Vertex 2 {m}
59.4921246251276, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 3 {m}
59.4921246251276, -28.1640557669233, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{8930c405-98c7-4759-b6a1-f374630adc05}, !- Handle
Sub Surface 125, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{9806ca68-c238-4025-abc3-709b79353d63}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
30.2374768032931, 1.05467103042699, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
30.2374768032931, 1.05467103042699, 0.0254, !- X,Y,Z Vertex 2 {m}
22.9687161284397, 8.32343170528035, 0.0254, !- X,Y,Z Vertex 3 {m}
22.9687161284397, 8.32343170528035, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c4983f5d-9bf5-48dd-a125-97a1fa3d8cbc}, !- Handle
Sub Surface 126, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{9e6277b7-338e-4a73-9061-684aa39f2aa6}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
56.7760940912095, -56.7401730667252, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
56.7760940912095, -56.7401730667252, 0.0254, !- X,Y,Z Vertex 2 {m}
64.7151590472075, -48.8011081107271, 0.0254, !- X,Y,Z Vertex 3 {m}
64.7151590472075, -48.8011081107271, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ab1222cf-6e8d-4181-9935-5730cb8ed940}, !- Handle
Sub Surface 127, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{a9843fe5-e0f0-43e0-983c-849c229b7e7c}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
104.590088949619, -8.89025718383162, 2.45163064936508, !- X,Y,Z Vertex 1 {m}
104.590088949619, -8.89025718383162, 0.0254, !- X,Y,Z Vertex 2 {m}
98.1609882826323, -2.4611565168449, 0.0254, !- X,Y,Z Vertex 3 {m}
98.1609882826323, -2.4611565168449, 2.45163064936508; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{521d0418-1a2f-42b9-ad48-87d0939c3220}, !- Handle
Sub Surface 128, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{b03cb684-2b36-4ada-8abb-21590e9616e2}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
15.6281134046179, 15.6281134046179, 2.44927972409293, !- X,Y,Z Vertex 1 {m}
15.6281134046179, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 2 {m}
7.84099747067211, 7.84099747067213, 0.0254, !- X,Y,Z Vertex 3 {m}
7.84099747067211, 7.84099747067213, 2.44927972409293; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{f0e9e8fe-12b6-4b90-bbc1-9c52680761c2}, !- Handle
Sub Surface 129, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c41f5042-6f1e-42ee-81eb-3c2ab6cfeda5}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
80.7010520326563, -32.8152151252784, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
80.7010520326563, -32.8152151252784, 0.0254, !- X,Y,Z Vertex 2 {m}
88.6401169886544, -24.8761501692803, 0.0254, !- X,Y,Z Vertex 3 {m}
88.6401169886544, -24.8761501692803, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ff09711e-d46c-4388-89b4-5ca542316aa4}, !- Handle
Sub Surface 130, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{c4aca2c9-69ea-4035-97df-4e657f4cad39}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
52.1515219013058, -20.8593740675858, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
52.1515219013058, -20.8593740675858, 0.0254, !- X,Y,Z Vertex 2 {m}
44.8827612264525, -13.5906133927325, 0.0254, !- X,Y,Z Vertex 3 {m}
44.8827612264525, -13.5906133927325, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{379a15db-8c12-4fa1-bf86-c34f5d17b0d4}, !- Handle
Sub Surface 131, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{cf9b5d6a-9b30-45c4-952d-d9e1b1785780}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
75.5581245836602, -12.0980558083907, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
75.5581245836602, -12.0980558083907, 0.0254, !- X,Y,Z Vertex 2 {m}
67.543085116636, -20.1130952754149, 0.0254, !- X,Y,Z Vertex 3 {m}
67.543085116636, -20.1130952754149, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{0d245f9a-e41f-4ef0-8b6c-78b77f74fd8e}, !- Handle
Sub Surface 132, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{dd8053f2-ae48-40c0-9ac3-26e4493088c1}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
14.2074939069838, -14.2074939069841, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
14.2074939069838, -14.2074939069841, 0.0254, !- X,Y,Z Vertex 2 {m}
21.2663395798706, -21.2663395798708, 0.0254, !- X,Y,Z Vertex 3 {m}
21.2663395798706, -21.2663395798708, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{c669374c-34f1-4855-b0e7-6bddbae4ac5d}, !- Handle
Sub Surface 133, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{e3fe5426-1957-47d1-9143-a006825f74b3}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
64.7510800716917, -48.7651870862429, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
64.7510800716917, -48.7651870862429, 0.0254, !- X,Y,Z Vertex 2 {m}
72.6901450276898, -40.8261221302449, 0.0254, !- X,Y,Z Vertex 3 {m}
72.6901450276898, -40.8261221302449, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{23294400-a028-450a-b7ae-16535a340bab}, !- Handle
Sub Surface 134, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{eaa6296f-2250-4781-8f08-4dbcf21ad8af}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
83.6090850751686, -4.04709531688232, 2.44896322832919, !- X,Y,Z Vertex 1 {m}
83.6090850751686, -4.04709531688232, 0.0254, !- X,Y,Z Vertex 2 {m}
75.5940456081444, -12.0621347839064, 0.0254, !- X,Y,Z Vertex 3 {m}
75.5940456081444, -12.0621347839064, 2.44896322832919; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ca46c826-a6ff-4fb4-b46e-b3afab3322e2}, !- Handle
Sub Surface 135, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{eb494f1b-e4a9-4456-a87a-fc934ed123e5}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
7.11272720961311, -7.11272720961298, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
7.11272720961311, -7.11272720961298, 0.0254, !- X,Y,Z Vertex 2 {m}
14.1715728824999, -14.1715728824996, 0.0254, !- X,Y,Z Vertex 3 {m}
14.1715728824999, -14.1715728824996, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{81a3230d-ac67-410c-84cc-d11666a62edc}, !- Handle
Sub Surface 136, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{ef68619b-d967-47f3-80d1-7f54bb64313c}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
22.9327951039555, 8.35935272976459, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
22.9327951039555, 8.35935272976459, 0.0254, !- X,Y,Z Vertex 2 {m}
15.6640344291021, 15.6281134046179, 0.0254, !- X,Y,Z Vertex 3 {m}
15.6640344291021, 15.6281134046179, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{db937b0e-72b6-4c4b-9acf-3fa6f158912e}, !- Handle
Sub Surface 137, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{f0f5f0e7-15a6-4b9c-9790-31331f443c9e}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
96.6510239936209, -16.8652431643139, 2.44906670773634, !- X,Y,Z Vertex 1 {m}
96.6510239936209, -16.8652431643139, 0.0254, !- X,Y,Z Vertex 2 {m}
104.590088949619, -8.92617820831576, 0.0254, !- X,Y,Z Vertex 3 {m}
104.590088949619, -8.92617820831576, 2.44906670773634; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{59cd848a-b3ba-4a90-af14-29c54f2e9b33}, !- Handle
Sub Surface 138, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{f4e4c427-6d3a-4879-aceb-50d971e4cf26}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
59.4562036006434, -28.1640557669233, 2.45007341524247, !- X,Y,Z Vertex 1 {m}
59.4562036006434, -28.1640557669233, 0.0254, !- X,Y,Z Vertex 2 {m}
52.18744292579, -20.89529509207, 0.0254, !- X,Y,Z Vertex 3 {m}
52.18744292579, -20.89529509207, 2.45007341524247; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{ffec3d81-d331-47b4-9ddf-90655663541d}, !- Handle
Sub Surface 139, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{fab80349-35be-4558-a332-bcee2fefef8d}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
28.3970273017255, -28.397027301726, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
28.3970273017255, -28.397027301726, 0.0254, !- X,Y,Z Vertex 2 {m}
35.4558729746122, -35.4558729746128, 0.0254, !- X,Y,Z Vertex 3 {m}
35.4558729746122, -35.4558729746128, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:SubSurface,
{1d603268-03f1-4657-8950-9051ceb22e2a}, !- Handle
Sub Surface 140, !- Name
FixedWindow, !- Sub Surface Type
, !- Construction Name
{fbfc5cc4-d648-4df1-8fd5-44d17c8e8766}, !- Surface Name
, !- Outside Boundary Condition Object
, !- View Factor to Ground
, !- Shading Control Name
, !- Frame and Divider Name
, !- Multiplier
, !- Number of Vertices
35.4917939990967, -35.4917939990967, 2.45042799215916, !- X,Y,Z Vertex 1 {m}
35.4917939990967, -35.4917939990967, 0.0254, !- X,Y,Z Vertex 2 {m}
42.5506396719834, -42.5506396719834, 0.0254, !- X,Y,Z Vertex 3 {m}
42.5506396719834, -42.5506396719834, 2.45042799215916; !- X,Y,Z Vertex 4 {m}
OS:BuildingStory,
{3f6f0a63-7cdd-47f4-aaf1-fd85fd9fa11e}, !- Handle
Story 15, !- Name
46.25, !- Nominal Z Coordinate {m}
3.75, !- Nominal Floor to Floor Height {m}
, !- Default Construction Set Name
, !- Default Schedule Set Name
{29d6c8fd-ced9-4d3f-a19b-c802cecd8ba7}; !- Group Rendering Name
OS:Space,
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Handle
4 Core Space 2, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
46.25, !- Z Origin {m}
{3f6f0a63-7cdd-47f4-aaf1-fd85fd9fa11e}, !- Building Story Name
{c5877681-30f0-47f1-bd04-71012d656448}; !- Thermal Zone Name
OS:Surface,
{cfb1f54c-6b37-4290-8b02-90bb64d49d98}, !- Handle
Surface 422, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.82303695842999, 7.82303695842997, 3.75, !- X,Y,Z Vertex 1 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 2 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 0, !- X,Y,Z Vertex 3 {m}
-1.39042066291924e-14, -3.22810711952141e-14, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{6403410b-dc6f-42f2-a08d-4d2c7dd6cecb}, !- Handle
Surface 423, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
15.64607391686, 15.64607391686, 3.75, !- X,Y,Z Vertex 1 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0, !- X,Y,Z Vertex 3 {m}
7.82303695842999, 7.82303695842997, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8a012e7a-7a6e-492c-8f19-2be36ca60077}, !- Handle
Surface 424, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
22.9507556161976, 8.34139221752247, 3.75, !- X,Y,Z Vertex 1 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 2 {m}
15.64607391686, 15.64607391686, 0, !- X,Y,Z Vertex 3 {m}
15.64607391686, 15.64607391686, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{73a88dc6-c28c-4d07-a252-d9955cd30c4d}, !- Handle
Surface 425, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
30.2554373155352, 1.03671051818487, 3.75, !- X,Y,Z Vertex 1 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 2 {m}
22.9507556161976, 8.34139221752247, 0, !- X,Y,Z Vertex 3 {m}
22.9507556161976, 8.34139221752247, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{1d5bff29-a168-41bb-8ee8-dcd8d6eed4c2}, !- Handle
Surface 426, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
37.5601190148727, -6.26797118115273, 3.75, !- X,Y,Z Vertex 1 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 2 {m}
30.2554373155352, 1.03671051818487, 0, !- X,Y,Z Vertex 3 {m}
30.2554373155352, 1.03671051818487, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{9d876874-75e1-46b0-9547-085d1171865c}, !- Handle
Surface 427, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
44.8648007142103, -13.5726528804903, 3.75, !- X,Y,Z Vertex 1 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 2 {m}
37.5601190148727, -6.26797118115273, 0, !- X,Y,Z Vertex 3 {m}
37.5601190148727, -6.26797118115273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{ec1b75bf-5188-4fe7-92d6-8ca2e69c85da}, !- Handle
Surface 428, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
52.1694824135479, -20.8773345798279, 3.75, !- X,Y,Z Vertex 1 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 2 {m}
44.8648007142103, -13.5726528804903, 0, !- X,Y,Z Vertex 3 {m}
44.8648007142103, -13.5726528804903, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{05e47f96-b506-47a9-846b-f0b4d0e57cd7}, !- Handle
Surface 429, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
59.4741641128855, -28.1820162791654, 3.75, !- X,Y,Z Vertex 1 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 2 {m}
52.1694824135479, -20.8773345798279, 0, !- X,Y,Z Vertex 3 {m}
52.1694824135479, -20.8773345798279, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0882d66a-574c-4efd-b2ee-3963476161db}, !- Handle
Surface 430, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
67.5251246043939, -20.131055787657, 3.75, !- X,Y,Z Vertex 1 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 2 {m}
59.4741641128855, -28.1820162791654, 0, !- X,Y,Z Vertex 3 {m}
59.4741641128855, -28.1820162791654, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{d994c7c9-698a-4076-a59b-c657ae801c3d}, !- Handle
Surface 431, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
75.5760850959023, -12.0800952961486, 3.75, !- X,Y,Z Vertex 1 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 2 {m}
67.5251246043939, -20.131055787657, 0, !- X,Y,Z Vertex 3 {m}
67.5251246043939, -20.131055787657, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{33ad36e5-73aa-494a-9868-120ab3f4c925}, !- Handle
Surface 432, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
83.6270455874107, -4.0291348046402, 3.75, !- X,Y,Z Vertex 1 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 2 {m}
75.5760850959023, -12.0800952961486, 0, !- X,Y,Z Vertex 3 {m}
75.5760850959023, -12.0800952961486, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f3c36dcb-fff7-4bb9-9506-4d9e8d1de4f4}, !- Handle
Surface 433, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
91.6780060789191, 4.02182568686818, 3.75, !- X,Y,Z Vertex 1 {m}
91.6780060789191, 4.02182568686818, 0, !- X,Y,Z Vertex 2 {m}
83.6270455874107, -4.0291348046402, 0, !- X,Y,Z Vertex 3 {m}
83.6270455874107, -4.0291348046402, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a7d808ea-5c56-497d-950c-61a40cebca96}, !- Handle
Surface 434, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
98.1430277703901, -2.44319600460273, 3.75, !- X,Y,Z Vertex 1 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 2 {m}
91.6780060789191, 4.02182568686817, 0, !- X,Y,Z Vertex 3 {m}
91.6780060789191, 4.02182568686817, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7d69e93f-397e-4ee3-ba84-4be293d5ce77}, !- Handle
Surface 435, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
104.608049461861, -8.90821769607368, 3.75, !- X,Y,Z Vertex 1 {m}
104.608049461861, -8.90821769607368, 0, !- X,Y,Z Vertex 2 {m}
98.1430277703901, -2.44319600460273, 0, !- X,Y,Z Vertex 3 {m}
98.1430277703901, -2.44319600460273, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7382f4a8-7bbb-4950-85dc-ccdbfe94d1b4}, !- Handle
Surface 436, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
96.6330634813788, -16.883203676556, 3.75, !- X,Y,Z Vertex 1 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 2 {m}
104.608049461861, -8.90821769607369, 0, !- X,Y,Z Vertex 3 {m}
104.608049461861, -8.90821769607369, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{5f00488e-170c-4d58-abd0-0efd25b30ca1}, !- Handle
Surface 437, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
88.6580775008965, -24.8581896570382, 3.75, !- X,Y,Z Vertex 1 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 2 {m}
96.6330634813788, -16.883203676556, 0, !- X,Y,Z Vertex 3 {m}
96.6330634813788, -16.883203676556, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{7dd1ede2-2085-4a4f-85c7-eb46c9d5389d}, !- Handle
Surface 438, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
80.6830915204142, -32.8331756375205, 3.75, !- X,Y,Z Vertex 1 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 2 {m}
88.6580775008965, -24.8581896570382, 0, !- X,Y,Z Vertex 3 {m}
88.6580775008965, -24.8581896570382, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{61f9a5a4-633e-4781-a0c9-00de27e0ccce}, !- Handle
Surface 439, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
72.7081055399319, -40.8081616180028, 3.75, !- X,Y,Z Vertex 1 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 2 {m}
80.6830915204142, -32.8331756375205, 0, !- X,Y,Z Vertex 3 {m}
80.6830915204142, -32.8331756375205, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{8d7d8f89-516d-4116-af9e-e67439581695}, !- Handle
Surface 440, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
64.7331195594496, -48.783147598485, 3.75, !- X,Y,Z Vertex 1 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 2 {m}
72.7081055399319, -40.8081616180028, 0, !- X,Y,Z Vertex 3 {m}
72.7081055399319, -40.8081616180028, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{48957cab-7269-46b8-839c-1a5e2efbdb83}, !- Handle
Surface 441, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
56.7581335789674, -56.7581335789673, 3.75, !- X,Y,Z Vertex 1 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 2 {m}
64.7331195594496, -48.783147598485, 0, !- X,Y,Z Vertex 3 {m}
64.7331195594496, -48.783147598485, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{89c9eb4c-f52d-4a08-a7e3-12e10a5ae97d}, !- Handle
Surface 442, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
49.6633668815964, -49.6633668815964, 3.75, !- X,Y,Z Vertex 1 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 2 {m}
56.7581335789674, -56.7581335789673, 0, !- X,Y,Z Vertex 3 {m}
56.7581335789674, -56.7581335789673, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{a94ea94e-9c25-48fc-9f21-6ac49a6c5670}, !- Handle
Surface 443, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
42.5686001842255, -42.5686001842255, 3.75, !- X,Y,Z Vertex 1 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 2 {m}
49.6633668815964, -49.6633668815964, 0, !- X,Y,Z Vertex 3 {m}
49.6633668815964, -49.6633668815964, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{f52d6f42-cc5e-49f6-beff-088bc4ec2474}, !- Handle
Surface 444, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
35.4738334868546, -35.4738334868546, 3.75, !- X,Y,Z Vertex 1 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 2 {m}
42.5686001842255, -42.5686001842255, 0, !- X,Y,Z Vertex 3 {m}
42.5686001842255, -42.5686001842255, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{b3514917-9d9e-4cf6-b182-e4090e3b3b56}, !- Handle
Surface 445, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
28.3790667894837, -28.3790667894836, 3.75, !- X,Y,Z Vertex 1 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 2 {m}
35.4738334868546, -35.4738334868546, 0, !- X,Y,Z Vertex 3 {m}
35.4738334868546, -35.4738334868546, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{db81302c-b665-44a0-8315-d4a3afc037be}, !- Handle
Surface 446, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
21.2843000921128, -21.2843000921128, 3.75, !- X,Y,Z Vertex 1 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 2 {m}
28.3790667894837, -28.3790667894836, 0, !- X,Y,Z Vertex 3 {m}
28.3790667894837, -28.3790667894836, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{57691e39-e3e6-4dff-97b9-60d66037d9d3}, !- Handle
Surface 447, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
14.1895333947419, -14.1895333947418, 3.75, !- X,Y,Z Vertex 1 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 2 {m}
21.2843000921128, -21.2843000921128, 0, !- X,Y,Z Vertex 3 {m}
21.2843000921128, -21.2843000921128, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{bbcef1b2-2121-4faf-9016-2ea8c95eaa20}, !- Handle
Surface 448, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.09476669737089, -7.09476669737092, 3.75, !- X,Y,Z Vertex 1 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 2 {m}
14.1895333947419, -14.1895333947418, 0, !- X,Y,Z Vertex 3 {m}
14.1895333947419, -14.1895333947418, 3.75; !- X,Y,Z Vertex 4 {m}
OS:Surface,
{0792c3bc-e1bf-48f6-bbca-b06c1aa5820a}, !- Handle
Surface 449, !- Name
Wall, !- Surface Type
, !- Construction Name
{9c893b79-0184-43bc-9c7a-da1f7190c7dd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
-1.40892965105258e-14, -3.18528649045283e-14, 3.75, !- X,Y,Z Vertex 1 {m}
-1.40892965105258e-14, -3.18528649045283e-14, 0, !- X,Y,Z Vertex 2 {m}
7.09476669737089, -7.09476669737092, 0, !- X,Y,Z Vertex 3 {m}
7.09476669737089, -7.09476669737092, 3.75; !- X,Y,Z Vertex 4 {m}
OS:ThermalZone,
{f8cb6b18-9deb-4bdd-aeb7-984111dede65}, !- Handle
Thermal Zone 1, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{43f9c984-d38f-464e-b79a-5ce9d20ee992}, !- Zone Air Inlet Port List
{0f029672-d48b-4109-9018-d792dd532d08}, !- Zone Air Exhaust Port List
{9dbc9dd2-16f6-4253-9dcc-d2fc2dcdbd0c}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{1527fb52-d7be-4648-8fe0-a2e4ef6515df}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{ba539dda-dc94-43cf-a259-1e3010c44b15}, !- Handle
Node 1, !- Name
{9dbc9dd2-16f6-4253-9dcc-d2fc2dcdbd0c}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{9dbc9dd2-16f6-4253-9dcc-d2fc2dcdbd0c}, !- Handle
{725c23dc-70cb-4881-b577-dbc4f78acd93}, !- Name
{f8cb6b18-9deb-4bdd-aeb7-984111dede65}, !- Source Object
11, !- Outlet Port
{ba539dda-dc94-43cf-a259-1e3010c44b15}, !- Target Object
2; !- Inlet Port
OS:PortList,
{43f9c984-d38f-464e-b79a-5ce9d20ee992}, !- Handle
Port List 1, !- Name
{f8cb6b18-9deb-4bdd-aeb7-984111dede65}; !- HVAC Component
OS:PortList,
{0f029672-d48b-4109-9018-d792dd532d08}, !- Handle
Port List 2, !- Name
{f8cb6b18-9deb-4bdd-aeb7-984111dede65}; !- HVAC Component
OS:Sizing:Zone,
{b69c9a37-4538-410b-8f16-89aa958a7ffc}, !- Handle
{f8cb6b18-9deb-4bdd-aeb7-984111dede65}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{4fe7b4ee-0c71-4246-a874-93293794f15f}, !- Handle
Zone HVAC Equipment List 1, !- Name
{f8cb6b18-9deb-4bdd-aeb7-984111dede65}; !- Thermal Zone
OS:ThermalZone,
{f920cf53-056f-488a-9a3f-a262ee732231}, !- Handle
Thermal Zone 2, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{0cf1864d-1282-4f93-9d60-28b514a3fe1b}, !- Zone Air Inlet Port List
{fc811285-55e1-4020-bac1-90bd407be69e}, !- Zone Air Exhaust Port List
{d1126f84-9f2e-4329-abb1-26b1cd9fe7b4}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{d4a790f2-36c2-4286-85c9-3b369fd9dd29}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{98ce999a-f60c-418c-a562-492e1aed8d0a}, !- Handle
Node 2, !- Name
{d1126f84-9f2e-4329-abb1-26b1cd9fe7b4}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{d1126f84-9f2e-4329-abb1-26b1cd9fe7b4}, !- Handle
{e24cdc88-973f-43f0-bb43-e98da50143da}, !- Name
{f920cf53-056f-488a-9a3f-a262ee732231}, !- Source Object
11, !- Outlet Port
{98ce999a-f60c-418c-a562-492e1aed8d0a}, !- Target Object
2; !- Inlet Port
OS:PortList,
{0cf1864d-1282-4f93-9d60-28b514a3fe1b}, !- Handle
Port List 3, !- Name
{f920cf53-056f-488a-9a3f-a262ee732231}; !- HVAC Component
OS:PortList,
{fc811285-55e1-4020-bac1-90bd407be69e}, !- Handle
Port List 4, !- Name
{f920cf53-056f-488a-9a3f-a262ee732231}; !- HVAC Component
OS:Sizing:Zone,
{2bf33174-74b7-4c25-a5a6-3f01750ddeeb}, !- Handle
{f920cf53-056f-488a-9a3f-a262ee732231}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{ecbe3c41-f013-4beb-9038-a8155a382958}, !- Handle
Zone HVAC Equipment List 2, !- Name
{f920cf53-056f-488a-9a3f-a262ee732231}; !- Thermal Zone
OS:ThermalZone,
{738a93b1-4c5d-4d0c-ad69-59ecf0073bb7}, !- Handle
Thermal Zone 3, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{ae811160-aa06-4bdc-a021-78e839f48d18}, !- Zone Air Inlet Port List
{8380801e-cd22-4449-b894-de9058119051}, !- Zone Air Exhaust Port List
{395ed864-89e4-4ce9-8171-6b18b655ca4d}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{a0d5256b-e46d-49e1-97fb-15c874a54ec9}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{3ba20cef-0cf0-46cd-9210-770b72b8ddca}, !- Handle
Node 3, !- Name
{395ed864-89e4-4ce9-8171-6b18b655ca4d}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{395ed864-89e4-4ce9-8171-6b18b655ca4d}, !- Handle
{3af30737-8f6d-4c74-a1f9-0ab3d635d915}, !- Name
{738a93b1-4c5d-4d0c-ad69-59ecf0073bb7}, !- Source Object
11, !- Outlet Port
{3ba20cef-0cf0-46cd-9210-770b72b8ddca}, !- Target Object
2; !- Inlet Port
OS:PortList,
{ae811160-aa06-4bdc-a021-78e839f48d18}, !- Handle
Port List 5, !- Name
{738a93b1-4c5d-4d0c-ad69-59ecf0073bb7}; !- HVAC Component
OS:PortList,
{8380801e-cd22-4449-b894-de9058119051}, !- Handle
Port List 6, !- Name
{738a93b1-4c5d-4d0c-ad69-59ecf0073bb7}; !- HVAC Component
OS:Sizing:Zone,
{6a9294d3-59b1-4e38-a464-63ce83567a31}, !- Handle
{738a93b1-4c5d-4d0c-ad69-59ecf0073bb7}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{783cde02-b2f8-4d2b-9e59-b237847c0494}, !- Handle
Zone HVAC Equipment List 3, !- Name
{738a93b1-4c5d-4d0c-ad69-59ecf0073bb7}; !- Thermal Zone
OS:ThermalZone,
{d12de6d0-2bdd-404b-bc71-d921897d3652}, !- Handle
Thermal Zone 4, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{ec0cd898-2d46-4f5e-babb-e486379f2c97}, !- Zone Air Inlet Port List
{f80a585e-5077-4a15-8249-223a97ad8643}, !- Zone Air Exhaust Port List
{c6a78231-d91e-45c3-b153-05af5f1bfd87}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{a7918e89-9ad4-4ac4-8c0d-2208a3ebb7b8}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{ce84cc49-65e5-4981-89af-8e25db7f6ff9}, !- Handle
Node 4, !- Name
{c6a78231-d91e-45c3-b153-05af5f1bfd87}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{c6a78231-d91e-45c3-b153-05af5f1bfd87}, !- Handle
{637a9b59-9097-4404-a25f-9c7ce5a1966a}, !- Name
{d12de6d0-2bdd-404b-bc71-d921897d3652}, !- Source Object
11, !- Outlet Port
{ce84cc49-65e5-4981-89af-8e25db7f6ff9}, !- Target Object
2; !- Inlet Port
OS:PortList,
{ec0cd898-2d46-4f5e-babb-e486379f2c97}, !- Handle
Port List 7, !- Name
{d12de6d0-2bdd-404b-bc71-d921897d3652}; !- HVAC Component
OS:PortList,
{f80a585e-5077-4a15-8249-223a97ad8643}, !- Handle
Port List 8, !- Name
{d12de6d0-2bdd-404b-bc71-d921897d3652}; !- HVAC Component
OS:Sizing:Zone,
{8dd8f0ad-f5d9-4970-b135-3e34121d371d}, !- Handle
{d12de6d0-2bdd-404b-bc71-d921897d3652}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{f9746c46-c941-4272-b0ea-caab34e0c5cf}, !- Handle
Zone HVAC Equipment List 4, !- Name
{d12de6d0-2bdd-404b-bc71-d921897d3652}; !- Thermal Zone
OS:ThermalZone,
{dafc4f4f-8afe-45c6-8e8b-f80fbb2bc5f2}, !- Handle
Thermal Zone 5, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{93682162-9adc-4de8-80cf-096a8bc0bcc5}, !- Zone Air Inlet Port List
{18bd87cc-f4ac-4739-b8a9-7e37360853a4}, !- Zone Air Exhaust Port List
{5070d569-f448-42d5-8163-5baf12de39db}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{1f7a5cc9-a8b3-4e7b-8f2b-736ef63b6e31}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{47731b7b-6552-4344-bd1a-5e584df3ee67}, !- Handle
Node 5, !- Name
{5070d569-f448-42d5-8163-5baf12de39db}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{5070d569-f448-42d5-8163-5baf12de39db}, !- Handle
{087bc84d-c6a9-43cc-9225-a171705fed84}, !- Name
{dafc4f4f-8afe-45c6-8e8b-f80fbb2bc5f2}, !- Source Object
11, !- Outlet Port
{47731b7b-6552-4344-bd1a-5e584df3ee67}, !- Target Object
2; !- Inlet Port
OS:PortList,
{93682162-9adc-4de8-80cf-096a8bc0bcc5}, !- Handle
Port List 9, !- Name
{dafc4f4f-8afe-45c6-8e8b-f80fbb2bc5f2}; !- HVAC Component
OS:PortList,
{18bd87cc-f4ac-4739-b8a9-7e37360853a4}, !- Handle
Port List 10, !- Name
{dafc4f4f-8afe-45c6-8e8b-f80fbb2bc5f2}; !- HVAC Component
OS:Sizing:Zone,
{87f43a66-f035-4a87-9c87-26f677fa94c3}, !- Handle
{dafc4f4f-8afe-45c6-8e8b-f80fbb2bc5f2}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{cac4f336-bd5f-4da7-8fcf-16b2cbf71be0}, !- Handle
Zone HVAC Equipment List 5, !- Name
{dafc4f4f-8afe-45c6-8e8b-f80fbb2bc5f2}; !- Thermal Zone
OS:ThermalZone,
{9b692068-cc48-4195-9a90-6cc681fb4340}, !- Handle
Thermal Zone 6, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{2c93dbe1-b452-41fb-803d-3464e3fbfbc7}, !- Zone Air Inlet Port List
{6f78ee3e-3896-4bfa-a67a-a4120a38ff99}, !- Zone Air Exhaust Port List
{8b00285e-5a62-4595-8e75-a7b0add5f188}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{3d04fb6b-5d31-4e4d-b7e9-41bca7107ea3}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{e06947d6-3241-4953-8f13-d1e121a301df}, !- Handle
Node 6, !- Name
{8b00285e-5a62-4595-8e75-a7b0add5f188}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{8b00285e-5a62-4595-8e75-a7b0add5f188}, !- Handle
{f49ac7e8-e8f7-4b53-be19-a1ab5bc158f7}, !- Name
{9b692068-cc48-4195-9a90-6cc681fb4340}, !- Source Object
11, !- Outlet Port
{e06947d6-3241-4953-8f13-d1e121a301df}, !- Target Object
2; !- Inlet Port
OS:PortList,
{2c93dbe1-b452-41fb-803d-3464e3fbfbc7}, !- Handle
Port List 11, !- Name
{9b692068-cc48-4195-9a90-6cc681fb4340}; !- HVAC Component
OS:PortList,
{6f78ee3e-3896-4bfa-a67a-a4120a38ff99}, !- Handle
Port List 12, !- Name
{9b692068-cc48-4195-9a90-6cc681fb4340}; !- HVAC Component
OS:Sizing:Zone,
{b54ef2e2-e440-4291-b3ac-98bbdc481afc}, !- Handle
{9b692068-cc48-4195-9a90-6cc681fb4340}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{6a3bd293-7f94-46ab-b46a-aea90a0f729f}, !- Handle
Zone HVAC Equipment List 6, !- Name
{9b692068-cc48-4195-9a90-6cc681fb4340}; !- Thermal Zone
OS:ThermalZone,
{cbae8917-ab5f-4689-8533-96e007c32818}, !- Handle
Thermal Zone 7, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{287088ea-711f-4c37-977b-3bcc4fb4a57b}, !- Zone Air Inlet Port List
{76a475a8-85eb-4fe8-a856-26231f2142d9}, !- Zone Air Exhaust Port List
{34ff62e1-c5e4-48b9-a665-cf44d3c4ae5f}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{4200045c-675c-4f3b-a2a4-3c4a1887e007}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{5a9a3d6a-1b9c-4d6f-9edb-040bc422f03e}, !- Handle
Node 7, !- Name
{34ff62e1-c5e4-48b9-a665-cf44d3c4ae5f}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{34ff62e1-c5e4-48b9-a665-cf44d3c4ae5f}, !- Handle
{64fb4e03-ac3c-4116-b1d3-a11300b04064}, !- Name
{cbae8917-ab5f-4689-8533-96e007c32818}, !- Source Object
11, !- Outlet Port
{5a9a3d6a-1b9c-4d6f-9edb-040bc422f03e}, !- Target Object
2; !- Inlet Port
OS:PortList,
{287088ea-711f-4c37-977b-3bcc4fb4a57b}, !- Handle
Port List 13, !- Name
{cbae8917-ab5f-4689-8533-96e007c32818}; !- HVAC Component
OS:PortList,
{76a475a8-85eb-4fe8-a856-26231f2142d9}, !- Handle
Port List 14, !- Name
{cbae8917-ab5f-4689-8533-96e007c32818}; !- HVAC Component
OS:Sizing:Zone,
{95aed799-c4c7-4232-a0fe-a3c7c7e1a2bb}, !- Handle
{cbae8917-ab5f-4689-8533-96e007c32818}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{fcfdeb89-3a4f-45a5-8b56-b259466651d6}, !- Handle
Zone HVAC Equipment List 7, !- Name
{cbae8917-ab5f-4689-8533-96e007c32818}; !- Thermal Zone
OS:ThermalZone,
{98b6d3f3-d842-4343-8082-0fc26793f5ab}, !- Handle
Thermal Zone 8, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{9c4deac2-2a31-4101-a9db-d932151ed392}, !- Zone Air Inlet Port List
{c85fcf65-58c1-41a2-8e80-fd3651e288ff}, !- Zone Air Exhaust Port List
{754acbea-a2cb-4e24-89aa-9cc9f5400d82}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{020af943-0074-4297-9e1c-b70d6ec21056}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{73e06b0d-4c30-40f0-8821-4da80f45d1cc}, !- Handle
Node 8, !- Name
{754acbea-a2cb-4e24-89aa-9cc9f5400d82}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{754acbea-a2cb-4e24-89aa-9cc9f5400d82}, !- Handle
{72998e42-1c82-4eb6-9725-945d9ba81773}, !- Name
{98b6d3f3-d842-4343-8082-0fc26793f5ab}, !- Source Object
11, !- Outlet Port
{73e06b0d-4c30-40f0-8821-4da80f45d1cc}, !- Target Object
2; !- Inlet Port
OS:PortList,
{9c4deac2-2a31-4101-a9db-d932151ed392}, !- Handle
Port List 15, !- Name
{98b6d3f3-d842-4343-8082-0fc26793f5ab}; !- HVAC Component
OS:PortList,
{c85fcf65-58c1-41a2-8e80-fd3651e288ff}, !- Handle
Port List 16, !- Name
{98b6d3f3-d842-4343-8082-0fc26793f5ab}; !- HVAC Component
OS:Sizing:Zone,
{46110550-1e1f-47ff-b94d-4193fa4e2d57}, !- Handle
{98b6d3f3-d842-4343-8082-0fc26793f5ab}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{88d879bc-876f-4044-9375-d7cedaad3b2e}, !- Handle
Zone HVAC Equipment List 8, !- Name
{98b6d3f3-d842-4343-8082-0fc26793f5ab}; !- Thermal Zone
OS:ThermalZone,
{044e5a07-bfbd-4a18-a3eb-fc6a98cf0269}, !- Handle
Thermal Zone 9, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{f7d4b7a5-d14f-4179-ae1e-c786b8c30880}, !- Zone Air Inlet Port List
{671f3486-2b37-41e2-b06d-c55d8ead51ef}, !- Zone Air Exhaust Port List
{88732340-fead-4b4e-bd12-7137fc10c6c7}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{3aed4dec-cdb6-49cc-a992-0e4461f97d60}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{58e53f2d-473a-4c9c-854a-1dd1bbe09aa0}, !- Handle
Node 9, !- Name
{88732340-fead-4b4e-bd12-7137fc10c6c7}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{88732340-fead-4b4e-bd12-7137fc10c6c7}, !- Handle
{a421273d-c0c4-45ef-9943-8cb244f8215d}, !- Name
{044e5a07-bfbd-4a18-a3eb-fc6a98cf0269}, !- Source Object
11, !- Outlet Port
{58e53f2d-473a-4c9c-854a-1dd1bbe09aa0}, !- Target Object
2; !- Inlet Port
OS:PortList,
{f7d4b7a5-d14f-4179-ae1e-c786b8c30880}, !- Handle
Port List 17, !- Name
{044e5a07-bfbd-4a18-a3eb-fc6a98cf0269}; !- HVAC Component
OS:PortList,
{671f3486-2b37-41e2-b06d-c55d8ead51ef}, !- Handle
Port List 18, !- Name
{044e5a07-bfbd-4a18-a3eb-fc6a98cf0269}; !- HVAC Component
OS:Sizing:Zone,
{4107ed98-1f3a-4e8c-b26a-c8bc815bd7f8}, !- Handle
{044e5a07-bfbd-4a18-a3eb-fc6a98cf0269}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{b738e763-a77a-45ae-b6de-95930f898edc}, !- Handle
Zone HVAC Equipment List 9, !- Name
{044e5a07-bfbd-4a18-a3eb-fc6a98cf0269}; !- Thermal Zone
OS:ThermalZone,
{164ffe5d-033c-4a1d-899a-52e7420c8660}, !- Handle
Thermal Zone 10, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{523cd260-94a9-4920-b8ce-31719b6e97a2}, !- Zone Air Inlet Port List
{34f04b58-ba3f-453a-96f0-134872f3a965}, !- Zone Air Exhaust Port List
{51992fd7-92c5-4898-9da7-b37726458a29}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{ce0bb9d3-7c68-47bb-bc6e-80673df6bab9}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{82e5c0be-8dc7-412c-a3b6-ab6300718954}, !- Handle
Node 10, !- Name
{51992fd7-92c5-4898-9da7-b37726458a29}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{51992fd7-92c5-4898-9da7-b37726458a29}, !- Handle
{1fa0620e-4ac1-4867-b91e-cc768e1e9b88}, !- Name
{164ffe5d-033c-4a1d-899a-52e7420c8660}, !- Source Object
11, !- Outlet Port
{82e5c0be-8dc7-412c-a3b6-ab6300718954}, !- Target Object
2; !- Inlet Port
OS:PortList,
{523cd260-94a9-4920-b8ce-31719b6e97a2}, !- Handle
Port List 19, !- Name
{164ffe5d-033c-4a1d-899a-52e7420c8660}; !- HVAC Component
OS:PortList,
{34f04b58-ba3f-453a-96f0-134872f3a965}, !- Handle
Port List 20, !- Name
{164ffe5d-033c-4a1d-899a-52e7420c8660}; !- HVAC Component
OS:Sizing:Zone,
{84956560-0351-4dbb-8d0f-6dc85dae0c72}, !- Handle
{164ffe5d-033c-4a1d-899a-52e7420c8660}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{24878513-e035-4bc6-8567-c47bfacc3a8f}, !- Handle
Zone HVAC Equipment List 10, !- Name
{164ffe5d-033c-4a1d-899a-52e7420c8660}; !- Thermal Zone
OS:ThermalZone,
{ca9eedfe-f9f0-4208-ac9d-5aef0b58f49c}, !- Handle
Thermal Zone 11, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{23d8d392-583b-4e94-bc28-5e436c52a670}, !- Zone Air Inlet Port List
{9989f01e-94f0-48a1-b0f6-35188c3bf1e3}, !- Zone Air Exhaust Port List
{dd6d7098-57dd-483b-b518-1df7f5eabf7b}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{f7dfd84f-b2e6-4012-a0c9-82d8bc29d1f1}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{5f3db88b-d06a-4486-9060-46f46a57a81d}, !- Handle
Node 11, !- Name
{dd6d7098-57dd-483b-b518-1df7f5eabf7b}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{dd6d7098-57dd-483b-b518-1df7f5eabf7b}, !- Handle
{4b3bae9e-6a40-4473-8ba0-d2ba94e53f01}, !- Name
{ca9eedfe-f9f0-4208-ac9d-5aef0b58f49c}, !- Source Object
11, !- Outlet Port
{5f3db88b-d06a-4486-9060-46f46a57a81d}, !- Target Object
2; !- Inlet Port
OS:PortList,
{23d8d392-583b-4e94-bc28-5e436c52a670}, !- Handle
Port List 21, !- Name
{ca9eedfe-f9f0-4208-ac9d-5aef0b58f49c}; !- HVAC Component
OS:PortList,
{9989f01e-94f0-48a1-b0f6-35188c3bf1e3}, !- Handle
Port List 22, !- Name
{ca9eedfe-f9f0-4208-ac9d-5aef0b58f49c}; !- HVAC Component
OS:Sizing:Zone,
{276d5310-1ac5-434d-b01d-2ffcf1d03421}, !- Handle
{ca9eedfe-f9f0-4208-ac9d-5aef0b58f49c}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{e9482c13-7565-490c-92ad-ed33f9bafc9b}, !- Handle
Zone HVAC Equipment List 11, !- Name
{ca9eedfe-f9f0-4208-ac9d-5aef0b58f49c}; !- Thermal Zone
OS:ThermalZone,
{c5877681-30f0-47f1-bd04-71012d656448}, !- Handle
Thermal Zone 12, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{c3a2c4c8-0920-47aa-8404-e3ea64dbd6fa}, !- Zone Air Inlet Port List
{4485964c-243e-4ee7-9765-c3dfef171258}, !- Zone Air Exhaust Port List
{6a0cbc02-7779-4a95-8a48-2c41fc860656}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{be36b89f-b053-4ea3-b8e9-fddf59c16e33}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{a3c4995d-0d4a-46f8-a2ac-69a982e4e095}, !- Handle
Node 12, !- Name
{6a0cbc02-7779-4a95-8a48-2c41fc860656}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{6a0cbc02-7779-4a95-8a48-2c41fc860656}, !- Handle
{c23e92f9-40b7-4042-ada9-cfa817f6f822}, !- Name
{c5877681-30f0-47f1-bd04-71012d656448}, !- Source Object
11, !- Outlet Port
{a3c4995d-0d4a-46f8-a2ac-69a982e4e095}, !- Target Object
2; !- Inlet Port
OS:PortList,
{c3a2c4c8-0920-47aa-8404-e3ea64dbd6fa}, !- Handle
Port List 23, !- Name
{c5877681-30f0-47f1-bd04-71012d656448}; !- HVAC Component
OS:PortList,
{4485964c-243e-4ee7-9765-c3dfef171258}, !- Handle
Port List 24, !- Name
{c5877681-30f0-47f1-bd04-71012d656448}; !- HVAC Component
OS:Sizing:Zone,
{afd1ac5f-4ddc-4c5c-b0f9-fa89db8adad6}, !- Handle
{c5877681-30f0-47f1-bd04-71012d656448}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{cfc2c897-fa49-4df0-9665-151ab3475976}, !- Handle
Zone HVAC Equipment List 12, !- Name
{c5877681-30f0-47f1-bd04-71012d656448}; !- Thermal Zone
OS:ThermalZone,
{9fbdefda-041c-43c6-89dd-dccc5d048445}, !- Handle
Thermal Zone 13, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{09538476-b74e-476e-8ce9-d504b6c1ad1e}, !- Zone Air Inlet Port List
{7c953c74-9f89-42fb-936f-3fda194e3711}, !- Zone Air Exhaust Port List
{b407a403-dc61-4a55-b63e-5a4928d67af0}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{70992ff1-8765-4d72-9c95-44d47d545bee}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{3cba7c35-28b4-4365-8a0e-7441592b0308}, !- Handle
Node 13, !- Name
{b407a403-dc61-4a55-b63e-5a4928d67af0}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{b407a403-dc61-4a55-b63e-5a4928d67af0}, !- Handle
{59bdf822-9794-4c93-9e8c-85259e4935af}, !- Name
{9fbdefda-041c-43c6-89dd-dccc5d048445}, !- Source Object
11, !- Outlet Port
{3cba7c35-28b4-4365-8a0e-7441592b0308}, !- Target Object
2; !- Inlet Port
OS:PortList,
{09538476-b74e-476e-8ce9-d504b6c1ad1e}, !- Handle
Port List 25, !- Name
{9fbdefda-041c-43c6-89dd-dccc5d048445}; !- HVAC Component
OS:PortList,
{7c953c74-9f89-42fb-936f-3fda194e3711}, !- Handle
Port List 26, !- Name
{9fbdefda-041c-43c6-89dd-dccc5d048445}; !- HVAC Component
OS:Sizing:Zone,
{158ddaa7-7bda-40f1-96e6-ecb19f20bad2}, !- Handle
{9fbdefda-041c-43c6-89dd-dccc5d048445}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{caf52b1f-7668-44c8-a11b-810685228f06}, !- Handle
Zone HVAC Equipment List 13, !- Name
{9fbdefda-041c-43c6-89dd-dccc5d048445}; !- Thermal Zone
OS:ThermalZone,
{eedf7d3c-d949-479d-a778-d3fc1108b17b}, !- Handle
Thermal Zone 14, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{76f385d3-eff0-461c-9af3-79dea2fe7977}, !- Zone Air Inlet Port List
{d0ce0870-8699-49b6-807c-f7d6322dd4c3}, !- Zone Air Exhaust Port List
{683eb381-f090-44e7-99ba-af79851a7068}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{d8dfc4a9-33e4-47e2-b3c4-9f219b5537ba}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{255c4465-7770-44e8-b898-a751d1913906}, !- Handle
Node 14, !- Name
{683eb381-f090-44e7-99ba-af79851a7068}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{683eb381-f090-44e7-99ba-af79851a7068}, !- Handle
{11aeae46-0857-404b-bef2-e802721cc1d9}, !- Name
{eedf7d3c-d949-479d-a778-d3fc1108b17b}, !- Source Object
11, !- Outlet Port
{255c4465-7770-44e8-b898-a751d1913906}, !- Target Object
2; !- Inlet Port
OS:PortList,
{76f385d3-eff0-461c-9af3-79dea2fe7977}, !- Handle
Port List 27, !- Name
{eedf7d3c-d949-479d-a778-d3fc1108b17b}; !- HVAC Component
OS:PortList,
{d0ce0870-8699-49b6-807c-f7d6322dd4c3}, !- Handle
Port List 28, !- Name
{eedf7d3c-d949-479d-a778-d3fc1108b17b}; !- HVAC Component
OS:Sizing:Zone,
{3009802f-969d-40d1-aafd-f25e1628d46b}, !- Handle
{eedf7d3c-d949-479d-a778-d3fc1108b17b}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{57396934-e665-4a1b-a8d6-02799c6c611b}, !- Handle
Zone HVAC Equipment List 14, !- Name
{eedf7d3c-d949-479d-a778-d3fc1108b17b}; !- Thermal Zone
OS:ThermalZone,
{7b1ae352-4877-4a47-b315-a76e2a37d7b2}, !- Handle
Thermal Zone 15, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{4331c83a-af8f-4a35-bb0b-771e4ae55d9b}, !- Zone Air Inlet Port List
{6a301030-3e11-48ca-af50-d7a33e724355}, !- Zone Air Exhaust Port List
{11f8a1e9-f72f-4c95-87d5-9fcf8f7f65d2}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{032dbd84-ba29-4406-958e-00bde6439cf8}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{661a145a-e39a-48e7-840f-d28b2c17c469}, !- Handle
Node 15, !- Name
{11f8a1e9-f72f-4c95-87d5-9fcf8f7f65d2}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{11f8a1e9-f72f-4c95-87d5-9fcf8f7f65d2}, !- Handle
{80d35c38-6b77-47fc-ac6a-67f6ed56f515}, !- Name
{7b1ae352-4877-4a47-b315-a76e2a37d7b2}, !- Source Object
11, !- Outlet Port
{661a145a-e39a-48e7-840f-d28b2c17c469}, !- Target Object
2; !- Inlet Port
OS:PortList,
{4331c83a-af8f-4a35-bb0b-771e4ae55d9b}, !- Handle
Port List 29, !- Name
{7b1ae352-4877-4a47-b315-a76e2a37d7b2}; !- HVAC Component
OS:PortList,
{6a301030-3e11-48ca-af50-d7a33e724355}, !- Handle
Port List 30, !- Name
{7b1ae352-4877-4a47-b315-a76e2a37d7b2}; !- HVAC Component
OS:Sizing:Zone,
{755a8956-4d96-4a62-a92c-5f0c175bbf57}, !- Handle
{7b1ae352-4877-4a47-b315-a76e2a37d7b2}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{8f7ee20e-f582-4a6a-bc11-3dbf3d938872}, !- Handle
Zone HVAC Equipment List 15, !- Name
{7b1ae352-4877-4a47-b315-a76e2a37d7b2}; !- Thermal Zone
OS:Construction,
{67a9d98c-d980-431b-8428-a5b5823ce43b}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone 6, !- Name
{241f6a49-d494-4733-af5a-4d48565b9cfd}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{4703cfbf-0912-4b09-af04-54d19432ec52}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:Material,
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Handle
1IN Stucco, !- Name
Smooth, !- Roughness
0.0253, !- Thickness {m}
0.691799999999999, !- Conductivity {W/m-K}
1858, !- Density {kg/m3}
836.999999999999, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.92, !- Solar Absorptance
0.92; !- Visible Absorptance
OS:Material,
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Handle
8IN CONCRETE HW RefBldg, !- Name
Rough, !- Roughness
0.2032, !- Thickness {m}
1.311, !- Conductivity {W/m-K}
2240, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:Material,
{4703cfbf-0912-4b09-af04-54d19432ec52}, !- Handle
Mass NonRes Wall Insulation-1.69, !- Name
MediumRough, !- Roughness
0.0623673293364368, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:Material,
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}, !- Handle
1/2IN Gypsum, !- Name
Smooth, !- Roughness
0.0127, !- Thickness {m}
0.16, !- Conductivity {W/m-K}
784.9, !- Density {kg/m3}
830.000000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.4, !- Solar Absorptance
0.4; !- Visible Absorptance
OS:StandardsInformation:Construction,
{cab64d36-f2ab-43de-8b2e-beaef923018b}, !- Handle
{67a9d98c-d980-431b-8428-a5b5823ce43b}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{56c2c3b4-70f0-4f24-9c54-a3a4f139468a}, !- Handle
ASHRAE 90.1-2004 ExtRoof IEAD ClimateZone 7, !- Name
{86c1a79b-43ee-44c7-8462-9f6ca4d2ff5b}, !- Surface Rendering Name
{30028f24-6411-4e4b-8838-199e50b88dd5}, !- Layer 1
{178a578b-e7fe-4694-9fb7-1b4a3f9ffaee}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:Material,
{30028f24-6411-4e4b-8838-199e50b88dd5}, !- Handle
Roof Membrane, !- Name
VeryRough, !- Roughness
0.0095, !- Thickness {m}
0.16, !- Conductivity {W/m-K}
1121.29, !- Density {kg/m3}
1460, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:Material,
{178a578b-e7fe-4694-9fb7-1b4a3f9ffaee}, !- Handle
IEAD NonRes Roof Insulation-2.79, !- Name
MediumRough, !- Roughness
0.124663450809702, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:Material,
{3ac19517-f998-49cf-a48b-4491fb351960}, !- Handle
Metal Decking, !- Name
MediumSmooth, !- Roughness
0.0015, !- Thickness {m}
45.006, !- Conductivity {W/m-K}
7680, !- Density {kg/m3}
418.4, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.6, !- Solar Absorptance
0.6; !- Visible Absorptance
OS:StandardsInformation:Construction,
{f14c5490-fd61-4e43-b6c3-8331302b8839}, !- Handle
{56c2c3b4-70f0-4f24-9c54-a3a4f139468a}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
IEAD; !- Standards Construction Type
OS:Construction,
{d4a28686-bd99-4ab5-b126-807409b36fc2}, !- Handle
ASHRAE 90.1-2004 ExtRoof Metal ClimateZone 2, !- Name
{f9fc4e50-1bc5-4e8d-bae1-0a12d18a87ea}, !- Surface Rendering Name
{380ac33b-a953-4530-8e51-f0bcdc8e2fd5}, !- Layer 1
{02fb1824-e4bd-4d31-9547-f73bd1123685}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:Material,
{380ac33b-a953-4530-8e51-f0bcdc8e2fd5}, !- Handle
Metal Roofing, !- Name
MediumSmooth, !- Roughness
0.0015, !- Thickness {m}
45.006, !- Conductivity {W/m-K}
7680, !- Density {kg/m3}
418.4, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.6, !- Solar Absorptance
0.6; !- Visible Absorptance
OS:Material,
{02fb1824-e4bd-4d31-9547-f73bd1123685}, !- Handle
Metal Semi-Cond Roof Insulation-1.05, !- Name
MediumRough, !- Roughness
0.0422673301906313, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{3bbc8b7e-4c1e-4620-803a-3f56c0844031}, !- Handle
{d4a28686-bd99-4ab5-b126-807409b36fc2}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{b9aa1649-b7a7-4bc6-a738-be853916be01}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone 3a-3b, !- Name
{cea6c409-cc34-46dc-ad15-dcc673305f5e}, !- Surface Rendering Name
{01528e8f-c3f9-4775-831e-4d610e716f90}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{01528e8f-c3f9-4775-831e-4d610e716f90}, !- Handle
Fixed Window 3.24/0.25/0.16, !- Name
3.23646, !- U-Factor {W/m2-K}
0.25, !- Solar Heat Gain Coefficient
0.16; !- Visible Transmittance
OS:StandardsInformation:Construction,
{89b015d8-9371-4648-9c39-cb9a723fb952}, !- Handle
{b9aa1649-b7a7-4bc6-a738-be853916be01}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{04fc2062-3d33-4ccf-8c9d-d21319331503}, !- Handle
ASHRAE 90.1-2004 ExtRoof IEAD ClimateZone 8, !- Name
{d597e39f-333d-4762-9bb3-ffeb68ce68c7}, !- Surface Rendering Name
{30028f24-6411-4e4b-8838-199e50b88dd5}, !- Layer 1
{b161d40f-06d1-49ba-872d-596fefef487e}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:Material,
{b161d40f-06d1-49ba-872d-596fefef487e}, !- Handle
IEAD NonRes Roof Insulation-3.72, !- Name
MediumRough, !- Roughness
0.170145232344671, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{634d10a9-77f3-4ee9-98e0-849ecdcce36e}, !- Handle
{04fc2062-3d33-4ccf-8c9d-d21319331503}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
IEAD; !- Standards Construction Type
OS:Construction,
{f5c196f2-7342-4756-bdd2-806b9b572390}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone alt-res 7, !- Name
{958008de-8868-410d-9bb7-7626cbf10327}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{1d3fcefb-3dd0-4cde-956b-e9e873adf10f}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:Material,
{1d3fcefb-3dd0-4cde-956b-e9e873adf10f}, !- Handle
Mass NonRes Wall Insulation-2.20, !- Name
MediumRough, !- Roughness
0.0872609809472425, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{22b97445-1e45-4d07-9c30-4c2ddd08e992}, !- Handle
{f5c196f2-7342-4756-bdd2-806b9b572390}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{a1d3606d-6ca0-470c-b1d9-b5c68f075d68}, !- Handle
ASHRAE 90.1-2004 ExtWall SteelFrame ClimateZone alt-res 4-6, !- Name
{b634b2eb-bc9f-4de3-9faa-7ba74fee46b3}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{8fe353e9-7b74-4c31-8d4f-c01d49cf2fe7}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Handle
Wood Siding, !- Name
MediumSmooth, !- Roughness
0.01, !- Thickness {m}
0.11, !- Conductivity {W/m-K}
544.62, !- Density {kg/m3}
1210, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.78, !- Solar Absorptance
0.78; !- Visible Absorptance
OS:Material,
{8fe353e9-7b74-4c31-8d4f-c01d49cf2fe7}, !- Handle
Steel Frame NonRes Wall Insulation-2.75, !- Name
MediumRough, !- Roughness
0.119161363096001, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{1bb3d728-6579-4158-a2fa-46731619b9b7}, !- Handle
{a1d3606d-6ca0-470c-b1d9-b5c68f075d68}, !- Construction Name
ExteriorWall, !- Intended Surface Type
SteelFramed; !- Standards Construction Type
OS:Construction,
{ca639a59-2999-4cc4-bb1f-43de8d3d052e}, !- Handle
ASHRAE 90.1-2004 ExtWall SteelFrame ClimateZone 7-8, !- Name
{b88d459b-dffc-4f52-ba19-b4ff4c18fdb6}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{8fe353e9-7b74-4c31-8d4f-c01d49cf2fe7}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:StandardsInformation:Construction,
{17c3b9c5-a5c4-48fc-8f02-cc96582f2155}, !- Handle
{ca639a59-2999-4cc4-bb1f-43de8d3d052e}, !- Construction Name
ExteriorWall, !- Intended Surface Type
SteelFramed; !- Standards Construction Type
OS:Construction,
{0fea1630-46f6-47b4-89de-8ce0a12b7297}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone 3c, !- Name
{ad8130a9-6f09-456b-87ee-3d0a7d3832da}, !- Surface Rendering Name
{54ddc5e9-a037-485f-9c9b-9c69b8e75008}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{54ddc5e9-a037-485f-9c9b-9c69b8e75008}, !- Handle
Fixed Window 5.84/0.39/0.22, !- Name
5.84000000000002, !- U-Factor {W/m2-K}
0.39, !- Solar Heat Gain Coefficient
0.22; !- Visible Transmittance
OS:StandardsInformation:Construction,
{db6d930b-cf90-4f4e-8dfb-fd137dd01d7b}, !- Handle
{0fea1630-46f6-47b4-89de-8ce0a12b7297}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{aecf28b2-528a-4031-8248-bf88d71f1148}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone alt-res 1-2, !- Name
{53756f4a-48e8-4b5c-b3bc-c4063fbb3b93}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{296e054a-6c06-48db-9733-6d2210d5db95}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:Material,
{296e054a-6c06-48db-9733-6d2210d5db95}, !- Handle
Mass NonRes Wall Insulation-1.17, !- Name
MediumRough, !- Roughness
0.0365394788793099, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{26cec31c-b9ce-4ec2-95f4-2cf72f70aa9e}, !- Handle
{aecf28b2-528a-4031-8248-bf88d71f1148}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{df807951-c23d-4cbc-8322-693b4dab577c}, !- Handle
Interior Window, !- Name
{4145c782-556d-4ed3-ae4a-dd7526d74428}, !- Surface Rendering Name
{ff06cdb6-5beb-4113-b75b-a6b75a303ec2}; !- Layer 1
OS:WindowMaterial:Glazing,
{ff06cdb6-5beb-4113-b75b-a6b75a303ec2}, !- Handle
Clear 3mm, !- Name
SpectralAverage, !- Optical Data Type
, !- Window Glass Spectral Data Set Name
0.00299999999999999, !- Thickness {m}
0.837, !- Solar Transmittance at Normal Incidence
0.075, !- Front Side Solar Reflectance at Normal Incidence
0, !- Back Side Solar Reflectance at Normal Incidence
0.898, !- Visible Transmittance at Normal Incidence
0.081, !- Front Side Visible Reflectance at Normal Incidence
0, !- Back Side Visible Reflectance at Normal Incidence
0, !- Infrared Transmittance at Normal Incidence
0.84, !- Front Side Infrared Hemispherical Emissivity
0.84, !- Back Side Infrared Hemispherical Emissivity
0.9, !- Conductivity {W/m-K}
1, !- Dirt Correction Factor for Solar and Visible Transmittance
No; !- Solar Diffusing
OS:StandardsInformation:Construction,
{c65977dd-8aad-4bdf-94a5-3d678f375a3f}, !- Handle
{df807951-c23d-4cbc-8322-693b4dab577c}, !- Construction Name
InteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{3cc638ff-44a6-407d-b001-8cb5b5e084b3}, !- Handle
ASHRAE 90.1-2004 ExtRoof IEAD ClimateZone 5-6 1, !- Name
{cdbfe682-11e9-40b4-8d58-d291a823a58b}, !- Surface Rendering Name
{30028f24-6411-4e4b-8838-199e50b88dd5}, !- Layer 1
{f07c4553-a301-4af3-acea-1d13647ab6bd}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:Material,
{f07c4553-a301-4af3-acea-1d13647ab6bd}, !- Handle
IEAD NonRes Roof Insulation-2.85, !- Name
MediumRough, !- Roughness
0.127338688569477, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{a6e39dcc-13e5-401e-b411-0f84346301a1}, !- Handle
{3cc638ff-44a6-407d-b001-8cb5b5e084b3}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
IEAD; !- Standards Construction Type
OS:Construction,
{2168d0cb-ae7a-44f3-87bc-09666c6920bc}, !- Handle
ASHRAE 90.1-2004 ExtWall WoodFrame ClimateZone 1-7, !- Name
{d742a069-0da3-4c88-a6de-e928c0cff510}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{9b8ba5bc-f91e-45bf-a8f1-e11a9b4cf4bb}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{9b8ba5bc-f91e-45bf-a8f1-e11a9b4cf4bb}, !- Handle
Wood Frame NonRes Wall Insulation-1.98, !- Name
MediumRough, !- Roughness
0.0812847864409826, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{90cf5a60-7472-49ab-bb9f-a7946d132760}, !- Handle
{2168d0cb-ae7a-44f3-87bc-09666c6920bc}, !- Construction Name
ExteriorWall, !- Intended Surface Type
WoodFramed; !- Standards Construction Type
OS:Construction,
{e18eb7ec-8f63-4496-8a1b-0f2145dd28f1}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone alt-res 4, !- Name
{b8b119de-25b1-47b6-8dfc-4c06f549f4a1}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{4703cfbf-0912-4b09-af04-54d19432ec52}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:StandardsInformation:Construction,
{efb05866-f5ff-4257-867b-1a8540f71fd8}, !- Handle
{e18eb7ec-8f63-4496-8a1b-0f2145dd28f1}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{2d2f2ed1-2124-4200-8100-eb56f88c34fd}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone 3-4, !- Name
{742a932c-1e8f-42ec-a520-fb9580ad2d59}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{296e054a-6c06-48db-9733-6d2210d5db95}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:StandardsInformation:Construction,
{cf746e78-8ca1-4f62-ba33-0e7388a203c2}, !- Handle
{2d2f2ed1-2124-4200-8100-eb56f88c34fd}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{b0d93ef6-7226-43de-a9ce-3936a0cb68b5}, !- Handle
ASHRAE 90.1-2004 ExtRoof IEAD ClimateZone 1-4, !- Name
{0a11a1f6-90ef-4ba2-bf87-2e4f038758b7}, !- Surface Rendering Name
{30028f24-6411-4e4b-8838-199e50b88dd5}, !- Layer 1
{178a578b-e7fe-4694-9fb7-1b4a3f9ffaee}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:StandardsInformation:Construction,
{f61a2b55-9b48-4a77-9fa5-8240ad622765}, !- Handle
{b0d93ef6-7226-43de-a9ce-3936a0cb68b5}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
IEAD; !- Standards Construction Type
OS:Construction,
{c9136c6c-97bc-40ab-be39-86d8ddf13584}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone alt-ware 1-8, !- Name
{c8a556bb-2b72-40a6-ae46-779d40767709}, !- Surface Rendering Name
{d57dc8f4-c370-4edc-abb8-d440f70d77a7}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{d57dc8f4-c370-4edc-abb8-d440f70d77a7}, !- Handle
Fixed Window 5.84/0.70/0.60, !- Name
5.84000000000002, !- U-Factor {W/m2-K}
0.7, !- Solar Heat Gain Coefficient
0.6; !- Visible Transmittance
OS:StandardsInformation:Construction,
{76b60829-32a3-458b-b50e-9bb10dbb284e}, !- Handle
{c9136c6c-97bc-40ab-be39-86d8ddf13584}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{c2667050-0b9d-42d5-af8b-2bd870d9a02d}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone 8, !- Name
{550f3767-8c2e-4659-ae81-7942f027937b}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{1d3fcefb-3dd0-4cde-956b-e9e873adf10f}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:StandardsInformation:Construction,
{c04711d3-e1ac-41ea-9d82-cfb0636d65c7}, !- Handle
{c2667050-0b9d-42d5-af8b-2bd870d9a02d}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{522a90a6-b899-4bbe-8504-b99fc8036e06}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone alt-res 8, !- Name
{fc8cb9a9-e8c5-4b40-8e80-4a874ffe86d1}, !- Surface Rendering Name
{294dfb44-15ad-4495-8f7c-a4a5662e2b57}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{294dfb44-15ad-4495-8f7c-a4a5662e2b57}, !- Handle
Fixed Window 2.67/0.30/0.21, !- Name
2.66866, !- U-Factor {W/m2-K}
0.49, !- Solar Heat Gain Coefficient
0.38; !- Visible Transmittance
OS:StandardsInformation:Construction,
{3bfe8e64-102b-4713-8849-a36097108513}, !- Handle
{522a90a6-b899-4bbe-8504-b99fc8036e06}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{0fa4fd77-d5bf-4d64-a4d6-046efe1c4b86}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone alt-res 3c, !- Name
{d6ddca45-2c1e-478d-9719-f8ce775d2ddc}, !- Surface Rendering Name
{61f8ae1a-ee13-4ab0-8ca4-46133bb4fdd4}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{61f8ae1a-ee13-4ab0-8ca4-46133bb4fdd4}, !- Handle
Fixed Window 5.84/0.61/0.47, !- Name
5.84000000000002, !- U-Factor {W/m2-K}
0.61, !- Solar Heat Gain Coefficient
0.47; !- Visible Transmittance
OS:StandardsInformation:Construction,
{862fb988-2720-4cda-be13-04e458cf17eb}, !- Handle
{0fa4fd77-d5bf-4d64-a4d6-046efe1c4b86}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{21761d39-072c-4e7c-9af8-40fa3fa0e171}, !- Handle
ASHRAE 90.1-2004 ExtRoof Metal ClimateZone 7, !- Name
{b4c45704-29b4-4420-9f01-faa3b24e61ca}, !- Surface Rendering Name
{380ac33b-a953-4530-8e51-f0bcdc8e2fd5}, !- Layer 1
{be973f10-c1ae-4e3e-b57d-eebd822048a4}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:Material,
{be973f10-c1ae-4e3e-b57d-eebd822048a4}, !- Handle
Metal Semi-Cond Roof Insulation-1.81, !- Name
MediumRough, !- Roughness
0.0795588880494838, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{282e1081-243b-4aba-9fd9-52a41a68f422}, !- Handle
{21761d39-072c-4e7c-9af8-40fa3fa0e171}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{58ad2640-4603-4f0a-97e2-643e6b685882}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone alt-resH 3a-3b, !- Name
{bcf1003e-f32c-4775-8cbe-5fc30aee4344}, !- Surface Rendering Name
{6a37c667-2394-4b0e-8be9-5c013a8b9ed4}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{6a37c667-2394-4b0e-8be9-5c013a8b9ed4}, !- Handle
Fixed Window 3.24/0.39/0.31, !- Name
3.23646, !- U-Factor {W/m2-K}
0.39, !- Solar Heat Gain Coefficient
0.31; !- Visible Transmittance
OS:StandardsInformation:Construction,
{64ce7de4-1625-4baf-886e-106818f62680}, !- Handle
{58ad2640-4603-4f0a-97e2-643e6b685882}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{aafb0365-14b4-4937-aa33-961c7abee217}, !- Handle
ASHRAE 90.1-2004 AtticFloor ClimateZone 1-5, !- Name
{352c6f8a-ef2a-4841-8615-a06fcb75ef92}, !- Surface Rendering Name
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}, !- Layer 1
{59c87b55-e1cd-496a-9aef-17a749c7a115}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{59c87b55-e1cd-496a-9aef-17a749c7a115}, !- Handle
AtticFloor NonRes Insulation-5.18, !- Name
MediumRough, !- Roughness
0.302609558350618, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{26f3b3ab-1f7c-47aa-b2e2-09209494ed45}, !- Handle
{aafb0365-14b4-4937-aa33-961c7abee217}, !- Construction Name
AtticFloor, !- Intended Surface Type
WoodFramed; !- Standards Construction Type
OS:Construction,
{43248f3b-e46e-4199-84d2-836d28d5f658}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone 1-2, !- Name
{ee948fd6-8ccb-4d3f-a0ba-2a1aac272a5d}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:StandardsInformation:Construction,
{92096a90-dc90-42bb-beab-1849843aa081}, !- Handle
{43248f3b-e46e-4199-84d2-836d28d5f658}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{34f16ee3-c69d-40a9-a645-e7d11ea7c6af}, !- Handle
ASHRAE 90.1-2004 ExtRoof IEAD ClimateZone 5-6, !- Name
{4665f8d9-1d15-4446-9b8b-aa7a092bc862}, !- Surface Rendering Name
{30028f24-6411-4e4b-8838-199e50b88dd5}, !- Layer 1
{f07c4553-a301-4af3-acea-1d13647ab6bd}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:StandardsInformation:Construction,
{ed26b360-fc83-42ae-b77f-0c62d6767117}, !- Handle
{34f16ee3-c69d-40a9-a645-e7d11ea7c6af}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
IEAD; !- Standards Construction Type
OS:Construction,
{4739908e-4a01-4ec9-84cb-9b77df1fc041}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone 1-2, !- Name
{aaa48ec9-518d-4b12-ba60-d7af069f1ebe}, !- Surface Rendering Name
{ccc2c584-a592-41db-be50-0874fc649b1d}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{ccc2c584-a592-41db-be50-0874fc649b1d}, !- Handle
Fixed Window 5.84/0.25/0.11, !- Name
5.84000000000002, !- U-Factor {W/m2-K}
0.25, !- Solar Heat Gain Coefficient
0.11; !- Visible Transmittance
OS:StandardsInformation:Construction,
{e34c4f2b-4648-4162-b4b2-0903e93867ad}, !- Handle
{4739908e-4a01-4ec9-84cb-9b77df1fc041}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{1b892e4e-8bab-4ce5-941b-375793fba140}, !- Handle
Interior Partition, !- Name
{4020ecf1-d097-458c-beee-b19b4fa0edc6}, !- Surface Rendering Name
{113a0723-3646-475d-9962-a33d2d9be9a0}; !- Layer 1
OS:Material,
{113a0723-3646-475d-9962-a33d2d9be9a0}, !- Handle
G05 25mm wood, !- Name
MediumSmooth, !- Roughness
0.0254, !- Thickness {m}
0.15, !- Conductivity {W/m-K}
608, !- Density {kg/m3}
1630, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.5, !- Solar Absorptance
0.5; !- Visible Absorptance
OS:StandardsInformation:Construction,
{e3e5e130-e5a1-4ac8-b6fd-7c9c1f59bc9d}, !- Handle
{1b892e4e-8bab-4ce5-941b-375793fba140}, !- Construction Name
InteriorPartition, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{81159b02-4eaf-48e8-8083-dc2abeacb5a8}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone alt-res 4-6, !- Name
{797821b5-4daf-4b5b-a935-7c99673b208c}, !- Surface Rendering Name
{73a581ba-90ef-4677-8410-cfc2ea1b95e2}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{73a581ba-90ef-4677-8410-cfc2ea1b95e2}, !- Handle
Fixed Window 3.81/0.39/0.27, !- Name
2.95256, !- U-Factor {W/m2-K}
0.39, !- Solar Heat Gain Coefficient
0.27; !- Visible Transmittance
OS:StandardsInformation:Construction,
{09eea50f-4f03-4a16-98b8-c0d6508b7d47}, !- Handle
{81159b02-4eaf-48e8-8083-dc2abeacb5a8}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{7f6bca69-0b0c-463f-9ba0-1310017f734d}, !- Handle
ASHRAE 90.1-2004 ExtWall Metal ClimateZone 4, !- Name
{8c25de0c-3fc8-4b30-a5e3-5dc820310317}, !- Surface Rendering Name
{4188840d-5044-4c07-948a-8716095439d8}, !- Layer 1
{e5dc6abe-14d9-48ea-bbb5-cbb836b2656e}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{4188840d-5044-4c07-948a-8716095439d8}, !- Handle
Metal Siding, !- Name
Smooth, !- Roughness
0.0015, !- Thickness {m}
44.9599999999999, !- Conductivity {W/m-K}
7688.86, !- Density {kg/m3}
410, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.6, !- Solar Absorptance
0.6; !- Visible Absorptance
OS:Material,
{e5dc6abe-14d9-48ea-bbb5-cbb836b2656e}, !- Handle
Metal Building Semi-Cond Wall Insulation-1.12, !- Name
MediumRough, !- Roughness
0.0437899773880745, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{a0ee5ebc-b8ec-4f88-8cf1-cf807df730ff}, !- Handle
{7f6bca69-0b0c-463f-9ba0-1310017f734d}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{8bb3b7e1-ff76-462d-bd29-69ba7caf3e7c}, !- Handle
ASHRAE 90.1-2004 ExtWall SteelFrame ClimateZone 1-4, !- Name
{c3e0db44-c6b0-42d7-bc0d-8e51b5cd0945}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{519a1edb-d73f-4a01-82e4-41cca4771508}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{519a1edb-d73f-4a01-82e4-41cca4771508}, !- Handle
Steel Frame NonRes Wall Insulation-1.42, !- Name
MediumRough, !- Roughness
0.0539159052000001, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{4dacda00-ccab-4e2f-9211-323996a75008}, !- Handle
{8bb3b7e1-ff76-462d-bd29-69ba7caf3e7c}, !- Construction Name
ExteriorWall, !- Intended Surface Type
SteelFramed; !- Standards Construction Type
OS:Construction,
{1d775235-9a6a-4874-84b3-30c7150b3036}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone 8, !- Name
{a0f184da-1f83-41a2-b11e-db5b2866416b}, !- Surface Rendering Name
{5d530508-7168-4408-b57a-867540e32451}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{5d530508-7168-4408-b57a-867540e32451}, !- Handle
Fixed Window 2.62/0.30/0.21, !- Name
2.61188, !- U-Factor {W/m2-K}
0.3, !- Solar Heat Gain Coefficient
0.21; !- Visible Transmittance
OS:StandardsInformation:Construction,
{6f856886-8248-46ec-adf2-b90c12044615}, !- Handle
{1d775235-9a6a-4874-84b3-30c7150b3036}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{1741fe01-cfb1-4d2d-a1de-92816bb502f7}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone alt-res 7, !- Name
{fd528f1f-e491-412f-ad7e-508d9c5160de}, !- Surface Rendering Name
{a167997a-00ba-4a37-8f61-ce40f5e580dc}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{a167997a-00ba-4a37-8f61-ce40f5e580dc}, !- Handle
Fixed Window 3.81/0.49/0.38, !- Name
2.95256, !- U-Factor {W/m2-K}
0.49, !- Solar Heat Gain Coefficient
0.38; !- Visible Transmittance
OS:StandardsInformation:Construction,
{e0aee1d8-3875-491a-8dd6-5a57bfa71ae5}, !- Handle
{1741fe01-cfb1-4d2d-a1de-92816bb502f7}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{c6b6e13b-45a5-4bb2-b20f-a4517a52fe0c}, !- Handle
ASHRAE 90.1-2004 ExtWall Metal ClimateZone 6-8, !- Name
{6bed0f95-67dc-44c8-a2d7-5f2efe19b59e}, !- Surface Rendering Name
{4188840d-5044-4c07-948a-8716095439d8}, !- Layer 1
{cf6c96d6-09f2-42b3-8263-656d77e234c6}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{cf6c96d6-09f2-42b3-8263-656d77e234c6}, !- Handle
Metal Building Semi-Cond Wall Insulation-1.37, !- Name
MediumRough, !- Roughness
0.0557583952804708, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{ceba110a-a783-41ff-a2fd-1f4df41c650a}, !- Handle
{c6b6e13b-45a5-4bb2-b20f-a4517a52fe0c}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{8d781132-d93a-4eee-99ed-eb803e99a290}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone 7, !- Name
{992f4f03-933a-4ebd-a3bc-391a25688266}, !- Surface Rendering Name
{9dd4d7cb-8ccb-40a5-9496-5ee2351d2796}; !- Layer 1
OS:WindowMaterial:SimpleGlazingSystem,
{9dd4d7cb-8ccb-40a5-9496-5ee2351d2796}, !- Handle
Fixed Window 3.24/0.49/0.41, !- Name
3.23646, !- U-Factor {W/m2-K}
0.49, !- Solar Heat Gain Coefficient
0.41; !- Visible Transmittance
OS:StandardsInformation:Construction,
{375078a9-5551-4e12-9dc6-c3602622b464}, !- Handle
{8d781132-d93a-4eee-99ed-eb803e99a290}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{608467f9-1ddd-4520-9f4f-e7be647a81bf}, !- Handle
ASHRAE 90.1-2004 ExtWall SteelFrame ClimateZone 5-6, !- Name
{47cc45dc-7b53-4d5f-b662-94b59c8b3866}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{39b65864-7835-4c8e-b595-744bc3f3bf27}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{39b65864-7835-4c8e-b595-744bc3f3bf27}, !- Handle
Steel Frame NonRes Wall Insulation-2.10, !- Name
MediumRough, !- Roughness
0.0870564552646046, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{9452172c-4872-4604-ad0c-bbbd2a734991}, !- Handle
{608467f9-1ddd-4520-9f4f-e7be647a81bf}, !- Construction Name
ExteriorWall, !- Intended Surface Type
SteelFramed; !- Standards Construction Type
OS:Construction,
{05eda8c6-26bf-45f4-a177-c853ccb2c51d}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone alt-resA 3a-3b, !- Name
{a6951a96-1204-45c5-b8f1-ae4a7e72e173}, !- Surface Rendering Name
{73a581ba-90ef-4677-8410-cfc2ea1b95e2}; !- Layer 1
OS:StandardsInformation:Construction,
{7363c8c8-deb3-4f0e-a9a2-e0347923913c}, !- Handle
{05eda8c6-26bf-45f4-a177-c853ccb2c51d}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{b4c32d79-f021-4e53-a658-fb52590b3264}, !- Handle
ASHRAE 90.1-2004 ExtRoof Metal ClimateZone 5-6, !- Name
{7b5cb4d2-d45c-4c14-b20b-9b719da62c3d}, !- Surface Rendering Name
{380ac33b-a953-4530-8e51-f0bcdc8e2fd5}, !- Layer 1
{a38c0c45-fb32-42dc-9607-79e8b3221547}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:Material,
{a38c0c45-fb32-42dc-9607-79e8b3221547}, !- Handle
Metal Semi-Cond Roof Insulation-1.87, !- Name
MediumRough, !- Roughness
0.0822341258092582, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{ca7e2c3e-2d35-4375-ac7c-f1af46777652}, !- Handle
{b4c32d79-f021-4e53-a658-fb52590b3264}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{b231fecf-1c9c-4916-811d-ed144a236b1d}, !- Handle
ASHRAE 90.1-2004 ExtWall SteelFrame ClimateZone alt-res 3, !- Name
{55cb38da-4245-4511-bdec-6e50f9cc878b}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{39b65864-7835-4c8e-b595-744bc3f3bf27}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:StandardsInformation:Construction,
{f58444dd-15e3-41ac-9836-abe00e58b0ce}, !- Handle
{b231fecf-1c9c-4916-811d-ed144a236b1d}, !- Construction Name
ExteriorWall, !- Intended Surface Type
SteelFramed; !- Standards Construction Type
OS:Construction,
{73fe8c40-5d7b-45bb-bc38-7a99c49e57a9}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone alt-res 5-6, !- Name
{87e871bd-b6f4-4482-97a3-cdb20d59b38e}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{89f414af-9231-4912-a076-102d05c66aee}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:Material,
{89f414af-9231-4912-a076-102d05c66aee}, !- Handle
Mass NonRes Wall Insulation-1.96, !- Name
MediumRough, !- Roughness
0.0752751486901879, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{580c257e-cfc7-42d5-bc15-3e06514fba58}, !- Handle
{73fe8c40-5d7b-45bb-bc38-7a99c49e57a9}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{ddf69928-b958-4a3a-8310-279c0f9d6ac5}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone 7, !- Name
{720a3fcc-01f4-4f17-ab18-7e1525fdd48f}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{89f414af-9231-4912-a076-102d05c66aee}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:StandardsInformation:Construction,
{34137e0c-408d-4506-ab36-95a4ad133784}, !- Handle
{ddf69928-b958-4a3a-8310-279c0f9d6ac5}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{30010092-070b-49e1-a3f0-aeca04004d52}, !- Handle
Exterior Door, !- Name
{113f73d5-9fe4-4781-8c99-24f265349f95}, !- Surface Rendering Name
{d09b0fbd-16a6-474d-ac08-483f38f3341a}, !- Layer 1
{798074e2-9644-4cf4-9a75-81e69579bf8e}; !- Layer 2
OS:Material,
{d09b0fbd-16a6-474d-ac08-483f38f3341a}, !- Handle
F08 Metal surface, !- Name
Smooth, !- Roughness
0.0008, !- Thickness {m}
45.2800000000001, !- Conductivity {W/m-K}
7823.99999999999, !- Density {kg/m3}
500, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:Material,
{798074e2-9644-4cf4-9a75-81e69579bf8e}, !- Handle
I01 25mm insulation board, !- Name
MediumRough, !- Roughness
0.0254, !- Thickness {m}
0.03, !- Conductivity {W/m-K}
43, !- Density {kg/m3}
1210, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.6, !- Solar Absorptance
0.6; !- Visible Absorptance
OS:StandardsInformation:Construction,
{af2e3f4b-0d29-4de1-9894-bda9666e2fa9}, !- Handle
{30010092-070b-49e1-a3f0-aeca04004d52}, !- Construction Name
ExteriorDoor, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{fec7e9cd-07ce-400c-a3ee-d3e02eab6414}, !- Handle
ASHRAE 90.1-2004 ExtWall Metal ClimateZone 2-3, !- Name
{3289e140-2244-4f6a-864a-29a96bc70b46}, !- Surface Rendering Name
{4188840d-5044-4c07-948a-8716095439d8}, !- Layer 1
{1d4fb379-6747-4a3e-86b7-95c6499bd83c}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{1d4fb379-6747-4a3e-86b7-95c6499bd83c}, !- Handle
Metal Building Semi-Cond Wall Insulation-0.77, !- Name
MediumRough, !- Roughness
0.0262895733787478, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{7b74f468-35e8-4a33-a867-74e4cd0ad00b}, !- Handle
{fec7e9cd-07ce-400c-a3ee-d3e02eab6414}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{6a340a90-5151-4f93-ae9f-6eaa8ff9389b}, !- Handle
ASHRAE 90.1-2004 ExtWall Metal ClimateZone 5, !- Name
{c1047da4-5068-466d-a43f-45500011b492}, !- Surface Rendering Name
{4188840d-5044-4c07-948a-8716095439d8}, !- Layer 1
{3faca884-ac38-4471-bd0e-12cdf4055f27}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{3faca884-ac38-4471-bd0e-12cdf4055f27}, !- Handle
Metal Building Semi-Cond Wall Insulation-1.24, !- Name
MediumRough, !- Roughness
0.0495494599433394, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{efca3bb9-c31b-49bc-bd47-65db00e947f3}, !- Handle
{6a340a90-5151-4f93-ae9f-6eaa8ff9389b}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{99d4de5f-21c6-4ed2-8be8-54e9cac45ab7}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone alt-res 3, !- Name
{beb8871f-3b01-4c51-9e3a-0e118e9809ab}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{77e1e725-840d-4482-be09-53324dd6cc98}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:Material,
{77e1e725-840d-4482-be09-53324dd6cc98}, !- Handle
Mass NonRes Wall Insulation-1.43, !- Name
MediumRough, !- Roughness
0.0495494599433394, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{dc253899-98b7-48f7-9f51-9371fdf11540}, !- Handle
{99d4de5f-21c6-4ed2-8be8-54e9cac45ab7}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{5902524b-decb-440c-88b4-ae88ced5a05c}, !- Handle
ASHRAE 90.1-2004 ExtWindow ClimateZone 4-6, !- Name
{b6949b4a-41a2-45df-b04d-1e2f34305a58}, !- Surface Rendering Name
{6a37c667-2394-4b0e-8be9-5c013a8b9ed4}; !- Layer 1
OS:StandardsInformation:Construction,
{395caade-18dd-4b0c-a085-b04e8cade387}, !- Handle
{5902524b-decb-440c-88b4-ae88ced5a05c}, !- Construction Name
ExteriorWindow, !- Intended Surface Type
; !- Standards Construction Type
OS:Construction,
{b3e5ded0-d8e6-4522-aa39-2a3f1d2482ff}, !- Handle
ASHRAE 90.1-2004 ExtRoof Metal ClimateZone 8, !- Name
{09f48843-9cb3-4fc7-ab18-7672a166d1d5}, !- Surface Rendering Name
{380ac33b-a953-4530-8e51-f0bcdc8e2fd5}, !- Layer 1
{40559ee1-ba04-43dc-ac5a-68283ee47ffe}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:Material,
{40559ee1-ba04-43dc-ac5a-68283ee47ffe}, !- Handle
Metal Semi-Cond Roof Insulation-2.50, !- Name
MediumRough, !- Roughness
0.113125446059399, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{cfb44aae-84e7-47cc-8aba-2f9681a00355}, !- Handle
{b3e5ded0-d8e6-4522-aa39-2a3f1d2482ff}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{ae7711ad-317a-4936-86ff-92a41c721210}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone alt-res 8, !- Name
{ff37745e-6d28-425c-8dcb-62175b53435c}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{ad6ba045-be52-4c39-9de0-425ef9d9cb8d}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:Material,
{ad6ba045-be52-4c39-9de0-425ef9d9cb8d}, !- Handle
Mass NonRes Wall Insulation-2.48, !- Name
MediumRough, !- Roughness
0.100934958592615, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{b99d6831-1a14-486e-8e98-903ca848bd27}, !- Handle
{ae7711ad-317a-4936-86ff-92a41c721210}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Construction,
{8a98a028-a269-481a-adef-473598bb70b7}, !- Handle
ASHRAE 90.1-2004 AtticFloor ClimateZone 6-8, !- Name
{169b6d02-981a-4465-a7a3-2f4e5754e110}, !- Surface Rendering Name
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}, !- Layer 1
{d94a32f8-857a-4e47-95fd-1001d2c3f69b}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{d94a32f8-857a-4e47-95fd-1001d2c3f69b}, !- Handle
AtticFloor NonRes Insulation-6.52, !- Name
MediumRough, !- Roughness
0.30260955835062, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{33caca0a-ebfb-4dd3-a9a8-5c5c6c7f24d1}, !- Handle
{8a98a028-a269-481a-adef-473598bb70b7}, !- Construction Name
AtticFloor, !- Intended Surface Type
WoodFramed; !- Standards Construction Type
OS:Construction,
{9df86269-1494-4fcf-ba71-c169cb9492fb}, !- Handle
ASHRAE 90.1-2004 ExtRoof Metal ClimateZone 1, !- Name
{eb0bf1dc-6e50-4fef-a709-b499d94c2baf}, !- Surface Rendering Name
{380ac33b-a953-4530-8e51-f0bcdc8e2fd5}; !- Layer 1
OS:StandardsInformation:Construction,
{10a80ac2-6bb8-4e95-82fc-f0811aa26c8a}, !- Handle
{9df86269-1494-4fcf-ba71-c169cb9492fb}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{e5ff11ac-8553-4fba-adc5-4c3e4aef59b0}, !- Handle
ASHRAE 90.1-2004 ExtRoof Metal ClimateZone 3-4, !- Name
{7861fd0f-717c-4966-b264-ea151ea0123c}, !- Surface Rendering Name
{380ac33b-a953-4530-8e51-f0bcdc8e2fd5}, !- Layer 1
{be973f10-c1ae-4e3e-b57d-eebd822048a4}, !- Layer 2
{3ac19517-f998-49cf-a48b-4491fb351960}; !- Layer 3
OS:StandardsInformation:Construction,
{98729292-a619-444c-b79f-2c227ed031c7}, !- Handle
{e5ff11ac-8553-4fba-adc5-4c3e4aef59b0}, !- Construction Name
ExteriorRoof, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{9b1e8eb6-d46a-43ed-b0d2-837b664409e9}, !- Handle
ASHRAE 90.1-2004 ExtWall Metal ClimateZone 1, !- Name
{8c41e771-8dfa-4da7-b79d-bfd787c75bea}, !- Surface Rendering Name
{4188840d-5044-4c07-948a-8716095439d8}, !- Layer 1
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 2
OS:StandardsInformation:Construction,
{7182bbe8-daa3-46a9-9534-f11f664090d8}, !- Handle
{9b1e8eb6-d46a-43ed-b0d2-837b664409e9}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Metal; !- Standards Construction Type
OS:Construction,
{2327672f-3ada-4ba2-a7a0-5eadddc07e9d}, !- Handle
ASHRAE 90.1-2004 ExtWall SteelFrame ClimateZone alt-res 8, !- Name
{7ef4f632-be31-4ec5-9240-7727c51c13bb}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{6a48b56d-1a94-4100-a088-5ddef8d041c4}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{6a48b56d-1a94-4100-a088-5ddef8d041c4}, !- Handle
Steel Frame NonRes Wall Insulation-3.21, !- Name
MediumRough, !- Roughness
0.14122619066012, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{c5abd5ed-6c32-45f6-af64-fca70c6f6a79}, !- Handle
{2327672f-3ada-4ba2-a7a0-5eadddc07e9d}, !- Construction Name
ExteriorWall, !- Intended Surface Type
SteelFramed; !- Standards Construction Type
OS:Construction,
{498cfd8f-fcb6-4f36-9a70-bc585546c8f5}, !- Handle
ASHRAE 90.1-2004 ExtWall WoodFrame ClimateZone 8, !- Name
{aeb78917-75c6-4ada-a0c1-650ae429f941}, !- Surface Rendering Name
{68acfcdd-bcd7-4767-ab86-047636621495}, !- Layer 1
{0633f335-22f1-44f7-9273-62aafe32c7fd}, !- Layer 2
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 3
OS:Material,
{0633f335-22f1-44f7-9273-62aafe32c7fd}, !- Handle
Wood Frame NonRes Wall Insulation-3.45, !- Name
MediumRough, !- Roughness
0.153532499715495, !- Thickness {m}
0.049, !- Conductivity {W/m-K}
265, !- Density {kg/m3}
836.800000000001, !- Specific Heat {J/kg-K}
0.9, !- Thermal Absorptance
0.7, !- Solar Absorptance
0.7; !- Visible Absorptance
OS:StandardsInformation:Construction,
{0e78498c-645a-4e0c-9287-86365c8c4d23}, !- Handle
{498cfd8f-fcb6-4f36-9a70-bc585546c8f5}, !- Construction Name
ExteriorWall, !- Intended Surface Type
WoodFramed; !- Standards Construction Type
OS:Construction,
{186bafd3-6103-4a18-b252-8536f8bf4086}, !- Handle
ASHRAE 90.1-2004 ExtWall Mass ClimateZone 5, !- Name
{3c643a00-0ddd-4c4d-915a-27a9a7e9d3f0}, !- Surface Rendering Name
{6119e650-b1e5-47fc-a8c1-de694d2074fb}, !- Layer 1
{55379cf3-0588-4b86-bf74-423688fff06a}, !- Layer 2
{77e1e725-840d-4482-be09-53324dd6cc98}, !- Layer 3
{0263a8f1-21ae-4625-8c0f-f4421a33ceac}; !- Layer 4
OS:StandardsInformation:Construction,
{5f49cf25-f20c-4d9c-9e21-d017d29e32ab}, !- Handle
{186bafd3-6103-4a18-b252-8536f8bf4086}, !- Construction Name
ExteriorWall, !- Intended Surface Type
Mass; !- Standards Construction Type
OS:Building,
{ec23a70e-1468-4d3d-a971-c3cb0b2edcd9}, !- Handle
Building 1, !- Name
, !- Building Sector Type
0, !- North Axis {deg}
, !- Nominal Floor to Floor Height {m}
, !- Space Type Name
{1bf4a8eb-bab2-4478-b469-a5198b6cb342}, !- Default Construction Set Name
; !- Default Schedule Set Name
OS:DefaultConstructionSet,
{1bf4a8eb-bab2-4478-b469-a5198b6cb342}, !- Handle
MyConsturction, !- Name
{59224cb9-57c4-47c9-8d8e-c79aee037d6e}, !- Default Exterior Surface Constructions Name
{59224cb9-57c4-47c9-8d8e-c79aee037d6e}, !- Default Interior Surface Constructions Name
{59224cb9-57c4-47c9-8d8e-c79aee037d6e}, !- Default Ground Contact Surface Constructions Name
{beff099d-0fe9-4a05-acbe-dbd27ba96dcd}, !- Default Exterior SubSurface Constructions Name
{beff099d-0fe9-4a05-acbe-dbd27ba96dcd}, !- Default Interior SubSurface Constructions Name
{1b892e4e-8bab-4ce5-941b-375793fba140}, !- Interior Partition Construction Name
, !- Space Shading Construction Name
, !- Building Shading Construction Name
; !- Site Shading Construction Name
OS:DefaultSurfaceConstructions,
{59224cb9-57c4-47c9-8d8e-c79aee037d6e}, !- Handle
Default Surface Constructions 1, !- Name
{67a9d98c-d980-431b-8428-a5b5823ce43b}, !- Floor Construction Name
{67a9d98c-d980-431b-8428-a5b5823ce43b}, !- Wall Construction Name
{67a9d98c-d980-431b-8428-a5b5823ce43b}; !- Roof Ceiling Construction Name
OS:DefaultSubSurfaceConstructions,
{beff099d-0fe9-4a05-acbe-dbd27ba96dcd}, !- Handle
Default Sub Surface Constructions 1, !- Name
{5902524b-decb-440c-88b4-ae88ced5a05c}, !- Fixed Window Construction Name
{5902524b-decb-440c-88b4-ae88ced5a05c}, !- Operable Window Construction Name
{30010092-070b-49e1-a3f0-aeca04004d52}, !- Door Construction Name
{5902524b-decb-440c-88b4-ae88ced5a05c}, !- Glass Door Construction Name
, !- Overhead Door Construction Name
{5902524b-decb-440c-88b4-ae88ced5a05c}, !- Skylight Construction Name
{df807951-c23d-4cbc-8322-693b4dab577c}, !- Tubular Daylight Dome Construction Name
{df807951-c23d-4cbc-8322-693b4dab577c}; !- Tubular Daylight Diffuser Construction Name
OS:Space,
{18cae7d8-8529-49ed-b8f1-9a7f4df0fdf6}, !- Handle
Roof, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-55.0553339831846, !- X Origin {m}
11.667261889578, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{cdf84f89-e192-4638-8fea-70eda51811f7}; !- Thermal Zone Name
OS:Surface,
{7a622747-8355-4a68-b102-810de4f21dc8}, !- Handle
Surface 456, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{18cae7d8-8529-49ed-b8f1-9a7f4df0fdf6}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933759, -7.30468169933757, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092468, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-1.4210854715202e-14, -3.19744231092045e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{1393ab35-19fd-44d8-b805-16ae59678d93}, !- Handle
Roof 1, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-47.2322970247546, !- X Origin {m}
19.490298848008, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{3cd2c7c4-0db4-4eaa-8eaf-52223f5696e6}; !- Thermal Zone Name
OS:Surface,
{fdbfd16d-5ef0-4a54-b441-76ea96b6d70e}, !- Handle
Surface 462, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{1393ab35-19fd-44d8-b805-16ae59678d93}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933759, -7.30468169933753, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.51835525909247, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695842999, 7.82303695842997, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-1.4210854715202e-14, -3.19744231092045e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{684ee95c-7766-4d26-84d7-08d87d86620b}, !- Handle
Roof 2, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-47.750652283847, !- X Origin {m}
4.36258019024046, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{8b65f105-4ae2-4d61-9c1a-2dfcd1d2b22c}; !- Thermal Zone Name
OS:Surface,
{4d4affe6-7887-4cc8-be26-2323d386b6ca}, !- Handle
Surface 468, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{684ee95c-7766-4d26-84d7-08d87d86620b}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933761, -7.30468169933758, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092424, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695843001, 7.82303695843004, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
7.105427357601e-15, 3.5527136788005e-15, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{6952aaeb-547c-4441-a365-bedf28eb9a96}, !- Handle
Roof 3, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-39.927615325417, !- X Origin {m}
12.1856171486705, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{15479aeb-dc9d-4391-a081-7388dd9d6e7c}; !- Thermal Zone Name
OS:Surface,
{7e87e500-a26f-483f-bf1b-2e26d9aa813c}, !- Handle
Surface 474, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{6952aaeb-547c-4441-a365-bedf28eb9a96}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933761, -7.30468169933758, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092443, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695843001, 7.82303695843004, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
7.105427357601e-15, 4.44089209850063e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{e501882f-aa45-4f9c-b153-1c98e34f6dd6}, !- Handle
Roof 4, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-40.4459705845094, !- X Origin {m}
-2.94210150909712, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{07e5b72a-42bb-415b-b2eb-9aaa2775d9f0}; !- Thermal Zone Name
OS:Surface,
{387c1f9a-00ed-4356-8be6-d12967fa6436}, !- Handle
Surface 480, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{e501882f-aa45-4f9c-b153-1c98e34f6dd6}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933754, -7.30468169933758, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577675, 0.518355259092429, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695843004, 7.82303695843, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
3.5527136788005e-14, -8.88178419700125e-16, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{3fda0bbe-c92b-40e9-92a2-4c0e0b280cfd}, !- Handle
Roof 5, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-32.6229336260794, !- X Origin {m}
4.88093544933288, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{5be5609d-1c2b-4cfd-a0d5-de8a87676ecb}; !- Thermal Zone Name
OS:Surface,
{83c6e519-e91b-4560-8968-d1d71957ded6}, !- Handle
Surface 486, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{3fda0bbe-c92b-40e9-92a2-4c0e0b280cfd}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933754, -7.30468169933757, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577675, 0.51835525909243, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695843004, 7.82303695843002, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
4.2632564145606e-14, 0, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{3c0a2271-f7f2-42fa-b09f-7a413e730db7}, !- Handle
Roof 6, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-33.1412888851719, !- X Origin {m}
-10.2467832084347, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{8a143944-1f37-4bd6-b42b-23d925d1c5ff}; !- Thermal Zone Name
OS:Surface,
{eccfa4a6-14ab-4360-b0d5-44dff101c993}, !- Handle
Surface 492, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{3c0a2271-f7f2-42fa-b09f-7a413e730db7}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933756, -7.30468169933761, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092422, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695842996, 7.82303695843, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-4.2632564145606e-14, -7.105427357601e-15, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{d5b169ab-852e-4785-895f-9c095eb05fa9}, !- Handle
Roof 7, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-25.3182519267419, !- X Origin {m}
-2.42374625000469, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{d14b52ed-7965-4203-be40-8e2a4519d322}; !- Thermal Zone Name
OS:Surface,
{f3aca4c9-ab92-45ea-b286-681c7bf73bb9}, !- Handle
Surface 498, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{d5b169ab-852e-4785-895f-9c095eb05fa9}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933756, -7.30468169933758, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092423, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695842996, 7.82303695843, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-3.90798504668055e-14, 3.10862446895044e-15, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{c8f853e5-332d-42e7-9ab3-f511ca1f4cc4}, !- Handle
Roof 8, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-25.8366071858343, !- X Origin {m}
-17.5514649077723, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{7ec91fef-28c9-48e8-8e48-2c6681579209}; !- Thermal Zone Name
OS:Surface,
{2a7b2a51-d017-4ee6-b8c7-24ff773f3fde}, !- Handle
Surface 504, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{c8f853e5-332d-42e7-9ab3-f511ca1f4cc4}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933758, -7.30468169933753, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.51835525909247, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695842998, 7.82303695843, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-1.77635683940025e-14, -2.8421709430404e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{efafa724-0984-4cb9-8443-28170b821fdb}, !- Handle
Roof 9, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-18.0135702274043, !- X Origin {m}
-9.72842794934227, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{92356d01-0b91-478e-a28d-dbc45e878d16}; !- Thermal Zone Name
OS:Surface,
{5e04fea5-89bc-48f5-b3ec-02e658ea8bd8}, !- Handle
Surface 510, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{efafa724-0984-4cb9-8443-28170b821fdb}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933758, -7.30468169933753, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092422, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695842998, 7.82303695843, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-1.77635683940025e-14, 1.77635683940025e-15, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{db588ad5-7ad8-4053-b852-88e4ccfa7ca1}, !- Handle
Roof 10, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-18.5319254864967, !- X Origin {m}
-24.8561466071098, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{be61136e-3eb8-43ba-8a96-8fd2096074a0}; !- Thermal Zone Name
OS:Surface,
{82077342-e3fc-4eb5-a0de-a5faaa03d622}, !- Handle
Surface 516, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{db588ad5-7ad8-4053-b852-88e4ccfa7ca1}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.3046816993376, -7.30468169933755, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092445, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695843, 7.82303695843004, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
3.5527136788005e-15, 4.61852778244065e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{97573eae-8adf-4ff8-9e85-27c344f4f8d6}, !- Handle
Roof 11, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-10.7088885280667, !- X Origin {m}
-17.0331096486798, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{d1df30f4-15b7-4dd4-beba-813c5b218831}; !- Thermal Zone Name
OS:Surface,
{6f649c04-7537-4b06-87f3-bb2ee3f1a509}, !- Handle
Surface 522, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{97573eae-8adf-4ff8-9e85-27c344f4f8d6}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
7.30468169933757, -7.30468169933755, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
15.1277186577676, 0.518355259092449, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.82303695843, 7.82303695843, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
5.32907051820075e-15, 4.61852778244065e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{6b000396-3f38-465a-b5ef-f249d9046c08}, !- Handle
Roof 12, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-11.2272437871591, !- X Origin {m}
-32.1608283064474, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{e3a57f3e-dbb4-4962-b1c1-112b3ca63564}; !- Thermal Zone Name
OS:Surface,
{8b3737b7-e314-463a-9ae5-b8b6ed121008}, !- Handle
Surface 528, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{6b000396-3f38-465a-b5ef-f249d9046c08}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147094, -6.46502169147097, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901133, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048228, 7.97498598048233, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
2.48689957516035e-14, 2.8421709430404e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{c37d3138-d527-4f18-bd12-78795d3bd88e}, !- Handle
Roof 13, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-3.25225780667685, !- X Origin {m}
-24.1858423259651, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{c6d33850-95f4-430c-a11e-bfb3ca4c84d7}; !- Thermal Zone Name
OS:Surface,
{994d1305-359c-4c55-9a8d-cc8eabc77575}, !- Handle
Surface 534, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{c37d3138-d527-4f18-bd12-78795d3bd88e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147095, -6.46502169147095, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901135, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048228, 7.97498598048225, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-3.5527136788005e-15, 4.61852778244065e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{6c88b3aa-c2aa-4b7b-9460-e7466882a31e}, !- Handle
Roof 14, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
4.72272817380543, !- X Origin {m}
-16.2108563454829, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{c8969937-f295-4556-99c2-ff2acf4377bc}; !- Thermal Zone Name
OS:Surface,
{d9276036-c2a9-4f0d-b7a0-28fa913898bf}, !- Handle
Surface 540, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{6c88b3aa-c2aa-4b7b-9460-e7466882a31e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147097, -6.46502169147093, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719533, 1.50996428901137, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048227, 7.97498598048228, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-2.66453525910038e-15, -3.19744231092045e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{c8ab94c4-c885-43dc-a426-7783d00a9007}, !- Handle
Roof 15, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
12.6977141542877, !- X Origin {m}
-8.23587036500059, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{2dc85d1e-87da-406b-afbb-bc14b02f610c}; !- Thermal Zone Name
OS:Surface,
{fdff994e-573a-4d21-b069-790fb5632fd9}, !- Handle
Surface 546, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{c8ab94c4-c885-43dc-a426-7783d00a9007}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147099, -6.46502169147091, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901134, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048229, 7.97498598048228, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-8.88178419700125e-15, 0, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{81ee2b61-fb7b-45b8-b110-908f824f7791}, !- Handle
Roof 16, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
20.67270013477, !- X Origin {m}
-0.26088438451831, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{97c79966-9dbb-4546-9b99-7c56928065fd}; !- Thermal Zone Name
OS:Surface,
{95382f67-37e7-42ea-815a-ff9d52d26a36}, !- Handle
Surface 552, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{81ee2b61-fb7b-45b8-b110-908f824f7791}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147091, -6.46502169147094, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901134, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048231, 7.97498598048228, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
1.06581410364015e-14, -4.44089209850063e-16, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{122a306d-0f60-471b-be17-59f1fed1f6aa}, !- Handle
Roof 17, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
28.6476861152523, !- X Origin {m}
7.71410159596397, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{e0503da7-f04f-447d-9336-ee0898d53c47}; !- Thermal Zone Name
OS:Surface,
{ae086339-ae2d-42fa-8c99-f2a6c031ffdf}, !- Handle
Surface 558, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{122a306d-0f60-471b-be17-59f1fed1f6aa}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147093, -6.46502169147094, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901133, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048223, 7.97498598048223, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
2.8421709430404e-14, -4.44089209850063e-15, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{8e7ca5a9-e265-47f5-b558-4e013dce5646}, !- Handle
Roof 18, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
-4.76222209568818, !- X Origin {m}
-38.6258499979184, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{11d43e88-a3cd-43d2-a412-6b251ba8ddaf}; !- Thermal Zone Name
OS:Surface,
{26f61529-67d0-403e-90ff-773f0212b1c6}, !- Handle
Surface 564, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{8e7ca5a9-e265-47f5-b558-4e013dce5646}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147095, -6.46502169147093, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901137, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048228, 7.97498598048227, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-3.5527136788005e-15, -2.8421709430404e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{86e0cf6e-17fa-4d4c-8f0e-b8146cc12c8e}, !- Handle
Roof 19, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
3.2127638847941, !- X Origin {m}
-30.6508640174361, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{41699387-49d1-4739-a83c-afbfafd0e0bf}; !- Thermal Zone Name
OS:Surface,
{3d4ba3b5-e717-4715-9542-8d71432f8c14}, !- Handle
Surface 570, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{86e0cf6e-17fa-4d4c-8f0e-b8146cc12c8e}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147095, -6.46502169147091, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901129, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.9749859804823, 7.97498598048229, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-1.77635683940025e-15, -7.105427357601e-15, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{6e30bb1c-7f72-4db8-8cf0-015fb154ae04}, !- Handle
Roof 20, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
11.1877498652764, !- X Origin {m}
-22.6758780369538, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{231f227f-a906-4ec8-8c94-8d389c308230}; !- Thermal Zone Name
OS:Surface,
{a7f15c6c-4414-4329-a170-a144e27b37b4}, !- Handle
Surface 576, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{6e30bb1c-7f72-4db8-8cf0-015fb154ae04}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147092, -6.46502169147099, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901131, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048232, 7.97498598048231, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
1.95399252334028e-14, 1.06581410364015e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{f99c9662-307d-4e10-8f4f-75033b2d2d49}, !- Handle
Roof 21, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
19.1627358457587, !- X Origin {m}
-14.7008920564715, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{774cb31d-7d12-47cf-8cf3-c7fb8f030f8b}; !- Thermal Zone Name
OS:Surface,
{1cb5fe27-464a-449a-9736-e4c1ef9f7d12}, !- Handle
Surface 582, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{f99c9662-307d-4e10-8f4f-75033b2d2d49}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147094, -6.46502169147097, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901133, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048224, 7.97498598048228, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
4.2632564145606e-14, 3.37507799486048e-14, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{658e6bdd-9880-4e57-ba0d-f50ad776fc22}, !- Handle
Roof 22, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
27.1377218262409, !- X Origin {m}
-6.72590607598925, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{b8f1fa8a-d5cc-4e3b-8749-114afe26cde4}; !- Thermal Zone Name
OS:Surface,
{7849f706-dda1-494a-8959-53db156716b6}, !- Handle
Surface 588, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{658e6bdd-9880-4e57-ba0d-f50ad776fc22}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147096, -6.46502169147095, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719533, 1.50996428901133, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048226, 7.97498598048228, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-3.90798504668055e-14, 4.44089209850063e-15, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:Space,
{972d74de-a02f-4fc8-b8a4-2dde7c16f2de}, !- Handle
Roof 23, !- Name
, !- Space Type Name
, !- Default Construction Set Name
, !- Default Schedule Set Name
-0, !- Direction of Relative North {deg}
35.1127078067232, !- X Origin {m}
1.24907990449303, !- Y Origin {m}
49.9, !- Z Origin {m}
, !- Building Story Name
{00288094-b1cb-404c-a278-0281bf072179}; !- Thermal Zone Name
OS:Surface,
{d948b451-9367-4c1e-bf0a-928d7fab04f9}, !- Handle
Surface 594, !- Name
RoofCeiling, !- Surface Type
, !- Construction Name
{972d74de-a02f-4fc8-b8a4-2dde7c16f2de}, !- Space Name
Outdoors, !- Outside Boundary Condition
, !- Outside Boundary Condition Object
SunExposed, !- Sun Exposure
WindExposed, !- Wind Exposure
, !- View Factor to Ground
, !- Number of Vertices
6.46502169147098, -6.46502169147095, 0.100000000000001, !- X,Y,Z Vertex 1 {m}
14.4400076719532, 1.50996428901132, 0.100000000000001, !- X,Y,Z Vertex 2 {m}
7.97498598048228, 7.97498598048227, 0.100000000000001, !- X,Y,Z Vertex 3 {m}
-2.1316282072803e-14, 2.22044604925031e-16, 0.100000000000001; !- X,Y,Z Vertex 4 {m}
OS:ThermalZone,
{e0503da7-f04f-447d-9336-ee0898d53c47}, !- Handle
Thermal Zone 16, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{530f7b95-739f-441a-a9b9-a9b48675f538}, !- Zone Air Inlet Port List
{cb417491-8465-4c6e-b249-5cd201e67ba8}, !- Zone Air Exhaust Port List
{a4b76198-0459-433a-9772-2836c5d2df5f}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{4c7b880b-907b-428c-a66a-1316cc6fa630}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{cf0cfaf2-8e9b-4663-9c8f-8e9d9e8aa715}, !- Handle
Node 16, !- Name
{a4b76198-0459-433a-9772-2836c5d2df5f}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{a4b76198-0459-433a-9772-2836c5d2df5f}, !- Handle
{09f375b4-1fee-4580-b220-9d716fb0e205}, !- Name
{e0503da7-f04f-447d-9336-ee0898d53c47}, !- Source Object
11, !- Outlet Port
{cf0cfaf2-8e9b-4663-9c8f-8e9d9e8aa715}, !- Target Object
2; !- Inlet Port
OS:PortList,
{530f7b95-739f-441a-a9b9-a9b48675f538}, !- Handle
Port List 31, !- Name
{e0503da7-f04f-447d-9336-ee0898d53c47}; !- HVAC Component
OS:PortList,
{cb417491-8465-4c6e-b249-5cd201e67ba8}, !- Handle
Port List 32, !- Name
{e0503da7-f04f-447d-9336-ee0898d53c47}; !- HVAC Component
OS:Sizing:Zone,
{8d2258bb-ce3f-447f-989d-b291d0643b48}, !- Handle
{e0503da7-f04f-447d-9336-ee0898d53c47}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{6c2f503f-cf06-4ade-96c1-22cf86d9b1a1}, !- Handle
Zone HVAC Equipment List 16, !- Name
{e0503da7-f04f-447d-9336-ee0898d53c47}; !- Thermal Zone
OS:ThermalZone,
{3cd2c7c4-0db4-4eaa-8eaf-52223f5696e6}, !- Handle
Thermal Zone 17, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{131fb794-bf58-46df-be12-f199cfb21112}, !- Zone Air Inlet Port List
{fe2b9ebd-ab17-4f79-84ce-fdfc57c7f907}, !- Zone Air Exhaust Port List
{fa627a4a-928e-47ba-9a96-aa77addd6d40}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{a2cf1f09-70c0-4495-99d0-03414f7ce01f}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{9cc3f168-d980-45cf-92ea-3fb4ed88ba9a}, !- Handle
Node 17, !- Name
{fa627a4a-928e-47ba-9a96-aa77addd6d40}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{fa627a4a-928e-47ba-9a96-aa77addd6d40}, !- Handle
{d429ca67-0d75-4573-821c-72f01433ce46}, !- Name
{3cd2c7c4-0db4-4eaa-8eaf-52223f5696e6}, !- Source Object
11, !- Outlet Port
{9cc3f168-d980-45cf-92ea-3fb4ed88ba9a}, !- Target Object
2; !- Inlet Port
OS:PortList,
{131fb794-bf58-46df-be12-f199cfb21112}, !- Handle
Port List 33, !- Name
{3cd2c7c4-0db4-4eaa-8eaf-52223f5696e6}; !- HVAC Component
OS:PortList,
{fe2b9ebd-ab17-4f79-84ce-fdfc57c7f907}, !- Handle
Port List 34, !- Name
{3cd2c7c4-0db4-4eaa-8eaf-52223f5696e6}; !- HVAC Component
OS:Sizing:Zone,
{d993b976-72f9-4c7a-8563-ae5e3e6c89f2}, !- Handle
{3cd2c7c4-0db4-4eaa-8eaf-52223f5696e6}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{57f99968-c440-49b8-a749-fa9579b4e681}, !- Handle
Zone HVAC Equipment List 17, !- Name
{3cd2c7c4-0db4-4eaa-8eaf-52223f5696e6}; !- Thermal Zone
OS:ThermalZone,
{cdf84f89-e192-4638-8fea-70eda51811f7}, !- Handle
Thermal Zone 18, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{0ee30759-d350-4c6e-9b36-9e6613cb8d6a}, !- Zone Air Inlet Port List
{861fe473-74c7-4896-a57b-90776a59657b}, !- Zone Air Exhaust Port List
{61a61bbc-45af-44eb-ba03-bff17c3297a6}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{168bb4bb-8fba-4543-aff5-553b687af460}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{c92f5ce0-cb6d-4d7f-a6f6-e9ca4ba6b0a2}, !- Handle
Node 18, !- Name
{61a61bbc-45af-44eb-ba03-bff17c3297a6}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{61a61bbc-45af-44eb-ba03-bff17c3297a6}, !- Handle
{3798d555-946f-49ca-8c59-c9450aec17cc}, !- Name
{cdf84f89-e192-4638-8fea-70eda51811f7}, !- Source Object
11, !- Outlet Port
{c92f5ce0-cb6d-4d7f-a6f6-e9ca4ba6b0a2}, !- Target Object
2; !- Inlet Port
OS:PortList,
{0ee30759-d350-4c6e-9b36-9e6613cb8d6a}, !- Handle
Port List 35, !- Name
{cdf84f89-e192-4638-8fea-70eda51811f7}; !- HVAC Component
OS:PortList,
{861fe473-74c7-4896-a57b-90776a59657b}, !- Handle
Port List 36, !- Name
{cdf84f89-e192-4638-8fea-70eda51811f7}; !- HVAC Component
OS:Sizing:Zone,
{241c0526-cfc0-4f27-8284-fe9c6a62fabe}, !- Handle
{cdf84f89-e192-4638-8fea-70eda51811f7}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{6531c227-85a6-475c-aad9-fba45e09119c}, !- Handle
Zone HVAC Equipment List 18, !- Name
{cdf84f89-e192-4638-8fea-70eda51811f7}; !- Thermal Zone
OS:ThermalZone,
{8a143944-1f37-4bd6-b42b-23d925d1c5ff}, !- Handle
Thermal Zone 19, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{51ef5a50-e1ff-459d-b79d-884bcd139150}, !- Zone Air Inlet Port List
{fa1c8d80-6f51-43ef-939c-cdf02e80f557}, !- Zone Air Exhaust Port List
{d1872ac3-026e-4139-908e-abc321011fd4}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{2a044ad8-8f72-4dc9-a0d6-4dc18144d671}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{3fc8e4d4-e874-47dc-8683-263a10c189cb}, !- Handle
Node 19, !- Name
{d1872ac3-026e-4139-908e-abc321011fd4}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{d1872ac3-026e-4139-908e-abc321011fd4}, !- Handle
{de386bcc-4525-4585-aa69-c140bee52683}, !- Name
{8a143944-1f37-4bd6-b42b-23d925d1c5ff}, !- Source Object
11, !- Outlet Port
{3fc8e4d4-e874-47dc-8683-263a10c189cb}, !- Target Object
2; !- Inlet Port
OS:PortList,
{51ef5a50-e1ff-459d-b79d-884bcd139150}, !- Handle
Port List 37, !- Name
{8a143944-1f37-4bd6-b42b-23d925d1c5ff}; !- HVAC Component
OS:PortList,
{fa1c8d80-6f51-43ef-939c-cdf02e80f557}, !- Handle
Port List 38, !- Name
{8a143944-1f37-4bd6-b42b-23d925d1c5ff}; !- HVAC Component
OS:Sizing:Zone,
{9a01572f-ef8a-4976-a1dd-fc46ed443022}, !- Handle
{8a143944-1f37-4bd6-b42b-23d925d1c5ff}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{fd13f882-0402-4c4c-ba6b-f6b7bfddada4}, !- Handle
Zone HVAC Equipment List 19, !- Name
{8a143944-1f37-4bd6-b42b-23d925d1c5ff}; !- Thermal Zone
OS:ThermalZone,
{5be5609d-1c2b-4cfd-a0d5-de8a87676ecb}, !- Handle
Thermal Zone 20, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{77c756e7-8ddd-4118-a3bb-1d1d5cf3d591}, !- Zone Air Inlet Port List
{b439c3fa-0c40-4380-b8fc-a0b6e581b22a}, !- Zone Air Exhaust Port List
{4475ece0-1bd1-4986-b2c7-82696fa09f33}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{a8891d4d-b91d-47ad-8775-2ba7e2392226}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{a374a9f2-0d39-4571-a696-7eaf08573fef}, !- Handle
Node 20, !- Name
{4475ece0-1bd1-4986-b2c7-82696fa09f33}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{4475ece0-1bd1-4986-b2c7-82696fa09f33}, !- Handle
{fc611a32-6bec-4589-b4ab-5cf5940484f7}, !- Name
{5be5609d-1c2b-4cfd-a0d5-de8a87676ecb}, !- Source Object
11, !- Outlet Port
{a374a9f2-0d39-4571-a696-7eaf08573fef}, !- Target Object
2; !- Inlet Port
OS:PortList,
{77c756e7-8ddd-4118-a3bb-1d1d5cf3d591}, !- Handle
Port List 39, !- Name
{5be5609d-1c2b-4cfd-a0d5-de8a87676ecb}; !- HVAC Component
OS:PortList,
{b439c3fa-0c40-4380-b8fc-a0b6e581b22a}, !- Handle
Port List 40, !- Name
{5be5609d-1c2b-4cfd-a0d5-de8a87676ecb}; !- HVAC Component
OS:Sizing:Zone,
{19700cef-c9ae-4ca1-8475-65d7953b8ba7}, !- Handle
{5be5609d-1c2b-4cfd-a0d5-de8a87676ecb}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{c02d0ba3-ed05-4210-b5bd-8fd74f2aaf96}, !- Handle
Zone HVAC Equipment List 20, !- Name
{5be5609d-1c2b-4cfd-a0d5-de8a87676ecb}; !- Thermal Zone
OS:ThermalZone,
{b8f1fa8a-d5cc-4e3b-8749-114afe26cde4}, !- Handle
Thermal Zone 21, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{2d3c6432-a213-4df6-a67b-beb92bba6f9c}, !- Zone Air Inlet Port List
{31f44e2a-931a-4275-9fc3-3b066f56f8ce}, !- Zone Air Exhaust Port List
{a01b425b-8000-46b2-8508-5b52ed026f3e}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{7c2db4ce-f274-430b-adac-d7183093abab}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{0420f5a6-3085-4c32-96e3-0f38047f4f96}, !- Handle
Node 21, !- Name
{a01b425b-8000-46b2-8508-5b52ed026f3e}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{a01b425b-8000-46b2-8508-5b52ed026f3e}, !- Handle
{2e7124f5-4d56-4c4b-bf98-ad4a9ddb400f}, !- Name
{b8f1fa8a-d5cc-4e3b-8749-114afe26cde4}, !- Source Object
11, !- Outlet Port
{0420f5a6-3085-4c32-96e3-0f38047f4f96}, !- Target Object
2; !- Inlet Port
OS:PortList,
{2d3c6432-a213-4df6-a67b-beb92bba6f9c}, !- Handle
Port List 41, !- Name
{b8f1fa8a-d5cc-4e3b-8749-114afe26cde4}; !- HVAC Component
OS:PortList,
{31f44e2a-931a-4275-9fc3-3b066f56f8ce}, !- Handle
Port List 42, !- Name
{b8f1fa8a-d5cc-4e3b-8749-114afe26cde4}; !- HVAC Component
OS:Sizing:Zone,
{f812c5e0-173f-4e88-9886-40187e4044d6}, !- Handle
{b8f1fa8a-d5cc-4e3b-8749-114afe26cde4}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{e82de886-8af0-4c27-895b-bcc11cfaca82}, !- Handle
Zone HVAC Equipment List 21, !- Name
{b8f1fa8a-d5cc-4e3b-8749-114afe26cde4}; !- Thermal Zone
OS:ThermalZone,
{8b65f105-4ae2-4d61-9c1a-2dfcd1d2b22c}, !- Handle
Thermal Zone 22, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{65c873b7-0e29-44ae-aab1-336b5eb5d7e6}, !- Zone Air Inlet Port List
{c7c7322a-a782-42af-81c6-8e32dd921d4e}, !- Zone Air Exhaust Port List
{5a416448-0696-427e-88f3-71b60d273f5e}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{0ade218c-7490-4522-8290-887c2f2f1c2b}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{cbd23918-3f74-4a17-b20f-78b299ff6390}, !- Handle
Node 22, !- Name
{5a416448-0696-427e-88f3-71b60d273f5e}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{5a416448-0696-427e-88f3-71b60d273f5e}, !- Handle
{9256e7d6-dda1-42b2-abe9-4333aaa583b8}, !- Name
{8b65f105-4ae2-4d61-9c1a-2dfcd1d2b22c}, !- Source Object
11, !- Outlet Port
{cbd23918-3f74-4a17-b20f-78b299ff6390}, !- Target Object
2; !- Inlet Port
OS:PortList,
{65c873b7-0e29-44ae-aab1-336b5eb5d7e6}, !- Handle
Port List 43, !- Name
{8b65f105-4ae2-4d61-9c1a-2dfcd1d2b22c}; !- HVAC Component
OS:PortList,
{c7c7322a-a782-42af-81c6-8e32dd921d4e}, !- Handle
Port List 44, !- Name
{8b65f105-4ae2-4d61-9c1a-2dfcd1d2b22c}; !- HVAC Component
OS:Sizing:Zone,
{29357c0d-b35a-42f0-b1ac-18261747e968}, !- Handle
{8b65f105-4ae2-4d61-9c1a-2dfcd1d2b22c}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{9a74cc35-6fc6-4823-9b50-e085df54a4c1}, !- Handle
Zone HVAC Equipment List 22, !- Name
{8b65f105-4ae2-4d61-9c1a-2dfcd1d2b22c}; !- Thermal Zone
OS:ThermalZone,
{15479aeb-dc9d-4391-a081-7388dd9d6e7c}, !- Handle
Thermal Zone 23, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{40c233f4-9b4e-45ad-a315-4666c13a7334}, !- Zone Air Inlet Port List
{bec3fdb7-777b-49f9-8883-d1a3f1ae9812}, !- Zone Air Exhaust Port List
{8e140e93-ed5f-4d93-8930-4abc9491eb35}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{a83607f3-ac17-43f0-abdf-41291da2fd97}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{c7aabe4c-9af7-46b3-9710-a43f26ed0e93}, !- Handle
Node 23, !- Name
{8e140e93-ed5f-4d93-8930-4abc9491eb35}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{8e140e93-ed5f-4d93-8930-4abc9491eb35}, !- Handle
{d2494458-4165-4c6b-b1a6-48c055d668b9}, !- Name
{15479aeb-dc9d-4391-a081-7388dd9d6e7c}, !- Source Object
11, !- Outlet Port
{c7aabe4c-9af7-46b3-9710-a43f26ed0e93}, !- Target Object
2; !- Inlet Port
OS:PortList,
{40c233f4-9b4e-45ad-a315-4666c13a7334}, !- Handle
Port List 45, !- Name
{15479aeb-dc9d-4391-a081-7388dd9d6e7c}; !- HVAC Component
OS:PortList,
{bec3fdb7-777b-49f9-8883-d1a3f1ae9812}, !- Handle
Port List 46, !- Name
{15479aeb-dc9d-4391-a081-7388dd9d6e7c}; !- HVAC Component
OS:Sizing:Zone,
{93419a42-9b7e-49aa-88b8-ed57efa5f845}, !- Handle
{15479aeb-dc9d-4391-a081-7388dd9d6e7c}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{d6f29702-5361-4dff-9915-9cd2ec7f1a50}, !- Handle
Zone HVAC Equipment List 23, !- Name
{15479aeb-dc9d-4391-a081-7388dd9d6e7c}; !- Thermal Zone
OS:ThermalZone,
{e3a57f3e-dbb4-4962-b1c1-112b3ca63564}, !- Handle
Thermal Zone 24, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{b6b57c45-9c95-4de2-889b-0c447567580d}, !- Zone Air Inlet Port List
{35ef5cae-1524-4cab-bf35-85d96e9ec4e2}, !- Zone Air Exhaust Port List
{a6464a8e-eb3c-4173-84fc-06066358353b}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{3fb5fdba-210b-4551-bb59-56ef02034ff8}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{79afbfa1-77c9-469c-aec9-315814741ca6}, !- Handle
Node 24, !- Name
{a6464a8e-eb3c-4173-84fc-06066358353b}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{a6464a8e-eb3c-4173-84fc-06066358353b}, !- Handle
{1d4a1378-2810-49c1-a9cf-66186d9d8616}, !- Name
{e3a57f3e-dbb4-4962-b1c1-112b3ca63564}, !- Source Object
11, !- Outlet Port
{79afbfa1-77c9-469c-aec9-315814741ca6}, !- Target Object
2; !- Inlet Port
OS:PortList,
{b6b57c45-9c95-4de2-889b-0c447567580d}, !- Handle
Port List 47, !- Name
{e3a57f3e-dbb4-4962-b1c1-112b3ca63564}; !- HVAC Component
OS:PortList,
{35ef5cae-1524-4cab-bf35-85d96e9ec4e2}, !- Handle
Port List 48, !- Name
{e3a57f3e-dbb4-4962-b1c1-112b3ca63564}; !- HVAC Component
OS:Sizing:Zone,
{eb2ec5a4-ff6c-45b1-9d40-490dc7fe4f7a}, !- Handle
{e3a57f3e-dbb4-4962-b1c1-112b3ca63564}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{fd4de6b3-9f8c-4083-b6a6-89fcf17fb7bc}, !- Handle
Zone HVAC Equipment List 24, !- Name
{e3a57f3e-dbb4-4962-b1c1-112b3ca63564}; !- Thermal Zone
OS:ThermalZone,
{c8969937-f295-4556-99c2-ff2acf4377bc}, !- Handle
Thermal Zone 25, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{3365eac9-6297-4384-b2e2-28d63ea526b0}, !- Zone Air Inlet Port List
{487bbe33-3f0e-49ad-839e-9b326635b5ab}, !- Zone Air Exhaust Port List
{95646d07-95c4-4feb-980b-e5f698b4fb71}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{a3201f97-790a-4fba-acb8-96a8309c9e1f}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{f7bd366a-960b-4e1b-b08d-e2326d92972d}, !- Handle
Node 25, !- Name
{95646d07-95c4-4feb-980b-e5f698b4fb71}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{95646d07-95c4-4feb-980b-e5f698b4fb71}, !- Handle
{4bc51c33-12f2-476e-84f1-165248329b62}, !- Name
{c8969937-f295-4556-99c2-ff2acf4377bc}, !- Source Object
11, !- Outlet Port
{f7bd366a-960b-4e1b-b08d-e2326d92972d}, !- Target Object
2; !- Inlet Port
OS:PortList,
{3365eac9-6297-4384-b2e2-28d63ea526b0}, !- Handle
Port List 49, !- Name
{c8969937-f295-4556-99c2-ff2acf4377bc}; !- HVAC Component
OS:PortList,
{487bbe33-3f0e-49ad-839e-9b326635b5ab}, !- Handle
Port List 50, !- Name
{c8969937-f295-4556-99c2-ff2acf4377bc}; !- HVAC Component
OS:Sizing:Zone,
{a8bb22bb-9f0b-4348-9cee-c64ddd38c2c9}, !- Handle
{c8969937-f295-4556-99c2-ff2acf4377bc}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{145a33a9-8222-4d39-9190-3ab3ea0e594f}, !- Handle
Zone HVAC Equipment List 25, !- Name
{c8969937-f295-4556-99c2-ff2acf4377bc}; !- Thermal Zone
OS:ThermalZone,
{231f227f-a906-4ec8-8c94-8d389c308230}, !- Handle
Thermal Zone 26, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{6fca5a5c-4bd0-487f-afd9-54dde83ce0da}, !- Zone Air Inlet Port List
{cbe42e7e-4cdf-4b79-9f35-7ffa4b93cc88}, !- Zone Air Exhaust Port List
{d12b6058-8e7d-48af-b406-d7ac43d5733a}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{85a030e0-ef6d-47f5-bd6f-80996a542d51}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{0b36639e-0c12-4eac-9e39-4a337a92a8e4}, !- Handle
Node 26, !- Name
{d12b6058-8e7d-48af-b406-d7ac43d5733a}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{d12b6058-8e7d-48af-b406-d7ac43d5733a}, !- Handle
{34aa5704-f8f0-4992-a393-1aa94fdf2188}, !- Name
{231f227f-a906-4ec8-8c94-8d389c308230}, !- Source Object
11, !- Outlet Port
{0b36639e-0c12-4eac-9e39-4a337a92a8e4}, !- Target Object
2; !- Inlet Port
OS:PortList,
{6fca5a5c-4bd0-487f-afd9-54dde83ce0da}, !- Handle
Port List 51, !- Name
{231f227f-a906-4ec8-8c94-8d389c308230}; !- HVAC Component
OS:PortList,
{cbe42e7e-4cdf-4b79-9f35-7ffa4b93cc88}, !- Handle
Port List 52, !- Name
{231f227f-a906-4ec8-8c94-8d389c308230}; !- HVAC Component
OS:Sizing:Zone,
{5ee7447f-f825-4df3-bea4-9363a6f751e3}, !- Handle
{231f227f-a906-4ec8-8c94-8d389c308230}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{a6fbcf0c-702f-44f8-98c6-85fe8a9d53f8}, !- Handle
Zone HVAC Equipment List 26, !- Name
{231f227f-a906-4ec8-8c94-8d389c308230}; !- Thermal Zone
OS:ThermalZone,
{97c79966-9dbb-4546-9b99-7c56928065fd}, !- Handle
Thermal Zone 27, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{6565db20-4ded-4b8e-8a66-c52b141cf379}, !- Zone Air Inlet Port List
{84fe68c7-5738-44be-ba56-d0c36c24a547}, !- Zone Air Exhaust Port List
{1e3d2525-ccdf-47b4-a7ca-6a9927d75548}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{387a970f-14df-4027-9fe1-c36e3bd74dae}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{6a34d49a-1551-4f76-a936-987023a7dcfe}, !- Handle
Node 27, !- Name
{1e3d2525-ccdf-47b4-a7ca-6a9927d75548}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{1e3d2525-ccdf-47b4-a7ca-6a9927d75548}, !- Handle
{240ffd0d-31a8-40f7-86b2-4b6f302240f2}, !- Name
{97c79966-9dbb-4546-9b99-7c56928065fd}, !- Source Object
11, !- Outlet Port
{6a34d49a-1551-4f76-a936-987023a7dcfe}, !- Target Object
2; !- Inlet Port
OS:PortList,
{6565db20-4ded-4b8e-8a66-c52b141cf379}, !- Handle
Port List 53, !- Name
{97c79966-9dbb-4546-9b99-7c56928065fd}; !- HVAC Component
OS:PortList,
{84fe68c7-5738-44be-ba56-d0c36c24a547}, !- Handle
Port List 54, !- Name
{97c79966-9dbb-4546-9b99-7c56928065fd}; !- HVAC Component
OS:Sizing:Zone,
{2fb78f97-cd4b-4608-b136-119797964912}, !- Handle
{97c79966-9dbb-4546-9b99-7c56928065fd}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{af441215-6177-485b-ac3a-030bd69903bd}, !- Handle
Zone HVAC Equipment List 27, !- Name
{97c79966-9dbb-4546-9b99-7c56928065fd}; !- Thermal Zone
OS:ThermalZone,
{41699387-49d1-4739-a83c-afbfafd0e0bf}, !- Handle
Thermal Zone 28, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{a89251cd-6f69-45f4-8cee-4224003e38b5}, !- Zone Air Inlet Port List
{18653d32-355a-4ee9-b507-7373d89f1cb8}, !- Zone Air Exhaust Port List
{b954594b-57bb-4675-a701-c2f946d2cc8d}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{2c7660ae-7a74-48fc-b631-ca7f4b54c2c6}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{0817e562-ff78-4caa-94ae-1ac6eda15840}, !- Handle
Node 28, !- Name
{b954594b-57bb-4675-a701-c2f946d2cc8d}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{b954594b-57bb-4675-a701-c2f946d2cc8d}, !- Handle
{2c194de3-6480-432b-a2b4-e8ed5cd76a70}, !- Name
{41699387-49d1-4739-a83c-afbfafd0e0bf}, !- Source Object
11, !- Outlet Port
{0817e562-ff78-4caa-94ae-1ac6eda15840}, !- Target Object
2; !- Inlet Port
OS:PortList,
{a89251cd-6f69-45f4-8cee-4224003e38b5}, !- Handle
Port List 55, !- Name
{41699387-49d1-4739-a83c-afbfafd0e0bf}; !- HVAC Component
OS:PortList,
{18653d32-355a-4ee9-b507-7373d89f1cb8}, !- Handle
Port List 56, !- Name
{41699387-49d1-4739-a83c-afbfafd0e0bf}; !- HVAC Component
OS:Sizing:Zone,
{ef1001ef-13fb-4d76-9c4f-4af66303ddc7}, !- Handle
{41699387-49d1-4739-a83c-afbfafd0e0bf}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{2cf94621-480a-4161-80fe-32d0741e0e0f}, !- Handle
Zone HVAC Equipment List 28, !- Name
{41699387-49d1-4739-a83c-afbfafd0e0bf}; !- Thermal Zone
OS:ThermalZone,
{11d43e88-a3cd-43d2-a412-6b251ba8ddaf}, !- Handle
Thermal Zone 29, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{86fd945d-aec8-4a41-a226-6d43f02a8954}, !- Zone Air Inlet Port List
{bc54a103-5122-4db6-b029-b09db2a81415}, !- Zone Air Exhaust Port List
{df43c6d4-fee9-4aba-accd-0b72a0f6de5c}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{bdeb9fcf-5ce1-4ea2-99b5-ba35c0c6f10e}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{865984ce-6d16-441c-a934-b6f476cab628}, !- Handle
Node 29, !- Name
{df43c6d4-fee9-4aba-accd-0b72a0f6de5c}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{df43c6d4-fee9-4aba-accd-0b72a0f6de5c}, !- Handle
{109d8dd1-e0bf-4255-8a9b-02b5f5a57f9c}, !- Name
{11d43e88-a3cd-43d2-a412-6b251ba8ddaf}, !- Source Object
11, !- Outlet Port
{865984ce-6d16-441c-a934-b6f476cab628}, !- Target Object
2; !- Inlet Port
OS:PortList,
{86fd945d-aec8-4a41-a226-6d43f02a8954}, !- Handle
Port List 57, !- Name
{11d43e88-a3cd-43d2-a412-6b251ba8ddaf}; !- HVAC Component
OS:PortList,
{bc54a103-5122-4db6-b029-b09db2a81415}, !- Handle
Port List 58, !- Name
{11d43e88-a3cd-43d2-a412-6b251ba8ddaf}; !- HVAC Component
OS:Sizing:Zone,
{b2410c5f-ffec-4465-be44-e94251074624}, !- Handle
{11d43e88-a3cd-43d2-a412-6b251ba8ddaf}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{042a043c-71a2-40f5-b445-7e74dcd5e285}, !- Handle
Zone HVAC Equipment List 29, !- Name
{11d43e88-a3cd-43d2-a412-6b251ba8ddaf}; !- Thermal Zone
OS:ThermalZone,
{00288094-b1cb-404c-a278-0281bf072179}, !- Handle
Thermal Zone 30, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{1d52b098-77c8-4855-aa7e-790edf186a5a}, !- Zone Air Inlet Port List
{eedd6ed6-706e-44e3-995d-b6cb1da0abac}, !- Zone Air Exhaust Port List
{6ef29a4f-0236-4d28-9564-06986fbe7786}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{b3d9ffea-ce01-4967-ae51-7e2fb6ec3fac}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{6d952ca9-b824-4bf8-b77d-7be6fd26ddb4}, !- Handle
Node 30, !- Name
{6ef29a4f-0236-4d28-9564-06986fbe7786}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{6ef29a4f-0236-4d28-9564-06986fbe7786}, !- Handle
{f8a300bf-4d74-41f0-9ada-0e86befc9494}, !- Name
{00288094-b1cb-404c-a278-0281bf072179}, !- Source Object
11, !- Outlet Port
{6d952ca9-b824-4bf8-b77d-7be6fd26ddb4}, !- Target Object
2; !- Inlet Port
OS:PortList,
{1d52b098-77c8-4855-aa7e-790edf186a5a}, !- Handle
Port List 59, !- Name
{00288094-b1cb-404c-a278-0281bf072179}; !- HVAC Component
OS:PortList,
{eedd6ed6-706e-44e3-995d-b6cb1da0abac}, !- Handle
Port List 60, !- Name
{00288094-b1cb-404c-a278-0281bf072179}; !- HVAC Component
OS:Sizing:Zone,
{5bff63f1-ec2a-40d3-97cf-770dab63fcbc}, !- Handle
{00288094-b1cb-404c-a278-0281bf072179}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{8d35c5e9-9013-4849-9a71-01ec75040024}, !- Handle
Zone HVAC Equipment List 30, !- Name
{00288094-b1cb-404c-a278-0281bf072179}; !- Thermal Zone
OS:ThermalZone,
{d1df30f4-15b7-4dd4-beba-813c5b218831}, !- Handle
Thermal Zone 31, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{b827abff-3b4b-4e45-b6e4-5cc84f88b61d}, !- Zone Air Inlet Port List
{d4d044d3-59da-4a0b-8c7f-21f3811e620f}, !- Zone Air Exhaust Port List
{477ba42c-cc01-4983-922c-5e3510abd263}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{9f38fb2a-173e-44d7-a58d-6cd3b6b9f7fd}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{95017417-8fc8-4ec0-85bf-ddf8b69addfe}, !- Handle
Node 31, !- Name
{477ba42c-cc01-4983-922c-5e3510abd263}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{477ba42c-cc01-4983-922c-5e3510abd263}, !- Handle
{a2d0f3f5-a264-4b18-9119-a89756b19f6a}, !- Name
{d1df30f4-15b7-4dd4-beba-813c5b218831}, !- Source Object
11, !- Outlet Port
{95017417-8fc8-4ec0-85bf-ddf8b69addfe}, !- Target Object
2; !- Inlet Port
OS:PortList,
{b827abff-3b4b-4e45-b6e4-5cc84f88b61d}, !- Handle
Port List 61, !- Name
{d1df30f4-15b7-4dd4-beba-813c5b218831}; !- HVAC Component
OS:PortList,
{d4d044d3-59da-4a0b-8c7f-21f3811e620f}, !- Handle
Port List 62, !- Name
{d1df30f4-15b7-4dd4-beba-813c5b218831}; !- HVAC Component
OS:Sizing:Zone,
{e25b31ef-d15e-4da8-9bb2-260fdf10715d}, !- Handle
{d1df30f4-15b7-4dd4-beba-813c5b218831}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{b8080bb7-cb40-4e13-b215-8e8d1e82c6e4}, !- Handle
Zone HVAC Equipment List 31, !- Name
{d1df30f4-15b7-4dd4-beba-813c5b218831}; !- Thermal Zone
OS:ThermalZone,
{c6d33850-95f4-430c-a11e-bfb3ca4c84d7}, !- Handle
Thermal Zone 32, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{b70aeff3-8784-45a8-981d-8cd8eb331e58}, !- Zone Air Inlet Port List
{4e60056e-fc30-47bf-9d22-4ac199c5f09f}, !- Zone Air Exhaust Port List
{9953b981-a850-45b5-ba90-549a8b1e241a}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{842cdfd1-55fc-407c-a8f4-e510df92958c}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{a5336725-689e-4e57-8666-d1fb23117267}, !- Handle
Node 32, !- Name
{9953b981-a850-45b5-ba90-549a8b1e241a}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{9953b981-a850-45b5-ba90-549a8b1e241a}, !- Handle
{91c590a2-1e20-4d2a-8630-ae058783e887}, !- Name
{c6d33850-95f4-430c-a11e-bfb3ca4c84d7}, !- Source Object
11, !- Outlet Port
{a5336725-689e-4e57-8666-d1fb23117267}, !- Target Object
2; !- Inlet Port
OS:PortList,
{b70aeff3-8784-45a8-981d-8cd8eb331e58}, !- Handle
Port List 63, !- Name
{c6d33850-95f4-430c-a11e-bfb3ca4c84d7}; !- HVAC Component
OS:PortList,
{4e60056e-fc30-47bf-9d22-4ac199c5f09f}, !- Handle
Port List 64, !- Name
{c6d33850-95f4-430c-a11e-bfb3ca4c84d7}; !- HVAC Component
OS:Sizing:Zone,
{11166872-b9f2-4612-bfb4-82922563a97b}, !- Handle
{c6d33850-95f4-430c-a11e-bfb3ca4c84d7}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{1d3913ae-5926-437d-b1d0-3d93e67e9ce0}, !- Handle
Zone HVAC Equipment List 32, !- Name
{c6d33850-95f4-430c-a11e-bfb3ca4c84d7}; !- Thermal Zone
OS:ThermalZone,
{2dc85d1e-87da-406b-afbb-bc14b02f610c}, !- Handle
Thermal Zone 33, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{a11cce7a-b2eb-4271-9d89-4dd61cfa6595}, !- Zone Air Inlet Port List
{2fc44c24-855f-4890-804a-1757b1a7349d}, !- Zone Air Exhaust Port List
{8453affb-8ba2-48a0-a4b3-879c01feef04}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{58475b90-d501-44c8-975f-791c49724caf}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{a37d3964-17f5-45bc-a165-d9aeddc32592}, !- Handle
Node 33, !- Name
{8453affb-8ba2-48a0-a4b3-879c01feef04}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{8453affb-8ba2-48a0-a4b3-879c01feef04}, !- Handle
{0937574c-b633-408f-a0ce-2684f4266dd2}, !- Name
{2dc85d1e-87da-406b-afbb-bc14b02f610c}, !- Source Object
11, !- Outlet Port
{a37d3964-17f5-45bc-a165-d9aeddc32592}, !- Target Object
2; !- Inlet Port
OS:PortList,
{a11cce7a-b2eb-4271-9d89-4dd61cfa6595}, !- Handle
Port List 65, !- Name
{2dc85d1e-87da-406b-afbb-bc14b02f610c}; !- HVAC Component
OS:PortList,
{2fc44c24-855f-4890-804a-1757b1a7349d}, !- Handle
Port List 66, !- Name
{2dc85d1e-87da-406b-afbb-bc14b02f610c}; !- HVAC Component
OS:Sizing:Zone,
{9732d8df-0a15-4d68-9804-6fc2b0675071}, !- Handle
{2dc85d1e-87da-406b-afbb-bc14b02f610c}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{372390b0-7610-420e-bc12-088b7645027f}, !- Handle
Zone HVAC Equipment List 33, !- Name
{2dc85d1e-87da-406b-afbb-bc14b02f610c}; !- Thermal Zone
OS:ThermalZone,
{7ec91fef-28c9-48e8-8e48-2c6681579209}, !- Handle
Thermal Zone 34, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{87cf29b9-c885-449a-80d7-5da60e3d2fbf}, !- Zone Air Inlet Port List
{d435ce2d-ff58-4c8a-9492-95ec1c42e947}, !- Zone Air Exhaust Port List
{35726961-bd19-4f1d-b2a9-8ce1290623a0}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{5b733e53-2b00-4456-ad17-d56fe5eb9a63}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{738f662c-6537-4c5c-8a64-24522a82feb1}, !- Handle
Node 34, !- Name
{35726961-bd19-4f1d-b2a9-8ce1290623a0}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{35726961-bd19-4f1d-b2a9-8ce1290623a0}, !- Handle
{1f37f61e-1fba-44ed-bb58-adf91edc78e8}, !- Name
{7ec91fef-28c9-48e8-8e48-2c6681579209}, !- Source Object
11, !- Outlet Port
{738f662c-6537-4c5c-8a64-24522a82feb1}, !- Target Object
2; !- Inlet Port
OS:PortList,
{87cf29b9-c885-449a-80d7-5da60e3d2fbf}, !- Handle
Port List 67, !- Name
{7ec91fef-28c9-48e8-8e48-2c6681579209}; !- HVAC Component
OS:PortList,
{d435ce2d-ff58-4c8a-9492-95ec1c42e947}, !- Handle
Port List 68, !- Name
{7ec91fef-28c9-48e8-8e48-2c6681579209}; !- HVAC Component
OS:Sizing:Zone,
{32472ea1-e2d2-4c44-90ee-c8c6f161fc17}, !- Handle
{7ec91fef-28c9-48e8-8e48-2c6681579209}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{2e6e9664-7579-4f9e-bbae-a6654c5d8e61}, !- Handle
Zone HVAC Equipment List 34, !- Name
{7ec91fef-28c9-48e8-8e48-2c6681579209}; !- Thermal Zone
OS:ThermalZone,
{d14b52ed-7965-4203-be40-8e2a4519d322}, !- Handle
Thermal Zone 35, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{a98129d1-9eb0-4345-b8d5-8f85b2a534bb}, !- Zone Air Inlet Port List
{43a8cf9d-bb10-4e61-836c-9453d0b553ed}, !- Zone Air Exhaust Port List
{b7be453a-5513-453c-a3d6-d64a091b05b2}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{5cbc2ed8-39cc-4e68-90cc-81a5ada60931}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{5d4a6a9d-a303-4ad7-a200-8be22edf70bf}, !- Handle
Node 35, !- Name
{b7be453a-5513-453c-a3d6-d64a091b05b2}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{b7be453a-5513-453c-a3d6-d64a091b05b2}, !- Handle
{5f6d4817-e33a-4afd-b84c-8178d6cd1702}, !- Name
{d14b52ed-7965-4203-be40-8e2a4519d322}, !- Source Object
11, !- Outlet Port
{5d4a6a9d-a303-4ad7-a200-8be22edf70bf}, !- Target Object
2; !- Inlet Port
OS:PortList,
{a98129d1-9eb0-4345-b8d5-8f85b2a534bb}, !- Handle
Port List 69, !- Name
{d14b52ed-7965-4203-be40-8e2a4519d322}; !- HVAC Component
OS:PortList,
{43a8cf9d-bb10-4e61-836c-9453d0b553ed}, !- Handle
Port List 70, !- Name
{d14b52ed-7965-4203-be40-8e2a4519d322}; !- HVAC Component
OS:Sizing:Zone,
{b89d7c05-b60c-4265-aa28-79ed36f0f5a6}, !- Handle
{d14b52ed-7965-4203-be40-8e2a4519d322}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{a77ea97c-28aa-45b1-ba1a-77a12c246ee8}, !- Handle
Zone HVAC Equipment List 35, !- Name
{d14b52ed-7965-4203-be40-8e2a4519d322}; !- Thermal Zone
OS:ThermalZone,
{be61136e-3eb8-43ba-8a96-8fd2096074a0}, !- Handle
Thermal Zone 36, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{5861b247-9d90-4e69-b6df-4097c5199caf}, !- Zone Air Inlet Port List
{9b961776-aff7-4217-97b9-1a7dbe567e7e}, !- Zone Air Exhaust Port List
{1a7252cc-d114-4acd-8772-40ff32b24493}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{54519212-92a4-4b2a-a7e0-9e905e86aa15}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{e8eeb1b9-677a-420c-a5b1-c09dae9663db}, !- Handle
Node 36, !- Name
{1a7252cc-d114-4acd-8772-40ff32b24493}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{1a7252cc-d114-4acd-8772-40ff32b24493}, !- Handle
{c6f195ab-9ce2-4a47-a8a4-6e50e932b752}, !- Name
{be61136e-3eb8-43ba-8a96-8fd2096074a0}, !- Source Object
11, !- Outlet Port
{e8eeb1b9-677a-420c-a5b1-c09dae9663db}, !- Target Object
2; !- Inlet Port
OS:PortList,
{5861b247-9d90-4e69-b6df-4097c5199caf}, !- Handle
Port List 71, !- Name
{be61136e-3eb8-43ba-8a96-8fd2096074a0}; !- HVAC Component
OS:PortList,
{9b961776-aff7-4217-97b9-1a7dbe567e7e}, !- Handle
Port List 72, !- Name
{be61136e-3eb8-43ba-8a96-8fd2096074a0}; !- HVAC Component
OS:Sizing:Zone,
{0c8005c5-f923-4a42-a49d-19aa4a881672}, !- Handle
{be61136e-3eb8-43ba-8a96-8fd2096074a0}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{4448953f-71f1-485c-94ce-257d353ace20}, !- Handle
Zone HVAC Equipment List 36, !- Name
{be61136e-3eb8-43ba-8a96-8fd2096074a0}; !- Thermal Zone
OS:ThermalZone,
{07e5b72a-42bb-415b-b2eb-9aaa2775d9f0}, !- Handle
Thermal Zone 37, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{b46fbb38-9563-453f-97b9-fc8d29e58f5d}, !- Zone Air Inlet Port List
{ae472302-91af-47bd-9705-aa21e6ceb7d8}, !- Zone Air Exhaust Port List
{28f32217-ad5f-43fd-8481-769c40529a51}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{6b1f29ba-ca25-4209-b9b6-ecfd389bea96}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{0e0b2512-3bb2-4aaa-b7a2-59077ad03e6c}, !- Handle
Node 37, !- Name
{28f32217-ad5f-43fd-8481-769c40529a51}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{28f32217-ad5f-43fd-8481-769c40529a51}, !- Handle
{55b17b88-07c6-49f1-81ef-7867c35ade8c}, !- Name
{07e5b72a-42bb-415b-b2eb-9aaa2775d9f0}, !- Source Object
11, !- Outlet Port
{0e0b2512-3bb2-4aaa-b7a2-59077ad03e6c}, !- Target Object
2; !- Inlet Port
OS:PortList,
{b46fbb38-9563-453f-97b9-fc8d29e58f5d}, !- Handle
Port List 73, !- Name
{07e5b72a-42bb-415b-b2eb-9aaa2775d9f0}; !- HVAC Component
OS:PortList,
{ae472302-91af-47bd-9705-aa21e6ceb7d8}, !- Handle
Port List 74, !- Name
{07e5b72a-42bb-415b-b2eb-9aaa2775d9f0}; !- HVAC Component
OS:Sizing:Zone,
{7829aec1-8272-48a0-bfea-7685ffaba0dc}, !- Handle
{07e5b72a-42bb-415b-b2eb-9aaa2775d9f0}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{4a2fb7f6-026b-4e2e-abda-6a85c1c5f376}, !- Handle
Zone HVAC Equipment List 37, !- Name
{07e5b72a-42bb-415b-b2eb-9aaa2775d9f0}; !- Thermal Zone
OS:ThermalZone,
{92356d01-0b91-478e-a28d-dbc45e878d16}, !- Handle
Thermal Zone 38, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{16fc4094-5b1a-4762-8095-f21ebf7a5d9e}, !- Zone Air Inlet Port List
{c0fdc86d-9c8d-4819-9e18-af456ab18fc3}, !- Zone Air Exhaust Port List
{0bcc86c5-46cf-4f17-b449-16966a463ddf}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{40aa8962-03c1-4cc1-8501-2f2613fc58db}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{520d1f79-26a7-4fa4-a1f7-8e37220ce940}, !- Handle
Node 38, !- Name
{0bcc86c5-46cf-4f17-b449-16966a463ddf}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{0bcc86c5-46cf-4f17-b449-16966a463ddf}, !- Handle
{2c125df7-880c-408c-a235-976b1c10b5f6}, !- Name
{92356d01-0b91-478e-a28d-dbc45e878d16}, !- Source Object
11, !- Outlet Port
{520d1f79-26a7-4fa4-a1f7-8e37220ce940}, !- Target Object
2; !- Inlet Port
OS:PortList,
{16fc4094-5b1a-4762-8095-f21ebf7a5d9e}, !- Handle
Port List 75, !- Name
{92356d01-0b91-478e-a28d-dbc45e878d16}; !- HVAC Component
OS:PortList,
{c0fdc86d-9c8d-4819-9e18-af456ab18fc3}, !- Handle
Port List 76, !- Name
{92356d01-0b91-478e-a28d-dbc45e878d16}; !- HVAC Component
OS:Sizing:Zone,
{d74ca9b2-9a58-43eb-b0f2-a56283771c8d}, !- Handle
{92356d01-0b91-478e-a28d-dbc45e878d16}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{7fa7ff06-a9b3-46a3-935b-ae8cd2b270ec}, !- Handle
Zone HVAC Equipment List 38, !- Name
{92356d01-0b91-478e-a28d-dbc45e878d16}; !- Thermal Zone
OS:ThermalZone,
{774cb31d-7d12-47cf-8cf3-c7fb8f030f8b}, !- Handle
Thermal Zone 39, !- Name
, !- Multiplier
, !- Ceiling Height {m}
, !- Volume {m3}
, !- Floor Area {m2}
, !- Zone Inside Convection Algorithm
, !- Zone Outside Convection Algorithm
, !- Zone Conditioning Equipment List Name
{bae602c0-fcb7-4b55-9b6e-d74013aa35f9}, !- Zone Air Inlet Port List
{e5fdde18-ddc6-4e71-a0cc-2d44812f1589}, !- Zone Air Exhaust Port List
{db0fea79-c991-470d-8abe-6677066f22a1}, !- Zone Air Node Name
, !- Zone Return Air Node Name
, !- Primary Daylighting Control Name
, !- Fraction of Zone Controlled by Primary Daylighting Control
, !- Secondary Daylighting Control Name
, !- Fraction of Zone Controlled by Secondary Daylighting Control
, !- Illuminance Map Name
{1bfda7aa-e9c0-4179-82ae-30ef172b42bd}, !- Group Rendering Name
, !- Thermostat Name
No; !- Use Ideal Air Loads
OS:Node,
{c68b74ca-99d1-4df2-a47a-ff47529be86b}, !- Handle
Node 39, !- Name
{db0fea79-c991-470d-8abe-6677066f22a1}, !- Inlet Port
; !- Outlet Port
OS:Connection,
{db0fea79-c991-470d-8abe-6677066f22a1}, !- Handle
{f62b3889-3a2e-4cf3-a651-0c63ba0dabaf}, !- Name
{774cb31d-7d12-47cf-8cf3-c7fb8f030f8b}, !- Source Object
11, !- Outlet Port
{c68b74ca-99d1-4df2-a47a-ff47529be86b}, !- Target Object
2; !- Inlet Port
OS:PortList,
{bae602c0-fcb7-4b55-9b6e-d74013aa35f9}, !- Handle
Port List 77, !- Name
{774cb31d-7d12-47cf-8cf3-c7fb8f030f8b}; !- HVAC Component
OS:PortList,
{e5fdde18-ddc6-4e71-a0cc-2d44812f1589}, !- Handle
Port List 78, !- Name
{774cb31d-7d12-47cf-8cf3-c7fb8f030f8b}; !- HVAC Component
OS:Sizing:Zone,
{555f98ee-fbea-440a-88b2-a4dbcfe0b36a}, !- Handle
{774cb31d-7d12-47cf-8cf3-c7fb8f030f8b}, !- Zone or ZoneList Name
14, !- Zone Cooling Design Supply Air Temperature {C}
40, !- Zone Heating Design Supply Air Temperature {C}
0.0085, !- Zone Cooling Design Supply Air Humidity Ratio {kg-H2O/kg-air}
0.008, !- Zone Heating Design Supply Air Humidity Ratio {kg-H2O/kg-air}
, !- Zone Heating Sizing Factor
, !- Zone Cooling Sizing Factor
DesignDay, !- Cooling Design Air Flow Method
, !- Cooling Design Air Flow Rate {m3/s}
, !- Cooling Minimum Air Flow per Zone Floor Area {m3/s-m2}
, !- Cooling Minimum Air Flow {m3/s}
, !- Cooling Minimum Air Flow Fraction
DesignDay, !- Heating Design Air Flow Method
, !- Heating Design Air Flow Rate {m3/s}
, !- Heating Maximum Air Flow per Zone Floor Area {m3/s-m2}
, !- Heating Maximum Air Flow {m3/s}
, !- Heating Maximum Air Flow Fraction
, !- Design Zone Air Distribution Effectiveness in Cooling Mode
; !- Design Zone Air Distribution Effectiveness in Heating Mode
OS:ZoneHVAC:EquipmentList,
{1914ed74-dd68-4bba-86f3-cb7f683260dd}, !- Handle
Zone HVAC Equipment List 39, !- Name
{774cb31d-7d12-47cf-8cf3-c7fb8f030f8b}; !- Thermal Zone
OS:RunPeriod,
{a33ed4cf-5486-41bc-a577-b9b1470ae06e}, !- Handle
Run Period 1, !- Name
1, !- Begin Month
1, !- Begin Day of Month
1, !- End Month
31, !- End Day of Month
, !- Use Weather File Holidays and Special Days
, !- Use Weather File Daylight Saving Period
, !- Apply Weekend Holiday Rule
, !- Use Weather File Rain Indicators
, !- Use Weather File Snow Indicators
; !- Number of Times Runperiod to be Repeated
OS:SimulationControl,
{5c0450e4-fcea-4e25-ba37-86d36b267a29}, !- Handle
, !- Do Zone Sizing Calculation
, !- Do System Sizing Calculation
, !- Do Plant Sizing Calculation
, !- Run Simulation for Sizing Periods
, !- Run Simulation for Weather File Run Periods
, !- Loads Convergence Tolerance Value
, !- Temperature Convergence Tolerance Value {deltaC}
FullExteriorWithReflections; !- Solar Distribution
OS:Facility,
{a76f4099-5f51-4f99-a3c2-8a7896be927a}; !- Handle
OS:Rendering:Color,
{d6ddca45-2c1e-478d-9719-f8ce775d2ddc}, !- Handle
Rendering Color 1, !- Name
205, !- Rendering Red Value
92, !- Rendering Green Value
92; !- Rendering Blue Value
OS:Rendering:Color,
{b4c45704-29b4-4420-9f01-faa3b24e61ca}, !- Handle
Rendering Color 2, !- Name
165, !- Rendering Red Value
42, !- Rendering Green Value
42; !- Rendering Blue Value
OS:Rendering:Color,
{bcf1003e-f32c-4775-8cbe-5fc30aee4344}, !- Handle
Rendering Color 3, !- Name
255, !- Rendering Red Value
228, !- Rendering Green Value
196; !- Rendering Blue Value
OS:Rendering:Color,
{352c6f8a-ef2a-4841-8615-a06fcb75ef92}, !- Handle
Rendering Color 4, !- Name
0, !- Rendering Red Value
250, !- Rendering Green Value
154; !- Rendering Blue Value
OS:Rendering:Color,
{ee948fd6-8ccb-4d3f-a0ba-2a1aac272a5d}, !- Handle
Rendering Color 5, !- Name
135, !- Rendering Red Value
206, !- Rendering Green Value
250; !- Rendering Blue Value
OS:Rendering:Color,
{4665f8d9-1d15-4446-9b8b-aa7a092bc862}, !- Handle
Rendering Color 6, !- Name
128, !- Rendering Red Value
128, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{aaa48ec9-518d-4b12-ba60-d7af069f1ebe}, !- Handle
Rendering Color 7, !- Name
255, !- Rendering Red Value
245, !- Rendering Green Value
238; !- Rendering Blue Value
OS:Rendering:Color,
{4020ecf1-d097-458c-beee-b19b4fa0edc6}, !- Handle
Rendering Color 8, !- Name
255, !- Rendering Red Value
255, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{797821b5-4daf-4b5b-a935-7c99673b208c}, !- Handle
Rendering Color 9, !- Name
160, !- Rendering Red Value
82, !- Rendering Green Value
45; !- Rendering Blue Value
OS:Rendering:Color,
{8c25de0c-3fc8-4b30-a5e3-5dc820310317}, !- Handle
Rendering Color 10, !- Name
255, !- Rendering Red Value
0, !- Rendering Green Value
255; !- Rendering Blue Value
OS:Rendering:Color,
{c3e0db44-c6b0-42d7-bc0d-8e51b5cd0945}, !- Handle
Rendering Color 11, !- Name
205, !- Rendering Red Value
92, !- Rendering Green Value
92; !- Rendering Blue Value
OS:Rendering:Color,
{a0f184da-1f83-41a2-b11e-db5b2866416b}, !- Handle
Rendering Color 12, !- Name
176, !- Rendering Red Value
196, !- Rendering Green Value
222; !- Rendering Blue Value
OS:Rendering:Color,
{fd528f1f-e491-412f-ad7e-508d9c5160de}, !- Handle
Rendering Color 13, !- Name
192, !- Rendering Red Value
192, !- Rendering Green Value
192; !- Rendering Blue Value
OS:Rendering:Color,
{6bed0f95-67dc-44c8-a2d7-5f2efe19b59e}, !- Handle
Rendering Color 14, !- Name
148, !- Rendering Red Value
0, !- Rendering Green Value
211; !- Rendering Blue Value
OS:Rendering:Color,
{992f4f03-933a-4ebd-a3bc-391a25688266}, !- Handle
Rendering Color 15, !- Name
70, !- Rendering Red Value
130, !- Rendering Green Value
180; !- Rendering Blue Value
OS:Rendering:Color,
{47cc45dc-7b53-4d5f-b662-94b59c8b3866}, !- Handle
Rendering Color 16, !- Name
175, !- Rendering Red Value
238, !- Rendering Green Value
238; !- Rendering Blue Value
OS:Rendering:Color,
{a6951a96-1204-45c5-b8f1-ae4a7e72e173}, !- Handle
Rendering Color 17, !- Name
216, !- Rendering Red Value
191, !- Rendering Green Value
216; !- Rendering Blue Value
OS:Rendering:Color,
{7b5cb4d2-d45c-4c14-b20b-9b719da62c3d}, !- Handle
Rendering Color 18, !- Name
245, !- Rendering Red Value
245, !- Rendering Green Value
245; !- Rendering Blue Value
OS:Rendering:Color,
{55cb38da-4245-4511-bdec-6e50f9cc878b}, !- Handle
Rendering Color 19, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
205; !- Rendering Blue Value
OS:Rendering:Color,
{87e871bd-b6f4-4482-97a3-cdb20d59b38e}, !- Handle
Rendering Color 20, !- Name
245, !- Rendering Red Value
245, !- Rendering Green Value
220; !- Rendering Blue Value
OS:Rendering:Color,
{720a3fcc-01f4-4f17-ab18-7e1525fdd48f}, !- Handle
Rendering Color 21, !- Name
154, !- Rendering Red Value
205, !- Rendering Green Value
50; !- Rendering Blue Value
OS:Rendering:Color,
{113f73d5-9fe4-4781-8c99-24f265349f95}, !- Handle
Rendering Color 22, !- Name
32, !- Rendering Red Value
178, !- Rendering Green Value
170; !- Rendering Blue Value
OS:Rendering:Color,
{3289e140-2244-4f6a-864a-29a96bc70b46}, !- Handle
Rendering Color 23, !- Name
244, !- Rendering Red Value
164, !- Rendering Green Value
96; !- Rendering Blue Value
OS:Rendering:Color,
{241f6a49-d494-4733-af5a-4d48565b9cfd}, !- Handle
Rendering Color 24, !- Name
95, !- Rendering Red Value
158, !- Rendering Green Value
160; !- Rendering Blue Value
OS:Rendering:Color,
{beb8871f-3b01-4c51-9e3a-0e118e9809ab}, !- Handle
Rendering Color 25, !- Name
255, !- Rendering Red Value
240, !- Rendering Green Value
245; !- Rendering Blue Value
OS:Rendering:Color,
{b6949b4a-41a2-45df-b04d-1e2f34305a58}, !- Handle
Rendering Color 26, !- Name
240, !- Rendering Red Value
255, !- Rendering Green Value
240; !- Rendering Blue Value
OS:Rendering:Color,
{09f48843-9cb3-4fc7-ab18-7672a166d1d5}, !- Handle
Rendering Color 27, !- Name
147, !- Rendering Red Value
112, !- Rendering Green Value
219; !- Rendering Blue Value
OS:Rendering:Color,
{ff37745e-6d28-425c-8dcb-62175b53435c}, !- Handle
Rendering Color 28, !- Name
173, !- Rendering Red Value
216, !- Rendering Green Value
230; !- Rendering Blue Value
OS:Rendering:Color,
{169b6d02-981a-4465-a7a3-2f4e5754e110}, !- Handle
Rendering Color 29, !- Name
173, !- Rendering Red Value
255, !- Rendering Green Value
47; !- Rendering Blue Value
OS:Rendering:Color,
{eb0bf1dc-6e50-4fef-a709-b499d94c2baf}, !- Handle
Rendering Color 30, !- Name
0, !- Rendering Red Value
255, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{7861fd0f-717c-4966-b264-ea151ea0123c}, !- Handle
Rendering Color 31, !- Name
60, !- Rendering Red Value
179, !- Rendering Green Value
113; !- Rendering Blue Value
OS:Rendering:Color,
{8c41e771-8dfa-4da7-b79d-bfd787c75bea}, !- Handle
Rendering Color 32, !- Name
175, !- Rendering Red Value
238, !- Rendering Green Value
238; !- Rendering Blue Value
OS:Rendering:Color,
{7ef4f632-be31-4ec5-9240-7727c51c13bb}, !- Handle
Rendering Color 33, !- Name
250, !- Rendering Red Value
250, !- Rendering Green Value
210; !- Rendering Blue Value
OS:Rendering:Color,
{aeb78917-75c6-4ada-a0c1-650ae429f941}, !- Handle
Rendering Color 34, !- Name
222, !- Rendering Red Value
184, !- Rendering Green Value
135; !- Rendering Blue Value
OS:Rendering:Color,
{3c643a00-0ddd-4c4d-915a-27a9a7e9d3f0}, !- Handle
Rendering Color 35, !- Name
210, !- Rendering Red Value
180, !- Rendering Green Value
140; !- Rendering Blue Value
OS:Rendering:Color,
{fc8cb9a9-e8c5-4b40-8e80-4a874ffe86d1}, !- Handle
Rendering Color 36, !- Name
250, !- Rendering Red Value
250, !- Rendering Green Value
210; !- Rendering Blue Value
OS:Rendering:Color,
{550f3767-8c2e-4659-ae81-7942f027937b}, !- Handle
Rendering Color 37, !- Name
153, !- Rendering Red Value
50, !- Rendering Green Value
204; !- Rendering Blue Value
OS:Rendering:Color,
{c8a556bb-2b72-40a6-ae46-779d40767709}, !- Handle
Rendering Color 38, !- Name
250, !- Rendering Red Value
240, !- Rendering Green Value
230; !- Rendering Blue Value
OS:Rendering:Color,
{0a11a1f6-90ef-4ba2-bf87-2e4f038758b7}, !- Handle
Rendering Color 39, !- Name
60, !- Rendering Red Value
179, !- Rendering Green Value
113; !- Rendering Blue Value
OS:Rendering:Color,
{742a932c-1e8f-42ec-a520-fb9580ad2d59}, !- Handle
Rendering Color 40, !- Name
255, !- Rendering Red Value
127, !- Rendering Green Value
80; !- Rendering Blue Value
OS:Rendering:Color,
{b8b119de-25b1-47b6-8dfc-4c06f549f4a1}, !- Handle
Rendering Color 41, !- Name
123, !- Rendering Red Value
104, !- Rendering Green Value
238; !- Rendering Blue Value
OS:Rendering:Color,
{d742a069-0da3-4c88-a6de-e928c0cff510}, !- Handle
Rendering Color 42, !- Name
238, !- Rendering Red Value
130, !- Rendering Green Value
238; !- Rendering Blue Value
OS:Rendering:Color,
{cdbfe682-11e9-40b4-8d58-d291a823a58b}, !- Handle
Rendering Color 43, !- Name
128, !- Rendering Red Value
0, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{4145c782-556d-4ed3-ae4a-dd7526d74428}, !- Handle
Rendering Color 44, !- Name
255, !- Rendering Red Value
99, !- Rendering Green Value
71; !- Rendering Blue Value
OS:Rendering:Color,
{53756f4a-48e8-4b5c-b3bc-c4063fbb3b93}, !- Handle
Rendering Color 45, !- Name
30, !- Rendering Red Value
144, !- Rendering Green Value
255; !- Rendering Blue Value
OS:Rendering:Color,
{ad8130a9-6f09-456b-87ee-3d0a7d3832da}, !- Handle
Rendering Color 46, !- Name
144, !- Rendering Red Value
238, !- Rendering Green Value
144; !- Rendering Blue Value
OS:Rendering:Color,
{b88d459b-dffc-4f52-ba19-b4ff4c18fdb6}, !- Handle
Rendering Color 47, !- Name
255, !- Rendering Red Value
218, !- Rendering Green Value
185; !- Rendering Blue Value
OS:Rendering:Color,
{b634b2eb-bc9f-4de3-9faa-7ba74fee46b3}, !- Handle
Rendering Color 48, !- Name
0, !- Rendering Red Value
139, !- Rendering Green Value
139; !- Rendering Blue Value
OS:Rendering:Color,
{958008de-8868-410d-9bb7-7626cbf10327}, !- Handle
Rendering Color 49, !- Name
219, !- Rendering Red Value
112, !- Rendering Green Value
147; !- Rendering Blue Value
OS:Rendering:Color,
{d597e39f-333d-4762-9bb3-ffeb68ce68c7}, !- Handle
Rendering Color 50, !- Name
95, !- Rendering Red Value
158, !- Rendering Green Value
160; !- Rendering Blue Value
OS:Rendering:Color,
{cea6c409-cc34-46dc-ad15-dcc673305f5e}, !- Handle
Rendering Color 51, !- Name
173, !- Rendering Red Value
216, !- Rendering Green Value
230; !- Rendering Blue Value
OS:Rendering:Color,
{f9fc4e50-1bc5-4e8d-bae1-0a12d18a87ea}, !- Handle
Rendering Color 52, !- Name
255, !- Rendering Red Value
160, !- Rendering Green Value
122; !- Rendering Blue Value
OS:Rendering:Color,
{86c1a79b-43ee-44c7-8462-9f6ca4d2ff5b}, !- Handle
Rendering Color 53, !- Name
255, !- Rendering Red Value
250, !- Rendering Green Value
250; !- Rendering Blue Value
OS:Rendering:Color,
{c1047da4-5068-466d-a43f-45500011b492}, !- Handle
Rendering Color 54, !- Name
0, !- Rendering Red Value
206, !- Rendering Green Value
209; !- Rendering Blue Value
OS:Rendering:Color,
{032dbd84-ba29-4406-958e-00bde6439cf8}, !- Handle
Rendering Color 55, !- Name
135, !- Rendering Red Value
206, !- Rendering Green Value
250; !- Rendering Blue Value
OS:Rendering:Color,
{d8dfc4a9-33e4-47e2-b3c4-9f219b5537ba}, !- Handle
Rendering Color 56, !- Name
128, !- Rendering Red Value
0, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{70992ff1-8765-4d72-9c95-44d47d545bee}, !- Handle
Rendering Color 57, !- Name
169, !- Rendering Red Value
169, !- Rendering Green Value
169; !- Rendering Blue Value
OS:Rendering:Color,
{be36b89f-b053-4ea3-b8e9-fddf59c16e33}, !- Handle
Rendering Color 58, !- Name
240, !- Rendering Red Value
230, !- Rendering Green Value
140; !- Rendering Blue Value
OS:Rendering:Color,
{f7dfd84f-b2e6-4012-a0c9-82d8bc29d1f1}, !- Handle
Rendering Color 59, !- Name
175, !- Rendering Red Value
238, !- Rendering Green Value
238; !- Rendering Blue Value
OS:Rendering:Color,
{ce0bb9d3-7c68-47bb-bc6e-80673df6bab9}, !- Handle
Rendering Color 60, !- Name
152, !- Rendering Red Value
251, !- Rendering Green Value
152; !- Rendering Blue Value
OS:Rendering:Color,
{3aed4dec-cdb6-49cc-a992-0e4461f97d60}, !- Handle
Rendering Color 61, !- Name
245, !- Rendering Red Value
245, !- Rendering Green Value
220; !- Rendering Blue Value
OS:Rendering:Color,
{020af943-0074-4297-9e1c-b70d6ec21056}, !- Handle
Rendering Color 62, !- Name
186, !- Rendering Red Value
85, !- Rendering Green Value
211; !- Rendering Blue Value
OS:Rendering:Color,
{4200045c-675c-4f3b-a2a4-3c4a1887e007}, !- Handle
Rendering Color 63, !- Name
139, !- Rendering Red Value
69, !- Rendering Green Value
19; !- Rendering Blue Value
OS:Rendering:Color,
{3d04fb6b-5d31-4e4d-b7e9-41bca7107ea3}, !- Handle
Rendering Color 64, !- Name
0, !- Rendering Red Value
128, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{1f7a5cc9-a8b3-4e7b-8f2b-736ef63b6e31}, !- Handle
Rendering Color 65, !- Name
255, !- Rendering Red Value
255, !- Rendering Green Value
240; !- Rendering Blue Value
OS:Rendering:Color,
{a7918e89-9ad4-4ac4-8c0d-2208a3ebb7b8}, !- Handle
Rendering Color 66, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
255; !- Rendering Blue Value
OS:Rendering:Color,
{a0d5256b-e46d-49e1-97fb-15c874a54ec9}, !- Handle
Rendering Color 67, !- Name
139, !- Rendering Red Value
69, !- Rendering Green Value
19; !- Rendering Blue Value
OS:Rendering:Color,
{d4a790f2-36c2-4286-85c9-3b369fd9dd29}, !- Handle
Rendering Color 68, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{1527fb52-d7be-4648-8fe0-a2e4ef6515df}, !- Handle
Rendering Color 69, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
139; !- Rendering Blue Value
OS:Rendering:Color,
{a3201f97-790a-4fba-acb8-96a8309c9e1f}, !- Handle
Rendering Color 70, !- Name
192, !- Rendering Red Value
192, !- Rendering Green Value
192; !- Rendering Blue Value
OS:Rendering:Color,
{85a030e0-ef6d-47f5-bd6f-80996a542d51}, !- Handle
Rendering Color 71, !- Name
25, !- Rendering Red Value
25, !- Rendering Green Value
112; !- Rendering Blue Value
OS:Rendering:Color,
{387a970f-14df-4027-9fe1-c36e3bd74dae}, !- Handle
Rendering Color 72, !- Name
0, !- Rendering Red Value
250, !- Rendering Green Value
154; !- Rendering Blue Value
OS:Rendering:Color,
{2c7660ae-7a74-48fc-b631-ca7f4b54c2c6}, !- Handle
Rendering Color 73, !- Name
112, !- Rendering Red Value
128, !- Rendering Green Value
144; !- Rendering Blue Value
OS:Rendering:Color,
{bdeb9fcf-5ce1-4ea2-99b5-ba35c0c6f10e}, !- Handle
Rendering Color 74, !- Name
255, !- Rendering Red Value
245, !- Rendering Green Value
238; !- Rendering Blue Value
OS:Rendering:Color,
{b3d9ffea-ce01-4967-ae51-7e2fb6ec3fac}, !- Handle
Rendering Color 75, !- Name
46, !- Rendering Red Value
139, !- Rendering Green Value
87; !- Rendering Blue Value
OS:Rendering:Color,
{9f38fb2a-173e-44d7-a58d-6cd3b6b9f7fd}, !- Handle
Rendering Color 76, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
128; !- Rendering Blue Value
OS:Rendering:Color,
{842cdfd1-55fc-407c-a8f4-e510df92958c}, !- Handle
Rendering Color 77, !- Name
255, !- Rendering Red Value
250, !- Rendering Green Value
240; !- Rendering Blue Value
OS:Rendering:Color,
{58475b90-d501-44c8-975f-791c49724caf}, !- Handle
Rendering Color 78, !- Name
245, !- Rendering Red Value
245, !- Rendering Green Value
245; !- Rendering Blue Value
OS:Rendering:Color,
{5b733e53-2b00-4456-ad17-d56fe5eb9a63}, !- Handle
Rendering Color 79, !- Name
255, !- Rendering Red Value
250, !- Rendering Green Value
240; !- Rendering Blue Value
OS:Rendering:Color,
{5cbc2ed8-39cc-4e68-90cc-81a5ada60931}, !- Handle
Rendering Color 80, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
139; !- Rendering Blue Value
OS:Rendering:Color,
{54519212-92a4-4b2a-a7e0-9e905e86aa15}, !- Handle
Rendering Color 81, !- Name
46, !- Rendering Red Value
139, !- Rendering Green Value
87; !- Rendering Blue Value
OS:Rendering:Color,
{3fb5fdba-210b-4551-bb59-56ef02034ff8}, !- Handle
Rendering Color 82, !- Name
221, !- Rendering Red Value
160, !- Rendering Green Value
221; !- Rendering Blue Value
OS:Rendering:Color,
{6b1f29ba-ca25-4209-b9b6-ecfd389bea96}, !- Handle
Rendering Color 83, !- Name
0, !- Rendering Red Value
255, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{40aa8962-03c1-4cc1-8501-2f2613fc58db}, !- Handle
Rendering Color 84, !- Name
255, !- Rendering Red Value
250, !- Rendering Green Value
250; !- Rendering Blue Value
OS:Rendering:Color,
{4c7b880b-907b-428c-a66a-1316cc6fa630}, !- Handle
Rendering Color 85, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
128; !- Rendering Blue Value
OS:Rendering:Color,
{a2cf1f09-70c0-4495-99d0-03414f7ce01f}, !- Handle
Rendering Color 86, !- Name
192, !- Rendering Red Value
192, !- Rendering Green Value
192; !- Rendering Blue Value
OS:Rendering:Color,
{168bb4bb-8fba-4543-aff5-553b687af460}, !- Handle
Rendering Color 87, !- Name
105, !- Rendering Red Value
105, !- Rendering Green Value
105; !- Rendering Blue Value
OS:Rendering:Color,
{2a044ad8-8f72-4dc9-a0d6-4dc18144d671}, !- Handle
Rendering Color 88, !- Name
255, !- Rendering Red Value
248, !- Rendering Green Value
220; !- Rendering Blue Value
OS:Rendering:Color,
{a8891d4d-b91d-47ad-8775-2ba7e2392226}, !- Handle
Rendering Color 89, !- Name
205, !- Rendering Red Value
92, !- Rendering Green Value
92; !- Rendering Blue Value
OS:Rendering:Color,
{7c2db4ce-f274-430b-adac-d7183093abab}, !- Handle
Rendering Color 90, !- Name
0, !- Rendering Red Value
255, !- Rendering Green Value
255; !- Rendering Blue Value
OS:Rendering:Color,
{0ade218c-7490-4522-8290-887c2f2f1c2b}, !- Handle
Rendering Color 91, !- Name
218, !- Rendering Red Value
165, !- Rendering Green Value
32; !- Rendering Blue Value
OS:Rendering:Color,
{a83607f3-ac17-43f0-abdf-41291da2fd97}, !- Handle
Rendering Color 92, !- Name
144, !- Rendering Red Value
238, !- Rendering Green Value
144; !- Rendering Blue Value
OS:Rendering:Color,
{1bfda7aa-e9c0-4179-82ae-30ef172b42bd}, !- Handle
Rendering Color 93, !- Name
255, !- Rendering Red Value
248, !- Rendering Green Value
220; !- Rendering Blue Value
OS:Rendering:Color,
{29d6c8fd-ced9-4d3f-a19b-c802cecd8ba7}, !- Handle
Rendering Color 94, !- Name
255, !- Rendering Red Value
165, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{277a878d-730b-48cc-869a-5e5d7b3f363a}, !- Handle
Rendering Color 95, !- Name
0, !- Rendering Red Value
255, !- Rendering Green Value
127; !- Rendering Blue Value
OS:Rendering:Color,
{edebb6b3-1b6c-49bb-a572-e9268317c20f}, !- Handle
Rendering Color 96, !- Name
0, !- Rendering Red Value
0, !- Rendering Green Value
255; !- Rendering Blue Value
OS:Rendering:Color,
{33ca113c-b065-465a-88b4-7fdf089503f5}, !- Handle
Rendering Color 97, !- Name
255, !- Rendering Red Value
248, !- Rendering Green Value
220; !- Rendering Blue Value
OS:Rendering:Color,
{b2a3a71e-0fe5-4bfa-afa4-d8de0b2ddd29}, !- Handle
Rendering Color 98, !- Name
255, !- Rendering Red Value
255, !- Rendering Green Value
224; !- Rendering Blue Value
OS:Rendering:Color,
{1eb19908-2a44-4b06-b3e3-0487a7da34fa}, !- Handle
Rendering Color 99, !- Name
32, !- Rendering Red Value
178, !- Rendering Green Value
170; !- Rendering Blue Value
OS:Rendering:Color,
{50b21793-7472-497c-9e2a-3c804cc6de0d}, !- Handle
Rendering Color 100, !- Name
0, !- Rendering Red Value
255, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{a44fbc64-cfe3-4f86-86d6-df0ae9c7b238}, !- Handle
Rendering Color 101, !- Name
148, !- Rendering Red Value
0, !- Rendering Green Value
211; !- Rendering Blue Value
OS:Rendering:Color,
{7d4f0994-d55b-46f1-90df-b0054a044975}, !- Handle
Rendering Color 102, !- Name
0, !- Rendering Red Value
191, !- Rendering Green Value
255; !- Rendering Blue Value
OS:Rendering:Color,
{7432bc3e-13a1-45a3-a1ba-9c692cf505f8}, !- Handle
Rendering Color 103, !- Name
199, !- Rendering Red Value
21, !- Rendering Green Value
133; !- Rendering Blue Value
OS:Rendering:Color,
{7d4c4029-be19-4b39-b0e4-87559fbb0d20}, !- Handle
Rendering Color 104, !- Name
255, !- Rendering Red Value
192, !- Rendering Green Value
203; !- Rendering Blue Value
OS:Rendering:Color,
{3e24dc20-e245-4ef3-a768-5a3777c19cdd}, !- Handle
Rendering Color 105, !- Name
0, !- Rendering Red Value
206, !- Rendering Green Value
209; !- Rendering Blue Value
OS:Rendering:Color,
{e3a4314d-23da-4456-9868-49b72ccd632d}, !- Handle
Rendering Color 106, !- Name
0, !- Rendering Red Value
100, !- Rendering Green Value
0; !- Rendering Blue Value
OS:Rendering:Color,
{f65ad43d-a097-415e-820c-5254c4b4ce2c}, !- Handle
Rendering Color 107, !- Name
255, !- Rendering Red Value
99, !- Rendering Green Value
71; !- Rendering Blue Value
OS:Rendering:Color,
{3a72332a-07f9-437e-a02e-feee48831931}, !- Handle
Rendering Color 108, !- Name
218, !- Rendering Red Value
165, !- Rendering Green Value
32; !- Rendering Blue Value
| 55.791945 | 106 | 0.470579 |
c97bada590f2fec6b66ce13524e855d629223c60 | 3,864 | xml | XML | app/src/main/res/layout/fragment_admin.xml | emmasonn/SkillHub | 84e4a537e3f45c21cf4ba121c78006f9fab889de | [
"Apache-2.0"
] | 1 | 2022-01-23T21:30:24.000Z | 2022-01-23T21:30:24.000Z | app/src/main/res/layout/fragment_admin.xml | emmasonn/SkillHub | 84e4a537e3f45c21cf4ba121c78006f9fab889de | [
"Apache-2.0"
] | null | null | null | app/src/main/res/layout/fragment_admin.xml | emmasonn/SkillHub | 84e4a537e3f45c21cf4ba121c78006f9fab889de | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?>
<androidx.constraintlayout.widget.ConstraintLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:app="http://schemas.android.com/apk/res-auto"
xmlns:tools="http://schemas.android.com/tools"
android:layout_width="match_parent"
android:layout_height="match_parent"
tools:context=".cms.providers.AdminFragment">
<androidx.constraintlayout.widget.ConstraintLayout
android:id="@+id/constraintLayout9"
android:layout_width="0dp"
android:layout_height="?attr/actionBarSize"
app:layout_constraintEnd_toEndOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toTopOf="parent">
<ImageView
android:id="@+id/bckKey"
android:layout_width="30dp"
android:layout_height="25dp"
android:layout_marginStart="16dp"
app:layout_constraintBottom_toBottomOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toTopOf="parent"
app:srcCompat="@drawable/arrow_back"
tools:ignore="ContentDescription" />
<androidx.appcompat.widget.SearchView
android:id="@+id/searchBar"
android:layout_width="250dp"
android:layout_height="40dp"
android:background="@drawable/tin_rectangle_outline"
app:iconifiedByDefault="false"
app:layout_constraintBottom_toBottomOf="@+id/bckKey"
app:layout_constraintEnd_toEndOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toTopOf="@+id/bckKey"
app:queryHint="search name" />
</androidx.constraintlayout.widget.ConstraintLayout>
<TextView
android:id="@+id/textView37"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:text="Filter"
android:layout_marginTop="10dp"
android:layout_marginStart="10dp"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toBottomOf="@+id/constraintLayout9" />
<Spinner
android:id="@+id/filterSpinner"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
app:layout_constraintBottom_toBottomOf="@+id/textView37"
app:layout_constraintStart_toEndOf="@+id/textView37"
app:layout_constraintTop_toTopOf="@+id/textView37" />
<View
android:id="@+id/view6"
android:layout_width="0dp"
android:layout_height="1dp"
android:layout_marginTop="3dp"
android:background="@color/transparentBlack"
app:layout_constraintEnd_toEndOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toBottomOf="@+id/filterSpinner" />
<androidx.recyclerview.widget.RecyclerView
android:id="@+id/skillsList"
android:layout_width="0dp"
android:layout_height="0dp"
android:orientation="vertical"
app:layoutManager="androidx.recyclerview.widget.StaggeredGridLayoutManager"
app:layout_constraintBottom_toBottomOf="parent"
app:layout_constraintEnd_toEndOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toBottomOf="@+id/view6"
tools:listitem="@layout/item_admin_skills" />
<ProgressBar
android:id="@+id/loadingSpin"
android:layout_width="30dp"
android:layout_height="30dp"
android:visibility="gone"
app:layout_constraintBottom_toBottomOf="parent"
app:layout_constraintEnd_toEndOf="parent"
app:layout_constraintStart_toStartOf="parent"
app:layout_constraintTop_toTopOf="parent" />
</androidx.constraintlayout.widget.ConstraintLayout> | 42 | 109 | 0.691253 |
c67ccd150d325aaaba4415c3e1c58c675e0632c3 | 764 | xml | XML | netbeans-plat/8.2/harness/update_tracking/org-netbeans-modules-nbjunit.xml | HienTH/autopsy | 1136839900cf6b0a5811851e6b56667e47f71b26 | [
"Apache-2.0"
] | 2 | 2020-04-02T17:32:08.000Z | 2021-09-12T12:55:50.000Z | netbeans-plat/8.2/harness/update_tracking/org-netbeans-modules-nbjunit.xml | HienTH/autopsy | 1136839900cf6b0a5811851e6b56667e47f71b26 | [
"Apache-2.0"
] | null | null | null | netbeans-plat/8.2/harness/update_tracking/org-netbeans-modules-nbjunit.xml | HienTH/autopsy | 1136839900cf6b0a5811851e6b56667e47f71b26 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?><module codename="org.netbeans.modules.nbjunit">
<module_version install_time="1522754889146" last="true" origin="Ant" specification_version="1.87.1">
<file crc="3013490805" name="config/Modules/org-netbeans-modules-nbjunit.xml"/>
<file crc="3268077752" name="modules/locale/org-netbeans-modules-nbjunit_ja.jar"/>
<file crc="3943458830" name="modules/locale/org-netbeans-modules-nbjunit_pt_BR.jar"/>
<file crc="3682375528" name="modules/locale/org-netbeans-modules-nbjunit_ru.jar"/>
<file crc="3881530439" name="modules/locale/org-netbeans-modules-nbjunit_zh_CN.jar"/>
<file crc="1175684269" name="modules/org-netbeans-modules-nbjunit.jar"/>
</module_version>
</module>
| 69.454545 | 105 | 0.717277 |
9a1dba67d7b7f9aed2e7a4aaed5bcc9a16ddc9a5 | 1,737 | xml | XML | src/Resources/buttonArt/LIBRARY/Symbols/RightCurlyBracket.xml | prodigious-moustachio/skyui-vr | 932dae1d9e32d375cf874dab87a1944e15f3b932 | [
"MIT"
] | null | null | null | src/Resources/buttonArt/LIBRARY/Symbols/RightCurlyBracket.xml | prodigious-moustachio/skyui-vr | 932dae1d9e32d375cf874dab87a1944e15f3b932 | [
"MIT"
] | null | null | null | src/Resources/buttonArt/LIBRARY/Symbols/RightCurlyBracket.xml | prodigious-moustachio/skyui-vr | 932dae1d9e32d375cf874dab87a1944e15f3b932 | [
"MIT"
] | null | null | null | <DOMSymbolItem xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns="http://ns.adobe.com/xfl/2008/" name="Symbols/RightCurlyBracket" itemID="50146d56-00000305" symbolType="graphic" lastModified="1343521917">
<timeline>
<DOMTimeline name="RightCurlyBracket">
<layers>
<DOMLayer name="Layer 1" color="#4FFF4F" current="true" isSelected="true">
<frames>
<DOMFrame index="0" keyMode="9728">
<elements>
<DOMShape selected="true" isFloating="true">
<matrix>
<Matrix a="0.604721069335938" d="0.602935791015625" tx="-1.15" ty="-0.8"/>
</matrix>
<fills>
<FillStyle index="1">
<SolidColor color="#CCCCCC"/>
</FillStyle>
</fills>
<edges>
<Edge fillStyle0="1" edges="!49 26S1|38 26!38 26|38 45!38 45[52 46 59 53!59 53[66 59 65 75!65 75|65 129!65 129[65 140 67 148!67 148[70 156 77 162!77 162[84 168 97 170!97 170|97 171!97 171[84 174 77 179!77 179[70 185 67 194!67 194[65 202 65 213!65 213|65 267!65 267
[66 282 59 289!59 289[52 296 38 297!38 297|38 316!38 316|49 316!49 316[62 316 72 312!72 312[82 308 88 298!88 298[93 289 93 271!93 271|93 207!93 207[94 197 98 191!98 191[103 185 110 183!110 183[117 180 124 180!124 180|124 162!124 162[117
161 110 159!110 159[103 156 98 151!98 151[94 145 93 134!93 134|93 70!93 70[93 53 88 43!88 43[82 33 72 29!72 29[62 26 49 26"/>
</edges>
</DOMShape>
</elements>
</DOMFrame>
</frames>
</DOMLayer>
</layers>
</DOMTimeline>
</timeline>
</DOMSymbolItem> | 56.032258 | 284 | 0.568221 |
10aaf0e5853a62a4e653c0614c39cfdfab01ffd6 | 272 | xml | XML | android/sample-showcase/src/main/res/drawable/item_background_circular.xml | jamesblasco/fluentui-system-icons | d12abd02219ca93bad20ab8285c8f4f454232ad6 | [
"MIT"
] | 3,870 | 2020-06-24T06:03:06.000Z | 2022-03-31T15:20:52.000Z | android/sample-showcase/src/main/res/drawable/item_background_circular.xml | jamesblasco/fluentui-system-icons | d12abd02219ca93bad20ab8285c8f4f454232ad6 | [
"MIT"
] | 216 | 2020-06-24T05:55:45.000Z | 2022-03-30T20:34:01.000Z | android/sample-showcase/src/main/res/drawable/item_background_circular.xml | jamesblasco/fluentui-system-icons | d12abd02219ca93bad20ab8285c8f4f454232ad6 | [
"MIT"
] | 349 | 2020-06-24T15:45:34.000Z | 2022-03-29T10:11:46.000Z | <?xml version="1.0" encoding="utf-8"?>
<!--
~ Copyright (c) Microsoft Corporation.
~ Licensed under the MIT license.
-->
<ripple xmlns:android="http://schemas.android.com/apk/res/android"
android:color="@color/item_highlight_color"
android:radius="48dp" />
| 27.2 | 66 | 0.683824 |
6ed338f8795a57a8ad5b0bed78ba59893a14903a | 1,438 | xml | XML | Ayo/sample-canvas/src/main/res/layout/layout_intro.xml | cowthan/Ayo2022 | a2807d2c78ae7b01e8ebaff9ff562449fce626bc | [
"MIT"
] | null | null | null | Ayo/sample-canvas/src/main/res/layout/layout_intro.xml | cowthan/Ayo2022 | a2807d2c78ae7b01e8ebaff9ff562449fce626bc | [
"MIT"
] | null | null | null | Ayo/sample-canvas/src/main/res/layout/layout_intro.xml | cowthan/Ayo2022 | a2807d2c78ae7b01e8ebaff9ff562449fce626bc | [
"MIT"
] | 1 | 2019-08-15T08:51:26.000Z | 2019-08-15T08:51:26.000Z | <?xml version="1.0" encoding="utf-8"?>
<FrameLayout xmlns:android="http://schemas.android.com/apk/res/android"
xmlns:tools="http://schemas.android.com/tools"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:background="#ffffff"
>
<TextView
android:id="@+id/tv_title"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginTop="20dp"
android:text="点击空白处试试"
android:layout_gravity="center_horizontal"
/>
<TextView
android:id="@+id/tv_method"
android:layout_width="wrap_content"
android:layout_height="wrap_content"
android:layout_marginTop="60dp"
android:text="方法名"
android:layout_gravity="center_horizontal"
/>
<TextView
android:id="@+id/tv_comment"
android:layout_width="match_parent"
android:gravity="left"
android:lineSpacingExtra="3dp"
android:layout_marginLeft="30dp"
android:layout_marginRight="30dp"
android:padding="20dp"
android:layout_height="wrap_content"
android:layout_marginTop="90dp"
android:textSize="13sp"
android:textColor="#ffffff"
android:text="方法名"
android:background="#669966"
android:layout_gravity="center_horizontal"
android:layout_marginBottom="10dp"
/>
</FrameLayout>
| 33.44186 | 71 | 0.654381 |
ca3e886105bb6568af0dd0b66dce9124a5e564b8 | 999 | xml | XML | site/public/tags/cloudfront/index.xml | nvuillam/kubeconform | 932b35d71ffc806ff5845ced8a9cb52c0104e883 | [
"Apache-2.0"
] | null | null | null | site/public/tags/cloudfront/index.xml | nvuillam/kubeconform | 932b35d71ffc806ff5845ced8a9cb52c0104e883 | [
"Apache-2.0"
] | null | null | null | site/public/tags/cloudfront/index.xml | nvuillam/kubeconform | 932b35d71ffc806ff5845ced8a9cb52c0104e883 | [
"Apache-2.0"
] | null | null | null | <?xml version="1.0" encoding="utf-8" standalone="yes"?>
<rss version="2.0" xmlns:atom="http://www.w3.org/2005/Atom">
<channel>
<title>Cloudfront on Kubeconform - Fast Kubernetes manifests validation!</title>
<link>http://localhost/tags/cloudfront/</link>
<description>Recent content in Cloudfront on Kubeconform - Fast Kubernetes manifests validation!</description>
<generator>Hugo -- gohugo.io</generator>
<language>en-us</language>
<lastBuildDate>Fri, 02 Jul 2021 00:00:00 +0000</lastBuildDate><atom:link href="http://localhost/tags/cloudfront/index.xml" rel="self" type="application/rss+xml" />
<item>
<title>The execution model of AWS Lambda@edge with Cloudfront's two- and three-tiered architecture</title>
<link>http://localhost/installation/</link>
<pubDate>Fri, 02 Jul 2021 00:00:00 +0000</pubDate>
<guid>http://localhost/installation/</guid>
<description>Installation</description>
</item>
</channel>
</rss>
| 47.571429 | 167 | 0.694695 |
ca604d618a596b8cd39e8719ef0b9c358cead996 | 147 | xml | XML | .idea/dictionaries/sgerard.xml | sebge2emasphere/clockify | 894c922a19f2e977fca80fc8b8b4c1fe09a13faa | [
"Apache-2.0"
] | null | null | null | .idea/dictionaries/sgerard.xml | sebge2emasphere/clockify | 894c922a19f2e977fca80fc8b8b4c1fe09a13faa | [
"Apache-2.0"
] | 1 | 2020-03-02T17:32:26.000Z | 2020-03-02T17:32:26.000Z | .idea/dictionaries/sgerard.xml | sebge2/clockify-kiss | 894c922a19f2e977fca80fc8b8b4c1fe09a13faa | [
"Apache-2.0"
] | null | null | null | <component name="ProjectDictionaryState">
<dictionary name="sgerard">
<words>
<w>clockify</w>
</words>
</dictionary>
</component> | 21 | 41 | 0.646259 |
80cd40ae52d91eee10d57c1ca8d7647b818c597c | 70,831 | xml | XML | src/packages/System.ComponentModel.TypeConverter.4.3.0/ref/netstandard1.5/de/System.ComponentModel.TypeConverter.xml | ArunKash/PrototypeApp | 5a4486f0383a31593045fdb59b4978957b07ad28 | [
"MIT"
] | 22 | 2019-04-02T14:10:03.000Z | 2021-04-24T23:40:04.000Z | src/packages/System.ComponentModel.TypeConverter.4.3.0/ref/netstandard1.5/de/System.ComponentModel.TypeConverter.xml | ArunKash/PrototypeApp | 5a4486f0383a31593045fdb59b4978957b07ad28 | [
"MIT"
] | 6 | 2019-03-28T14:34:50.000Z | 2022-03-19T21:14:00.000Z | src/packages/System.ComponentModel.TypeConverter.4.3.0/ref/netstandard1.5/de/System.ComponentModel.TypeConverter.xml | ArunKash/PrototypeApp | 5a4486f0383a31593045fdb59b4978957b07ad28 | [
"MIT"
] | 10 | 2019-05-30T15:35:22.000Z | 2021-12-18T09:09:07.000Z | <?xml version="1.0" encoding="utf-8"?>
<doc>
<assembly>
<name>System.ComponentModel.TypeConverter</name>
</assembly>
<members>
<member name="T:System.ComponentModel.ArrayConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von <see cref="T:System.Array" />-Objekten in verschiedene andere und aus verschiedenen anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.ArrayConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.ArrayConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.ArrayConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt in den angegebenen Zieltyp.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Die Kultur, in die der <paramref name="value" /> konvertiert wird.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Die <see cref="T:System.Type" />-Klasse, in die der Wert konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.BaseNumberConverter">
<summary>Stellt einen Basistypkonverter für numerische Festkommatypen bereit.</summary>
</member>
<member name="M:System.ComponentModel.BaseNumberConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.BaseNumberConverter" />-Klasse.</summary>
</member>
<member name="M:System.ComponentModel.BaseNumberConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Bestimmt, ob dieser Konverter ein Objekt des angegebenen Quelltyps in den systemeigenen Typ des Konverters konvertieren kann.</summary>
<returns>true, wenn dieser Konverter den Vorgang durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.BaseNumberConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Gibt einen Wert zurück, der angibt, ob dieser Konverter ein Objekt unter Verwendung des Kontexts in den angegebenen Zieltyp konvertieren kann.</summary>
<returns>true, wenn dieser Konverter den Vorgang durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="t">Ein <see cref="T:System.Type" />, der den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.BaseNumberConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt in den systemeigenen Typ des Konverters.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine <see cref="T:System.Globalization.CultureInfo" />-Klasse, die die Kultur angibt, in der die Zahl dargestellt werden soll. </param>
<param name="value">Das zu konvertierende Objekt. </param>
<exception cref="T:System.Exception">
<paramref name="value" /> ist kein gültiger Wert für den Zieltyp.</exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.BaseNumberConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Objekt in einen anderen Typ.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine <see cref="T:System.Globalization.CultureInfo" />-Klasse, die die Kultur angibt, in der die Zahl dargestellt werden soll. </param>
<param name="value">Das zu konvertierende Objekt. </param>
<param name="destinationType">Der Typ, in den das Objekt konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null.</exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.BooleanConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von <see cref="T:System.Boolean" />-Objekten in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.BooleanConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.BooleanConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.BooleanConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt vom angegebenen Quelltyp unter Verwendung des angegebenen Kontexts in ein boolesches Objekt konvertieren kann.</summary>
<returns>true, wenn dieses Objekt die Konvertierung ausführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.BooleanConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Wertobjekt in ein boolesches Objekt.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine <see cref="T:System.Globalization.CultureInfo" />-Klasse, die die Kultur angibt, in die konvertiert werden soll.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.FormatException">
<paramref name="value" /> ist kein gültiger Wert für den Zieltyp. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.ByteConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von 8-Bit-Ganzzahlobjekten ohne Vorzeichen in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.ByteConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.ByteConverter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.CharConverter">
<summary>Stellt einen Typkonverter zum Konvertieren von Unicode-Zeichenobjekten in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.CharConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.CharConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.CharConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt vom angegebenen Quelltyp unter Verwendung des angegebenen Kontexts in ein Unicode-Zeichenobjekt konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.CharConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt in ein Unicode-Zeichenobjekt.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Die Kultur, in die der <paramref name="value" /> konvertiert wird.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.FormatException">
<paramref name="value" /> ist kein gültiger Wert für den Zieltyp. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.CharConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt mithilfe der Argumente in ein Unicode-Zeichenobjekt.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Die Kultur, in die der <paramref name="value" /> konvertiert wird.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Die <see cref="T:System.Type" />-Klasse, in die der Wert konvertiert werden soll. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.CollectionConverter">
<summary>Stellt einen Typkonverter zum Konvertieren von Auflistungsobjekten in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.CollectionConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.CollectionConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.CollectionConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt in den angegebenen Zieltyp.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Die Kultur, in die der <paramref name="value" /> konvertiert wird.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse.Dieser Parameter muss von der <see cref="T:System.Collections.ICollection" />-Schnittstelle erben.</param>
<param name="destinationType">Die <see cref="T:System.Type" />-Klasse, in die der Wert konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.DateTimeConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von <see cref="T:System.DateTime" />-Objekten in verschiedene andere und aus verschiedenen anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.DateTimeConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.DateTimeConverter" />-Klasse.</summary>
</member>
<member name="M:System.ComponentModel.DateTimeConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt vom angegebenen Quelltyp unter Verwendung des angegebenen Kontexts in eine <see cref="T:System.DateTime" />-Struktur konvertieren kann.</summary>
<returns>true, wenn dieses Objekt die Konvertierung ausführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.DateTimeConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt unter Verwendung des Kontexts in den angegebenen Zieltyp konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="destinationType">Eine <see cref="T:System.Type" />-Klasse, die den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.DateTimeConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert den angegebenen Wert in eine <see cref="T:System.DateTime" />-Struktur.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.FormatException">
<paramref name="value" /> ist kein gültiger Wert für den Zieltyp. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.DateTimeConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert den angegebenen Wert mithilfe der Argumente in eine <see cref="T:System.DateTime" />-Struktur.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Die <see cref="T:System.Type" />-Klasse, in die der Wert konvertiert werden soll. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.DateTimeOffsetConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von <see cref="T:System.DateTimeOffset" />-Strukturen in verschiedene andere und aus verschiedenen anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.DateTimeOffsetConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.DateTimeOffsetConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.DateTimeOffsetConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Gibt einen Wert zurück, der angibt, ob ein Objekt des angegebenen Quelltyps in einen <see cref="T:System.DateTimeOffset" /> konvertiert werden kann.</summary>
<returns>true, wenn der angegebene Typ in einen <see cref="T:System.DateTimeOffset" /> konvertiert werden kann, andernfalls false.</returns>
<param name="context">Der Datenformatkontext.</param>
<param name="sourceType">Der zu überprüfende Quelltyp.</param>
</member>
<member name="M:System.ComponentModel.DateTimeOffsetConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Gibt einen Wert zurück, der angibt, ob ein <see cref="T:System.DateTimeOffset" /> in ein Objekt vom angegebenen Typ konvertiert werden kann.</summary>
<returns>true, wenn ein <see cref="T:System.DateTimeOffset" /> in den angegebenen Typ konvertiert werden kann, andernfalls false.</returns>
<param name="context">Der Datenformatkontext.</param>
<param name="destinationType">Der zu überprüfende Zieltyp.</param>
</member>
<member name="M:System.ComponentModel.DateTimeOffsetConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt in einen <see cref="T:System.DateTimeOffset" />.</summary>
<returns>Ein <see cref="T:System.DateTimeOffset" />, der das angegebene Objekt darstellt.</returns>
<param name="context">Der Datenformatkontext.</param>
<param name="culture">Die Datumskultur.</param>
<param name="value">Das zu konvertierende Objekt.</param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden.</exception>
</member>
<member name="M:System.ComponentModel.DateTimeOffsetConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert einen <see cref="T:System.DateTimeOffset" /> in ein Objekt vom angegebenen Typ.</summary>
<returns>Ein Objekt vom angegebenen Typ, das den <see cref="T:System.DateTimeOffset" /> darstellt. </returns>
<param name="context">Der Datenformatkontext.</param>
<param name="culture">Die Datumskultur.</param>
<param name="value">Der zu konvertierende <see cref="T:System.DateTimeOffset" />.</param>
<param name="destinationType">Der Typ, in den konvertiert werden soll.</param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden.</exception>
</member>
<member name="T:System.ComponentModel.DecimalConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von <see cref="T:System.Decimal" />-Objekten in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.DecimalConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.DecimalConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.DecimalConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt unter Verwendung des Kontexts in den angegebenen Zieltyp konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="destinationType">Eine <see cref="T:System.Type" />-Klasse, die den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.DecimalConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt mithilfe der Argumente in eine <see cref="T:System.Decimal" />-Struktur.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Die <see cref="T:System.Type" />-Klasse, in die der Wert konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">Die <paramref name="destinationType" /> ist null. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.DoubleConverter">
<summary>Stellt einen Typkonverter bereit, mit dem Objekte für Gleitkommazahlen doppelter Genauigkeit in andere und aus anderen Darstellungen konvertiert werden können.</summary>
</member>
<member name="M:System.ComponentModel.DoubleConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.DoubleConverter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.EnumConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von <see cref="T:System.Enum" />-Objekten in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.EnumConverter.#ctor(System.Type)">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.EnumConverter" />-Klasse für den angegebenen Typ.</summary>
<param name="type">Eine <see cref="T:System.Type" />-Klasse, die den Typ der Enumeration darstellt, der diesem Enumerationskonverter zugeordnet werden soll. </param>
</member>
<member name="M:System.ComponentModel.EnumConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt vom angegebenen Quelltyp unter Verwendung des angegebenen Kontexts in ein Enumerationsobjekt konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.EnumConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt unter Verwendung des Kontexts in den angegebenen Zieltyp konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="destinationType">Eine <see cref="T:System.Type" />-Klasse, die den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.EnumConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Wertobjekt in ein Enumerationsobjekt.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.FormatException">
<paramref name="value" /> ist kein gültiger Wert für den Zieltyp. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.EnumConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt in den angegebenen Zieltyp.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Die <see cref="T:System.Type" />-Klasse, in die der Wert konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null. </exception>
<exception cref="T:System.ArgumentException">
<paramref name="value" /> ist kein gültiger Wert für die Enumeration. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="P:System.ComponentModel.EnumConverter.EnumType">
<summary>Gibt den Typ des Enumerators an, dem dieser Konverter zugeordnet wurde.</summary>
<returns>Der Typ des Enumerators, dem dieser Konverter zugeordnet wurde.</returns>
</member>
<member name="T:System.ComponentModel.GuidConverter">
<summary>Stellt einen Typkonverter für das Konvertieren von <see cref="T:System.Guid" />-Objekten in verschiedene andere und aus verschiedenen anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.GuidConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.GuidConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.GuidConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt vom angegebenen Quelltyp unter Verwendung des Kontexts in ein GUID-Objekt konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.GuidConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt unter Verwendung des Kontexts in den angegebenen Zieltyp konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="destinationType">Eine <see cref="T:System.Type" />-Klasse, die den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.GuidConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt in ein GUID-Objekt.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.GuidConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Objekt in einen anderen Typ.</summary>
<returns>Das konvertierte Objekt.</returns>
<param name="context">Ein Formatierungskontext. </param>
<param name="culture">Die Kultur, in die der <paramref name="value" /> konvertiert wird.</param>
<param name="value">Das zu konvertierende Objekt. </param>
<param name="destinationType">Der Typ, in den das Objekt konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null.</exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.Int16Converter">
<summary>Stellt einen Typkonverter für das Konvertieren von 16-Bit-Ganzzahlobjekten mit Vorzeichen in und von anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.Int16Converter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.Int16Converter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.Int32Converter">
<summary>Stellt einen Typkonverter für das Konvertieren von 32-Bit-Ganzzahlobjekten mit Vorzeichen in und von anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.Int32Converter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.Int32Converter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.Int64Converter">
<summary>Stellt einen Typkonverter für das Konvertieren von 64-Bit-Ganzzahlobjekten mit Vorzeichen in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.Int64Converter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.Int64Converter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.ITypeDescriptorContext">
<summary>Stellt Kontextinformationen über eine Komponente bereit, z. B. den zugehörigen Container und Eigenschaftendeskriptor.</summary>
</member>
<member name="P:System.ComponentModel.ITypeDescriptorContext.Container">
<summary>Ruft den Container ab, der diese <see cref="T:System.ComponentModel.TypeDescriptor" />-Anforderung darstellt.</summary>
<returns>Ein <see cref="T:System.ComponentModel.IContainer" /> mit der Gruppe von Objekten für diesen <see cref="T:System.ComponentModel.TypeDescriptor" />, andernfalls null, wenn kein Container vorhanden ist oder der <see cref="T:System.ComponentModel.TypeDescriptor" /> keine externen Objekte verwendet.</returns>
</member>
<member name="P:System.ComponentModel.ITypeDescriptorContext.Instance">
<summary>Ruft das Objekt ab, das mit dieser Typdeskriptoranforderung verbunden ist.</summary>
<returns>Das Objekt, das die Methode für den <see cref="T:System.ComponentModel.TypeDescriptor" /> aufruft, andernfalls null, wenn kein für den Aufruf verantwortliches Objekt vorhanden ist.</returns>
</member>
<member name="M:System.ComponentModel.ITypeDescriptorContext.OnComponentChanged">
<summary>Löst das <see cref="E:System.ComponentModel.Design.IComponentChangeService.ComponentChanged" />-Ereignis aus.</summary>
</member>
<member name="M:System.ComponentModel.ITypeDescriptorContext.OnComponentChanging">
<summary>Löst das <see cref="E:System.ComponentModel.Design.IComponentChangeService.ComponentChanging" />-Ereignis aus.</summary>
<returns>true, wenn dieses Objekt geändert werden kann, andernfalls false.</returns>
</member>
<member name="P:System.ComponentModel.ITypeDescriptorContext.PropertyDescriptor">
<summary>Ruft den <see cref="T:System.ComponentModel.PropertyDescriptor" /> ab, der dem angegebenen Kontextelement zugeordnet ist.</summary>
<returns>Der <see cref="T:System.ComponentModel.PropertyDescriptor" />, der das angegebene Kontextelement beschreibt, andernfalls null, wenn kein für den Aufruf verantwortlicher <see cref="T:System.ComponentModel.PropertyDescriptor" /> vorhanden ist.</returns>
</member>
<member name="T:System.ComponentModel.MultilineStringConverter">
<summary>Stellt einen Typkonverter bereit, um mehrzeilige Zeichenfolgen in eine einfache Zeichenfolge zu konvertieren.</summary>
</member>
<member name="M:System.ComponentModel.MultilineStringConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.MultilineStringConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.MultilineStringConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt unter Verwendung des angegebenen Kontexts und der angegebenen Kulturinformationen in den angegebenen Typ.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Ein <see cref="T:System.ComponentModel.ITypeDescriptorContext" />, der einen Formatierungskontext bereitstellt.</param>
<param name="culture">
<see cref="T:System.Globalization.CultureInfo" />Wenn null übergeben wird, wird von der aktuellen Kultur ausgegangen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse.</param>
<param name="destinationType">Der <see cref="T:System.Type" />, in den der Parameter für den Wert konvertiert werden soll.</param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null.</exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.NullableConverter">
<summary>Stellt die automatische Konvertierung zwischen einem Typ, der NULL-Werte zulässt, und seinem zugrunde liegenden primitiven Typ bereit.</summary>
</member>
<member name="M:System.ComponentModel.NullableConverter.#ctor(System.Type)">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.NullableConverter" />-Klasse.</summary>
<param name="type">Der angegebene Typ, der NULL-Werte zulässt.</param>
<exception cref="T:System.ArgumentException">
<paramref name="type" /> ist kein Typ, der NULL-Werte zulässt.</exception>
</member>
<member name="M:System.ComponentModel.NullableConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Gibt zurück, ob dieser Konverter ein Objekt des angegebenen Typs mithilfe des angegebenen Kontexts in den Typ des Konverters konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Ein <see cref="T:System.ComponentModel.ITypeDescriptorContext" />, der einen Formatierungskontext bereitstellt.</param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt.</param>
</member>
<member name="M:System.ComponentModel.NullableConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Gibt zurück, ob dieser Konverter das Objekt mithilfe des angegebenen Kontexts in den angegebenen Typ konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt.</param>
<param name="destinationType">Ein <see cref="T:System.Type" />, der den Zieltyp der Konvertierung darstellt.</param>
</member>
<member name="M:System.ComponentModel.NullableConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt unter Verwendung des angegebenen Kontexts und der Kulturinformationen in den Typ dieses Konverters.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt.</param>
<param name="culture">Die als aktuelle Kultur zu verwendenden <see cref="T:System.Globalization.CultureInfo" />.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse.</param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.NullableConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt unter Verwendung des angegebenen Kontexts und der angegebenen Kulturinformationen in den angegebenen Typ.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt.</param>
<param name="culture">Die als aktuelle Kultur zu verwendenden <see cref="T:System.Globalization.CultureInfo" />.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse.</param>
<param name="destinationType">Der <see cref="T:System.Type" />, in den der Parameter für den Wert konvertiert werden soll.</param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null.</exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="P:System.ComponentModel.NullableConverter.NullableType">
<summary>Ruft den Typ ab, der NULL-Werte zulässt.</summary>
<returns>Ein <see cref="T:System.Type" />, der den Typ darstellt, der NULL-Werte zulässt.</returns>
</member>
<member name="P:System.ComponentModel.NullableConverter.UnderlyingType">
<summary>Ruft den zugrunde liegenden Typ ab.</summary>
<returns>Ein <see cref="T:System.Type" />, der den zugrunde liegenden Typ darstellt.</returns>
</member>
<member name="P:System.ComponentModel.NullableConverter.UnderlyingTypeConverter">
<summary>Ruft den zugrunde liegenden Typkonverter ab.</summary>
<returns>Ein <see cref="T:System.ComponentModel.TypeConverter" />, der den zugrunde liegenden Typkonverter darstellt.</returns>
</member>
<member name="T:System.ComponentModel.PropertyDescriptor">
<summary>Stellt eine Abstraktion einer Eigenschaft für eine Klasse bereit.</summary>
</member>
<member name="T:System.ComponentModel.SByteConverter">
<summary>Stellt einen Typkonverter zum Konvertieren von 8-Bit-Ganzzahlobjekten ohne Vorzeichen in eine und aus einer Zeichenfolge bereit.</summary>
</member>
<member name="M:System.ComponentModel.SByteConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.SByteConverter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.SingleConverter">
<summary>Stellt einen Typkonverter bereit, um Gleitkommazahlobjekte mit einfacher Genauigkeit in andere und aus anderen Darstellungen zu konvertieren.</summary>
</member>
<member name="M:System.ComponentModel.SingleConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.SingleConverter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.StringConverter">
<summary>Stellt einen Typkonverter zum Konvertieren von Zeichenfolgenobjekten in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.StringConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.StringConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.StringConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt vom angegebenen Quelltyp unter Verwendung des angegebenen Kontexts in eine Zeichenfolge konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.StringConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Wertobjekt in ein <see cref="T:System.String" />-Objekt.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Der zu verwendende <see cref="T:System.Globalization.CultureInfo" />. </param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung konnte nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.TimeSpanConverter">
<summary>Stellt einen Typkonverter zum Konvertieren von <see cref="T:System.TimeSpan" />-Objekten in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.TimeSpanConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.TimeSpanConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.TimeSpanConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt vom angegebenen Quelltyp unter Verwendung des angegebenen Kontexts in eine <see cref="T:System.TimeSpan" />-Struktur konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.TimeSpanConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt unter Verwendung des Kontexts in den angegebenen Zieltyp konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="destinationType">Eine <see cref="T:System.Type" />-Klasse, die den Zieltyp der Konvertierung darstellt. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null.</exception>
<exception cref="T:System.FormatException">
<paramref name="value" /> ist kein gültiger Wert für den Zieltyp. </exception>
</member>
<member name="M:System.ComponentModel.TimeSpanConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt in eine <see cref="T:System.TimeSpan" />-Struktur.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
<exception cref="T:System.FormatException">
<paramref name="value" /> ist kein gültiger Wert für den Zieltyp. </exception>
</member>
<member name="M:System.ComponentModel.TimeSpanConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Objekt in einen anderen Typ. </summary>
<returns>Das konvertierte Objekt.</returns>
<param name="context">Ein Formatierungskontext. </param>
<param name="culture">Die Kultur, in die der <paramref name="value" /> konvertiert wird.</param>
<param name="value">Das zu konvertierende Objekt. </param>
<param name="destinationType">Der Typ, in den das Objekt konvertiert werden soll. </param>
</member>
<member name="T:System.ComponentModel.TypeConverter">
<summary>Stellt eine einheitliche Methode zum Konvertieren von Werttypen in andere Typen sowie zum Zugreifen auf Standardwerte und Untereigenschaften bereit.</summary>
</member>
<member name="M:System.ComponentModel.TypeConverter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.TypeConverter" />-Klasse. </summary>
</member>
<member name="M:System.ComponentModel.TypeConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Gibt zurück, ob dieser Konverter ein Objekt des angegebenen Typs mithilfe des angegebenen Kontexts in den Typ des Konverters konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.TypeConverter.CanConvertFrom(System.Type)">
<summary>Gibt zurück, ob dieser Konverter ein Objekt des angegebenen Typs in den Typ dieses Konverters konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="sourceType">Eine <see cref="T:System.Type" />-Klasse, die den Ausgangstyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.TypeConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Gibt zurück, ob dieser Konverter das Objekt mithilfe des angegebenen Kontexts in den angegebenen Typ konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="destinationType">Ein <see cref="T:System.Type" />, der den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.TypeConverter.CanConvertTo(System.Type)">
<summary>Gibt zurück, ob dieser Konverter das Objekt in den angegebenen Typ konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="destinationType">Ein <see cref="T:System.Type" />, der den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt unter Verwendung des angegebenen Kontexts und der Kulturinformationen in den Typ dieses Konverters.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Die als aktuelle Kultur zu verwendenden <see cref="T:System.Globalization.CultureInfo" />. </param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertFrom(System.Object)">
<summary>Konvertiert den angegebenen Wert in den Typ dieses Konverters.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertFromInvariantString(System.String)">
<summary>Konvertiert die angegebene Zeichenfolge unter Verwendung der invarianten Kultur in einen Typ dieses Konverters.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten Text darstellt.</returns>
<param name="text">Die zu konvertierende <see cref="T:System.String" />. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertFromString(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.String)">
<summary>Konvertiert den angegebenen Text unter Verwendung des angegebenen Kontexts und der angegebenen Kulturinformationen in ein Objekt.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten Text darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">
<see cref="T:System.Globalization.CultureInfo" />Wenn null übergeben wird, wird von der aktuellen Kultur ausgegangen.</param>
<param name="text">Die zu konvertierende <see cref="T:System.String" />. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertFromString(System.String)">
<summary>Konvertiert den angegebenen Text in ein Objekt.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten Text darstellt.</returns>
<param name="text">Die Textdarstellung des zu konvertierenden Objekts. </param>
<exception cref="T:System.NotSupportedException">Die Zeichenfolge kann nicht in das entsprechende Objekt konvertiert werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt unter Verwendung des angegebenen Kontexts und der angegebenen Kulturinformationen in den angegebenen Typ.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">
<see cref="T:System.Globalization.CultureInfo" />Wenn null übergeben wird, wird von der aktuellen Kultur ausgegangen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Der <see cref="T:System.Type" />, in den der <paramref name="value" />-Parameter konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">Der <paramref name="destinationType" />-Parameter ist null. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertTo(System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt unter Verwendung der Argumente in den angegebenen Typ.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Der <see cref="T:System.Type" />, in den der <paramref name="value" />-Parameter konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">Der <paramref name="destinationType" />-Parameter ist null. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertToInvariantString(System.Object)">
<summary>Konvertiert den angegebenen Wert in eine Zeichenfolgendarstellung mit invarianter Kultur.</summary>
<returns>Eine <see cref="T:System.String" />-Klasse, die den konvertierten Wert darstellt.</returns>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertToString(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert den angegebenen Wert unter Verwendung des angegebenen Kontexts und der angegebenen Kulturinformationen in eine Zeichenfolgendarstellung.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">
<see cref="T:System.Globalization.CultureInfo" />Wenn null übergeben wird, wird von der aktuellen Kultur ausgegangen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.ConvertToString(System.Object)">
<summary>Konvertiert den angegebenen Wert in eine Zeichenfolgendarstellung.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.GetConvertFromException(System.Object)">
<summary>Gibt eine Ausnahme zurück, die ausgelöst wird, wenn eine Konvertierung nicht durchgeführt werden kann.</summary>
<returns>Eine <see cref="T:System.Exception" />-Klasse, die die Ausnahme darstellt, die ausgelöst wird, wenn eine Konvertierung nicht durchgeführt werden kann.</returns>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse oder null, wenn das Objekt nicht verfügbar ist. </param>
<exception cref="T:System.NotSupportedException">Wird automatisch durch diese Methode ausgelöst. </exception>
</member>
<member name="M:System.ComponentModel.TypeConverter.GetConvertToException(System.Object,System.Type)">
<summary>Gibt eine Ausnahme zurück, die ausgelöst wird, wenn eine Konvertierung nicht durchgeführt werden kann.</summary>
<returns>Eine <see cref="T:System.Exception" />-Klasse, die die Ausnahme darstellt, die ausgelöst wird, wenn eine Konvertierung nicht durchgeführt werden kann.</returns>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse oder null, wenn das Objekt nicht verfügbar ist. </param>
<param name="destinationType">Eine <see cref="T:System.Type" />-Klasse, die den Typ darstellt, in den konvertiert werden sollte. </param>
<exception cref="T:System.NotSupportedException">Wird automatisch durch diese Methode ausgelöst. </exception>
</member>
<member name="T:System.ComponentModel.TypeConverterAttribute">
<summary>Gibt an, welcher Typ als Konverter für das Objekt verwendet werden sollte, an das dieses Attribut gebunden ist.</summary>
</member>
<member name="M:System.ComponentModel.TypeConverterAttribute.#ctor(System.String)">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.TypeConverterAttribute" />-Klasse. Dabei wird der angegebene Typname als Datenkonverter für das Objekt verwendet, an das dieses Attribut gebunden ist.</summary>
<param name="typeName">Der voll gekennzeichnete Name der Klasse, mit der die Datenkonvertierung für das Objekt erfolgt, an die dieses Attribut gebunden ist. </param>
</member>
<member name="M:System.ComponentModel.TypeConverterAttribute.#ctor(System.Type)">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.TypeConverterAttribute" />-Klasse. Dabei wird der angegebene Typ als Datenkonverter für das Objekt verwendet, an das dieses Attribut gebunden ist.</summary>
<param name="type">Ein <see cref="T:System.Type" />, der den Typ der Konverterklasse darstellt, der zur Datenkonvertierung für das Objekt verwendet wird, an das dieses Attribut gebunden ist. </param>
</member>
<member name="P:System.ComponentModel.TypeConverterAttribute.ConverterTypeName">
<summary>Ruft den voll gekennzeichneten Typnamen von <see cref="T:System.Type" /> ab, der als Konverter für das Objekt verwendet wird, an das dieses Attribut gebunden ist.</summary>
<returns>Der voll gekennzeichnete Typname von <see cref="T:System.Type" />, der als Konverter für das Objekt verwendet wird, an das dieses Attribut gebunden ist. Eine leere Zeichenfolge (""), wenn kein Konverter vorhanden ist.Der Standardwert ist eine leere Zeichenfolge ("").</returns>
</member>
<member name="M:System.ComponentModel.TypeConverterAttribute.Equals(System.Object)">
<summary>Gibt zurück, ob der Wert des angegebenen Objekts gleich dem aktuellen <see cref="T:System.ComponentModel.TypeConverterAttribute" /> ist.</summary>
<returns>true, wenn der Wert des angegebenen Objekts dem aktuellen <see cref="T:System.ComponentModel.TypeConverterAttribute" /> entspricht, andernfalls false.</returns>
<param name="obj">Das Objekt, dessen Wert auf Gleichheit geprüft werden soll. </param>
</member>
<member name="M:System.ComponentModel.TypeConverterAttribute.GetHashCode">
<summary>Gibt den Hashcode für diese Instanz zurück.</summary>
<returns>Ein Hashcode für das aktuelle <see cref="T:System.ComponentModel.TypeConverterAttribute" />.</returns>
</member>
<member name="T:System.ComponentModel.TypeDescriptor">
<summary>Stellt Informationen über die Eigenschaften einer Komponente bereit, z. B. seine Attribute, Eigenschaften und Ereignisse.Diese Klasse kann nicht vererbt werden.</summary>
</member>
<member name="M:System.ComponentModel.TypeDescriptor.GetConverter(System.Type)">
<summary>Gibt einen Typkonverter für den angegebenen Typ zurück.</summary>
<returns>Ein <see cref="T:System.ComponentModel.TypeConverter" /> für den angegebenen Typ.</returns>
<param name="type">Der <see cref="T:System.Type" /> der Zielkomponente. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="component" /> ist null. </exception>
</member>
<member name="T:System.ComponentModel.TypeListConverter">
<summary>Stellt einen Typkonverter bereit, der zum Auffüllen eines Listenfelds mit verfügbaren Typen verwendet werden kann.</summary>
</member>
<member name="M:System.ComponentModel.TypeListConverter.#ctor(System.Type[])">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.TypeListConverter" />-Klasse, unter Verwendung des Typarrays als verfügbare Typen.</summary>
<param name="types">Das Array vom Typ <see cref="T:System.Type" />, das als verfügbare Typen verwendet werden soll. </param>
</member>
<member name="M:System.ComponentModel.TypeListConverter.CanConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob der Konverter die angegebene <see cref="T:System.Type" />-Klasse des Quellobjekts mithilfe des angegebenen Kontexts konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt.</param>
<param name="sourceType">Die <see cref="T:System.Type" />-Klasse des Quellobjekts.</param>
</member>
<member name="M:System.ComponentModel.TypeListConverter.CanConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Type)">
<summary>Ruft einen Wert ab, der angibt, ob dieser Konverter ein Objekt unter Verwendung des Kontexts in den angegebenen Zieltyp konvertieren kann.</summary>
<returns>true, wenn dieser Konverter die Konvertierung durchführen kann, andernfalls false.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="destinationType">Eine <see cref="T:System.Type" />-Klasse, die den Zieltyp der Konvertierung darstellt. </param>
</member>
<member name="M:System.ComponentModel.TypeListConverter.ConvertFrom(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object)">
<summary>Konvertiert das angegebene Objekt in den systemeigenen Typ des Konverters.</summary>
<returns>Ein <see cref="T:System.Object" />, das den konvertierten Wert darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine <see cref="T:System.Globalization.CultureInfo" />-Klasse, die die Kultur angibt, mit der die Schriftart dargestellt wird. </param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
</member>
<member name="M:System.ComponentModel.TypeListConverter.ConvertTo(System.ComponentModel.ITypeDescriptorContext,System.Globalization.CultureInfo,System.Object,System.Type)">
<summary>Konvertiert das angegebene Wertobjekt in den angegebenen Zieltyp.</summary>
<returns>Eine <see cref="T:System.Object" />-Klasse, die den konvertierten <paramref name="value" />-Parameter darstellt.</returns>
<param name="context">Eine <see cref="T:System.ComponentModel.ITypeDescriptorContext" />-Schnittstelle, die einen Formatierungskontext bereitstellt. </param>
<param name="culture">Eine optionale <see cref="T:System.Globalization.CultureInfo" />-Klasse.Wenn nichts anderes angegeben ist, wird die aktuelle Kultur angenommen.</param>
<param name="value">Die zu konvertierende <see cref="T:System.Object" />-Klasse. </param>
<param name="destinationType">Die <see cref="T:System.Type" />-Klasse, in die der Wert konvertiert werden soll. </param>
<exception cref="T:System.ArgumentNullException">
<paramref name="destinationType" /> ist null. </exception>
<exception cref="T:System.NotSupportedException">Die Konvertierung kann nicht durchgeführt werden. </exception>
</member>
<member name="T:System.ComponentModel.UInt16Converter">
<summary>Stellt einen Typkonverter für das Konvertieren von 16-Bit-Ganzzahlobjekten mit Vorzeichen in und von anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.UInt16Converter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.UInt16Converter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.UInt32Converter">
<summary>Stellt einen Typkonverter für das Konvertieren von 32-Bit-Ganzzahlobjekten ohne Vorzeichen in andere und aus anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.UInt32Converter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.UInt32Converter" />-Klasse. </summary>
</member>
<member name="T:System.ComponentModel.UInt64Converter">
<summary>Stellt einen Typkonverter für das Konvertieren von 64-Bit-Ganzzahlobjekten mit Vorzeichen in und von anderen Darstellungen bereit.</summary>
</member>
<member name="M:System.ComponentModel.UInt64Converter.#ctor">
<summary>Initialisiert eine neue Instanz der <see cref="T:System.ComponentModel.UInt64Converter" />-Klasse. </summary>
</member>
</members>
</doc> | 99.342216 | 322 | 0.749418 |
d3e400de0d90902f8b91d40cbc335767c56ceed6 | 1,152 | xml | XML | ivy.xml | danielholgate/marklogic-kinesis-connector | 400fc0b27afa369717bb6e7a1fd1170d6308549f | [
"MIT"
] | 2 | 2016-07-26T06:57:27.000Z | 2016-07-27T23:17:06.000Z | ivy.xml | danielholgate/marklogic-kinesis-connector | 400fc0b27afa369717bb6e7a1fd1170d6308549f | [
"MIT"
] | null | null | null | ivy.xml | danielholgate/marklogic-kinesis-connector | 400fc0b27afa369717bb6e7a1fd1170d6308549f | [
"MIT"
] | 1 | 2020-07-15T15:33:13.000Z | 2020-07-15T15:33:13.000Z | <ivy-module version="2.0">
<info organisation="org.apache" module="marklogic-kinesis-connector"/>
<configurations>
<conf name="default"/>
<conf name="build" extends="default" visibility="private"/>
<conf name="test" extends="build" visibility="private"/>
<conf name="runtime" description="Additional run-time dependencies" extends="compile"/>
<conf name="test" description="Required for test only" extends="runtime"/>
<conf name="compile" extends="default" />
</configurations>
<dependencies>
<dependency org="log4j" name="log4j" rev="1.2.17" conf="compile->default"/>
<dependency org="commons-codec" name="commons-codec" rev="1.10"/>
<dependency org="com.amazonaws" name="amazon-kinesis-client" rev="1.6.3"/>
<dependency org="com.amazonaws" name="amazon-kinesis-connectors" rev="1.2.0"/>
<dependency org="junit" name="junit" rev="4.10" conf="test->default"/>
<dependency org="com.marklogic" name="java-client-api" rev="3.0.5"/>
<dependency org="javax.ws.rs" name="javax.ws.rs-api" rev="2.0.1"/>
<dependency org="org.glassfish.jersey.core" name="jersey-common" rev="2.12"/>
</dependencies>
</ivy-module>
| 44.307692 | 91 | 0.69184 |
315a21aec83bbaa98a7ed469e1d08329a58d6f43 | 1,778 | xml | XML | docs/en/MonoMac.IOKit.USB/IIOUSBDescriptor.xml | dlech/monomac | 7ddfe388f4396405152fd3201a4a5cd47f2636b0 | [
"MIT"
] | 1 | 2017-04-20T04:41:53.000Z | 2017-04-20T04:41:53.000Z | docs/en/MonoMac.IOKit.USB/IIOUSBDescriptor.xml | dlech/monomac | 7ddfe388f4396405152fd3201a4a5cd47f2636b0 | [
"MIT"
] | null | null | null | docs/en/MonoMac.IOKit.USB/IIOUSBDescriptor.xml | dlech/monomac | 7ddfe388f4396405152fd3201a4a5cd47f2636b0 | [
"MIT"
] | null | null | null | <Type Name="IIOUSBDescriptor" FullName="MonoMac.IOKit.USB.IIOUSBDescriptor">
<TypeSignature Language="C#" Value="public interface IIOUSBDescriptor" />
<TypeSignature Language="ILAsm" Value=".class public interface auto ansi abstract IIOUSBDescriptor" />
<AssemblyInfo>
<AssemblyName>MonoMac</AssemblyName>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<Interfaces />
<Docs>
<summary>To be added.</summary>
<remarks>To be added.</remarks>
</Docs>
<Members>
<Member MemberName="DescriptorType">
<MemberSignature Language="C#" Value="public MonoMac.IOKit.USB.DescriptorType DescriptorType { get; }" />
<MemberSignature Language="ILAsm" Value=".property instance valuetype MonoMac.IOKit.USB.DescriptorType DescriptorType" />
<MemberType>Property</MemberType>
<AssemblyInfo>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>MonoMac.IOKit.USB.DescriptorType</ReturnType>
</ReturnValue>
<Docs>
<summary>To be added.</summary>
<value>To be added.</value>
<remarks>To be added.</remarks>
</Docs>
</Member>
<Member MemberName="Length">
<MemberSignature Language="C#" Value="public byte Length { get; }" />
<MemberSignature Language="ILAsm" Value=".property instance unsigned int8 Length" />
<MemberType>Property</MemberType>
<AssemblyInfo>
<AssemblyVersion>0.0.0.0</AssemblyVersion>
</AssemblyInfo>
<ReturnValue>
<ReturnType>System.Byte</ReturnType>
</ReturnValue>
<Docs>
<summary>To be added.</summary>
<value>To be added.</value>
<remarks>To be added.</remarks>
</Docs>
</Member>
</Members>
</Type>
| 37.041667 | 127 | 0.66198 |
bb9a3f10dcaee54a9806c5baf417e98aaca42c23 | 3,361 | fxml | XML | Banco de Dados/mapa-de-bordo/build/classes/FXMLView/FXMLPreencheLance.fxml | guuhx97/graduation-activities | 20502e2392f4139c53a028bc913168a28167e81c | [
"MIT"
] | null | null | null | Banco de Dados/mapa-de-bordo/build/classes/FXMLView/FXMLPreencheLance.fxml | guuhx97/graduation-activities | 20502e2392f4139c53a028bc913168a28167e81c | [
"MIT"
] | 4 | 2021-10-06T20:39:30.000Z | 2022-02-27T08:58:59.000Z | Banco de Dados/mapa-de-bordo/build/classes/FXMLView/FXMLPreencheLance.fxml | guuhx97/graduation-activities | 20502e2392f4139c53a028bc913168a28167e81c | [
"MIT"
] | null | null | null | <?xml version="1.0" encoding="UTF-8"?>
<?import javafx.scene.control.Button?>
<?import javafx.scene.control.DatePicker?>
<?import javafx.scene.control.Label?>
<?import javafx.scene.control.TextField?>
<?import javafx.scene.layout.AnchorPane?>
<?import javafx.scene.text.Font?>
<AnchorPane id="AnchorPane" prefHeight="523.0" prefWidth="581.0" xmlns="http://javafx.com/javafx/8.0.111" xmlns:fx="http://javafx.com/fxml/1" fx:controller="FXMLController.FXMLPreencheLance">
<children>
<Label layoutX="198.0" layoutY="48.0" text="Cadastre Lance">
<font>
<Font name="MT Extra" size="30.0" />
</font>
</Label>
<Label layoutX="25.0" layoutY="318.0" text="Altura Rede">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<Label layoutX="42.0" layoutY="131.0" text="Data">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<Label layoutX="292.0" layoutY="195.0" text="Hora Final">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<Label layoutX="27.0" layoutY="195.0" text="Hora Inicial">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<Label layoutX="286.0" layoutY="318.0" text="Comp. Rede">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<Label layoutX="14.0" layoutY="262.0" text="Produndidade">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<Label layoutX="34.0" layoutY="390.0" text="Latitude">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<Label layoutX="299.0" layoutY="390.0" text="Longitude">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<DatePicker fx:id="dpData" layoutX="159.0" layoutY="139.0" prefHeight="33.0" prefWidth="384.0" />
<TextField fx:id="taHoraInicial" layoutX="159.0" layoutY="199.0" prefHeight="33.0" prefWidth="121.0" />
<TextField fx:id="taHoraFinal" layoutX="420.0" layoutY="199.0" prefHeight="33.0" prefWidth="121.0" />
<TextField fx:id="taProfundidade" layoutX="159.0" layoutY="266.0" prefHeight="33.0" prefWidth="124.0" />
<TextField fx:id="taLatitude" layoutX="159.0" layoutY="394.0" prefHeight="33.0" prefWidth="121.0" />
<TextField fx:id="taCompRede" layoutX="420.0" layoutY="322.0" prefHeight="33.0" prefWidth="121.0" />
<TextField fx:id="taLongitude" layoutX="422.0" layoutY="394.0" prefHeight="33.0" prefWidth="121.0" />
<TextField fx:id="taAlturaRede" layoutX="159.0" layoutY="322.0" prefHeight="33.0" prefWidth="121.0" />
<Button fx:id="btCadastrar" layoutX="226.0" layoutY="455.0" mnemonicParsing="false" onAction="#jogarPraLancePraLista" prefHeight="43.0" prefWidth="146.0" text="Cadastrar">
<font>
<Font name="MT Extra" size="18.0" />
</font>
</Button>
<Label layoutX="315.0" layoutY="262.0" text="Malha">
<font>
<Font name="MT Extra" size="24.0" />
</font>
</Label>
<TextField fx:id="taMalhaRede" layoutX="420.0" layoutY="266.0" prefHeight="33.0" prefWidth="121.0" />
</children>
</AnchorPane>
| 43.089744 | 191 | 0.576614 |
552d3623d58bcb1729bd2ceeaa0f174e087d99cf | 413 | xml | XML | azure-nuget.xml | osisdie/Hello6.WebAPI.on.NET5.OpenAPI.JWT.FluentValidator.MediatR.EmailHandler.Docker.AZ_Pipeline.xUnit | 08bc9d3c48bf4cd711a179616c21d9be37043b55 | [
"BSD-3-Clause"
] | null | null | null | azure-nuget.xml | osisdie/Hello6.WebAPI.on.NET5.OpenAPI.JWT.FluentValidator.MediatR.EmailHandler.Docker.AZ_Pipeline.xUnit | 08bc9d3c48bf4cd711a179616c21d9be37043b55 | [
"BSD-3-Clause"
] | null | null | null | azure-nuget.xml | osisdie/Hello6.WebAPI.on.NET5.OpenAPI.JWT.FluentValidator.MediatR.EmailHandler.Docker.AZ_Pipeline.xUnit | 08bc9d3c48bf4cd711a179616c21d9be37043b55 | [
"BSD-3-Clause"
] | null | null | null | <?xml version="1.0" encoding="utf-8"?><configuration><packageSources><add key="nuget.org" value="https://api.nuget.org/v3/index.json" protocolVersion="3"/><add key="Private.Nuget" value="NUGET_ENDPOINT"/></packageSources><packageSourceCredentials><Private.Nuget><add key="Username" value="NUGET_USERNAME"/><add key="ClearTextPassword" value="NUGET_PAT"/></Private.Nuget></packageSourceCredentials></configuration> | 413 | 413 | 0.772397 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.