content
stringlengths
7
1.05M
fixed_cases
stringlengths
1
1.28M
class MinIONBasecallerException(Exception): pass class TooLargeEditDistance(MinIONBasecallerException): pass class MissingRNN1DBasecall(MinIONBasecallerException): pass class BlockSizeYTooSmall(MinIONBasecallerException): pass class InsufficientDataBlocks(MinIONBasecallerException): pass c...
class Minionbasecallerexception(Exception): pass class Toolargeeditdistance(MinIONBasecallerException): pass class Missingrnn1Dbasecall(MinIONBasecallerException): pass class Blocksizeytoosmall(MinIONBasecallerException): pass class Insufficientdatablocks(MinIONBasecallerException): pass class ...
# https://programmers.co.kr/learn/courses/30/lessons/42747 def solution(citations): citations.sort() citations_cnt = len(citations) result = 0 for idx in range(citations_cnt): if citations[idx] >= citations_cnt-idx: result = citations_cnt-idx break return result p...
def solution(citations): citations.sort() citations_cnt = len(citations) result = 0 for idx in range(citations_cnt): if citations[idx] >= citations_cnt - idx: result = citations_cnt - idx break return result print(solution([3, 0, 6, 1, 5]) == 3) print(solution([0, 0, ...
def _Test_ConstuctGraphFromJson(): g=ConstructGraphFromJSON(nameJSON='Graph_JSON_test') string = GetBackJSON(nameJSON='Graph_JSON_test') JSONObject = DataGraph(string) passedtests=0 failedtests=0 #Compare graph created from JSON and JSON itself __Pass_Test('nodes', __TestConstructNodes(g, JSONObject), True) ...
def __test__constuct_graph_from_json(): g = construct_graph_from_json(nameJSON='Graph_JSON_test') string = get_back_json(nameJSON='Graph_JSON_test') json_object = data_graph(string) passedtests = 0 failedtests = 0 ___pass__test('nodes', ___test_construct_nodes(g, JSONObject), True) ___pass__...
n=int(input("Enter a 3 digit number ")) i=n%10 j=(n//10)%10 k=n//100 s=i+j+k print(s)
n = int(input('Enter a 3 digit number ')) i = n % 10 j = n // 10 % 10 k = n // 100 s = i + j + k print(s)
num = {} def fib(n): if n in num: return num[n] if n <= 2: f = 1 else: f = fib(n-1) + fib(n-2) num[n]=f return f number=int(input("enter the range")) print( fib(number))
num = {} def fib(n): if n in num: return num[n] if n <= 2: f = 1 else: f = fib(n - 1) + fib(n - 2) num[n] = f return f number = int(input('enter the range')) print(fib(number))
#!/usr/bin/env python3 NOTE_ON = 0x90 NOTE_OFF = 0x80
note_on = 144 note_off = 128
k = int(input()) if(k == 1): print("Top 1") elif(k <= 3): print("Top 3") elif(k <= 5): print("Top 5") elif(k <= 10): print("Top 10") elif(k <= 25): print("Top 25") elif(k <= 50): print("Top 50") elif(k <= 100): print("Top 100")
k = int(input()) if k == 1: print('Top 1') elif k <= 3: print('Top 3') elif k <= 5: print('Top 5') elif k <= 10: print('Top 10') elif k <= 25: print('Top 25') elif k <= 50: print('Top 50') elif k <= 100: print('Top 100')
def collect_minima(m_space, x_space, a_space, params): U_data = np.zeros((len(m_space), len(x_space), len(a_space))) gmin_overm = []; b1_overm = []; b2_overm = []; inf_overm = []; capture2minima = []; capture_mvals = []; for mi, mm in enumerate(m_space): gmin_coords = []; bi1_coords = ...
def collect_minima(m_space, x_space, a_space, params): u_data = np.zeros((len(m_space), len(x_space), len(a_space))) gmin_overm = [] b1_overm = [] b2_overm = [] inf_overm = [] capture2minima = [] capture_mvals = [] for (mi, mm) in enumerate(m_space): gmin_coords = [] bi1_...
def euclide(a: int, b: int) -> int: if b == 0: return a return euclide(b, a % b) def euclide_etendu(a: int, b: int) -> tuple: if b == 0: return (a, 1, 0) else: (pgcd, u, v) = euclide_etendu(b, a % b) return (pgcd, v, u - (a // b) * v) def pgcd(a: int, b: int) -> int: ...
def euclide(a: int, b: int) -> int: if b == 0: return a return euclide(b, a % b) def euclide_etendu(a: int, b: int) -> tuple: if b == 0: return (a, 1, 0) else: (pgcd, u, v) = euclide_etendu(b, a % b) return (pgcd, v, u - a // b * v) def pgcd(a: int, b: int) -> int: ...
def Mergesort(L): if len(L) <= 1: return L mid = len(L) // 2 left = Mergesort(L[:mid]) right = Mergesort(L[mid:]) return Merge(left, right) def Merge(left, right): i, j = 0, 0 result = [] while (i < len(left)) and (j < len(right)): if left[i] < right[j]: result.a...
def mergesort(L): if len(L) <= 1: return L mid = len(L) // 2 left = mergesort(L[:mid]) right = mergesort(L[mid:]) return merge(left, right) def merge(left, right): (i, j) = (0, 0) result = [] while i < len(left) and j < len(right): if left[i] < right[j]: resu...
CODE_MESSAGES = { "0x00": "IP has never been observed scanning the Internet", "0x01": "IP has been observed by the GreyNoise sensor network", "0x02": ( "IP has been observed scanning the GreyNoise sensor network, " "but has not completed a full connection, meaning this can be spoofed" ),...
code_messages = {'0x00': 'IP has never been observed scanning the Internet', '0x01': 'IP has been observed by the GreyNoise sensor network', '0x02': 'IP has been observed scanning the GreyNoise sensor network, but has not completed a full connection, meaning this can be spoofed', '0x03': 'IP is adjacent to another host...
class MockSocket: def __init__(self, host, port): self.host = host self.port = port self.connected = False self.closed = False self.out_buffer = [] self.in_buffer = [] self.timeout = None def connect(self, addr): if addr == (self.host, self.por...
class Mocksocket: def __init__(self, host, port): self.host = host self.port = port self.connected = False self.closed = False self.out_buffer = [] self.in_buffer = [] self.timeout = None def connect(self, addr): if addr == (self.host, self.port)...
# TODO-USC Shape rewards here class Rewards: def __init__(self): self.obs = None self.agent_list = None self.died_agents = 0 def setAgentList(self, agents): self.agent_list = agents def update_state(self, obs): self.obs = obs def agent_died(self, agent): ...
class Rewards: def __init__(self): self.obs = None self.agent_list = None self.died_agents = 0 def set_agent_list(self, agents): self.agent_list = agents def update_state(self, obs): self.obs = obs def agent_died(self, agent): self.died_agents += 1 ...
# This challenge use a disjoint set with set size tracking. # In addition to the basic disjoint set operations, we keep # track of the total elements in a set with (#1), and add a # method (#2) to get the set size. class DisjointSet: def __init__(self, N): self.parent = [i for i in range(N)] self.total = [1...
class Disjointset: def __init__(self, N): self.parent = [i for i in range(N)] self.total = [1] * N def union(self, a, b): a_parent = self.find(a) b_parent = self.find(b) if a_parent != b_parent: self.parent[b_parent] = a_parent self.total[a_paren...
def func1(num2): num1 = 1 print(num1) print(num2 + num1) func1(12) print(num1)
def func1(num2): num1 = 1 print(num1) print(num2 + num1) func1(12) print(num1)
class PrepareNetworkActionResult(object): def __init__(self): self.actionId = '' self.success = True self.infoMessage = '' self.errorMessage = '' self.type = 'PrepareNetwork' self.access_key = '' self.secret_key = '' class PrepareSubnetActionResult(object): ...
class Preparenetworkactionresult(object): def __init__(self): self.actionId = '' self.success = True self.infoMessage = '' self.errorMessage = '' self.type = 'PrepareNetwork' self.access_key = '' self.secret_key = '' class Preparesubnetactionresult(object): ...
#!/usr/bin/env python3 # # Cross Platform and Multi Architecture Advanced Binary Emulation Framework # # https://opensource.apple.com/source/cctools/cctools-795/include/mach-o/loader.h # magic # MAGIC_32 = 0xFEEDFACE # MAGIC_64 = 0xFEEDFACF # MAGIC_FAT = 0xBEBAFECA MAGIC_...
magic_32 = [4277009102, 3472551422] magic_64 = [4277009103, 3489328638] magic_fat = [3199925962, 3405691582] cpu_type_x8664 = 16777223 cpu_type_arm64 = 16777228 cpu_type_x86 = 7 cpu_subtype_arm64_all = 6 cpu_subtype_x8664_all = 48 cpu_subtype_i386_all = 48 mh_dylinker = 7 mh_execute = 2 lc_segment_64 = 25 lc_segment = ...
'''this program aims to decrypt the message given. notes: that A = 65, B = 66 etc and that a = 97, b = 98 etc ord(A) returns ascii value for letter chr(65) returns letter for ascii value int() tells python that the item is a number ^ is an xor function ''' message = [1,9,9,24,1,9,3,25,24,31,5...
"""this program aims to decrypt the message given. notes: that A = 65, B = 66 etc and that a = 97, b = 98 etc ord(A) returns ascii value for letter chr(65) returns letter for ascii value int() tells python that the item is a number ^ is an xor function """ message = [1, 9, 9, 24, 1, 9, 3, 25, 2...
# dictionary # indexed by keys, can be any immutable type d = {"pet": "dog", "age": 5, "name": "kgb"} print(type(d)) d = dict(pet="dog", age=5, name="spot") print(d.items()) print(d.keys()) print(d.values()) print(d["pet"]) # add an item d["add"] = "sit" # remove an item del d["add"] # the value as...
d = {'pet': 'dog', 'age': 5, 'name': 'kgb'} print(type(d)) d = dict(pet='dog', age=5, name='spot') print(d.items()) print(d.keys()) print(d.values()) print(d['pet']) d['add'] = 'sit' del d['add'] for key in d.keys(): print(f'{key} = {d[key]}')
#coding=utf-8 class DBQueryError(Exception): pass class CoreError(Exception): pass class UserError(Exception): pass class NotAnError(Exception): pass class SpiderFinish(NotAnError): pass
class Dbqueryerror(Exception): pass class Coreerror(Exception): pass class Usererror(Exception): pass class Notanerror(Exception): pass class Spiderfinish(NotAnError): pass
# Boolen while input("Do you know what a boolean is ?[yes/no]") != "yes": continue print("Nice") def f(x): if x > 0: return True
while input('Do you know what a boolean is ?[yes/no]') != 'yes': continue print('Nice') def f(x): if x > 0: return True
class IncorrectAPIFormatException(Exception): pass class PageNotFoundException(Exception): pass class UnsupportedLanguageException(Exception): pass class TitleNotFound(Exception): pass
class Incorrectapiformatexception(Exception): pass class Pagenotfoundexception(Exception): pass class Unsupportedlanguageexception(Exception): pass class Titlenotfound(Exception): pass
def findDecision(obj): #obj[0]: Coupon, obj[1]: Education, obj[2]: Occupation # {"feature": "Education", "instances": 51, "metric_value": 0.9997, "depth": 1} if obj[1]>0: # {"feature": "Occupation", "instances": 31, "metric_value": 0.9629, "depth": 2} if obj[2]<=20: # {"feature": "Coupon", "instances": 29, "me...
def find_decision(obj): if obj[1] > 0: if obj[2] <= 20: if obj[0] > 3: return 'False' elif obj[0] <= 3: return 'False' else: return 'False' elif obj[2] > 20: return 'True' else: return...
x = int(input()) s1 = input() y = int(input()) s2 = input() z = int(input()) if s1 == '*': conta = x * y if s2 == '+': conta = conta + z print(int(conta), end="") elif s2 == '-': conta = conta - z print(int(conta), end="") elif s1 == '/': if y == 0: print("erro",...
x = int(input()) s1 = input() y = int(input()) s2 = input() z = int(input()) if s1 == '*': conta = x * y if s2 == '+': conta = conta + z print(int(conta), end='') elif s2 == '-': conta = conta - z print(int(conta), end='') elif s1 == '/': if y == 0: print('erro', ...
# When one base class is extending one parent class # Child class is able to access parent class methods and variables class Parent: def __init__(self): super().__init__() print('Parent constructor') def displayP(self): print('Parent Display') class Child(Parent): #Inherited fro...
class Parent: def __init__(self): super().__init__() print('Parent constructor') def display_p(self): print('Parent Display') class Child(Parent): def __init__(self): super().__init__() print('Child constructor') def display_c(self): print('Child Disp...
class Node: def __init__(self,key): self.left=None self.right=None self.key=key self.extremness=0 def __str__(self): return(str("the key is "+str(self.key)+" "+str(self.right)+" "+str(self.left))) root=Node(23) root.right=None root.left=None root.extremness=0 vrt_line=d...
class Node: def __init__(self, key): self.left = None self.right = None self.key = key self.extremness = 0 def __str__(self): return str('the key is ' + str(self.key) + ' ' + str(self.right) + ' ' + str(self.left)) root = node(23) root.right = None root.left = None root...
#!/usr/bin/env python3 def love(a): print( "I love my {}".format(a)) def decorator_love(func): def inner_love(a): print( "I miss my dog, Cherie.") return func(a) return inner_love new_func = decorator_love(love) new_func("Kit")
def love(a): print('I love my {}'.format(a)) def decorator_love(func): def inner_love(a): print('I miss my dog, Cherie.') return func(a) return inner_love new_func = decorator_love(love) new_func('Kit')
def format(matrix): rows = len(matrix) for x in range(rows): columns = len(matrix[x]) for i in range(columns): print(matrix[x][i], end=' ') print() def format_tester(): matrix = [ [1,2,3],[4,5,6],[7,8,9] ] format(matrix) matrix2 = [ [1,2,3],[4,5,6],[7,8,9],[10,1...
def format(matrix): rows = len(matrix) for x in range(rows): columns = len(matrix[x]) for i in range(columns): print(matrix[x][i], end=' ') print() def format_tester(): matrix = [[1, 2, 3], [4, 5, 6], [7, 8, 9]] format(matrix) matrix2 = [[1, 2, 3], [4, 5, 6], [7,...
class Queue: # initialize your data structure here. def __init__(self): self.stk1 = [] self.stk2 = [] self.head = None # @param x, an integer # @return nothing def push(self, x): self.stk1.append(x) if self.head is None: self.head = x # @ret...
class Queue: def __init__(self): self.stk1 = [] self.stk2 = [] self.head = None def push(self, x): self.stk1.append(x) if self.head is None: self.head = x def pop(self): while len(self.stk1): self.stk2.append(self.stk1.pop()) ...
src = Split(''' spi_flash.c spi_flash_platform.c ''') component = aos_component('Lib_SPI_Flash_Library', src)
src = split('\n spi_flash.c\n spi_flash_platform.c \n') component = aos_component('Lib_SPI_Flash_Library', src)
# Third-party dependencies fetched by Bazel # Unlike WORKSPACE, the content of this file is unordered. # We keep them separate to make the WORKSPACE file more maintainable. # Install the nodejs "bootstrap" package # This provides the basic tools for running and packaging nodejs programs in Bazel load("@bazel_tools//to...
load('@bazel_tools//tools/build_defs/repo:http.bzl', 'http_archive') load('@bazel_tools//tools/build_defs/repo:git.bzl', 'git_repository') def fetch_dependencies(): http_archive(name='bazel_skylib', urls=['https://github.com/bazelbuild/bazel-skylib/releases/download/1.0.3/bazel-skylib-1.0.3.tar.gz', 'https://mirro...
class TerraformComplianceInvalidConfig(Exception): pass class TerraformComplianceInvalidConfigurationType(Exception): pass class Failure(Exception): pass class TerraformComplianceNotImplemented(Exception): pass class TerraformComplianceInternalFailure(Exception): pass
class Terraformcomplianceinvalidconfig(Exception): pass class Terraformcomplianceinvalidconfigurationtype(Exception): pass class Failure(Exception): pass class Terraformcompliancenotimplemented(Exception): pass class Terraformcomplianceinternalfailure(Exception): pass
def group_by_f(f, lst): dct = {} for i in range(0, len(lst)): if f(lst[i]) not in dct : dct[f(lst[i])] = [] for i in dct: for j in range(0, len(lst)): if f(lst[j]) == i : #zashto ne raboti dct[i] ? dct[i].append(lst[j]) retur...
def group_by_f(f, lst): dct = {} for i in range(0, len(lst)): if f(lst[i]) not in dct: dct[f(lst[i])] = [] for i in dct: for j in range(0, len(lst)): if f(lst[j]) == i: dct[i].append(lst[j]) return dct print(group_by_f(lambda a: a % 2 == 0, [1, 2, ...
# AUTOGENERATED BY NBDEV! DO NOT EDIT! __all__ = ["index", "modules", "custom_doc_links", "git_url"] index = {"process_dirs": "00_encryption.ipynb", "encrypt_file": "00_encryption.ipynb", "pv": "00_encryption.ipynb", "decrypt_file": "00_encryption.ipynb", "txt2encrypted_file": "01_...
__all__ = ['index', 'modules', 'custom_doc_links', 'git_url'] index = {'process_dirs': '00_encryption.ipynb', 'encrypt_file': '00_encryption.ipynb', 'pv': '00_encryption.ipynb', 'decrypt_file': '00_encryption.ipynb', 'txt2encrypted_file': '01_talker.ipynb', 'encrypted_file2txt': '01_talker.ipynb', 'HttpConnectionFailur...
general_settings = { "auto_connect_to_ip": "127.0.0.1:5555", } connection_settings = { "disable_logging": True } userinterface_settings = { "dont_show_button_prompts": False, } # Debug Settings debug_switches = ( "debug_skip_ip", "debug_skip_new_save_file_message", "debug_skip_name_when_creating_new_sa...
general_settings = {'auto_connect_to_ip': '127.0.0.1:5555'} connection_settings = {'disable_logging': True} userinterface_settings = {'dont_show_button_prompts': False} debug_switches = ('debug_skip_ip', 'debug_skip_new_save_file_message', 'debug_skip_name_when_creating_new_save_files', 'debug_skip_empire_name_when_cre...
# save file with RMSE scores from Weyn et al. (2020): https://github.com/pangeo-data/WeatherBench/blob/master/notebooks/Weyn2020-scores.ipynb def generate_weyn_scores(): lead_time = [ 6., 12., 18., 24., 30., 36., 42., 48., 54., 60., 66., 72., 78., 84., 90., 96., 102., 108., 114., 120., 1...
def generate_weyn_scores(): lead_time = [6.0, 12.0, 18.0, 24.0, 30.0, 36.0, 42.0, 48.0, 54.0, 60.0, 66.0, 72.0, 78.0, 84.0, 90.0, 96.0, 102.0, 108.0, 114.0, 120.0, 126.0, 132.0, 138.0, 144.0, 150.0, 156.0, 162.0, 168.0, 174.0, 180.0, 186.0, 192.0, 198.0, 204.0, 210.0, 216.0, 222.0, 228.0, 234.0, 240.0, 246.0, 252.0...
class History: def __init__(self, aspects=()): self.history = {aspect: [] for aspect in ["generation"] + list(aspects)} def record(self, data): for key in data: self.history[key].append(data[key]) def __getitem__(self, item): return self.history[item]
class History: def __init__(self, aspects=()): self.history = {aspect: [] for aspect in ['generation'] + list(aspects)} def record(self, data): for key in data: self.history[key].append(data[key]) def __getitem__(self, item): return self.history[item]
# Copyright 2021 Invana # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http:www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to ...
class Propertiesobject: def __repr__(self): __str = '' for (k, v) in self.__dict__.items(): __str += f'{k}={v} ' return __str class Elementbase: id = None label = None def __init__(self, *args, **kwargs): self.properties = properties_object() def to_js...
WANDB = True start_molecule = None #'CCn1c(Sc2ncnc3onc(C)c23)nnc1N1CCOCC1' epsilon_start = 1.0 epsilon_end = 0.01 epsilon_decay = 2000 optimizer = "Adam" polyak = 0.995 atom_types = ["C", "O", "N"] num_episodes = 10000 max_steps_per_episode = 40 allow_removal = True allow_no_modification = True allow_bonds_between_rin...
wandb = True start_molecule = None epsilon_start = 1.0 epsilon_end = 0.01 epsilon_decay = 2000 optimizer = 'Adam' polyak = 0.995 atom_types = ['C', 'O', 'N'] num_episodes = 10000 max_steps_per_episode = 40 allow_removal = True allow_no_modification = True allow_bonds_between_rings = False allowed_ring_sizes = [3, 4, 5,...
GUIDs = { "LENOVO_SYSTEM_USB_SWITCH_DXE_GUID": [1293931, 8600, 17393, 147, 186, 42, 126, 215, 177, 225, 204], "LENOVO_SYSTEM_SCSI_BUS_DXE_GUID": [23579844, 53495, 20257, 163, 239, 158, 100, 183, 205, 206, 139], "LENOVO_SYSTEM_AHCI_BUS_DXE_GUID": [23579844, 53495, 20257, 163, 239, 158, 100, 183, 205, 206, 1...
gui_ds = {'LENOVO_SYSTEM_USB_SWITCH_DXE_GUID': [1293931, 8600, 17393, 147, 186, 42, 126, 215, 177, 225, 204], 'LENOVO_SYSTEM_SCSI_BUS_DXE_GUID': [23579844, 53495, 20257, 163, 239, 158, 100, 183, 205, 206, 139], 'LENOVO_SYSTEM_AHCI_BUS_DXE_GUID': [23579844, 53495, 20257, 163, 239, 158, 100, 183, 205, 206, 140], 'LENOVO_...
BLACK = 0 RED = 1 class Node: def __init__(self, key, color=BLACK, parent=None, left=None, right=None): self.color = color self.key = key self.parent = parent self.left = left self.right = right class Tree: def __init__(self, root=None): self.root = root def...
black = 0 red = 1 class Node: def __init__(self, key, color=BLACK, parent=None, left=None, right=None): self.color = color self.key = key self.parent = parent self.left = left self.right = right class Tree: def __init__(self, root=None): self.root = root def ...
def divide_nums(a, b): return a / 5 def multiply_nums(a, b): return a * b def subtract_nums(a, b): return a - b def add_nums(a, b): return a + b def raise_to_power(a, b): return a ** b def calculate(string): a, sign, b = string.split() a, b = float(a), int(b) if sign == '/': ...
def divide_nums(a, b): return a / 5 def multiply_nums(a, b): return a * b def subtract_nums(a, b): return a - b def add_nums(a, b): return a + b def raise_to_power(a, b): return a ** b def calculate(string): (a, sign, b) = string.split() (a, b) = (float(a), int(b)) if sign == '/': ...
def ranged_xor(m, n): f_m = [m, 1, m + 1, 0][m % 4] f_n = [n, 1, n + 1, 0][n % 4] return f_m ^ f_n def solution(start, length): xor = 0 for i in range(length): xor ^= ranged_xor(start - 1, start + length - i - 1) start += length return xor print(solution(0,3)) prin...
def ranged_xor(m, n): f_m = [m, 1, m + 1, 0][m % 4] f_n = [n, 1, n + 1, 0][n % 4] return f_m ^ f_n def solution(start, length): xor = 0 for i in range(length): xor ^= ranged_xor(start - 1, start + length - i - 1) start += length return xor print(solution(0, 3)) print(solution(17...
#IDEAS # Languages: tuples with code/name and options # FIRST ONE IS THE BASE ONE LANGUAGES = [ ('it', 'Italiano'), ('en', 'English'), ] LANGUAGE_CODE = 'it' #LANGUAGE_SELECTORS = ['prefix'] # 'query_string', 'cookie', 'header', ... SITE_MODULES = [ 'cms_theme_bootstrap', 'cmz_translations', ...
languages = [('it', 'Italiano'), ('en', 'English')] language_code = 'it' site_modules = ['cms_theme_bootstrap', 'cmz_translations', 'cms_content', 'cms_news', 'cms_cookieconsent'] cookieconsent_options = {'message': 'This is a custom message from CMZ!', 'theme': 'dark-bottom', 'link': '/example-cookie-policy/', 'dismis...
# Ant Warrior n = int(input()) data = list(map(int, input().split())) dynamic_table = [0] * 101 for select_point in range(0, n): if select_point == 0: dynamic_table[0] = data[0] elif select_point == 1: dynamic_table[1] = max(data[0], data[1]) else: dynamic_table[select_point] = m...
n = int(input()) data = list(map(int, input().split())) dynamic_table = [0] * 101 for select_point in range(0, n): if select_point == 0: dynamic_table[0] = data[0] elif select_point == 1: dynamic_table[1] = max(data[0], data[1]) else: dynamic_table[select_point] = max(dynamic_table[s...
class NotFoundException(Exception): pass class TooManyElementsException(Exception): def __init__(self, *args, **kwargs): Exception.__init__(*args, **kwargs) class IllegalArgumentException(Exception): def __init__(self, *args, **kwargs): Exception.__init__(*args, **kwargs)
class Notfoundexception(Exception): pass class Toomanyelementsexception(Exception): def __init__(self, *args, **kwargs): Exception.__init__(*args, **kwargs) class Illegalargumentexception(Exception): def __init__(self, *args, **kwargs): Exception.__init__(*args, **kwargs)
globalVar1:int = 0 # Semantic Rule 8: In function and method bodies, there must be no assignment # to variables (nonlocal or global), whose binding is inherited implicitly # (that is, without an explicit nonlocal or global declaration). See bad_local_assign.py. # 1. Global function def globalFunc1(): localVar1:st...
global_var1: int = 0 def global_func1(): local_var1: str = 'Hello' def nested_func1(): local_var1 = 'Start' global_var1 = globalVar1 + 1 class Class1(object): def method1(self: 'class1'): local_var1: str = 'Hello' def nested_func1(): local_var1 = 'Start' ...
class Wikilink(object): def __init__(self, wikilink): if not isinstance(wikilink, str): raise BadWikilinkException("Wikilink not a string") if not wikilink[:2] == "[[" or not wikilink[-2:] == "]]": raise BadWikilinkException("No wikilink in supplied string") self.wiki...
class Wikilink(object): def __init__(self, wikilink): if not isinstance(wikilink, str): raise bad_wikilink_exception('Wikilink not a string') if not wikilink[:2] == '[[' or not wikilink[-2:] == ']]': raise bad_wikilink_exception('No wikilink in supplied string') self...
class Solution: def findMaximumXOR(self, nums, ans = 0): ans = 0 for bit in range(30, -1, -1): ans <<= 1 attempt = ans | 1 prefix = set() for x in nums: p = x >> bit if attempt ^ p in prefix: ans = at...
class Solution: def find_maximum_xor(self, nums, ans=0): ans = 0 for bit in range(30, -1, -1): ans <<= 1 attempt = ans | 1 prefix = set() for x in nums: p = x >> bit if attempt ^ p in prefix: ans = a...
#These functions are involved in returning a unique key def sub_key_gen(new, parent_key_substring, **dictionary): tmp_key = "null" max_increment = 100 for key in dictionary: l = len(parent_key_substring) if key[:l] == parent_key_substring: increment = int(key[-3:]) ...
def sub_key_gen(new, parent_key_substring, **dictionary): tmp_key = 'null' max_increment = 100 for key in dictionary: l = len(parent_key_substring) if key[:l] == parent_key_substring: increment = int(key[-3:]) if increment >= max_increment: max_increme...
''' teachers and centers are lists of Teacher objects and ExamCenter objects respectively class Teacher and class ExamCentre and defined in locatable.py Link : https://github.com/aahnik/mapTeachersToCenters/blob/master/locatable.py ''' def algorithm(teachers, centers): # algorithm v connections = {} ...
""" teachers and centers are lists of Teacher objects and ExamCenter objects respectively class Teacher and class ExamCentre and defined in locatable.py Link : https://github.com/aahnik/mapTeachersToCenters/blob/master/locatable.py """ def algorithm(teachers, centers): connections = {} for teacher i...
# http://codingbat.com/prob/p153599 def front_back(str): if len(str) <= 1: return str return str[len(str)-1] + str[1:-1] + str[0]
def front_back(str): if len(str) <= 1: return str return str[len(str) - 1] + str[1:-1] + str[0]
# -- encoding: UTF-8 -- STANDARD = { # BGR -- this is the normal Windows color map 0: 0x000000, 1: 0x800000, 2: 0x00aa00, 3: 0xaaaa00, 4: 0x0000aa, 5: 0x800080, 6: 0x00aaaa, 7: 0xc0c0c0, 8: 0x808080, 9: 0xff0000, 10: 0x00ff00, 11: 0xffff00, 12: 0x0000ff, 13: 0xf...
standard = {0: 0, 1: 8388608, 2: 43520, 3: 11184640, 4: 170, 5: 8388736, 6: 43690, 7: 12632256, 8: 8421504, 9: 16711680, 10: 65280, 11: 16776960, 12: 255, 13: 16711935, 14: 65535, 15: 16777215} gamma = dict(enumerate([0, 9830400, 43520, 11184640, 170, 8388736, 43690, 12632256, 8421504, 16711680, 65280, 16776960, 255, 1...
# yacc_parsetab.py # This file is automatically generated. Do not edit. _tabversion = '3.10' _lr_method = 'LALR' _lr_signature = 'leftsemixleftopxleftbopxleftbdotxrightudotxbofx eofx linefeedx newlinex lpackagex rpackagex interpolationx indentx dedentx stringx funx slicex numberx namex eopx iopx bopx opx uopx ropx u...
_tabversion = '3.10' _lr_method = 'LALR' _lr_signature = 'leftsemixleftopxleftbopxleftbdotxrightudotxbofx eofx linefeedx newlinex lpackagex rpackagex interpolationx indentx dedentx stringx funx slicex numberx namex eopx iopx bopx opx uopx ropx udotx bdotx semix commax colonx lparx rparx lketx rketx lkcax lpcax\n\tcode\...
# Write a progra, to read two numbers and print their quotient and remainder num1 = float(input("Enter the first number: ")) num2 = float(input("Enter the second number: ")) quotient = num1 / num2 remainder = num1 % num2 print(f"{num1} / {num2} = {quotient}") print(f"{num1} % {num2} = {remainder}")
num1 = float(input('Enter the first number: ')) num2 = float(input('Enter the second number: ')) quotient = num1 / num2 remainder = num1 % num2 print(f'{num1} / {num2} = {quotient}') print(f'{num1} % {num2} = {remainder}')
password = input("Enter a password: ") abc = "abcdefghijklmnopqrstuvwxyz" ABC = "ABCDEFGHIJKLMNOPQRSTUVWXYZ" digits = "0123456789" special = "!@#$%&*+-=?^_~" length_indicator = False abc_indicator = False ABC_indicator = False digits_indicator = False special_indicator = False # check length if len(password) >= 8 an...
password = input('Enter a password: ') abc = 'abcdefghijklmnopqrstuvwxyz' abc = 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' digits = '0123456789' special = '!@#$%&*+-=?^_~' length_indicator = False abc_indicator = False abc_indicator = False digits_indicator = False special_indicator = False if len(password) >= 8 and len(password) <=...
class BlobArg(object): bucket_name: str path: str def __init__(self, bucket_name: str, path: str): self.bucket_name = bucket_name self.path = path def __repr__(self) -> str: return f"BlobArg(bucket_name={self.bucket_name},path={self.path})"
class Blobarg(object): bucket_name: str path: str def __init__(self, bucket_name: str, path: str): self.bucket_name = bucket_name self.path = path def __repr__(self) -> str: return f'BlobArg(bucket_name={self.bucket_name},path={self.path})'
def _print_aspect_impl(target, ctx): if hasattr(ctx.rule.attr, "srcjar"): srcjar = ctx.rule.attr.srcjar if srcjar != None: for f in srcjar.files.to_list(): if f != None: print(f.path) return [] print_aspect = aspect( implementation = _print_as...
def _print_aspect_impl(target, ctx): if hasattr(ctx.rule.attr, 'srcjar'): srcjar = ctx.rule.attr.srcjar if srcjar != None: for f in srcjar.files.to_list(): if f != None: print(f.path) return [] print_aspect = aspect(implementation=_print_aspect_imp...
file = open("test.txt", "r") content=file.read() measurements=content.split('\n') class Log: def __init__(self, alt,temp,acceleration,orientation,pressure): #self.time = time self.alt=float(alt) self.temp = float(temp) self.orientation=[float(i) for i in orientation] ...
file = open('test.txt', 'r') content = file.read() measurements = content.split('\n') class Log: def __init__(self, alt, temp, acceleration, orientation, pressure): self.alt = float(alt) self.temp = float(temp) self.orientation = [float(i) for i in orientation] self.acceleration = ...
''' Sieve of Eratosthenes Input: Integer n Output: Intger ''' def sieve(n): not_prime = [] for i in xrange(2, n+1): if i not in not_prime: print(i) for j in xrange(i*i, n+1, i): not_prime.append(j) x = int(raw_input()) sieve(x)
""" Sieve of Eratosthenes Input: Integer n Output: Intger """ def sieve(n): not_prime = [] for i in xrange(2, n + 1): if i not in not_prime: print(i) for j in xrange(i * i, n + 1, i): not_prime.append(j) x = int(raw_input()) sieve(x)
class Fact: def __init__(self, name: str): self.name = name self.watched = False def __eq__(self, other): if not isinstance(other, Fact): raise ValueError() return self.name == other.name def __str__(self): return self.name def __repr__(self): ...
class Fact: def __init__(self, name: str): self.name = name self.watched = False def __eq__(self, other): if not isinstance(other, Fact): raise value_error() return self.name == other.name def __str__(self): return self.name def __repr__(self): ...
# coding = utf-8 # Create date: 2018-11-07 # Author :Hailong def test_ros_config(ros_kvm_with_paramiko, cloud_config_url): fb_cc_hostname = 'hostname3' command_cc_hostname = 'sudo ros config get hostname' client = ros_kvm_with_paramiko(cloud_config='{url}/test_ros_config.yml'.format(url=cloud_config_url))...
def test_ros_config(ros_kvm_with_paramiko, cloud_config_url): fb_cc_hostname = 'hostname3' command_cc_hostname = 'sudo ros config get hostname' client = ros_kvm_with_paramiko(cloud_config='{url}/test_ros_config.yml'.format(url=cloud_config_url)) (stdin, stdout, stderr) = client.exec_command(command_cc_h...
def isTree(nums): n = len(nums) if n == 0: return True last_root, i = n / 2, 0 while i < last_root: if (nums[2 * i + 1] >= nums[i] or nums[2 * i + 2] <= nums[i]): break i+=1 return i == last_root if __name__=='__main__': s = input() nums = [int(x) for x ...
def is_tree(nums): n = len(nums) if n == 0: return True (last_root, i) = (n / 2, 0) while i < last_root: if nums[2 * i + 1] >= nums[i] or nums[2 * i + 2] <= nums[i]: break i += 1 return i == last_root if __name__ == '__main__': s = input() nums = [int(x) f...
# AUTOGENERATED BY NBDEV! DO NOT EDIT! __all__ = ["index", "modules", "custom_doc_links", "git_url"] index = {"Config": "00_helpers.ipynb", "download_url": "00_helpers.ipynb", "download_data": "00_helpers.ipynb", "file_extract": "00_helpers.ipynb", "URLs": "01_url.ipynb", ...
__all__ = ['index', 'modules', 'custom_doc_links', 'git_url'] index = {'Config': '00_helpers.ipynb', 'download_url': '00_helpers.ipynb', 'download_data': '00_helpers.ipynb', 'file_extract': '00_helpers.ipynb', 'URLs': '01_url.ipynb', 'FastDownload': '01_url.ipynb'} modules = ['helper.py', 'url.py'] doc_url = 'https://f...
arquivo = open('pessoa.csv') # abrindo arquivo dados = arquivo.read() # fazendo leitura e armazenando dados do arquivo na variavel arquivo.close() # fechando arquivo for registro in dados.splitlines(): registro = registro.split(',') print(f'Nome: {registro[0]}, Idade: {registro[1]} anos')
arquivo = open('pessoa.csv') dados = arquivo.read() arquivo.close() for registro in dados.splitlines(): registro = registro.split(',') print(f'Nome: {registro[0]}, Idade: {registro[1]} anos')
class Solution: def intersect(self, nums1, nums2): ''' 1. sort the two arrays. 2. compare the elements in the two arrays ''' nums1 = sorted(nums1) nums2 = sorted(nums2) result = [] i, j = 0, 0 while i < len(nums1) and j < len(nums2): ...
class Solution: def intersect(self, nums1, nums2): """ 1. sort the two arrays. 2. compare the elements in the two arrays """ nums1 = sorted(nums1) nums2 = sorted(nums2) result = [] (i, j) = (0, 0) while i < len(nums1) and j < len(nums2): ...
''' FINDING LONGEST PALINDROMIC SUBSTRING IN THE STRING. ''' s=input() l,m,u=[],[],[] for i in range(1,len(s)+1): for j in range(i): s_=s[j:i] l.append(s_) for i in l: if i==i[::-1]: m.append(i) for i in m: u.append(len(i)) z=list(zip(u,m)) z=sorted(z) print(z[-1][1])
""" FINDING LONGEST PALINDROMIC SUBSTRING IN THE STRING. """ s = input() (l, m, u) = ([], [], []) for i in range(1, len(s) + 1): for j in range(i): s_ = s[j:i] l.append(s_) for i in l: if i == i[::-1]: m.append(i) for i in m: u.append(len(i)) z = list(zip(u, m)) z = sorted(z) print(z...
with open("day06.txt", "r") as f: inputdata = f.readlines() theabc = "abcdefghijklmnopqrstuvwxyz" abc = [0 for i in range(26)] totsum = 0 for line in inputdata: if line == "\n": summ = abc.count(1) totsum += 26 - summ #Part 1 without the 26, just + summ abc = [0 for i in ran...
with open('day06.txt', 'r') as f: inputdata = f.readlines() theabc = 'abcdefghijklmnopqrstuvwxyz' abc = [0 for i in range(26)] totsum = 0 for line in inputdata: if line == '\n': summ = abc.count(1) totsum += 26 - summ abc = [0 for i in range(26)] else: line = line.rstrip() ...
REDDIT_USERNAME = 'HERE' #YOUR USERNAME as string REDDIT_PASS = 'HERE' # YOUR PASSWORD as string MYUID = 'HERE' MYTOKEN = 'HERE'
reddit_username = 'HERE' reddit_pass = 'HERE' myuid = 'HERE' mytoken = 'HERE'
### s = 'Hello, world!' str(s) ###
s = 'Hello, world!' str(s)
{ 'rules': [['Q', 'Q', ' ', 'Qualification'], ['PL', 'PL', '313.04_2', 'Damage/destroy 1st buoy'], ['PL', 'PL', '311.01.6', 'Penalty from prev. start (restart)'], ['NQ', 'NQ', ' ', 'No Qualification'], ['LL', 'LL', '313.02_1', 'Rounding a mark in the wrong way'], ...
{'rules': [['Q', 'Q', ' ', 'Qualification'], ['PL', 'PL', '313.04_2', 'Damage/destroy 1st buoy'], ['PL', 'PL', '311.01.6', 'Penalty from prev. start (restart)'], ['NQ', 'NQ', ' ', 'No Qualification'], ['LL', 'LL', '313.02_1', 'Rounding a mark in the wrong way'], ['LL', 'LL', '307.04_3', 'Engine rotation prior the green...
proteins = [{'accession': u'sp|Q13449|LSAMP_HUMAN Limbic system-associated membrane protein', 'id': 1, 'search_database_id': 1, 'sequence': u'MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISS...
proteins = [{'accession': u'sp|Q13449|LSAMP_HUMAN Limbic system-associated membrane protein', 'id': 1, 'search_database_id': 1, 'sequence': u'MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGE...
''' Author: tusikalanse Date: 2021-07-23 15:06:55 LastEditTime: 2021-07-23 15:44:19 LastEditors: tusikalanse Description: ''' def next_permutation(a): for i in reversed(range(len(a) - 1)): if a[i] < a[i + 1]: break else: return False j = next(j for j in reversed(range(i + 1, l...
""" Author: tusikalanse Date: 2021-07-23 15:06:55 LastEditTime: 2021-07-23 15:44:19 LastEditors: tusikalanse Description: """ def next_permutation(a): for i in reversed(range(len(a) - 1)): if a[i] < a[i + 1]: break else: return False j = next((j for j in reversed(range(i + 1, l...
# The_Captain_Room # Enter your code here. Read input from STDIN. Print output to STDOUT a,b = int(input()), list(map(int, input().split())) m=set() n=set() for i in b: if i not in m: m.add(i) else: n.add(i) print(m.difference(n).pop())
(a, b) = (int(input()), list(map(int, input().split()))) m = set() n = set() for i in b: if i not in m: m.add(i) else: n.add(i) print(m.difference(n).pop())
def search(arr, target): low = 0 high = len(arr) - 1 while low <= high: mid = (low + high) // 2 if target == arr[mid]: return mid if target > arr[mid]: low = mid + 1 else: high = mid - 1 return None def b_sort(l): for i in rang...
def search(arr, target): low = 0 high = len(arr) - 1 while low <= high: mid = (low + high) // 2 if target == arr[mid]: return mid if target > arr[mid]: low = mid + 1 else: high = mid - 1 return None def b_sort(l): for i in range(le...
class colors: class set: bold = "\x1b[1m" dim = "\x1b[2m" underline = "\x1b[4m" blink = "\x1b[5m" reverse = "\x1b[7m" hidden = "\x1b[8m" class reset: all = "\x1b[0m" bold = "\x1b[21m" dim = "\x1b[22m" underline = "\x1b[24m" blink = "\x1b[25m" reverse = "\x1b[27m" hidden = "\x1b[28m" class f...
class Colors: class Set: bold = '\x1b[1m' dim = '\x1b[2m' underline = '\x1b[4m' blink = '\x1b[5m' reverse = '\x1b[7m' hidden = '\x1b[8m' class Reset: all = '\x1b[0m' bold = '\x1b[21m' dim = '\x1b[22m' underline = '\x1b[24m' ...
def my_integ_tester(event, context): message = "hello world!" return {"message": message}
def my_integ_tester(event, context): message = 'hello world!' return {'message': message}
def is_abba(input_str: str) -> bool: first = input_str[0:2] second = input_str[3] + input_str[2] return first == second and input_str[0] != input_str[1] def is_aba(input_str: str) -> bool: return input_str[0] == input_str[2] and input_str[0] != input_str[1] def create_target(input_str: str, start_i...
def is_abba(input_str: str) -> bool: first = input_str[0:2] second = input_str[3] + input_str[2] return first == second and input_str[0] != input_str[1] def is_aba(input_str: str) -> bool: return input_str[0] == input_str[2] and input_str[0] != input_str[1] def create_target(input_str: str, start_inde...
# Part 1 of the Python Review lab. def hello_world(): print("hello world") def greet_by_name(name): print("hello "+str(name)) def encode(x): return int(x*3953531) def decode(coded_message): return coded_message / 3953531 print(decode(encode(5)))
def hello_world(): print('hello world') def greet_by_name(name): print('hello ' + str(name)) def encode(x): return int(x * 3953531) def decode(coded_message): return coded_message / 3953531 print(decode(encode(5)))
# # PySNMP MIB module JUNIPER-SP-MIB (http://snmplabs.com/pysmi) # ASN.1 source file:///Users/davwang4/Dev/mibs.snmplabs.com/asn1/JUNIPER-SP-MIB # Produced by pysmi-0.3.4 at Wed May 1 13:58:35 2019 # On host DAVWANG4-M-1475 platform Darwin version 18.5.0 by user davwang4 # Using Python version 3.7.3 (default, Mar 27 2...
(octet_string, integer, object_identifier) = mibBuilder.importSymbols('ASN1', 'OctetString', 'Integer', 'ObjectIdentifier') (named_values,) = mibBuilder.importSymbols('ASN1-ENUMERATION', 'NamedValues') (constraints_intersection, constraints_union, value_range_constraint, value_size_constraint, single_value_constraint) ...
#eg1 a = 10 b = 20 c = 100 d = 5 print((a+b)/c*d) # 1.1 print(a+(b/c)*d) # 1.2 print(a+b/(c*d)) # 1.3 print((a+b)/(c*d)) # 1.4 #eg2 print(10*4//6) #eg3 print(10*(4//6)) #eg4 print(((((20+10)*5)-10)/2)-25) #eg5 print(2**2**3) #eg6 print((2**2)**3) #eg7 print(0 or 'Python' and 1) #eg8 ...
a = 10 b = 20 c = 100 d = 5 print((a + b) / c * d) print(a + b / c * d) print(a + b / (c * d)) print((a + b) / (c * d)) print(10 * 4 // 6) print(10 * (4 // 6)) print(((20 + 10) * 5 - 10) / 2 - 25) print(2 ** 2 ** 3) print((2 ** 2) ** 3) print(0 or ('Python' and 1)) print(10 * 8 % 3) print(5 * (10 % 2))
n = int(input("Enter Any Number ")) def isPerfect(n): sum=0 for i in range(1,n): if n%i==0: sum += i if sum == n: return 1 else: return 0 if isPerfect(n): print("Perfect Number") else: print("Not A Perfect Number")
n = int(input('Enter Any Number ')) def is_perfect(n): sum = 0 for i in range(1, n): if n % i == 0: sum += i if sum == n: return 1 else: return 0 if is_perfect(n): print('Perfect Number') else: print('Not A Perfect Number')
# Autogenerated for the ucla2 variant core_addr = "192.168.1.76" device_db = { "core": { "type": "local", "module": "artiq.coredevice.core", "class": "Core", "arguments": {"host": core_addr, "ref_period": 1e-09, "target": "or1k"}, }, "core_log": { "type": "controll...
core_addr = '192.168.1.76' device_db = {'core': {'type': 'local', 'module': 'artiq.coredevice.core', 'class': 'Core', 'arguments': {'host': core_addr, 'ref_period': 1e-09, 'target': 'or1k'}}, 'core_log': {'type': 'controller', 'host': '::1', 'port': 1068, 'command': 'aqctl_corelog -p {port} --bind {bind} ' + core_addr}...
cdns_dict = { 'cerulean': '<link href="https://stackpath.bootstrapcdn.com/bootswatch/4.3.1/cerulean/bootstrap.min.css" rel="stylesheet" integrity="sha384-C++cugH8+Uf86JbNOnQoBweHHAe/wVKN/mb0lTybu/NZ9sEYbd+BbbYtNpWYAsNP" crossorigin="anonymous">', 'cosmo': '<link href="https://stackpath.bootstrapcdn.com/bootswat...
cdns_dict = {'cerulean': '<link href="https://stackpath.bootstrapcdn.com/bootswatch/4.3.1/cerulean/bootstrap.min.css" rel="stylesheet" integrity="sha384-C++cugH8+Uf86JbNOnQoBweHHAe/wVKN/mb0lTybu/NZ9sEYbd+BbbYtNpWYAsNP" crossorigin="anonymous">', 'cosmo': '<link href="https://stackpath.bootstrapcdn.com/bootswatch/4.3.1/...
# # PySNMP MIB module NMS-EAPS-MIB (http://snmplabs.com/pysmi) # ASN.1 source file:///Users/davwang4/Dev/mibs.snmplabs.com/asn1/NMS-EAPS-MIB # Produced by pysmi-0.3.4 at Mon Apr 29 20:11:48 2019 # On host DAVWANG4-M-1475 platform Darwin version 18.5.0 by user davwang4 # Using Python version 3.7.3 (default, Mar 27 2019,...
(octet_string, integer, object_identifier) = mibBuilder.importSymbols('ASN1', 'OctetString', 'Integer', 'ObjectIdentifier') (named_values,) = mibBuilder.importSymbols('ASN1-ENUMERATION', 'NamedValues') (value_size_constraint, value_range_constraint, constraints_union, constraints_intersection, single_value_constraint) ...
#This program prompts the user for numbers and prints the maximum and minimum of #the numbers count = 0 numbers = [] while True: # prompts the user for a number line = input("Enter a number: ") try: line = int(line) numbers.append(line) count = count + 1 maximum = max(numbers...
count = 0 numbers = [] while True: line = input('Enter a number: ') try: line = int(line) numbers.append(line) count = count + 1 maximum = max(numbers) minimum = min(numbers) except: if line == 'done': break else: print('Invalid...
class BinaryTree: def __init__(self, value): self.value = value self.left = None self.right = None # O(n) time \\ O(n) space def branchSums(root): sums = [] calculateBranchSums(root, 0, sums) return sums def calculateBranchSums(node, runningSum, sums): if node is None: ...
class Binarytree: def __init__(self, value): self.value = value self.left = None self.right = None def branch_sums(root): sums = [] calculate_branch_sums(root, 0, sums) return sums def calculate_branch_sums(node, runningSum, sums): if node is None: return new_r...
class rotor(object): def __init__(self, arg): self.arg = arg self.rotors = { # EKMFLGDQVZNTOWYHXUSPAIBRCJ 1: {1: 5, 2: 11, 3: 13, 4: 6, 5: 12, 6: 7, 7: 4, 8: 17, 9: 22, 10: 26, 11: 14, 12: 20, 13: 15, 14: 23, 15: 25, 16: 8, 17: 24, 18: 21, 19: 19, 20: 16, 21: 1, 22: 9, 23: 2, 24: 18, 25: 3, 26: 10} ...
class Rotor(object): def __init__(self, arg): self.arg = arg self.rotors = {1: {1: 5, 2: 11, 3: 13, 4: 6, 5: 12, 6: 7, 7: 4, 8: 17, 9: 22, 10: 26, 11: 14, 12: 20, 13: 15, 14: 23, 15: 25, 16: 8, 17: 24, 18: 21, 19: 19, 20: 16, 21: 1, 22: 9, 23: 2, 24: 18, 25: 3, 26: 10}, 2: {1: 1, 2: 10, 3: 4, 4: 11...
class ListNode: def __init__(self, val, next = None): self.val = val self.next = next class Solution: def isPalindrome(self, head): if not head or not head.next: return True # Find the middle slow = fast = head while fast.next and fast.next.next: ...
class Listnode: def __init__(self, val, next=None): self.val = val self.next = next class Solution: def is_palindrome(self, head): if not head or not head.next: return True slow = fast = head while fast.next and fast.next.next: slow = slow.next ...
# noinspection PyUnusedLocal # skus = unicode string def checkout(skus): raise NotImplementedError()
def checkout(skus): raise not_implemented_error()
# Recieving user input yellowC, blueC = map(int, input().split()) yellowB, greenB, blueB = map(int, input().split()) # Counting the deficit yellowC -= (2 * yellowB + greenB) blueC -= (greenB + 3 * blueB) # Totalling the amount required requiredC = 0 if yellowC < 0: requiredC += yellowC * -1 if blueC < 0: requir...
(yellow_c, blue_c) = map(int, input().split()) (yellow_b, green_b, blue_b) = map(int, input().split()) yellow_c -= 2 * yellowB + greenB blue_c -= greenB + 3 * blueB required_c = 0 if yellowC < 0: required_c += yellowC * -1 if blueC < 0: required_c += blueC * -1 print(requiredC)
# This problem was recently asked by Twitter: # Given a binary tree and an integer k, filter the binary tree such that its leaves don't contain the value k. # Here are the rules: # - If a leaf node has a value of k, remove it. # - If a parent node has a value of k, and all of its children are removed, remove it. cla...
class Node: def __init__(self, value, left=None, right=None): self.value = value self.left = left self.right = right def __repr__(self): return f'value: {self.value}, left: ({self.left.__repr__()}), right: ({self.right.__repr__()})' def filter(tree, k): if tree is None: ...
a=1 b=1 print(id(a)) print(id(b))
a = 1 b = 1 print(id(a)) print(id(b))
class ServerAccess: _url = "" # type: str _token = "" # type: str def __init__(self, url: str, token: str): self._url = url self._token = token @staticmethod def from_config(config: dict): return ServerAccess(config['url'], config['token']) def get_url(self): ...
class Serveraccess: _url = '' _token = '' def __init__(self, url: str, token: str): self._url = url self._token = token @staticmethod def from_config(config: dict): return server_access(config['url'], config['token']) def get_url(self): return self._url de...
def count_down(n): print(n) if n > 0: return count_down(n - 1) count_down(5)
def count_down(n): print(n) if n > 0: return count_down(n - 1) count_down(5)
def nd_6_sigma(img: np.ndarray, **kwargs) -> np.ndarray: for key, value in kwargs.items(): if key == "sigma": _s_level: int = value else: _s_level: int = 4 # default sigma level _s_yield: float = 0.0 if _s_level == 1: _s_yield = 0.69 ...
def nd_6_sigma(img: np.ndarray, **kwargs) -> np.ndarray: for (key, value) in kwargs.items(): if key == 'sigma': _s_level: int = value else: _s_level: int = 4 _s_yield: float = 0.0 if _s_level == 1: _s_yield = 0.69 elif _s_level == 2: _s_yield = 0.3...
numItem = int(input('What is your maximum number for the list of triples? ')) def cost(numItem): while numItem > 0: print(numItem * 3) numItem -= 1 cost(numItem)
num_item = int(input('What is your maximum number for the list of triples? ')) def cost(numItem): while numItem > 0: print(numItem * 3) num_item -= 1 cost(numItem)
class Queue: def __init__(self,n): self.maxsize = n self.front = 0 self.rear = 0 self.queue = [] def enqueue(self,data): if (self.rear >= self.maxsize): print("Queue is full") else : self.front+=1 self.rear+=1 ...
class Queue: def __init__(self, n): self.maxsize = n self.front = 0 self.rear = 0 self.queue = [] def enqueue(self, data): if self.rear >= self.maxsize: print('Queue is full') else: self.front += 1 self.rear += 1 s...
name = input("Escreva seu nome: ") print("Bem vindo ao PyCgarm,", name)
name = input('Escreva seu nome: ') print('Bem vindo ao PyCgarm,', name)
# table of specific heat capacities [in Joules per kilogram Kelvin] materials = { "iron": "440", "aluminium": "887", "copper": "385", "steel": "452", "gold": "129", "mercury": "140", "copper": "385", "aluminum": "902", "water": "4197", "air": "1000", "ice": "2003", "sil...
materials = {'iron': '440', 'aluminium': '887', 'copper': '385', 'steel': '452', 'gold': '129', 'mercury': '140', 'copper': '385', 'aluminum': '902', 'water': '4197', 'air': '1000', 'ice': '2003', 'silver': '236', 'tin': '226', 'zinc': '389', 'sand': '780'}