contestId
int64 0
1.01k
| index
stringclasses 40
values | name
stringlengths 2
54
| type
stringclasses 2
values | rating
int64 0
3.4k
| tags
listlengths 0
7
| title
stringclasses 393
values | time-limit
stringclasses 7
values | memory-limit
stringclasses 6
values | problem-description
stringlengths 0
2.97k
| input-specification
stringlengths 4
1.87k
| output-specification
stringlengths 4
1.12k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
3.5k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 1
value | testset
stringclasses 9
values | passedTestCount
int64 1
402
| timeConsumedMillis
int64 15
8.06k
| memoryConsumedBytes
int64 0
514M
| code
stringlengths 11
61.4k
| prompt
stringlengths 297
7.35k
| response
stringlengths 25
61.4k
| score
float64 2.82
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
604
|
A
|
Uncowed Forces
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score.
Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack.
All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer.
|
The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=β€<=*m**i*<=β€<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted.
The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=β€<=*w**i*<=β€<=10) is Kevin's number of wrong submissions on problem *i*.
The last line contains two space-separated integers *h**s* and *h**u* (0<=β€<=*h**s*,<=*h**u*<=β€<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively.
|
Print a single integer, the value of Kevin's final score.
|
[
"20 40 60 80 100\n0 1 2 3 4\n1 0\n",
"119 119 119 119 119\n0 0 0 0 0\n10 0\n"
] |
[
"4900\n",
"4930\n"
] |
In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10Β·100β=β1000 points from hacks, his total score becomes 3930β+β1000β=β4930.
| 500
|
[
{
"input": "20 40 60 80 100\n0 1 2 3 4\n1 0",
"output": "4900"
},
{
"input": "119 119 119 119 119\n0 0 0 0 0\n10 0",
"output": "4930"
},
{
"input": "3 6 13 38 60\n6 10 10 3 8\n9 9",
"output": "5088"
},
{
"input": "21 44 11 68 75\n6 2 4 8 4\n2 8",
"output": "4522"
},
{
"input": "16 112 50 114 68\n1 4 8 4 9\n19 11",
"output": "5178"
},
{
"input": "55 66 75 44 47\n6 0 6 6 10\n19 0",
"output": "6414"
},
{
"input": "47 11 88 5 110\n6 10 4 2 3\n10 6",
"output": "5188"
},
{
"input": "5 44 61 103 92\n9 0 10 4 8\n15 7",
"output": "4914"
},
{
"input": "115 53 96 62 110\n7 8 1 7 9\n7 16",
"output": "3416"
},
{
"input": "102 83 26 6 11\n3 4 1 8 3\n17 14",
"output": "6704"
},
{
"input": "36 102 73 101 19\n5 9 2 2 6\n4 13",
"output": "4292"
},
{
"input": "40 115 93 107 113\n5 7 2 6 8\n6 17",
"output": "2876"
},
{
"input": "53 34 53 107 81\n4 3 1 10 8\n7 7",
"output": "4324"
},
{
"input": "113 37 4 84 66\n2 0 10 3 0\n20 19",
"output": "6070"
},
{
"input": "10 53 101 62 1\n8 0 9 7 9\n0 11",
"output": "4032"
},
{
"input": "45 45 75 36 76\n6 2 2 0 0\n8 17",
"output": "5222"
},
{
"input": "47 16 44 78 111\n7 9 8 0 2\n1 19",
"output": "3288"
},
{
"input": "7 54 39 102 31\n6 0 2 10 1\n18 3",
"output": "6610"
},
{
"input": "0 46 86 72 40\n1 5 5 5 9\n6 5",
"output": "4924"
},
{
"input": "114 4 45 78 113\n0 4 8 10 2\n10 12",
"output": "4432"
},
{
"input": "56 56 96 105 107\n4 9 10 4 8\n2 1",
"output": "3104"
},
{
"input": "113 107 59 50 56\n3 7 10 6 3\n10 12",
"output": "4586"
},
{
"input": "96 104 9 94 84\n6 10 7 8 3\n14 11",
"output": "4754"
},
{
"input": "98 15 116 43 55\n4 3 0 9 3\n10 7",
"output": "5400"
},
{
"input": "0 26 99 108 35\n0 4 3 0 10\n9 5",
"output": "5388"
},
{
"input": "89 24 51 49 84\n5 6 2 2 9\n2 14",
"output": "4066"
},
{
"input": "57 51 76 45 96\n1 0 4 3 6\n12 15",
"output": "5156"
},
{
"input": "79 112 37 36 116\n2 8 4 7 5\n4 12",
"output": "3872"
},
{
"input": "71 42 60 20 7\n7 1 1 10 6\n1 7",
"output": "5242"
},
{
"input": "86 10 66 80 55\n0 2 5 10 5\n15 6",
"output": "5802"
},
{
"input": "66 109 22 22 62\n3 1 5 4 5\n10 5",
"output": "5854"
},
{
"input": "97 17 43 84 58\n2 8 3 8 6\n10 7",
"output": "5028"
},
{
"input": "109 83 5 114 104\n6 0 3 9 5\n5 2",
"output": "4386"
},
{
"input": "94 18 24 91 105\n2 0 7 10 3\n1 4",
"output": "4118"
},
{
"input": "64 17 86 59 45\n8 0 10 2 2\n4 4",
"output": "5144"
},
{
"input": "70 84 31 57 2\n7 0 0 2 7\n12 5",
"output": "6652"
},
{
"input": "98 118 117 86 4\n2 10 9 7 5\n11 15",
"output": "4476"
},
{
"input": "103 110 101 97 70\n4 2 1 0 5\n7 5",
"output": "4678"
},
{
"input": "78 96 6 97 62\n7 7 9 2 9\n10 3",
"output": "4868"
},
{
"input": "95 28 3 31 115\n1 9 0 7 3\n10 13",
"output": "5132"
},
{
"input": "45 17 116 58 3\n8 8 7 6 4\n3 19",
"output": "3992"
},
{
"input": "19 12 0 113 77\n3 0 10 9 2\n8 6",
"output": "5040"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0",
"output": "7500"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n20 0",
"output": "9500"
},
{
"input": "119 119 119 119 119\n10 10 10 10 10\n0 20",
"output": "1310"
},
{
"input": "0 0 0 0 0\n10 10 10 10 10\n0 20",
"output": "4150"
},
{
"input": "119 0 0 0 0\n10 0 0 0 0\n5 5",
"output": "7400"
},
{
"input": "0 119 0 0 0\n0 10 0 0 0\n5 5",
"output": "7050"
},
{
"input": "0 0 119 0 0\n0 0 10 0 0\n0 0",
"output": "6450"
},
{
"input": "0 0 0 119 0\n0 0 0 10 0\n5 5",
"output": "6350"
},
{
"input": "0 0 0 0 119\n0 0 0 0 10\n5 5",
"output": "6060"
},
{
"input": "119 0 0 0 0\n2 0 0 0 0\n5 5",
"output": "7412"
},
{
"input": "0 119 0 0 0\n0 2 0 0 0\n5 5",
"output": "7174"
},
{
"input": "0 0 119 0 0\n0 0 2 0 0\n5 5",
"output": "6936"
},
{
"input": "0 0 0 119 0\n0 0 0 2 0\n5 5",
"output": "6698"
},
{
"input": "0 0 0 0 119\n0 0 0 0 2\n5 5",
"output": "6460"
},
{
"input": "119 0 0 0 0\n0 0 0 0 0\n4 9",
"output": "7212"
}
] | 1,629,089,355
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 77
| 6,963,200
|
def score(x,m,w):
t=(1-(m/250))*x - (50*w)
return max(0.3*x,t)
sl=[500,1000,1500,2000,2500]
m=list(map(int, input().split()))
w=list(map(int, input().split()))
s,u=map(int,input().split())
res=0
for i in range(5):
res+=score(sl[i],m[i],w[i])
res+=(100*s)
res-=(50*u)
print(int(res))
|
Title: Uncowed Forces
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score.
Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack.
All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer.
Input Specification:
The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=β€<=*m**i*<=β€<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted.
The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=β€<=*w**i*<=β€<=10) is Kevin's number of wrong submissions on problem *i*.
The last line contains two space-separated integers *h**s* and *h**u* (0<=β€<=*h**s*,<=*h**u*<=β€<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively.
Output Specification:
Print a single integer, the value of Kevin's final score.
Demo Input:
['20 40 60 80 100\n0 1 2 3 4\n1 0\n', '119 119 119 119 119\n0 0 0 0 0\n10 0\n']
Demo Output:
['4900\n', '4930\n']
Note:
In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10Β·100β=β1000 points from hacks, his total score becomes 3930β+β1000β=β4930.
|
```python
def score(x,m,w):
t=(1-(m/250))*x - (50*w)
return max(0.3*x,t)
sl=[500,1000,1500,2000,2500]
m=list(map(int, input().split()))
w=list(map(int, input().split()))
s,u=map(int,input().split())
res=0
for i in range(5):
res+=score(sl[i],m[i],w[i])
res+=(100*s)
res-=(50*u)
print(int(res))
```
| 3
|
|
281
|
A
|
Word Capitalization
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500
|
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,697,612,339
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
s=str(input())
s=list(s)
a=s[0]
a=a.upper()
s[0]=a
y="".join(s)
print(y)
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
s=str(input())
s=list(s)
a=s[0]
a=a.upper()
s[0]=a
y="".join(s)
print(y)
```
| 3
|
|
322
|
B
|
Ciel and Flowers
|
PROGRAMMING
| 1,600
|
[
"combinatorics",
"math"
] | null | null |
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make.
|
The first line contains three integers *r*, *g* and *b* (0<=β€<=*r*,<=*g*,<=*b*<=β€<=109) β the number of red, green and blue flowers.
|
Print the maximal number of bouquets Fox Ciel can make.
|
[
"3 6 9\n",
"4 4 4\n",
"0 0 0\n"
] |
[
"6\n",
"4\n",
"0\n"
] |
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
| 1,000
|
[
{
"input": "3 6 9",
"output": "6"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "0 3 6",
"output": "3"
},
{
"input": "7 8 9",
"output": "7"
},
{
"input": "8 8 9",
"output": "8"
},
{
"input": "15 3 999",
"output": "339"
},
{
"input": "32 62 92",
"output": "62"
},
{
"input": "123456789 123456789 123456789",
"output": "123456789"
},
{
"input": "3 5 5",
"output": "4"
},
{
"input": "666806767 385540591 357848286",
"output": "470065214"
},
{
"input": "80010646 727118126 817880463",
"output": "541669744"
},
{
"input": "829651016 732259171 572879931",
"output": "711596705"
},
{
"input": "242854896 442432924 180395753",
"output": "288561190"
},
{
"input": "139978911 5123031 935395222",
"output": "360165721"
},
{
"input": "553182792 10264076 395427398",
"output": "319624755"
},
{
"input": "597790453 720437830 855459575",
"output": "724562619"
},
{
"input": "494914467 356982656 757942689",
"output": "536613270"
},
{
"input": "908118348 67156409 217974865",
"output": "397749873"
},
{
"input": "952726009 629846517 972974334",
"output": "851848953"
},
{
"input": "775140200 616574841 630329230",
"output": "674014756"
},
{
"input": "524780569 326748594 90361407",
"output": "313963523"
},
{
"input": "937984449 184405994 992844522",
"output": "705078321"
},
{
"input": "835108464 525983528 452876698",
"output": "604656229"
},
{
"input": "879716125 531124573 207876166",
"output": "539572288"
},
{
"input": "292920005 241298326 667908343",
"output": "400708891"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 999999999 999999998",
"output": "999999998"
},
{
"input": "999999998 999999998 999999999",
"output": "999999998"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "0 1000000000 0",
"output": "333333333"
},
{
"input": "0 1 0",
"output": "0"
},
{
"input": "1 0 0",
"output": "0"
},
{
"input": "0 2 2",
"output": "0"
},
{
"input": "3 3 5",
"output": "3"
},
{
"input": "2 2 0",
"output": "0"
},
{
"input": "0 5 5",
"output": "2"
},
{
"input": "2 0 11",
"output": "3"
},
{
"input": "9 9 7",
"output": "8"
},
{
"input": "65 30 74",
"output": "56"
}
] | 1,372,488,972
| 672
|
Python 3
|
OK
|
TESTS
| 40
| 78
| 102,400
|
def f(x): return x // 3
r, g, b = map(int, input().split())
m = min(r, g, b)
ans = 0
for i in range(max(0, m - 30), m + 1):
ans = max(ans, i + f(r - i) + f(g - i) + f(b - i))
print(ans)
|
Title: Ciel and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=β€<=*r*,<=*g*,<=*b*<=β€<=109) β the number of red, green and blue flowers.
Output Specification:
Print the maximal number of bouquets Fox Ciel can make.
Demo Input:
['3 6 9\n', '4 4 4\n', '0 0 0\n']
Demo Output:
['6\n', '4\n', '0\n']
Note:
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
|
```python
def f(x): return x // 3
r, g, b = map(int, input().split())
m = min(r, g, b)
ans = 0
for i in range(max(0, m - 30), m + 1):
ans = max(ans, i + f(r - i) + f(g - i) + f(b - i))
print(ans)
```
| 3
|
|
804
|
B
|
Minimum number of steps
|
PROGRAMMING
| 1,400
|
[
"combinatorics",
"greedy",
"implementation",
"math"
] | null | null |
We have a string of letters 'a' and 'b'. We want to perform some operations on it. On each step we choose one of substrings "ab" in the string and replace it with the string "bba". If we have no "ab" as a substring, our job is done. Print the minimum number of steps we should perform to make our job done modulo 109<=+<=7.
The string "ab" appears as a substring if there is a letter 'b' right after the letter 'a' somewhere in the string.
|
The first line contains the initial string consisting of letters 'a' and 'b' only with length from 1 to 106.
|
Print the minimum number of steps modulo 109<=+<=7.
|
[
"ab\n",
"aab\n"
] |
[
"1\n",
"3\n"
] |
The first example: "ab" βββ "bba".
The second example: "aab" βββ "abba" βββ "bbaba" βββ "bbbbaa".
| 1,000
|
[
{
"input": "ab",
"output": "1"
},
{
"input": "aab",
"output": "3"
},
{
"input": "aaaaabaabababaaaaaba",
"output": "17307"
},
{
"input": "abaabaaabbabaabab",
"output": "1795"
},
{
"input": "abbaa",
"output": "2"
},
{
"input": "abbaaabaabaaaaabbbbaababaaaaabaabbaaaaabbaabbaaaabbbabbbabb",
"output": "690283580"
},
{
"input": "aababbaaaabbaabbbbbbbbabbababbbaaabbaaabbabbba",
"output": "2183418"
},
{
"input": "aabbaababbabbbaabbaababaaaabbaaaabaaaaaababbaaaabaababbabbbb",
"output": "436420225"
},
{
"input": "aaabaaaabbababbaabbababbbbaaaaaaabbabbba",
"output": "8431094"
},
{
"input": "abbbbababbabbbbbabaabbbaabbbbbbbaaab",
"output": "8180"
},
{
"input": "bbababbbaabaaaaaaaabbabbbb",
"output": "40979"
},
{
"input": "abbbaaabbbbbabaabbaaabbbababbbaabaabababababa",
"output": "2065758"
},
{
"input": "abaaaaaabaaaabbabbaaabbbbabababaaaaabbaabbaaaaabbbaababaaaaaaabbbbbaaaaabaababbabababbabbbbaabbaabbabbbabaabbaabbaaaaaab",
"output": "235606597"
},
{
"input": "abbbbbbbbbbbbbbbbbbbbbbbbbbaababaaaaaaabaabaaababaabaababaaabababaababab",
"output": "7"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbaaaaaaaaabaabaaababaabaababaaabababaabbbbbbb",
"output": "557763786"
}
] | 1,609,661,478
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 218
| 6,348,800
|
import math as m
t=1
#t=int(input())
mod=10**9+7
while t:
t-=1
s=input()
ans,cost=0,0
for i in range(len(s)):
if s[i]=='a':
cost=(cost*2+1)%mod
else :
ans+=cost
print(ans%mod)
|
Title: Minimum number of steps
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We have a string of letters 'a' and 'b'. We want to perform some operations on it. On each step we choose one of substrings "ab" in the string and replace it with the string "bba". If we have no "ab" as a substring, our job is done. Print the minimum number of steps we should perform to make our job done modulo 109<=+<=7.
The string "ab" appears as a substring if there is a letter 'b' right after the letter 'a' somewhere in the string.
Input Specification:
The first line contains the initial string consisting of letters 'a' and 'b' only with length from 1 to 106.
Output Specification:
Print the minimum number of steps modulo 109<=+<=7.
Demo Input:
['ab\n', 'aab\n']
Demo Output:
['1\n', '3\n']
Note:
The first example: "ab" βββ "bba".
The second example: "aab" βββ "abba" βββ "bbaba" βββ "bbbbaa".
|
```python
import math as m
t=1
#t=int(input())
mod=10**9+7
while t:
t-=1
s=input()
ans,cost=0,0
for i in range(len(s)):
if s[i]=='a':
cost=(cost*2+1)%mod
else :
ans+=cost
print(ans%mod)
```
| 3
|
|
776
|
A
|
A Serial Killer
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern.
|
First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=β€<=*n*<=β€<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters.
|
Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order.
|
[
"ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n",
"icm codeforces\n1\ncodeforces technex\n"
] |
[
"ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n",
"icm codeforces\nicm technex\n"
] |
In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears.
| 500
|
[
{
"input": "ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler",
"output": "ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler"
},
{
"input": "icm codeforces\n1\ncodeforces technex",
"output": "icm codeforces\nicm technex"
},
{
"input": "a b\n3\na c\nb d\nd e",
"output": "a b\nc b\nc d\nc e"
},
{
"input": "ze udggmyop\n4\nze szhrbmft\nudggmyop mjorab\nszhrbmft ojdtfnzxj\nojdtfnzxj yjlkg",
"output": "ze udggmyop\nszhrbmft udggmyop\nszhrbmft mjorab\nojdtfnzxj mjorab\nyjlkg mjorab"
},
{
"input": "q s\n10\nq b\nb j\ns g\nj f\nf m\ng c\nc a\nm d\nd z\nz o",
"output": "q s\nb s\nj s\nj g\nf g\nm g\nm c\nm a\nd a\nz a\no a"
},
{
"input": "iii iiiiii\n7\niii iiiiiiiiii\niiiiiiiiii iiii\niiii i\niiiiii iiiiiiii\niiiiiiii iiiiiiiii\ni iiiii\niiiii ii",
"output": "iii iiiiii\niiiiiiiiii iiiiii\niiii iiiiii\ni iiiiii\ni iiiiiiii\ni iiiiiiiii\niiiii iiiiiiiii\nii iiiiiiiii"
},
{
"input": "bwyplnjn zkms\n26\nzkms nzmcsytxh\nnzmcsytxh yujsb\nbwyplnjn gtbzhudpb\ngtbzhudpb hpk\nyujsb xvy\nhpk wrwnfokml\nwrwnfokml ndouuikw\nndouuikw ucgrja\nucgrja tgfmpldz\nxvy nycrfphn\nnycrfphn quvs\nquvs htdy\nhtdy k\ntgfmpldz xtdpkxm\nxtdpkxm suwqxs\nk fv\nsuwqxs qckllwy\nqckllwy diun\nfv lefa\nlefa gdoqjysx\ndiun dhpz\ngdoqjysx bdmqdyt\ndhpz dgz\ndgz v\nbdmqdyt aswy\naswy ydkayhlrnm",
"output": "bwyplnjn zkms\nbwyplnjn nzmcsytxh\nbwyplnjn yujsb\ngtbzhudpb yujsb\nhpk yujsb\nhpk xvy\nwrwnfokml xvy\nndouuikw xvy\nucgrja xvy\ntgfmpldz xvy\ntgfmpldz nycrfphn\ntgfmpldz quvs\ntgfmpldz htdy\ntgfmpldz k\nxtdpkxm k\nsuwqxs k\nsuwqxs fv\nqckllwy fv\ndiun fv\ndiun lefa\ndiun gdoqjysx\ndhpz gdoqjysx\ndhpz bdmqdyt\ndgz bdmqdyt\nv bdmqdyt\nv aswy\nv ydkayhlrnm"
},
{
"input": "wxz hbeqwqp\n7\nhbeqwqp cpieghnszh\ncpieghnszh tlqrpd\ntlqrpd ttwrtio\nttwrtio xapvds\nxapvds zk\nwxz yryk\nzk b",
"output": "wxz hbeqwqp\nwxz cpieghnszh\nwxz tlqrpd\nwxz ttwrtio\nwxz xapvds\nwxz zk\nyryk zk\nyryk b"
},
{
"input": "wced gnsgv\n23\ngnsgv japawpaf\njapawpaf nnvpeu\nnnvpeu a\na ddupputljq\nddupputljq qyhnvbh\nqyhnvbh pqwijl\nwced khuvs\nkhuvs bjkh\npqwijl ysacmboc\nbjkh srf\nsrf jknoz\njknoz hodf\nysacmboc xqtkoyh\nhodf rfp\nxqtkoyh bivgnwqvoe\nbivgnwqvoe nknf\nnknf wuig\nrfp e\ne bqqknq\nwuig sznhhhu\nbqqknq dhrtdld\ndhrtdld n\nsznhhhu bguylf",
"output": "wced gnsgv\nwced japawpaf\nwced nnvpeu\nwced a\nwced ddupputljq\nwced qyhnvbh\nwced pqwijl\nkhuvs pqwijl\nbjkh pqwijl\nbjkh ysacmboc\nsrf ysacmboc\njknoz ysacmboc\nhodf ysacmboc\nhodf xqtkoyh\nrfp xqtkoyh\nrfp bivgnwqvoe\nrfp nknf\nrfp wuig\ne wuig\nbqqknq wuig\nbqqknq sznhhhu\ndhrtdld sznhhhu\nn sznhhhu\nn bguylf"
},
{
"input": "qqqqqqqqqq qqqqqqqq\n3\nqqqqqqqq qqqqqqqqq\nqqqqqqqqq qqqqq\nqqqqq q",
"output": "qqqqqqqqqq qqqqqqqq\nqqqqqqqqqq qqqqqqqqq\nqqqqqqqqqq qqqqq\nqqqqqqqqqq q"
},
{
"input": "wwwww w\n8\nwwwww wwwwwwww\nwwwwwwww wwwwwwwww\nwwwwwwwww wwwwwwwwww\nw www\nwwwwwwwwww wwww\nwwww ww\nwww wwwwww\nwwwwww wwwwwww",
"output": "wwwww w\nwwwwwwww w\nwwwwwwwww w\nwwwwwwwwww w\nwwwwwwwwww www\nwwww www\nww www\nww wwwwww\nww wwwwwww"
},
{
"input": "k d\n17\nk l\nd v\nv z\nl r\nz i\nr s\ns p\np w\nw j\nj h\ni c\nh m\nm q\nc o\no g\nq x\nx n",
"output": "k d\nl d\nl v\nl z\nr z\nr i\ns i\np i\nw i\nj i\nh i\nh c\nm c\nq c\nq o\nq g\nx g\nn g"
}
] | 1,576,631,314
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 57
| 124
| 204,800
|
s = ' '+input()+' '
n = int(input())
print(s[1:-1])
for i in range(n):
l,r = input().split()
s = s.replace(' '+l+' ',' '+r+' ')
print(s[1:-1])
|
Title: A Serial Killer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern.
Input Specification:
First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=β€<=*n*<=β€<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters.
Output Specification:
Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order.
Demo Input:
['ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n', 'icm codeforces\n1\ncodeforces technex\n']
Demo Output:
['ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n', 'icm codeforces\nicm technex\n']
Note:
In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears.
|
```python
s = ' '+input()+' '
n = int(input())
print(s[1:-1])
for i in range(n):
l,r = input().split()
s = s.replace(' '+l+' ',' '+r+' ')
print(s[1:-1])
```
| 3
|
|
854
|
A
|
Fraction
|
PROGRAMMING
| 800
|
[
"brute force",
"constructive algorithms",
"math"
] | null | null |
Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (Γ·) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.
|
In the only line of input there is an integer *n* (3<=β€<=*n*<=β€<=1000), the sum of numerator and denominator of the fraction.
|
Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.
|
[
"3\n",
"4\n",
"12\n"
] |
[
"1 2\n",
"1 3\n",
"5 7\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "1 2"
},
{
"input": "4",
"output": "1 3"
},
{
"input": "12",
"output": "5 7"
},
{
"input": "34",
"output": "15 19"
},
{
"input": "13",
"output": "6 7"
},
{
"input": "11",
"output": "5 6"
},
{
"input": "24",
"output": "11 13"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "10",
"output": "3 7"
},
{
"input": "69",
"output": "34 35"
},
{
"input": "100",
"output": "49 51"
},
{
"input": "57",
"output": "28 29"
},
{
"input": "1000",
"output": "499 501"
},
{
"input": "999",
"output": "499 500"
},
{
"input": "998",
"output": "497 501"
},
{
"input": "997",
"output": "498 499"
},
{
"input": "996",
"output": "497 499"
},
{
"input": "995",
"output": "497 498"
},
{
"input": "994",
"output": "495 499"
},
{
"input": "5",
"output": "2 3"
},
{
"input": "6",
"output": "1 5"
},
{
"input": "8",
"output": "3 5"
},
{
"input": "9",
"output": "4 5"
},
{
"input": "423",
"output": "211 212"
},
{
"input": "876",
"output": "437 439"
},
{
"input": "29",
"output": "14 15"
}
] | 1,650,187,539
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 61
| 512,000
|
from math import gcd
n=int(input())
#print(gcd(1,0))
a=0
u=[]
for i in range(1,n+1):
if gcd(a+i,n-i)==1:
u.append([a+i,n-i])
print(*u[(len(u)//2)-1])
|
Title: Fraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (Γ·) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.
Input Specification:
In the only line of input there is an integer *n* (3<=β€<=*n*<=β€<=1000), the sum of numerator and denominator of the fraction.
Output Specification:
Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.
Demo Input:
['3\n', '4\n', '12\n']
Demo Output:
['1 2\n', '1 3\n', '5 7\n']
Note:
none
|
```python
from math import gcd
n=int(input())
#print(gcd(1,0))
a=0
u=[]
for i in range(1,n+1):
if gcd(a+i,n-i)==1:
u.append([a+i,n-i])
print(*u[(len(u)//2)-1])
```
| 3
|
|
32
|
B
|
Borze
|
PROGRAMMING
| 800
|
[
"expression parsing",
"implementation"
] |
B. Borze
|
2
|
256
|
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as Β«.Β», 1 as Β«-.Β» and 2 as Β«--Β». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
|
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
|
Output the decoded ternary number. It can have leading zeroes.
|
[
".-.--\n",
"--.\n",
"-..-.--\n"
] |
[
"012",
"20",
"1012"
] |
none
| 1,000
|
[
{
"input": ".-.--",
"output": "012"
},
{
"input": "--.",
"output": "20"
},
{
"input": "-..-.--",
"output": "1012"
},
{
"input": "---..",
"output": "210"
},
{
"input": "..--.---..",
"output": "0020210"
},
{
"input": "-.....----.",
"output": "10000220"
},
{
"input": ".",
"output": "0"
},
{
"input": "-.",
"output": "1"
},
{
"input": "--",
"output": "2"
},
{
"input": "..",
"output": "00"
},
{
"input": "--.",
"output": "20"
},
{
"input": ".--.",
"output": "020"
},
{
"input": ".-.-..",
"output": "0110"
},
{
"input": "----.-.",
"output": "2201"
},
{
"input": "-..--.-.",
"output": "10201"
},
{
"input": "..--..--.",
"output": "0020020"
},
{
"input": "-.-.---.--..-..-.-.-..-..-.--.",
"output": "112120010111010120"
},
{
"input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.",
"output": "21112220010101011012011011221011"
},
{
"input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------",
"output": "11020111110111222212021020002022111100201121222020012022110010222"
},
{
"input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..",
"output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110"
},
{
"input": ".-..-.-.---.-----.--.---...-.--.-.-....-..",
"output": "01011212212021001201100010"
},
{
"input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..",
"output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210"
},
{
"input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.",
"output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220"
},
{
"input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----",
"output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122"
},
{
"input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..",
"output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110"
},
{
"input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.",
"output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020"
},
{
"input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..",
"output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200"
},
{
"input": "-.---...----...--.--...-.--.----",
"output": "121002200020200012022"
},
{
"input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.",
"output": "202020212012111010201021100001021221200011222112012201012220"
}
] | 1,578,716,707
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 248
| 0
|
p=0
c=''
s=input()
for i in range(len(s)):
if p==0:
if s[i]=='.':
c+='0'
elif s[i+1]=='.':
c+='1'
p=1
else:
c+='2'
p=1
else:
p=0
print(c)
|
Title: Borze
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as Β«.Β», 1 as Β«-.Β» and 2 as Β«--Β». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
Input Specification:
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output Specification:
Output the decoded ternary number. It can have leading zeroes.
Demo Input:
['.-.--\n', '--.\n', '-..-.--\n']
Demo Output:
['012', '20', '1012']
Note:
none
|
```python
p=0
c=''
s=input()
for i in range(len(s)):
if p==0:
if s[i]=='.':
c+='0'
elif s[i+1]=='.':
c+='1'
p=1
else:
c+='2'
p=1
else:
p=0
print(c)
```
| 3.938
|
808
|
D
|
Array Division
|
PROGRAMMING
| 1,900
|
[
"binary search",
"data structures",
"implementation"
] | null | null |
Vasya has an array *a* consisting of positive integer numbers. Vasya wants to divide this array into two non-empty consecutive parts (the prefix and the suffix) so that the sum of all elements in the first part equals to the sum of elements in the second part. It is not always possible, so Vasya will move some element before dividing the array (Vasya will erase some element and insert it into an arbitrary position).
Inserting an element in the same position he was erased from is also considered moving.
Can Vasya divide the array after choosing the right element to move and its new position?
|
The first line contains single integer *n* (1<=β€<=*n*<=β€<=100000) β the size of the array.
The second line contains *n* integers *a*1,<=*a*2... *a**n* (1<=β€<=*a**i*<=β€<=109) β the elements of the array.
|
Print YES if Vasya can divide the array after moving one element. Otherwise print NO.
|
[
"3\n1 3 2\n",
"5\n1 2 3 4 5\n",
"5\n2 2 3 4 5\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first example Vasya can move the second element to the end of the array.
In the second example no move can make the division possible.
In the third example Vasya can move the fourth element by one position to the left.
| 0
|
[
{
"input": "3\n1 3 2",
"output": "YES"
},
{
"input": "5\n1 2 3 4 5",
"output": "NO"
},
{
"input": "5\n2 2 3 4 5",
"output": "YES"
},
{
"input": "5\n72 32 17 46 82",
"output": "NO"
},
{
"input": "6\n26 10 70 11 69 57",
"output": "NO"
},
{
"input": "7\n4 7 10 7 5 5 1",
"output": "NO"
},
{
"input": "8\n9 5 5 10 4 9 5 8",
"output": "NO"
},
{
"input": "10\n9 6 8 5 5 2 8 9 2 2",
"output": "YES"
},
{
"input": "15\n4 8 10 3 1 4 5 9 3 2 1 7 7 3 8",
"output": "NO"
},
{
"input": "20\n71 83 54 6 10 64 91 98 94 49 65 68 14 39 91 60 74 100 17 13",
"output": "NO"
},
{
"input": "20\n2 8 10 4 6 6 4 1 2 2 6 9 5 1 9 1 9 8 10 6",
"output": "NO"
},
{
"input": "100\n9 9 72 55 14 8 55 58 35 67 3 18 73 92 41 49 15 60 18 66 9 26 97 47 43 88 71 97 19 34 48 96 79 53 8 24 69 49 12 23 77 12 21 88 66 9 29 13 61 69 54 77 41 13 4 68 37 74 7 6 29 76 55 72 89 4 78 27 29 82 18 83 12 4 32 69 89 85 66 13 92 54 38 5 26 56 17 55 29 4 17 39 29 94 3 67 85 98 21 14",
"output": "YES"
},
{
"input": "100\n89 38 63 73 77 4 99 74 30 5 69 57 97 37 88 71 36 59 19 63 46 20 33 58 61 98 100 31 33 53 99 96 34 17 44 95 54 52 22 77 67 88 20 88 26 43 12 23 96 94 14 7 57 86 56 54 32 8 3 43 97 56 74 22 5 100 12 60 93 12 44 68 31 63 7 71 21 29 19 38 50 47 97 43 50 59 88 40 51 61 20 68 32 66 70 48 19 55 91 53",
"output": "NO"
},
{
"input": "100\n80 100 88 52 25 87 85 8 92 62 35 66 74 39 58 41 55 53 23 73 90 72 36 44 97 67 16 54 3 8 25 34 84 47 77 39 93 19 49 20 29 44 21 48 21 56 82 59 8 31 94 95 84 54 72 20 95 91 85 1 67 19 76 28 31 63 87 98 55 28 16 20 36 91 93 39 94 69 80 97 100 96 68 26 91 45 22 84 20 36 20 92 53 75 58 51 60 26 76 25",
"output": "NO"
},
{
"input": "100\n27 95 57 29 91 85 83 36 72 86 39 5 79 61 78 93 100 97 73 23 82 66 41 92 38 92 100 96 48 56 66 47 5 32 69 13 95 23 46 62 99 83 57 66 98 82 81 57 37 37 81 64 45 76 72 43 99 76 86 22 37 39 93 80 99 36 53 83 3 32 52 9 78 34 47 100 33 72 19 40 29 56 77 32 79 72 15 88 100 98 56 50 22 81 88 92 58 70 21 19",
"output": "NO"
},
{
"input": "100\n35 31 83 11 7 94 57 58 30 26 2 99 33 58 98 6 3 52 13 66 21 53 26 94 100 5 1 3 91 13 97 49 86 25 63 90 88 98 57 57 34 81 32 16 65 94 59 83 44 14 46 18 28 89 75 95 87 57 52 18 46 80 31 43 38 54 69 75 82 9 64 96 75 40 96 52 67 85 86 38 95 55 16 57 17 20 22 7 63 3 12 16 42 87 46 12 51 95 67 80",
"output": "NO"
},
{
"input": "6\n1 4 3 100 100 6",
"output": "YES"
},
{
"input": "6\n6 100 100 3 4 1",
"output": "YES"
},
{
"input": "6\n4 2 3 7 1 1",
"output": "YES"
},
{
"input": "4\n6 1 4 5",
"output": "NO"
},
{
"input": "3\n228 114 114",
"output": "YES"
},
{
"input": "3\n229 232 444",
"output": "NO"
},
{
"input": "3\n322 324 555",
"output": "NO"
},
{
"input": "3\n69 34 5",
"output": "NO"
},
{
"input": "6\n5 4 1 2 2 2",
"output": "YES"
},
{
"input": "3\n545 237 546",
"output": "NO"
},
{
"input": "5\n2 3 1 1 1",
"output": "YES"
},
{
"input": "6\n2 2 10 2 2 2",
"output": "YES"
},
{
"input": "5\n5 4 6 5 6",
"output": "NO"
},
{
"input": "5\n6 1 1 1 1",
"output": "NO"
},
{
"input": "2\n1 3",
"output": "NO"
},
{
"input": "5\n5 2 2 3 4",
"output": "YES"
},
{
"input": "2\n2 2",
"output": "YES"
},
{
"input": "5\n1 2 6 1 2",
"output": "YES"
},
{
"input": "5\n1 1 8 5 1",
"output": "YES"
},
{
"input": "10\n73 67 16 51 56 71 37 49 90 6",
"output": "NO"
},
{
"input": "1\n10",
"output": "NO"
},
{
"input": "1\n1",
"output": "NO"
},
{
"input": "2\n1 1",
"output": "YES"
},
{
"input": "5\n8 2 7 5 4",
"output": "YES"
},
{
"input": "1\n2",
"output": "NO"
},
{
"input": "16\n9 10 2 1 6 7 6 5 8 3 2 10 8 4 9 2",
"output": "YES"
},
{
"input": "4\n8 2 2 4",
"output": "YES"
},
{
"input": "19\n9 9 3 2 4 5 5 7 8 10 8 10 1 2 2 6 5 3 3",
"output": "NO"
},
{
"input": "11\n7 2 1 8 8 2 4 10 8 7 1",
"output": "YES"
},
{
"input": "6\n10 20 30 40 99 1",
"output": "YES"
},
{
"input": "10\n3 7 9 2 10 1 9 6 4 1",
"output": "NO"
},
{
"input": "3\n3 1 2",
"output": "YES"
},
{
"input": "2\n9 3",
"output": "NO"
},
{
"input": "7\n1 2 3 12 1 2 3",
"output": "YES"
},
{
"input": "6\n2 4 4 5 8 5",
"output": "YES"
},
{
"input": "18\n2 10 3 6 6 6 10 8 8 1 10 9 9 3 1 9 7 4",
"output": "YES"
},
{
"input": "20\n9 6 6 10 4 4 8 7 4 10 10 2 10 5 9 5 3 10 1 9",
"output": "NO"
},
{
"input": "12\n3 8 10 2 4 4 6 9 5 10 10 3",
"output": "YES"
},
{
"input": "11\n9 2 7 7 7 3 7 5 4 10 7",
"output": "NO"
},
{
"input": "5\n1 1 4 1 1",
"output": "YES"
},
{
"input": "2\n4 4",
"output": "YES"
},
{
"input": "2\n7 1",
"output": "NO"
},
{
"input": "5\n10 5 6 7 6",
"output": "YES"
},
{
"input": "11\n4 3 10 3 7 8 4 9 2 1 1",
"output": "YES"
},
{
"input": "6\n705032704 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "NO"
},
{
"input": "8\n1 5 6 8 3 1 7 3",
"output": "YES"
},
{
"input": "20\n8 6 3 6 3 5 10 2 6 1 7 6 9 10 8 3 5 9 3 8",
"output": "YES"
},
{
"input": "11\n2 4 8 3 4 7 9 10 5 3 3",
"output": "YES"
},
{
"input": "7\n6 4 2 24 6 4 2",
"output": "YES"
},
{
"input": "17\n7 1 1 1 8 9 1 10 8 8 7 9 7 9 1 6 5",
"output": "NO"
},
{
"input": "7\n7 10 1 2 6 2 2",
"output": "NO"
},
{
"input": "5\n10 10 40 10 10",
"output": "YES"
},
{
"input": "3\n4 3 13",
"output": "NO"
},
{
"input": "5\n5 2 10 2 1",
"output": "YES"
},
{
"input": "7\n7 4 5 62 20 20 6",
"output": "YES"
},
{
"input": "6\n1 5 2 20 10 2",
"output": "YES"
},
{
"input": "2\n5 6",
"output": "NO"
},
{
"input": "14\n5 2 9 7 5 8 3 2 2 4 9 1 3 10",
"output": "YES"
},
{
"input": "5\n1 2 3 4 2",
"output": "YES"
},
{
"input": "5\n2 2 2 5 5",
"output": "NO"
},
{
"input": "11\n1 1 1 1 1 10 1 1 1 1 1",
"output": "YES"
},
{
"input": "9\n8 4 13 19 11 1 8 2 8",
"output": "YES"
},
{
"input": "6\n14 16 14 14 15 11",
"output": "YES"
},
{
"input": "9\n14 19 1 13 11 3 1 1 7",
"output": "YES"
},
{
"input": "6\n16 13 3 7 4 15",
"output": "YES"
},
{
"input": "4\n11 7 12 14",
"output": "NO"
},
{
"input": "3\n3 2 1",
"output": "YES"
},
{
"input": "5\n2 1 3 6 4",
"output": "YES"
},
{
"input": "5\n3 4 8 11 2",
"output": "YES"
},
{
"input": "5\n1 2 10 3 4",
"output": "YES"
},
{
"input": "6\n8 15 12 14 15 4",
"output": "YES"
},
{
"input": "5\n1 2 4 4 5",
"output": "YES"
},
{
"input": "3\n2 4 2",
"output": "YES"
},
{
"input": "5\n2 3 1 6 4",
"output": "YES"
},
{
"input": "7\n1 2 3 12 3 2 1",
"output": "YES"
},
{
"input": "3\n3 4 13",
"output": "NO"
},
{
"input": "6\n1 1 1 1 1000000000 1000000000",
"output": "YES"
},
{
"input": "6\n19 6 5 13 6 13",
"output": "YES"
},
{
"input": "8\n2 2 2 5 1 2 3 3",
"output": "YES"
}
] | 1,659,599,404
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 115
| 108
| 18,022,400
|
n = int(input())
arr = list(map(int, input().split()))
def solve(n, a):
s = sum(a)
if n == 1 or s & 1:
print('NO')
return
half = s // 2
def judge(a):
pre, st = 0, {0}
for num in a:
st.add(num)
pre += num
if pre - half in st: return True
return False
print('YES' if judge(a) or judge(a[::-1]) else 'NO')
solve(n, arr)
|
Title: Array Division
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has an array *a* consisting of positive integer numbers. Vasya wants to divide this array into two non-empty consecutive parts (the prefix and the suffix) so that the sum of all elements in the first part equals to the sum of elements in the second part. It is not always possible, so Vasya will move some element before dividing the array (Vasya will erase some element and insert it into an arbitrary position).
Inserting an element in the same position he was erased from is also considered moving.
Can Vasya divide the array after choosing the right element to move and its new position?
Input Specification:
The first line contains single integer *n* (1<=β€<=*n*<=β€<=100000) β the size of the array.
The second line contains *n* integers *a*1,<=*a*2... *a**n* (1<=β€<=*a**i*<=β€<=109) β the elements of the array.
Output Specification:
Print YES if Vasya can divide the array after moving one element. Otherwise print NO.
Demo Input:
['3\n1 3 2\n', '5\n1 2 3 4 5\n', '5\n2 2 3 4 5\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first example Vasya can move the second element to the end of the array.
In the second example no move can make the division possible.
In the third example Vasya can move the fourth element by one position to the left.
|
```python
n = int(input())
arr = list(map(int, input().split()))
def solve(n, a):
s = sum(a)
if n == 1 or s & 1:
print('NO')
return
half = s // 2
def judge(a):
pre, st = 0, {0}
for num in a:
st.add(num)
pre += num
if pre - half in st: return True
return False
print('YES' if judge(a) or judge(a[::-1]) else 'NO')
solve(n, arr)
```
| 3
|
|
750
|
A
|
New Year and Hurry
|
PROGRAMMING
| 800
|
[
"binary search",
"brute force",
"implementation",
"math"
] | null | null |
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
|
The only line of the input contains two integers *n* and *k* (1<=β€<=*n*<=β€<=10, 1<=β€<=*k*<=β€<=240)Β β the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
|
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
|
[
"3 222\n",
"4 190\n",
"7 1\n"
] |
[
"2\n",
"4\n",
"7\n"
] |
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5β+β10β=β15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5β+β10β+β15β+β20β=β50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
| 500
|
[
{
"input": "3 222",
"output": "2"
},
{
"input": "4 190",
"output": "4"
},
{
"input": "7 1",
"output": "7"
},
{
"input": "10 135",
"output": "6"
},
{
"input": "10 136",
"output": "5"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "9 240",
"output": "0"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "9 235",
"output": "1"
},
{
"input": "9 236",
"output": "0"
},
{
"input": "5 225",
"output": "2"
},
{
"input": "5 226",
"output": "1"
},
{
"input": "4 210",
"output": "3"
},
{
"input": "4 211",
"output": "2"
},
{
"input": "4 191",
"output": "3"
},
{
"input": "10 165",
"output": "5"
},
{
"input": "10 166",
"output": "4"
},
{
"input": "8 100",
"output": "7"
},
{
"input": "8 101",
"output": "6"
},
{
"input": "8 60",
"output": "8"
},
{
"input": "8 61",
"output": "7"
},
{
"input": "10 15",
"output": "9"
},
{
"input": "10 16",
"output": "8"
},
{
"input": "4 100",
"output": "4"
},
{
"input": "4 101",
"output": "4"
},
{
"input": "7 167",
"output": "4"
},
{
"input": "10 164",
"output": "5"
},
{
"input": "9 170",
"output": "4"
},
{
"input": "8 160",
"output": "5"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "8 123",
"output": "6"
},
{
"input": "2 99",
"output": "2"
},
{
"input": "10 88",
"output": "7"
},
{
"input": "1 235",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 240",
"output": "0"
},
{
"input": "1 55",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "3 240",
"output": "0"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "2 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "2 236",
"output": "0"
},
{
"input": "10 2",
"output": "9"
},
{
"input": "3 239",
"output": "0"
},
{
"input": "1 237",
"output": "0"
},
{
"input": "7 8",
"output": "7"
},
{
"input": "10 235",
"output": "1"
}
] | 1,678,031,962
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 52
| 62
| 0
|
inp = input().split()
lis = [eval(i) for i in inp]
k = lis[1]
n = 5
a,b=0,lis[0]
for i in range(lis[0]):
if(k<240 and k+((i+1)*5)<=240):
k+=n
n+=5
else:break
a=i+1
print(int(a))
|
Title: New Year and Hurry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
Input Specification:
The only line of the input contains two integers *n* and *k* (1<=β€<=*n*<=β€<=10, 1<=β€<=*k*<=β€<=240)Β β the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Output Specification:
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
Demo Input:
['3 222\n', '4 190\n', '7 1\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5β+β10β=β15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5β+β10β+β15β+β20β=β50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
|
```python
inp = input().split()
lis = [eval(i) for i in inp]
k = lis[1]
n = 5
a,b=0,lis[0]
for i in range(lis[0]):
if(k<240 and k+((i+1)*5)<=240):
k+=n
n+=5
else:break
a=i+1
print(int(a))
```
| 3
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko β W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W β the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format Β«A/BΒ», where A β the numerator, and B β the denominator. If the required probability equals to zero, output Β«0/1Β». If the required probability equals to 1, output Β«1/1Β».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,666,546,201
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 36
| 124
| 0
|
y,w=map(int,input().split())
probability=["", "1/1", "5/6", "2/3", "1/2", "1/3", "1/6"]
print(probability[max(y,w)])
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko β W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W β the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format Β«A/BΒ», where A β the numerator, and B β the denominator. If the required probability equals to zero, output Β«0/1Β». If the required probability equals to 1, output Β«1/1Β».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
y,w=map(int,input().split())
probability=["", "1/1", "5/6", "2/3", "1/2", "1/3", "1/6"]
print(probability[max(y,w)])
```
| 3.938
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
|
Output one number β the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,670,948,713
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
# n = int(input())
# words = [input() for i in range(n)]
# def shorter(word):
# if len(word) <= 10:
# return word
# else:
# return word[0] + str(len(word)-2) + word[-1]
# for i in words:
# print(shorter(i))
# n = int(input())
# sol = [input().split(" ") for i in range(n)]
# soln = 0
# for item in sol:
# if item.count("1")>=2:
# soln += 1
# print(soln)
# n, k = input().split(" ")
# score = input().split(" ")
# count = 0
# for i in score:
# if int(i) >= int(score[int(k) - 1]) and int(i) != 0:
# count+=1
# print(count)
m, n = list(map(int,input().split(" ")))
print(m*n//2)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
Output Specification:
Output one number β the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
# n = int(input())
# words = [input() for i in range(n)]
# def shorter(word):
# if len(word) <= 10:
# return word
# else:
# return word[0] + str(len(word)-2) + word[-1]
# for i in words:
# print(shorter(i))
# n = int(input())
# sol = [input().split(" ") for i in range(n)]
# soln = 0
# for item in sol:
# if item.count("1")>=2:
# soln += 1
# print(soln)
# n, k = input().split(" ")
# score = input().split(" ")
# count = 0
# for i in score:
# if int(i) >= int(score[int(k) - 1]) and int(i) != 0:
# count+=1
# print(count)
m, n = list(map(int,input().split(" ")))
print(m*n//2)
```
| 3.977
|
439
|
A
|
Devu, the Singer and Churu, the Joker
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sΡhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
|
The first line contains two space separated integers *n*, *d* (1<=β€<=*n*<=β€<=100;Β 1<=β€<=*d*<=β€<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=β€<=*t**i*<=β€<=100).
|
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
|
[
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] |
[
"5\n",
"-1\n"
] |
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5β+β2β+β10β+β2β+β10β+β1β=β30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
| 500
|
[
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,632,117,780
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 62
| 6,758,400
|
n,m=map(int, input().split())
a=sum(list(map(int, input().split())))
if a+(n-1)*10<=m:
print((m-a)//5)
else:
print(-1)
|
Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sΡhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=β€<=*n*<=β€<=100;Β 1<=β€<=*d*<=β€<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=β€<=*t**i*<=β€<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5β+β2β+β10β+β2β+β10β+β1β=β30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
|
```python
n,m=map(int, input().split())
a=sum(list(map(int, input().split())))
if a+(n-1)*10<=m:
print((m-a)//5)
else:
print(-1)
```
| 3
|
|
902
|
A
|
Visiting a Friend
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car.
|
The first line contains two integers *n* and *m* (1<=β€<=*n*<=β€<=100,<=1<=β€<=*m*<=β€<=100)Β β the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=β€<=*a**i*<=β€<=*b**i*<=β€<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=β₯<=*a**i*<=-<=1 for every *i* (2<=β€<=*i*<=β€<=*n*).
|
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
|
[
"3 5\n0 2\n2 4\n3 5\n",
"3 7\n0 4\n2 5\n6 7\n"
] |
[
"YES\n",
"NO\n"
] |
The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports.
| 500
|
[
{
"input": "3 5\n0 2\n2 4\n3 5",
"output": "YES"
},
{
"input": "3 7\n0 4\n2 5\n6 7",
"output": "NO"
},
{
"input": "1 1\n0 0",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 8\n8 8\n9 9\n9 9\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 100\n71 73\n80 94\n81 92\n84 85\n85 100\n88 91\n91 95\n92 98\n92 98\n99 100\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 6\n1 6\n1 2\n1 3\n1 2\n1 3\n2 5\n2 4\n2 3\n2 4\n2 6\n2 2\n2 5\n2 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 9\n3 3\n3 7\n3 9\n3 3\n3 9\n4 6\n4 7\n4 5\n4 7\n5 8\n5 5\n5 9\n5 7\n5 5\n6 6\n6 9\n6 7\n6 8\n6 9\n6 8\n7 7\n7 8\n7 7\n7 8\n8 9\n8 8\n8 9\n8 8\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 10\n8 10\n9 9\n9 9\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 100\n1 38\n2 82\n5 35\n7 71\n8 53\n11 49\n15 27\n17 84\n17 75\n18 99\n18 43\n18 69\n21 89\n27 60\n27 29\n38 62\n38 77\n39 83\n40 66\n48 80\n48 100\n50 51\n50 61\n53 77\n53 63\n55 58\n56 68\n60 82\n62 95\n66 74\n67 83\n69 88\n69 81\n69 88\n69 98\n70 91\n70 76\n71 90\n72 99\n81 99\n85 87\n88 97\n88 93\n90 97\n90 97\n92 98\n98 99\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 10\n1 9\n1 6\n1 2\n1 3\n1 2\n2 6\n2 5\n2 4\n2 3\n2 10\n2 2\n2 6\n2 2\n3 10\n3 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 10\n3 5\n3 3\n3 7\n4 8\n4 8\n4 9\n4 6\n5 7\n5 10\n5 7\n5 8\n5 5\n6 8\n6 9\n6 10\n6 6\n6 9\n6 7\n7 8\n7 9\n7 10\n7 10\n8 8\n8 8\n8 9\n8 10\n9 10\n9 9\n9 10\n9 10\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 4\n1 5\n1 9\n1 1\n1 6\n1 6\n2 5\n2 7\n2 7\n2 7\n2 7\n3 4\n3 7\n3 9\n3 5\n3 3\n4 4\n4 6\n4 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n5 8\n5 9\n5 8\n6 8\n6 7\n6 8\n6 9\n6 9\n6 6\n6 9\n6 7\n7 7\n7 7\n7 7\n7 8\n7 7\n7 8\n7 8\n7 9\n8 8\n8 8\n8 8\n8 8\n8 8\n8 9\n8 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 40\n38 38\n40 40",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 92\n92 97\n96 99\n97 98\n97 99\n99 99\n100 100\n100 100\n100 100",
"output": "NO"
},
{
"input": "1 10\n0 10",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 40\n23 23\n23 28\n24 29\n25 38\n26 35\n27 37\n28 39\n28 33\n28 40\n28 33\n29 31\n29 33\n30 38\n30 36\n30 30\n30 38\n31 37\n31 35\n31 32\n31 36\n33 39\n33 40\n35 38\n36 38\n37 38\n37 40\n38 39\n38 40\n38 39\n39 39\n39 40\n40 40\n40 40\n40 40\n40 40",
"output": "YES"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 40\n11 31\n12 26\n13 25\n14 32\n17 19\n21 29\n22 36\n24 27\n25 39\n25 27\n27 32\n27 29\n27 39\n27 29\n28 38\n30 38\n32 40\n32 38\n33 33\n33 40\n34 35\n34 34\n34 38\n34 38\n35 37\n36 39\n36 39\n37 37\n38 40\n39 39\n40 40",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 22\n23 28\n23 39\n24 24\n25 27\n26 38\n27 39\n28 33\n28 39\n28 34\n28 33\n29 30\n29 35\n30 30\n30 38\n30 34\n30 31\n31 36\n31 31\n31 32\n31 38\n33 34\n33 34\n35 36\n36 38\n37 38\n37 39\n38 38\n38 38\n38 38\n39 39\n39 39\n40 40\n40 40\n40 40\n40 40",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n88 99",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 10\n7 10\n9 10",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 5\n4 8\n5 5\n5 7\n6 7\n6 6\n7 7\n7 7\n7 7\n7 8\n7 8\n8 8\n8 8\n8 9\n8 8\n8 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n32 37",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 10\n4 6\n5 9\n5 5\n6 7\n6 10\n7 8\n7 7\n7 7\n7 7\n7 10\n8 8\n8 8\n8 10\n8 8\n8 8\n9 10\n9 10\n9 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "1 1\n0 1",
"output": "YES"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 36\n38 38\n40 40",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 82\n71 94\n80 90\n81 88\n84 93\n85 89\n88 92\n91 97\n92 99\n92 97\n99 99\n100 100",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n79 100",
"output": "YES"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n37 40",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 10\n1 2\n1 5\n1 10\n1 8\n1 1\n2 8\n2 7\n2 5\n2 5\n2 7\n3 5\n3 7\n3 5\n3 4\n3 7\n4 7\n4 8\n4 6\n5 7\n5 10\n5 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n6 10\n6 9\n6 7\n6 10\n6 8\n6 7\n6 10\n6 10\n7 8\n7 9\n7 8\n7 8\n7 8\n7 8\n7 7\n7 7\n8 8\n8 8\n8 10\n8 9\n8 9\n8 9\n8 9\n9 9\n9 10\n9 9\n9 9\n9 9\n9 9\n9 10\n9 10\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 7\n1 69\n2 83\n5 67\n7 82\n8 31\n11 25\n15 44\n17 75\n17 27\n18 43\n18 69\n18 40\n21 66\n27 29\n27 64\n38 77\n38 90\n39 52\n40 60\n48 91\n48 98\n50 89\n50 63\n53 54\n53 95\n55 76\n56 59\n60 96\n62 86\n66 70\n67 77\n69 88\n69 98\n69 80\n69 95\n70 74\n70 77\n71 99\n72 73\n81 87\n85 99\n88 96\n88 91\n90 97\n90 99\n92 92\n98 99\n100 100",
"output": "NO"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 35\n11 23\n12 36\n13 31\n14 31\n17 17\n21 25\n22 33\n24 26\n25 32\n25 25\n27 39\n27 29\n27 34\n27 32\n28 34\n30 36\n32 37\n32 33\n33 35\n33 33\n34 38\n34 38\n34 36\n34 36\n35 36\n36 36\n36 39\n37 37\n38 39\n39 39\n40 40",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 9\n7 7\n9 9",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 100\n92 97\n96 96\n97 98\n97 100\n99 100\n100 100\n100 100\n100 100",
"output": "YES"
},
{
"input": "2 2\n0 2\n0 1",
"output": "YES"
},
{
"input": "2 100\n0 49\n50 100",
"output": "NO"
},
{
"input": "2 100\n0 50\n50 100",
"output": "YES"
},
{
"input": "10 100\n0 10\n10 20\n20 30\n30 40\n40 50\n50 60\n60 70\n70 80\n80 90\n90 100",
"output": "YES"
},
{
"input": "100 10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 10",
"output": "YES"
},
{
"input": "1 4\n1 4",
"output": "NO"
},
{
"input": "3 5\n0 2\n2 5\n3 4",
"output": "YES"
},
{
"input": "2 5\n0 5\n1 2",
"output": "YES"
},
{
"input": "5 5\n0 2\n0 2\n3 5\n3 5\n3 5",
"output": "NO"
},
{
"input": "4 10\n0 3\n2 10\n4 10\n5 7",
"output": "YES"
},
{
"input": "3 8\n0 0\n1 8\n2 8",
"output": "NO"
},
{
"input": "6 8\n0 3\n1 5\n2 3\n5 6\n6 7\n7 8",
"output": "YES"
}
] | 1,627,676,949
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 55
| 109
| 20,172,800
|
n, finish = map(int, input().split())
end_interval = [0, finish]
points = []
for _ in range(n):
x, y = map(int, input().split())
points.append([x, y])
points.sort()
#print(points)
merge_interval = [points[0][0], points[0][1]]
for i in range(1, n):
if merge_interval[1]>=points[i][0]:
merge_interval[1]=max(merge_interval[1], points[i][1])
#print(merge_interval)
if end_interval[0]>=merge_interval[0] and end_interval[1]<=merge_interval[1]:
print('YES')
else:
print('NO')
|
Title: Visiting a Friend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car.
Input Specification:
The first line contains two integers *n* and *m* (1<=β€<=*n*<=β€<=100,<=1<=β€<=*m*<=β€<=100)Β β the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=β€<=*a**i*<=β€<=*b**i*<=β€<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=β₯<=*a**i*<=-<=1 for every *i* (2<=β€<=*i*<=β€<=*n*).
Output Specification:
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['3 5\n0 2\n2 4\n3 5\n', '3 7\n0 4\n2 5\n6 7\n']
Demo Output:
['YES\n', 'NO\n']
Note:
The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports.
|
```python
n, finish = map(int, input().split())
end_interval = [0, finish]
points = []
for _ in range(n):
x, y = map(int, input().split())
points.append([x, y])
points.sort()
#print(points)
merge_interval = [points[0][0], points[0][1]]
for i in range(1, n):
if merge_interval[1]>=points[i][0]:
merge_interval[1]=max(merge_interval[1], points[i][1])
#print(merge_interval)
if end_interval[0]>=merge_interval[0] and end_interval[1]<=merge_interval[1]:
print('YES')
else:
print('NO')
```
| 3
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=100) β the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,569,500,881
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 280
| 0
|
n=int(input())
a=list(map(int,input().split()))
k = sum(a)
n+=1
c=0
for i in range(1,6):
if (k+i)%n==1:
c+=1
print(5-c)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=100) β the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
n=int(input())
a=list(map(int,input().split()))
k = sum(a)
n+=1
c=0
for i in range(1,6):
if (k+i)%n==1:
c+=1
print(5-c)
```
| 3
|
|
219
|
C
|
Color Stripe
|
PROGRAMMING
| 1,600
|
[
"brute force",
"dp",
"greedy"
] | null | null |
A colored stripe is represented by a horizontal row of *n* square cells, each cell is pained one of *k* colors. Your task is to repaint the minimum number of cells so that no two neighbouring cells are of the same color. You can use any color from 1 to *k* to repaint the cells.
|
The first input line contains two integers *n* and *k* (1<=β€<=*n*<=β€<=5Β·105;Β 2<=β€<=*k*<=β€<=26). The second line contains *n* uppercase English letters. Letter "A" stands for the first color, letter "B" stands for the second color and so on. The first *k* English letters may be used. Each letter represents the color of the corresponding cell of the stripe.
|
Print a single integer β the required minimum number of repaintings. In the second line print any possible variant of the repainted stripe.
|
[
"6 3\nABBACC\n",
"3 2\nBBB\n"
] |
[
"2\nABCACA\n",
"1\nBAB\n"
] |
none
| 1,500
|
[
{
"input": "6 3\nABBACC",
"output": "2\nABCACA"
},
{
"input": "3 2\nBBB",
"output": "1\nBAB"
},
{
"input": "1 2\nA",
"output": "0\nA"
},
{
"input": "1 26\nZ",
"output": "0\nZ"
},
{
"input": "2 2\nAA",
"output": "1\nAB"
},
{
"input": "2 2\nBA",
"output": "0\nBA"
},
{
"input": "6 2\nAAABBB",
"output": "2\nABABAB"
},
{
"input": "8 3\nAABBABBB",
"output": "3\nBACBABCB"
},
{
"input": "10 26\nAAAAAAAAAA",
"output": "5\nBABABABABA"
},
{
"input": "12 3\nAAABBBAAABBB",
"output": "4\nABABCBABABCB"
},
{
"input": "3 2\nAAB",
"output": "1\nBAB"
},
{
"input": "3 3\nBBA",
"output": "1\nABA"
},
{
"input": "3 3\nCCC",
"output": "1\nCAC"
},
{
"input": "8 3\nAABBCCBB",
"output": "4\nBACBACAB"
},
{
"input": "200 2\nBABAABBABBABBABABBBABAAABABBABABBBAABBBBABBAABBABABAAAAABAABBBAAAAAAABBBABAAAABABBBAABABAABAABBBAABBABAAAABABAAAABABABBBABBBAAABAAABAAABABAAABABABBABABABBABBBABBBBBABABBBABAAABAAABAABBAABBABBBBBABBBAB",
"output": "87\nABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABAB"
},
{
"input": "20 2\nBBBBAAAAAABBBAAAAAAB",
"output": "10\nABABABABABABABABABAB"
},
{
"input": "20 3\nCCCCAAAAAAAAAAAAAAAA",
"output": "10\nACACBABABABABABABABA"
},
{
"input": "100 2\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "49\nABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABAB"
},
{
"input": "100 2\nBBBBBBBAAABBAAAABAABBBAABABAAABBBABBAAAABBABAAAAAAAAAAAAABAAABBBAAABAABBBBBBBABBBBAABAAABBBAABBAAAAB",
"output": "48\nBABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABA"
},
{
"input": "100 2\nABAAABABABAAABAAABAAABABABAAABABABAAABABABAAABAAABAAABABABAAABAAABAAABABABAAABAAABAAABABABAAABABABAA",
"output": "17\nABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABAB"
},
{
"input": "100 2\nABABABABABABABABABABABABABABABABABABABABABBBABABABABABABABABABABABABABABABABABABABABABABABABABABABAB",
"output": "1\nABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABAB"
},
{
"input": "2 3\nAA",
"output": "1\nBA"
},
{
"input": "12 2\nBBBBABABABAB",
"output": "2\nABABABABABAB"
},
{
"input": "4 2\nAABA",
"output": "1\nBABA"
},
{
"input": "6 2\nBAABAB",
"output": "2\nABABAB"
},
{
"input": "10 2\nAABABABABA",
"output": "1\nBABABABABA"
},
{
"input": "6 2\nBBABAB",
"output": "1\nABABAB"
},
{
"input": "5 2\nBBABA",
"output": "1\nABABA"
},
{
"input": "45 26\nABCDEFGHIJKLMNOOOOOPPPPPQQQQQQPPQZZZZASDASDGF",
"output": "10\nABCDEFGHIJKLMNOPOPOPQPQPAQAQAQAPQAZAZASDASDGF"
},
{
"input": "3 2\nBBA",
"output": "1\nABA"
},
{
"input": "4 2\nABBA",
"output": "2\nABAB"
},
{
"input": "6 2\nAABABA",
"output": "1\nBABABA"
},
{
"input": "6 2\nBAAAAB",
"output": "3\nABABAB"
},
{
"input": "4 2\nAABB",
"output": "2\nABAB"
},
{
"input": "7 2\nAAAABBB",
"output": "3\nBABABAB"
},
{
"input": "41 2\nAABAAABBBBBBAAAABBBAAAAAABBBBBBBBAAAAAAAA",
"output": "19\nBABABABABABABABABABABABABABABABABABABABAB"
},
{
"input": "8 2\nAABABABA",
"output": "1\nBABABABA"
},
{
"input": "20 2\nABBABABBBABBABAAAABA",
"output": "8\nBABABABABABABABABABA"
},
{
"input": "5 2\nABBAB",
"output": "2\nBABAB"
},
{
"input": "10 2\nBBABABABAB",
"output": "1\nABABABABAB"
},
{
"input": "6 2\nABBABB",
"output": "3\nABABAB"
}
] | 1,626,522,661
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 87
| 810
| 12,697,600
|
n, k = map(int, input().split())
s = list(input())
if k > 2:
c = set(ord("A") + i for i in range(26))
r = 0
for i in range(1,len(s)):
if s[i-1] == s[i]:
r += 1
if i + 1 < n:
s[i] = "A" if "A" not in {s[i-1], s[i+1]} else ('B' if "B" not in {s[i], s[i+1]} else "C")
else:
s[i] = "A" if s[i-1] != "A" else "B"
print(r)
print("".join(s))
else:
x, y = "AB" * n, "BA" * n
def check(x, y):
return sum(x[i] != y[i] for i in range(n))
check_1 = check(x, s)
check_2 = check(y, s)
z = [x,y][check_1 > check_2]
print(min(check_1, check_2))
print(z[:n])
|
Title: Color Stripe
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A colored stripe is represented by a horizontal row of *n* square cells, each cell is pained one of *k* colors. Your task is to repaint the minimum number of cells so that no two neighbouring cells are of the same color. You can use any color from 1 to *k* to repaint the cells.
Input Specification:
The first input line contains two integers *n* and *k* (1<=β€<=*n*<=β€<=5Β·105;Β 2<=β€<=*k*<=β€<=26). The second line contains *n* uppercase English letters. Letter "A" stands for the first color, letter "B" stands for the second color and so on. The first *k* English letters may be used. Each letter represents the color of the corresponding cell of the stripe.
Output Specification:
Print a single integer β the required minimum number of repaintings. In the second line print any possible variant of the repainted stripe.
Demo Input:
['6 3\nABBACC\n', '3 2\nBBB\n']
Demo Output:
['2\nABCACA\n', '1\nBAB\n']
Note:
none
|
```python
n, k = map(int, input().split())
s = list(input())
if k > 2:
c = set(ord("A") + i for i in range(26))
r = 0
for i in range(1,len(s)):
if s[i-1] == s[i]:
r += 1
if i + 1 < n:
s[i] = "A" if "A" not in {s[i-1], s[i+1]} else ('B' if "B" not in {s[i], s[i+1]} else "C")
else:
s[i] = "A" if s[i-1] != "A" else "B"
print(r)
print("".join(s))
else:
x, y = "AB" * n, "BA" * n
def check(x, y):
return sum(x[i] != y[i] for i in range(n))
check_1 = check(x, s)
check_2 = check(y, s)
z = [x,y][check_1 > check_2]
print(min(check_1, check_2))
print(z[:n])
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,592,891,029
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 216
| 6,656,000
|
s=input()
ascii_lower=0
ascii_upper=0
str=''
for ele in s:
if ord(ele) <= 90:
ascii_upper+=1
elif ord(ele) >= 97:
ascii_lower+=1
if ascii_lower>=ascii_upper:
print(s.lower())
else:
print(s.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s=input()
ascii_lower=0
ascii_upper=0
str=''
for ele in s:
if ord(ele) <= 90:
ascii_upper+=1
elif ord(ele) >= 97:
ascii_lower+=1
if ascii_lower>=ascii_upper:
print(s.lower())
else:
print(s.upper())
```
| 3.933602
|
520
|
A
|
Pangram
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
|
The first line contains a single integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
|
Output "YES", if the string is a pangram and "NO" otherwise.
|
[
"12\ntoosmallword\n",
"35\nTheQuickBrownFoxJumpsOverTheLazyDog\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "12\ntoosmallword",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog",
"output": "YES"
},
{
"input": "1\na",
"output": "NO"
},
{
"input": "26\nqwertyuiopasdfghjklzxcvbnm",
"output": "YES"
},
{
"input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "YES"
},
{
"input": "48\nthereisasyetinsufficientdataforameaningfulanswer",
"output": "NO"
},
{
"input": "30\nToBeOrNotToBeThatIsTheQuestion",
"output": "NO"
},
{
"input": "30\njackdawslovemybigsphinxofquarz",
"output": "NO"
},
{
"input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY",
"output": "YES"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx",
"output": "YES"
},
{
"input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ",
"output": "YES"
},
{
"input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ",
"output": "YES"
},
{
"input": "25\nnxYTzLFwzNolAumjgcAboyxAj",
"output": "NO"
},
{
"input": "26\npRWdodGdxUESvcScPGbUoooZsC",
"output": "NO"
},
{
"input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj",
"output": "NO"
},
{
"input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa",
"output": "YES"
},
{
"input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK",
"output": "NO"
},
{
"input": "26\nvCUFRKElZOnjmXGylWQaHDiPst",
"output": "NO"
},
{
"input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY",
"output": "NO"
},
{
"input": "26\npGiFluRteQwkaVoPszJyNBChxM",
"output": "NO"
},
{
"input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY",
"output": "NO"
},
{
"input": "26\nLndjgvAEuICHKxPwqYztosrmBN",
"output": "NO"
},
{
"input": "26\nMdaXJrCipnOZLykfqHWEStevbU",
"output": "NO"
},
{
"input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba",
"output": "NO"
},
{
"input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo",
"output": "NO"
},
{
"input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa",
"output": "NO"
},
{
"input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO",
"output": "NO"
},
{
"input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe",
"output": "NO"
},
{
"input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG",
"output": "NO"
},
{
"input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF",
"output": "NO"
},
{
"input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu",
"output": "NO"
},
{
"input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf",
"output": "NO"
},
{
"input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE",
"output": "NO"
},
{
"input": "26\nDqspXZJTuONYieKgaHLMBwfVSC",
"output": "NO"
},
{
"input": "26\necOyUkqNljFHRVXtIpWabGMLDz",
"output": "NO"
},
{
"input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI",
"output": "NO"
},
{
"input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA",
"output": "NO"
},
{
"input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz",
"output": "NO"
},
{
"input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ",
"output": "NO"
},
{
"input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF",
"output": "NO"
},
{
"input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB",
"output": "NO"
},
{
"input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg",
"output": "NO"
},
{
"input": "26\nmnbvcxxlkjhgfdsapoiuytrewq",
"output": "NO"
},
{
"input": "26\naAbcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl",
"output": "NO"
},
{
"input": "25\nabcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "26\nabcdefhijklmnopqrstVxyzABC",
"output": "NO"
},
{
"input": "25\nqwertyuiopasdfghjklxcvbnm",
"output": "NO"
},
{
"input": "34\nTheQuickBrownFoxJumpsOverTheLayDog",
"output": "NO"
},
{
"input": "26\nabcdefghigklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxyA",
"output": "NO"
},
{
"input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog",
"output": "NO"
},
{
"input": "25\nbcdefghijklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa",
"output": "NO"
},
{
"input": "26\nabcdefghiklmnopqrstvxyzABC",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxzZ",
"output": "NO"
},
{
"input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY",
"output": "NO"
}
] | 1,694,337,559
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 46
| 0
|
n = int(input())
str = input()
s = set(str.lower())
if len(s) == 26: print("YES")
else: print("NO")
|
Title: Pangram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
Input Specification:
The first line contains a single integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output Specification:
Output "YES", if the string is a pangram and "NO" otherwise.
Demo Input:
['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
n = int(input())
str = input()
s = set(str.lower())
if len(s) == 26: print("YES")
else: print("NO")
```
| 3
|
|
151
|
A
|
Soft Drinking
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt.
To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make?
|
The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space.
|
Print a single integer β the number of toasts each friend can make.
|
[
"3 4 5 10 8 100 3 1\n",
"5 100 10 1 19 90 4 3\n",
"10 1000 1000 25 23 1 50 1\n"
] |
[
"2\n",
"3\n",
"0\n"
] |
A comment to the first sample:
Overall the friends have 4β*β5β=β20 milliliters of the drink, it is enough to make 20β/β3β=β6 toasts. The limes are enough for 10β*β8β=β80 toasts and the salt is enough for 100β/β1β=β100 toasts. However, there are 3 friends in the group, so the answer is *min*(6,β80,β100)β/β3β=β2.
| 500
|
[
{
"input": "3 4 5 10 8 100 3 1",
"output": "2"
},
{
"input": "5 100 10 1 19 90 4 3",
"output": "3"
},
{
"input": "10 1000 1000 25 23 1 50 1",
"output": "0"
},
{
"input": "1 7 4 5 5 8 3 2",
"output": "4"
},
{
"input": "2 3 3 5 5 10 1 3",
"output": "1"
},
{
"input": "2 6 4 5 6 5 1 3",
"output": "0"
},
{
"input": "1 7 3 5 3 6 2 1",
"output": "6"
},
{
"input": "2 4 5 4 5 7 3 2",
"output": "1"
},
{
"input": "2 3 6 5 7 8 2 1",
"output": "4"
},
{
"input": "1 4 5 5 3 10 3 1",
"output": "6"
},
{
"input": "1 4 6 7 3 5 1 3",
"output": "1"
},
{
"input": "1 6 5 5 5 8 3 1",
"output": "8"
},
{
"input": "1 7 5 3 3 9 2 1",
"output": "9"
},
{
"input": "3 5 3 7 6 10 3 1",
"output": "1"
},
{
"input": "3 6 3 5 3 6 3 1",
"output": "2"
},
{
"input": "1 7 5 5 5 5 2 2",
"output": "2"
},
{
"input": "2 5 3 5 6 9 2 1",
"output": "3"
},
{
"input": "3 4 3 5 3 6 2 1",
"output": "2"
},
{
"input": "1 5 5 4 7 6 3 1",
"output": "6"
},
{
"input": "2 3 7 6 5 9 3 1",
"output": "3"
},
{
"input": "2 6 5 3 3 8 1 1",
"output": "4"
},
{
"input": "2 4 7 3 4 10 2 1",
"output": "5"
},
{
"input": "1 1000 1000 1000 1000 1000 1 1",
"output": "1000"
},
{
"input": "17 1000 1000 1000 1000 1000 3 7",
"output": "8"
},
{
"input": "115 1000 1000 1000 1000 1000 17 15",
"output": "0"
},
{
"input": "1 587 981 1 2 1 1 1",
"output": "1"
},
{
"input": "1 1 2 1 2 2 1 1",
"output": "2"
}
] | 1,679,554,582
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 27
| 124
| 0
|
n,k,l,c,d,p,nl,np = tuple(map(int,input().split()))
drink = (k*l)//(nl)
slice = c*d
salt = p//np
print(min(drink,slice,salt)//n)
|
Title: Soft Drinking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt.
To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make?
Input Specification:
The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space.
Output Specification:
Print a single integer β the number of toasts each friend can make.
Demo Input:
['3 4 5 10 8 100 3 1\n', '5 100 10 1 19 90 4 3\n', '10 1000 1000 25 23 1 50 1\n']
Demo Output:
['2\n', '3\n', '0\n']
Note:
A comment to the first sample:
Overall the friends have 4β*β5β=β20 milliliters of the drink, it is enough to make 20β/β3β=β6 toasts. The limes are enough for 10β*β8β=β80 toasts and the salt is enough for 100β/β1β=β100 toasts. However, there are 3 friends in the group, so the answer is *min*(6,β80,β100)β/β3β=β2.
|
```python
n,k,l,c,d,p,nl,np = tuple(map(int,input().split()))
drink = (k*l)//(nl)
slice = c*d
salt = p//np
print(min(drink,slice,salt)//n)
```
| 3
|
|
870
|
A
|
Search for Pretty Integers
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
|
The first line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=9) β the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=9) β the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=β€<=*b**i*<=β€<=9) β the elements of the second list.
|
Print the smallest pretty integer.
|
[
"2 3\n4 2\n5 7 6\n",
"8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n"
] |
[
"25\n",
"1\n"
] |
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
| 500
|
[
{
"input": "2 3\n4 2\n5 7 6",
"output": "25"
},
{
"input": "8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n9\n1",
"output": "19"
},
{
"input": "9 1\n5 4 2 3 6 1 7 9 8\n9",
"output": "9"
},
{
"input": "5 3\n7 2 5 8 6\n3 1 9",
"output": "12"
},
{
"input": "4 5\n5 2 6 4\n8 9 1 3 7",
"output": "12"
},
{
"input": "5 9\n4 2 1 6 7\n2 3 4 5 6 7 8 9 1",
"output": "1"
},
{
"input": "9 9\n5 4 3 2 1 6 7 8 9\n3 2 1 5 4 7 8 9 6",
"output": "1"
},
{
"input": "9 5\n2 3 4 5 6 7 8 9 1\n4 2 1 6 7",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n8\n9",
"output": "89"
},
{
"input": "1 1\n9\n8",
"output": "89"
},
{
"input": "1 1\n1\n2",
"output": "12"
},
{
"input": "1 1\n2\n1",
"output": "12"
},
{
"input": "1 1\n9\n9",
"output": "9"
},
{
"input": "1 1\n1\n1",
"output": "1"
},
{
"input": "4 5\n3 2 4 5\n1 6 5 9 8",
"output": "5"
},
{
"input": "3 2\n4 5 6\n1 5",
"output": "5"
},
{
"input": "5 4\n1 3 5 6 7\n2 4 3 9",
"output": "3"
},
{
"input": "5 5\n1 3 5 7 9\n2 4 6 8 9",
"output": "9"
},
{
"input": "2 2\n1 8\n2 8",
"output": "8"
},
{
"input": "5 5\n5 6 7 8 9\n1 2 3 4 5",
"output": "5"
},
{
"input": "5 5\n1 2 3 4 5\n1 2 3 4 5",
"output": "1"
},
{
"input": "5 5\n1 2 3 4 5\n2 3 4 5 6",
"output": "2"
},
{
"input": "2 2\n1 5\n2 5",
"output": "5"
},
{
"input": "4 4\n1 3 5 8\n2 4 6 8",
"output": "8"
},
{
"input": "3 3\n1 5 3\n2 5 7",
"output": "5"
},
{
"input": "3 3\n3 6 8\n2 6 9",
"output": "6"
},
{
"input": "2 2\n1 4\n2 4",
"output": "4"
},
{
"input": "5 3\n3 4 5 6 7\n1 5 9",
"output": "5"
},
{
"input": "4 4\n1 2 3 4\n2 5 6 7",
"output": "2"
},
{
"input": "5 5\n1 2 3 4 5\n9 2 1 7 5",
"output": "1"
},
{
"input": "2 2\n1 3\n2 3",
"output": "3"
},
{
"input": "3 3\n3 2 1\n3 2 1",
"output": "1"
},
{
"input": "3 3\n1 3 5\n2 3 6",
"output": "3"
},
{
"input": "3 3\n5 6 7\n5 6 7",
"output": "5"
},
{
"input": "1 2\n5\n2 5",
"output": "5"
},
{
"input": "3 3\n2 4 9\n7 8 9",
"output": "9"
},
{
"input": "3 3\n1 2 4\n3 4 5",
"output": "4"
},
{
"input": "3 2\n1 4 9\n2 4",
"output": "4"
},
{
"input": "3 3\n3 5 6\n1 5 9",
"output": "5"
},
{
"input": "3 2\n1 2 4\n3 4",
"output": "4"
},
{
"input": "2 4\n8 9\n1 2 3 9",
"output": "9"
},
{
"input": "1 2\n9\n8 9",
"output": "9"
},
{
"input": "3 2\n1 2 4\n4 2",
"output": "2"
},
{
"input": "2 3\n4 5\n1 3 5",
"output": "5"
},
{
"input": "3 2\n1 2 3\n2 3",
"output": "2"
},
{
"input": "4 3\n1 3 5 9\n2 8 9",
"output": "9"
},
{
"input": "2 2\n1 9\n9 2",
"output": "9"
}
] | 1,581,944,379
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 124
| 307,200
|
input();c=lambda: set(map(int,input().split()));k=c();k1=c();d=k.intersection(k1);z=min(k);z1=min(k1)
try:print(min(int(str(min(z,z1))+str(max(z,z1))),int(str(min(d)))))
except:print(int(str(min(z,z1))+str(max(z,z1))))
|
Title: Search for Pretty Integers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
Input Specification:
The first line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=9) β the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=9) β the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=β€<=*b**i*<=β€<=9) β the elements of the second list.
Output Specification:
Print the smallest pretty integer.
Demo Input:
['2 3\n4 2\n5 7 6\n', '8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n']
Demo Output:
['25\n', '1\n']
Note:
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
|
```python
input();c=lambda: set(map(int,input().split()));k=c();k1=c();d=k.intersection(k1);z=min(k);z1=min(k1)
try:print(min(int(str(min(z,z1))+str(max(z,z1))),int(str(min(d)))))
except:print(int(str(min(z,z1))+str(max(z,z1))))
```
| 3
|
|
6
|
C
|
Alice, Bob and Chocolate
|
PROGRAMMING
| 1,200
|
[
"greedy",
"two pointers"
] |
C. Alice, Bob and Chocolate
|
2
|
64
|
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob β from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
|
The first line contains one integer *n* (1<=β€<=*n*<=β€<=105) β the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=β€<=*t**i*<=β€<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
|
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
|
[
"5\n2 9 8 2 7\n"
] |
[
"2 3\n"
] |
none
| 0
|
[
{
"input": "5\n2 9 8 2 7",
"output": "2 3"
},
{
"input": "1\n1",
"output": "1 0"
},
{
"input": "2\n1 1",
"output": "1 1"
},
{
"input": "3\n1 1 1",
"output": "2 1"
},
{
"input": "4\n1 1 1 1",
"output": "2 2"
},
{
"input": "1\n6",
"output": "1 0"
},
{
"input": "2\n8 2",
"output": "1 1"
},
{
"input": "3\n6 8 4",
"output": "1 2"
},
{
"input": "4\n4 3 2 8",
"output": "3 1"
},
{
"input": "5\n1 9 8 2 7",
"output": "2 3"
},
{
"input": "6\n1 4 7 3 2 1",
"output": "3 3"
},
{
"input": "11\n7 9 1 8 7 1 7 1 4 8 1",
"output": "4 7"
},
{
"input": "12\n4 2 7 1 9 5 6 2 7 8 5 7",
"output": "7 5"
},
{
"input": "13\n9 9 9 9 9 9 9 9 9 9 9 9 9",
"output": "7 6"
}
] | 1,587,286,149
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 466
| 6,963,200
|
n = int(input())
t = list(map(int,input().split()))
Alice = 0
Bob = 0
cA = 0
cB = 0
i = 0
j = n-1
while i<j:
temp = min(Bob,Alice)
Alice -= temp
if Alice==0:
Alice += t[i]
cA += 1
i += 1
Bob -= temp
if Bob==0:
Bob += t[j]
cB += 1
j -= 1
if i<=j:
Alice -= min(Bob,Alice)
if Alice==0:
Alice += t[i]
cA += 1
i += 1
else:
Bob -= min(Alice,Bob)
Bob += t[j]
cB += 1
j -= 1
print(cA,cB)
|
Title: Alice, Bob and Chocolate
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob β from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
Input Specification:
The first line contains one integer *n* (1<=β€<=*n*<=β€<=105) β the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=β€<=*t**i*<=β€<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
Output Specification:
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
Demo Input:
['5\n2 9 8 2 7\n']
Demo Output:
['2 3\n']
Note:
none
|
```python
n = int(input())
t = list(map(int,input().split()))
Alice = 0
Bob = 0
cA = 0
cB = 0
i = 0
j = n-1
while i<j:
temp = min(Bob,Alice)
Alice -= temp
if Alice==0:
Alice += t[i]
cA += 1
i += 1
Bob -= temp
if Bob==0:
Bob += t[j]
cB += 1
j -= 1
if i<=j:
Alice -= min(Bob,Alice)
if Alice==0:
Alice += t[i]
cA += 1
i += 1
else:
Bob -= min(Alice,Bob)
Bob += t[j]
cB += 1
j -= 1
print(cA,cB)
```
| 3.83162
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=Γ<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=Γ<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=β€<=<=*n*,<=*m*,<=*a*<=β€<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,686,881,986
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 31
| 0
|
'''Vipin'''
# cook your dish here
n,m,a=map(int,input().split())
if a>n and a>m:
print("1")
else:
if n%a>0:
n=n//a+1
else:
n=n//a
if m%a>0:
m=(m//a)+1
else:
m=m//a
ans = n*m
print(ans)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=Γ<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=Γ<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=β€<=<=*n*,<=*m*,<=*a*<=β€<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
'''Vipin'''
# cook your dish here
n,m,a=map(int,input().split())
if a>n and a>m:
print("1")
else:
if n%a>0:
n=n//a+1
else:
n=n//a
if m%a>0:
m=(m//a)+1
else:
m=m//a
ans = n*m
print(ans)
```
| 3.9845
|
489
|
B
|
BerSU Ball
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"dp",
"graph matchings",
"greedy",
"sortings",
"two pointers"
] | null | null |
The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves.
We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one.
For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls.
|
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100) β the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=100), where *a**i* is the *i*-th boy's dancing skill.
Similarly, the third line contains an integer *m* (1<=β€<=*m*<=β€<=100) β the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=β€<=*b**j*<=β€<=100), where *b**j* is the *j*-th girl's dancing skill.
|
Print a single number β the required maximum possible number of pairs.
|
[
"4\n1 4 6 2\n5\n5 1 5 7 9\n",
"4\n1 2 3 4\n4\n10 11 12 13\n",
"5\n1 1 1 1 1\n3\n1 2 3\n"
] |
[
"3\n",
"0\n",
"2\n"
] |
none
| 1,000
|
[
{
"input": "4\n1 4 6 2\n5\n5 1 5 7 9",
"output": "3"
},
{
"input": "4\n1 2 3 4\n4\n10 11 12 13",
"output": "0"
},
{
"input": "5\n1 1 1 1 1\n3\n1 2 3",
"output": "2"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 10\n1\n9",
"output": "1"
},
{
"input": "4\n4 5 4 4\n5\n5 3 4 2 4",
"output": "4"
},
{
"input": "1\n2\n1\n1",
"output": "1"
},
{
"input": "1\n3\n2\n3 2",
"output": "1"
},
{
"input": "1\n4\n3\n4 4 4",
"output": "1"
},
{
"input": "1\n2\n4\n3 1 4 2",
"output": "1"
},
{
"input": "1\n4\n5\n2 5 5 3 1",
"output": "1"
},
{
"input": "2\n2 2\n1\n2",
"output": "1"
},
{
"input": "2\n4 2\n2\n4 4",
"output": "1"
},
{
"input": "2\n4 1\n3\n2 3 2",
"output": "2"
},
{
"input": "2\n4 3\n4\n5 5 5 6",
"output": "1"
},
{
"input": "2\n5 7\n5\n4 6 7 2 5",
"output": "2"
},
{
"input": "3\n1 2 3\n1\n1",
"output": "1"
},
{
"input": "3\n5 4 5\n2\n2 1",
"output": "0"
},
{
"input": "3\n6 3 4\n3\n4 5 2",
"output": "3"
},
{
"input": "3\n7 7 7\n4\n2 7 2 4",
"output": "1"
},
{
"input": "3\n1 3 3\n5\n1 3 4 1 2",
"output": "3"
},
{
"input": "4\n1 2 1 3\n1\n4",
"output": "1"
},
{
"input": "4\n4 4 6 6\n2\n2 1",
"output": "0"
},
{
"input": "4\n3 1 1 1\n3\n1 6 7",
"output": "1"
},
{
"input": "4\n2 5 1 2\n4\n2 3 3 1",
"output": "3"
},
{
"input": "4\n9 1 7 1\n5\n9 9 9 8 4",
"output": "2"
},
{
"input": "5\n1 6 5 5 6\n1\n2",
"output": "1"
},
{
"input": "5\n5 2 4 5 6\n2\n7 4",
"output": "2"
},
{
"input": "5\n4 1 3 1 4\n3\n6 3 6",
"output": "1"
},
{
"input": "5\n5 2 3 1 4\n4\n1 3 1 7",
"output": "3"
},
{
"input": "5\n9 8 10 9 10\n5\n2 1 5 4 6",
"output": "0"
},
{
"input": "1\n48\n100\n76 90 78 44 29 30 35 85 98 38 27 71 51 100 15 98 78 45 85 26 48 66 98 71 45 85 83 77 92 17 23 95 98 43 11 15 39 53 71 25 74 53 77 41 39 35 66 4 92 44 44 55 35 87 91 6 44 46 57 24 46 82 15 44 81 40 65 17 64 24 42 52 13 12 64 82 26 7 66 85 93 89 58 92 92 77 37 91 47 73 35 69 31 22 60 60 97 21 52 6",
"output": "1"
},
{
"input": "100\n9 90 66 62 60 9 10 97 47 73 26 81 97 60 80 84 19 4 25 77 19 17 91 12 1 27 15 54 18 45 71 79 96 90 51 62 9 13 92 34 7 52 55 8 16 61 96 12 52 38 50 9 60 3 30 3 48 46 77 64 90 35 16 16 21 42 67 70 23 19 90 14 50 96 98 92 82 62 7 51 93 38 84 82 37 78 99 3 20 69 44 96 94 71 3 55 27 86 92 82\n1\n58",
"output": "0"
},
{
"input": "10\n20 87 3 39 20 20 8 40 70 51\n100\n69 84 81 84 35 97 69 68 63 97 85 80 95 58 70 91 100 65 72 80 41 87 87 87 22 49 96 96 78 96 97 56 90 31 62 98 89 74 100 86 95 88 66 54 93 62 41 60 95 79 29 69 63 70 52 63 87 58 54 52 48 57 26 75 39 61 98 78 52 73 99 49 74 50 59 90 31 97 16 85 63 72 81 68 75 59 70 67 73 92 10 88 57 95 3 71 80 95 84 96",
"output": "6"
},
{
"input": "100\n10 10 9 18 56 64 92 66 54 42 66 65 58 5 74 68 80 57 58 30 58 69 70 13 38 19 34 63 38 17 26 24 66 83 48 77 44 37 78 97 13 90 51 56 60 23 49 32 14 86 90 100 13 14 52 69 85 95 81 53 5 3 91 66 2 64 45 59 7 30 80 42 61 82 70 10 62 82 5 34 50 28 24 47 85 68 27 50 24 61 76 17 63 24 3 67 83 76 42 60\n10\n66 74 40 67 28 82 99 57 93 64",
"output": "9"
},
{
"input": "100\n4 1 1 1 3 3 2 5 1 2 1 2 1 1 1 6 1 3 1 1 1 1 2 4 1 1 4 2 2 8 2 2 1 8 2 4 3 3 8 1 3 2 3 2 1 3 8 2 2 3 1 1 2 2 5 1 4 3 1 1 3 1 3 1 7 1 1 1 3 2 1 2 2 3 7 2 1 4 3 2 1 1 3 4 1 1 3 5 1 8 4 1 1 1 3 10 2 2 1 2\n100\n1 1 5 2 13 2 2 3 6 12 1 13 8 1 1 16 1 1 5 6 2 4 6 4 2 7 4 1 7 3 3 9 5 3 1 7 4 1 6 6 8 2 2 5 2 3 16 3 6 3 8 6 1 8 1 2 6 5 3 4 11 3 4 8 2 13 2 5 2 7 3 3 1 8 1 4 4 2 4 7 7 1 5 7 6 3 6 9 1 1 1 3 1 11 5 2 5 11 13 1",
"output": "76"
},
{
"input": "4\n1 6 9 15\n2\n5 8",
"output": "2"
},
{
"input": "2\n2 4\n2\n3 1",
"output": "2"
},
{
"input": "3\n2 3 5\n3\n3 4 6",
"output": "3"
},
{
"input": "3\n1 3 4\n3\n2 1 5",
"output": "3"
},
{
"input": "2\n5 5\n4\n1 1 1 5",
"output": "1"
},
{
"input": "2\n3 2\n2\n3 4",
"output": "2"
},
{
"input": "2\n3 1\n2\n2 4",
"output": "2"
},
{
"input": "2\n2 3\n2\n2 1",
"output": "2"
},
{
"input": "2\n10 12\n2\n11 9",
"output": "2"
},
{
"input": "3\n1 2 3\n3\n3 2 1",
"output": "3"
},
{
"input": "2\n1 3\n2\n2 1",
"output": "2"
},
{
"input": "2\n4 5\n2\n5 3",
"output": "2"
},
{
"input": "2\n7 5\n2\n6 8",
"output": "2"
},
{
"input": "4\n4 3 2 1\n4\n1 2 3 4",
"output": "4"
},
{
"input": "2\n2 3\n2\n3 1",
"output": "2"
},
{
"input": "2\n2 4\n3\n3 1 8",
"output": "2"
},
{
"input": "3\n3 1 1\n3\n2 4 4",
"output": "2"
},
{
"input": "2\n5 3\n2\n4 6",
"output": "2"
},
{
"input": "4\n1 1 3 3\n4\n2 2 1 1",
"output": "4"
},
{
"input": "3\n3 2 1\n3\n2 4 3",
"output": "3"
},
{
"input": "5\n1 2 3 4 5\n5\n2 3 4 5 1",
"output": "5"
},
{
"input": "3\n3 2 1\n3\n1 2 3",
"output": "3"
},
{
"input": "2\n5 4\n2\n4 6",
"output": "2"
},
{
"input": "4\n3 3 5 5\n4\n4 4 2 2",
"output": "4"
},
{
"input": "3\n2 7 5\n3\n2 4 8",
"output": "3"
},
{
"input": "100\n2 3 3 4 2 1 4 4 5 5 2 1 5 2 3 3 5 4 3 2 4 2 3 3 2 2 3 4 2 2 2 3 1 2 3 2 2 3 5 3 3 3 3 4 5 2 2 1 1 1 3 1 2 2 3 5 5 2 5 1 3 4 5 3 5 4 1 1 2 3 4 4 5 3 2 4 5 5 5 2 1 4 2 4 5 4 4 5 5 3 2 5 1 4 4 2 2 2 5 3\n100\n4 5 3 3 2 2 4 3 1 5 4 3 3 2 2 4 5 2 5 2 1 4 3 4 2 3 5 3 4 4 1 2 3 5 2 2 1 5 4 2 4 3 4 3 4 2 3 1 3 3 4 1 1 1 4 4 5 3 1 4 2 3 2 1 3 3 2 3 2 1 1 2 3 2 1 3 3 4 3 3 1 1 3 3 3 1 1 3 5 3 3 3 3 4 4 5 2 5 4 5",
"output": "100"
},
{
"input": "1\n3\n2\n2 3",
"output": "1"
},
{
"input": "2\n5 6\n3\n1 5 100",
"output": "1"
},
{
"input": "2\n2 7\n2\n6 8",
"output": "1"
},
{
"input": "4\n4 10 15 17\n4\n3 12 16 16",
"output": "3"
},
{
"input": "2\n2 3\n2\n1 2",
"output": "2"
}
] | 1,681,630,347
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 77
| 0
|
n=int(input())
arr1=list(map(int,input().split()))
m=int(input())
arr2=list(map(int,input().split()))
arr1=sorted(arr1)
arr2=sorted(arr2)
ans=0
for i in range(n):
for j in range(m):
if(arr1[i]==arr2[j] or arr1[i]+1==arr2[j] or arr1[i]-1==arr2[j]):
ans=ans+1
arr2[j]=-1
break
print(ans)
|
Title: BerSU Ball
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves.
We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one.
For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls.
Input Specification:
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100) β the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=100), where *a**i* is the *i*-th boy's dancing skill.
Similarly, the third line contains an integer *m* (1<=β€<=*m*<=β€<=100) β the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=β€<=*b**j*<=β€<=100), where *b**j* is the *j*-th girl's dancing skill.
Output Specification:
Print a single number β the required maximum possible number of pairs.
Demo Input:
['4\n1 4 6 2\n5\n5 1 5 7 9\n', '4\n1 2 3 4\n4\n10 11 12 13\n', '5\n1 1 1 1 1\n3\n1 2 3\n']
Demo Output:
['3\n', '0\n', '2\n']
Note:
none
|
```python
n=int(input())
arr1=list(map(int,input().split()))
m=int(input())
arr2=list(map(int,input().split()))
arr1=sorted(arr1)
arr2=sorted(arr2)
ans=0
for i in range(n):
for j in range(m):
if(arr1[i]==arr2[j] or arr1[i]+1==arr2[j] or arr1[i]-1==arr2[j]):
ans=ans+1
arr2[j]=-1
break
print(ans)
```
| 3
|
|
463
|
B
|
Caisa and Pylons
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math"
] | null | null |
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=β€<=<=*h**i*<=<=β€<=<=105) representing the heights of the pylons.
|
Print a single number representing the minimum number of dollars paid by Caisa.
|
[
"5\n3 4 3 2 4\n",
"3\n4 4 4\n"
] |
[
"4\n",
"4\n"
] |
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
| 1,000
|
[
{
"input": "5\n3 4 3 2 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730",
"output": "4000"
},
{
"input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621",
"output": "3993"
},
{
"input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "30"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n69",
"output": "69"
}
] | 1,612,625,183
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 49
| 140
| 10,035,200
|
try:
t=int(input())
a=list(map(int,input().split(" ")))
k=max(a)
print(k)
except:
pass
|
Title: Caisa and Pylons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=β€<=<=*h**i*<=<=β€<=<=105) representing the heights of the pylons.
Output Specification:
Print a single number representing the minimum number of dollars paid by Caisa.
Demo Input:
['5\n3 4 3 2 4\n', '3\n4 4 4\n']
Demo Output:
['4\n', '4\n']
Note:
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
|
```python
try:
t=int(input())
a=list(map(int,input().split(" ")))
k=max(a)
print(k)
except:
pass
```
| 3
|
|
5
|
A
|
Chat Servers Outgoing Traffic
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Chat Server's Outgoing Traffic
|
1
|
64
|
Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem.
|
Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive.
|
Print a single number β answer to the problem.
|
[
"+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n",
"+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n"
] |
[
"9\n",
"14\n"
] |
none
| 0
|
[
{
"input": "+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate",
"output": "9"
},
{
"input": "+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate",
"output": "14"
},
{
"input": "+Dmitry\n+Mike\nDmitry:All letters will be used\nDmitry:qwertyuiopasdfghjklzxcvbnm QWERTYUIOPASDFGHJKLZXCVBNM\nDmitry:And digits too\nDmitry:1234567890 0987654321\n-Dmitry",
"output": "224"
},
{
"input": "+Dmitry\n+Mike\n+Kate\nDmitry:",
"output": "0"
},
{
"input": "+Dmitry\nDmitry:No phrases with spaces at the beginning and at the end\n+Mike\nDmitry:spaces spaces\n-Dmitry",
"output": "86"
},
{
"input": "+XqD\n+aT537\nXqD:x6ZPjMR1DDKG2\nXqD:lLCriywPnB\n-XqD",
"output": "46"
},
{
"input": "+8UjgAJ\n8UjgAJ:02hR7UBc1tqqfL\n-8UjgAJ\n+zdi\n-zdi",
"output": "14"
},
{
"input": "+6JPKkgXDrA\n+j6JHjv70An\n+QGtsceK0zJ\n6JPKkgXDrA:o4\n+CSmwi9zDra\nQGtsceK0zJ:Zl\nQGtsceK0zJ:0\nj6JHjv70An:7\nj6JHjv70An:B\nQGtsceK0zJ:OO",
"output": "34"
},
{
"input": "+1aLNq9S7uLV\n-1aLNq9S7uLV\n+O9ykq3xDJv\n-O9ykq3xDJv\n+54Yq1xJq14F\n+0zJ5Vo0RDZ\n-54Yq1xJq14F\n-0zJ5Vo0RDZ\n+lxlH7sdolyL\n-lxlH7sdolyL",
"output": "0"
},
{
"input": "+qlHEc2AuYy\nqlHEc2AuYy:YYRwD0 edNZgpE nGfOguRWnMYpTpGUVM aXDKGXo1Gv1tHL9\nqlHEc2AuYy:yvh3GsPcImqrvoUcBNQcP6ezwpU0 xAVltaKZp94VKiNao\nqlHEc2AuYy:zuCO6Opey L eu7lTwysaSk00zjpv zrDfbt8l hpHfu\n+pErDMxgVgh\nqlHEc2AuYy:I1FLis mmQbZtd8Ui7y 1vcax6yZBMhVRdD6Ahlq7MNCw\nqlHEc2AuYy:lz MFUNJZhlqBYckHUDlNhLiEkmecRh1o0t7alXBvCRVEFVx\npErDMxgVgh:jCyMbu1dkuEj5TzbBOjyUhpfC50cL8R900Je3R KxRgAI dT\nqlHEc2AuYy:62b47eabo2hf vSUD7KioN ZHki6WB6gh3u GKv5rgwyfF\npErDMxgVgh:zD5 9 ympl4wR gy7a7eAGAn5xVdGP9FbL6hRCZAR6O4pT6zb",
"output": "615"
},
{
"input": "+adabacaba0",
"output": "0"
},
{
"input": "+acabadab\n+caba0aba",
"output": "0"
},
{
"input": "+dabaca\n-dabaca\n+aba0ab",
"output": "0"
},
{
"input": "+cab\n+abac\n-abac\n+baca",
"output": "0"
},
{
"input": "+cabadabac\n-cabadabac\n+abacaba1ab\n-abacaba1ab\n+ba0abaca",
"output": "0"
},
{
"input": "+adabacaba\n-adabacaba\n+aca\naca:caba\n-aca\n+bacaba\n-bacaba\n+aba\n-aba\n+bad",
"output": "4"
},
{
"input": "+acabadab\n-acabadab\n+aba0abacab\n+baca\n+abacaba0ab\n-baca\n-abacaba0ab\n-aba0abacab\n+cab\n-cab\n+abacabada\n-abacabada\n+badabaca\n-badabaca\n+badaba",
"output": "0"
},
{
"input": "+badabac\nbadabac:abacabad\n-badabac\n+0ab\n-0ab\n+dabacab\n-dabacab\n+a0ab\n-a0ab\n+0abaca\n-0abaca\n+dabac\n-dabac\n+abaca\n-abaca\n+bacabada\n-bacabada\n+aca\n-aca\n+abadabaca\n-abadabaca\n+acaba\n-acaba\n+abacabadab\n-abacabadab",
"output": "8"
}
] | 1,678,883,045
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 0
|
import sys
names = set()
result = 0
lines = sys.stdin.readlines()
for s in lines:
s = s.strip()
if '+' in s:
names.add(s[1:])
continue
if '-' in s:
names.remove(s[1:])
continue
name, messsage = s.split(':')
result += len(names) * len(messsage)
print(result)
|
Title: Chat Servers Outgoing Traffic
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem.
Input Specification:
Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive.
Output Specification:
Print a single number β answer to the problem.
Demo Input:
['+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n', '+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n']
Demo Output:
['9\n', '14\n']
Note:
none
|
```python
import sys
names = set()
result = 0
lines = sys.stdin.readlines()
for s in lines:
s = s.strip()
if '+' in s:
names.add(s[1:])
continue
if '-' in s:
names.remove(s[1:])
continue
name, messsage = s.split(':')
result += len(names) * len(messsage)
print(result)
```
| 3.938
|
940
|
C
|
Phone Numbers
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"implementation",
"strings"
] | null | null |
And where the are the phone numbers?
You are given a string *s* consisting of lowercase English letters and an integer *k*. Find the lexicographically smallest string *t* of length *k*, such that its set of letters is a subset of the set of letters of *s* and *s* is lexicographically smaller than *t*.
It's guaranteed that the answer exists.
Note that the set of letters is a set, not a multiset. For example, the set of letters of abadaba is {*a*,<=*b*,<=*d*}.
String *p* is lexicographically smaller than string *q*, if *p* is a prefix of *q*, is not equal to *q* or there exists *i*, such that *p**i*<=<<=*q**i* and for all *j*<=<<=*i* it is satisfied that *p**j*<==<=*q**j*. For example, abc is lexicographically smaller than abcd , abd is lexicographically smaller than abec, afa is not lexicographically smaller than ab and a is not lexicographically smaller than a.
|
The first line of input contains two space separated integers *n* and *k* (1<=β€<=*n*,<=*k*<=β€<=100<=000)Β β the length of *s* and the required length of *t*.
The second line of input contains the string *s* consisting of *n* lowercase English letters.
|
Output the string *t* conforming to the requirements above.
It's guaranteed that the answer exists.
|
[
"3 3\nabc\n",
"3 2\nabc\n",
"3 3\nayy\n",
"2 3\nba\n"
] |
[
"aca\n",
"ac\n",
"yaa\n",
"baa\n"
] |
In the first example the list of strings *t* of length 3, such that the set of letters of *t* is a subset of letters of *s* is as follows: aaa, aab, aac, aba, abb, abc, aca, acb, .... Among them, those are lexicographically greater than abc: aca, acb, .... Out of those the lexicographically smallest is aca.
| 1,250
|
[
{
"input": "3 3\nabc",
"output": "aca"
},
{
"input": "3 2\nabc",
"output": "ac"
},
{
"input": "3 3\nayy",
"output": "yaa"
},
{
"input": "2 3\nba",
"output": "baa"
},
{
"input": "1 3\nf",
"output": "fff"
},
{
"input": "3 1\nazz",
"output": "z"
},
{
"input": "3 3\nzbf",
"output": "zbz"
},
{
"input": "2 3\ngi",
"output": "gig"
},
{
"input": "3 2\nyzy",
"output": "zy"
},
{
"input": "5 10\nkekff",
"output": "kekffeeeee"
},
{
"input": "10 5\nhqqqqcdddb",
"output": "qbbbb"
},
{
"input": "10 10\nmrfkcsxcuj",
"output": "mrfkcsxcuk"
},
{
"input": "10 3\nggjnohlepu",
"output": "ggl"
},
{
"input": "8 9\npppppppp",
"output": "ppppppppp"
},
{
"input": "10 7\nffffffffyf",
"output": "ffffffy"
},
{
"input": "10 2\nkmiejhcimj",
"output": "mc"
},
{
"input": "10 1\ngiwekrmngf",
"output": "i"
},
{
"input": "8 8\nlolololo",
"output": "lololool"
},
{
"input": "10 9\nbcegikmyyy",
"output": "bcegikybb"
},
{
"input": "7 5000\nqqqqqqq",
"output": "qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq..."
},
{
"input": "3 99948\nttt",
"output": "ttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt..."
}
] | 1,519,721,168
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 78
| 5,939,200
|
a,b = map(int,input().split(' '))
s = input()
s1 = sorted(set(s))
if b>a:
print(s+s1[0]*(b-a))
else:
i = b-1
while s[i]>=s1[-1] and i>-1:
i -= 1
d = s1.index(s[i])
print(s[:i]+s1[d+1]+s1[0]*(b-i-1))
|
Title: Phone Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
And where the are the phone numbers?
You are given a string *s* consisting of lowercase English letters and an integer *k*. Find the lexicographically smallest string *t* of length *k*, such that its set of letters is a subset of the set of letters of *s* and *s* is lexicographically smaller than *t*.
It's guaranteed that the answer exists.
Note that the set of letters is a set, not a multiset. For example, the set of letters of abadaba is {*a*,<=*b*,<=*d*}.
String *p* is lexicographically smaller than string *q*, if *p* is a prefix of *q*, is not equal to *q* or there exists *i*, such that *p**i*<=<<=*q**i* and for all *j*<=<<=*i* it is satisfied that *p**j*<==<=*q**j*. For example, abc is lexicographically smaller than abcd , abd is lexicographically smaller than abec, afa is not lexicographically smaller than ab and a is not lexicographically smaller than a.
Input Specification:
The first line of input contains two space separated integers *n* and *k* (1<=β€<=*n*,<=*k*<=β€<=100<=000)Β β the length of *s* and the required length of *t*.
The second line of input contains the string *s* consisting of *n* lowercase English letters.
Output Specification:
Output the string *t* conforming to the requirements above.
It's guaranteed that the answer exists.
Demo Input:
['3 3\nabc\n', '3 2\nabc\n', '3 3\nayy\n', '2 3\nba\n']
Demo Output:
['aca\n', 'ac\n', 'yaa\n', 'baa\n']
Note:
In the first example the list of strings *t* of length 3, such that the set of letters of *t* is a subset of letters of *s* is as follows: aaa, aab, aac, aba, abb, abc, aca, acb, .... Among them, those are lexicographically greater than abc: aca, acb, .... Out of those the lexicographically smallest is aca.
|
```python
a,b = map(int,input().split(' '))
s = input()
s1 = sorted(set(s))
if b>a:
print(s+s1[0]*(b-a))
else:
i = b-1
while s[i]>=s1[-1] and i>-1:
i -= 1
d = s1.index(s[i])
print(s[:i]+s1[d+1]+s1[0]*(b-i-1))
```
| 3
|
|
404
|
A
|
Valera and X
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
|
The first line contains integer *n* (3<=β€<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters β the description of Valera's paper.
|
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
|
[
"5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n",
"3\nwsw\nsws\nwsw\n",
"3\nxpx\npxp\nxpe\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nwsw\nsws\nwsw",
"output": "YES"
},
{
"input": "3\nxpx\npxp\nxpe",
"output": "NO"
},
{
"input": "5\nliiil\nilili\niilii\nilili\nliiil",
"output": "YES"
},
{
"input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt",
"output": "NO"
},
{
"input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos",
"output": "YES"
},
{
"input": "3\naaa\naaa\naaa",
"output": "NO"
},
{
"input": "3\naca\noec\nzba",
"output": "NO"
},
{
"input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "3\nxxx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxx\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxxx",
"output": "NO"
},
{
"input": "3\nxax\nxxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naaa\nxax",
"output": "NO"
},
{
"input": "3\naax\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxaa\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\naax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaa",
"output": "NO"
},
{
"input": "3\nxfx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\nafa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaf",
"output": "NO"
},
{
"input": "3\nxox\nxxx\nxxx",
"output": "NO"
},
{
"input": "3\naxa\naax\nxxa",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxox",
"output": "NO"
},
{
"input": "3\nxox\nooo\nxox",
"output": "NO"
},
{
"input": "3\naaa\naab\nbbb",
"output": "NO"
},
{
"input": "3\nxxx\nsxs\nxsx",
"output": "NO"
},
{
"input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba",
"output": "NO"
},
{
"input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba",
"output": "NO"
},
{
"input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxxx",
"output": "NO"
},
{
"input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox",
"output": "NO"
},
{
"input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox",
"output": "NO"
},
{
"input": "3\naaa\nbab\naba",
"output": "NO"
}
] | 1,649,159,881
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 77
| 204,800
|
n = int(input())
arr = []
for i in range(n):
arr.append(list(input()))
cnt = set()
x = arr[0][0]
y = arr[0][1]
ans = "YES"
for i in range(n):
for j in range(n):
cnt.add(arr[i][j])
if i == j or i == n-1-j:
if arr[i][j] != x:
ans = "NO"
break
else:
if arr[i][j] != y:
ans = "NO"
break
if len(cnt) != 2:
print("NO")
else:
print(ans)
|
Title: Valera and X
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
Input Specification:
The first line contains integer *n* (3<=β€<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters β the description of Valera's paper.
Output Specification:
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
Demo Input:
['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none
|
```python
n = int(input())
arr = []
for i in range(n):
arr.append(list(input()))
cnt = set()
x = arr[0][0]
y = arr[0][1]
ans = "YES"
for i in range(n):
for j in range(n):
cnt.add(arr[i][j])
if i == j or i == n-1-j:
if arr[i][j] != x:
ans = "NO"
break
else:
if arr[i][j] != y:
ans = "NO"
break
if len(cnt) != 2:
print("NO")
else:
print(ans)
```
| 3
|
|
965
|
C
|
Greedy Arkady
|
PROGRAMMING
| 2,000
|
[
"math"
] | null | null |
$k$ people want to split $n$ candies between them. Each candy should be given to exactly one of them or be thrown away.
The people are numbered from $1$ to $k$, and Arkady is the first of them. To split the candies, Arkady will choose an integer $x$ and then give the first $x$ candies to himself, the next $x$ candies to the second person, the next $x$ candies to the third person and so on in a cycle. The leftover (the remainder that is not divisible by $x$) will be thrown away.
Arkady can't choose $x$ greater than $M$ as it is considered greedy. Also, he can't choose such a small $x$ that some person will receive candies more than $D$ times, as it is considered a slow splitting.
Please find what is the maximum number of candies Arkady can receive by choosing some valid $x$.
|
The only line contains four integers $n$, $k$, $M$ and $D$ ($2 \le n \le 10^{18}$, $2 \le k \le n$, $1 \le M \le n$, $1 \le D \le \min{(n, 1000)}$, $M \cdot D \cdot k \ge n$)Β β the number of candies, the number of people, the maximum number of candies given to a person at once, the maximum number of times a person can receive candies.
|
Print a single integerΒ β the maximum possible number of candies Arkady can give to himself.
Note that it is always possible to choose some valid $x$.
|
[
"20 4 5 2\n",
"30 9 4 1\n"
] |
[
"8\n",
"4\n"
] |
In the first example Arkady should choose $x = 4$. He will give $4$ candies to himself, $4$ candies to the second person, $4$ candies to the third person, then $4$ candies to the fourth person and then again $4$ candies to himself. No person is given candies more than $2$ times, and Arkady receives $8$ candies in total.
Note that if Arkady chooses $x = 5$, he will receive only $5$ candies, and if he chooses $x = 3$, he will receive only $3 + 3 = 6$ candies as well as the second person, the third and the fourth persons will receive $3$ candies, and $2$ candies will be thrown away. He can't choose $x = 1$ nor $x = 2$ because in these cases he will receive candies more than $2$ times.
In the second example Arkady has to choose $x = 4$, because any smaller value leads to him receiving candies more than $1$ time.
| 1,500
|
[
{
"input": "20 4 5 2",
"output": "8"
},
{
"input": "30 9 4 1",
"output": "4"
},
{
"input": "2 2 1 1",
"output": "1"
},
{
"input": "42 20 5 29",
"output": "5"
},
{
"input": "1000000000000000000 135 1000000000000000 1000",
"output": "8325624421831635"
},
{
"input": "100 33 100 100",
"output": "100"
},
{
"input": "1000000000 1000000000 1000000000 1000",
"output": "1000000000"
},
{
"input": "1000000000 32428 1000000000 1000",
"output": "1000000000"
},
{
"input": "1000000000 324934 1000 1000",
"output": "4000"
},
{
"input": "1000000000000000000 32400093004 10000000 1000",
"output": "40000000"
},
{
"input": "885 2 160 842",
"output": "504"
},
{
"input": "216 137 202 208",
"output": "202"
},
{
"input": "72 66 28 9",
"output": "28"
},
{
"input": "294 4 13 8",
"output": "80"
},
{
"input": "9 2 2 3",
"output": "4"
},
{
"input": "31 3 2 8",
"output": "10"
},
{
"input": "104 2 5 11",
"output": "50"
},
{
"input": "1000000000000000000 1000000000000000000 1000 1000",
"output": "1000"
},
{
"input": "1000000000000000000 100000000000000000 1 1000",
"output": "10"
},
{
"input": "23925738098196565 23925738098196565 23925738098196565 1000",
"output": "23925738098196565"
},
{
"input": "576460752303423488 576460752303423488 351082447248993993 1000",
"output": "351082447248993993"
},
{
"input": "962768465676381898 72057594037927936 586039918340257175 256",
"output": "586039918340257175"
},
{
"input": "1000000000000000000 1000000000000000000 10 1000",
"output": "10"
},
{
"input": "23925738098196565 23925738098196565 1 1000",
"output": "1"
},
{
"input": "1000000000000000000 1000000000000000000 1 1000",
"output": "1"
}
] | 1,609,558,220
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 25
| 140
| 0
|
s=list(map(int,input().split()))
n=s[0]
k=s[1]
M=s[2]
D=s[3]
ans=0
for d in range(0,D+1):
x=n//((d-1)*k+1)
if x>M:
x=M
if x*d>ans:
ans=x*d
print(ans)
|
Title: Greedy Arkady
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
$k$ people want to split $n$ candies between them. Each candy should be given to exactly one of them or be thrown away.
The people are numbered from $1$ to $k$, and Arkady is the first of them. To split the candies, Arkady will choose an integer $x$ and then give the first $x$ candies to himself, the next $x$ candies to the second person, the next $x$ candies to the third person and so on in a cycle. The leftover (the remainder that is not divisible by $x$) will be thrown away.
Arkady can't choose $x$ greater than $M$ as it is considered greedy. Also, he can't choose such a small $x$ that some person will receive candies more than $D$ times, as it is considered a slow splitting.
Please find what is the maximum number of candies Arkady can receive by choosing some valid $x$.
Input Specification:
The only line contains four integers $n$, $k$, $M$ and $D$ ($2 \le n \le 10^{18}$, $2 \le k \le n$, $1 \le M \le n$, $1 \le D \le \min{(n, 1000)}$, $M \cdot D \cdot k \ge n$)Β β the number of candies, the number of people, the maximum number of candies given to a person at once, the maximum number of times a person can receive candies.
Output Specification:
Print a single integerΒ β the maximum possible number of candies Arkady can give to himself.
Note that it is always possible to choose some valid $x$.
Demo Input:
['20 4 5 2\n', '30 9 4 1\n']
Demo Output:
['8\n', '4\n']
Note:
In the first example Arkady should choose $x = 4$. He will give $4$ candies to himself, $4$ candies to the second person, $4$ candies to the third person, then $4$ candies to the fourth person and then again $4$ candies to himself. No person is given candies more than $2$ times, and Arkady receives $8$ candies in total.
Note that if Arkady chooses $x = 5$, he will receive only $5$ candies, and if he chooses $x = 3$, he will receive only $3 + 3 = 6$ candies as well as the second person, the third and the fourth persons will receive $3$ candies, and $2$ candies will be thrown away. He can't choose $x = 1$ nor $x = 2$ because in these cases he will receive candies more than $2$ times.
In the second example Arkady has to choose $x = 4$, because any smaller value leads to him receiving candies more than $1$ time.
|
```python
s=list(map(int,input().split()))
n=s[0]
k=s[1]
M=s[2]
D=s[3]
ans=0
for d in range(0,D+1):
x=n//((d-1)*k+1)
if x>M:
x=M
if x*d>ans:
ans=x*d
print(ans)
```
| 3
|
|
246
|
B
|
Increase and Decrease
|
PROGRAMMING
| 1,300
|
[
"greedy",
"math"
] | null | null |
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=β <=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=105) β the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=β€<=104) β the original array.
|
Print a single integer β the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
|
[
"2\n2 1\n",
"3\n1 4 1\n"
] |
[
"1\n",
"3\n"
] |
none
| 1,000
|
[
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 4 1",
"output": "3"
},
{
"input": "4\n2 -7 -2 -6",
"output": "3"
},
{
"input": "4\n2 0 -2 -1",
"output": "3"
},
{
"input": "6\n-1 1 0 0 -1 -1",
"output": "5"
},
{
"input": "5\n0 0 0 0 0",
"output": "5"
},
{
"input": "100\n968 793 -628 -416 942 -308 977 168 728 -879 952 781 -425 -475 -480 738 -740 142 -319 -116 -701 -183 41 324 -918 -391 -176 781 763 888 475 -617 134 -802 -133 -211 855 -869 -236 503 550 387 137 -221 -957 -800 -56 -673 440 -791 -217 -959 -892 886 -593 427 890 223 -425 -342 -262 693 -137 924 860 156 -110 444 -12 703 421 -638 725 -551 597 -206 -80 393 -441 -759 617 424 -506 209 579 -685 -861 507 312 597 -81 -491 424 222 -892 629 512 743 -452 -504",
"output": "99"
}
] | 1,561,915,247
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 342
| 5,632,000
|
n = int(input())
arr = [int(i) for i in input().split()]
if sum(arr)%n ==0: print(n)
else: print(n-1)
|
Title: Increase and Decrease
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=β <=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=105) β the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=β€<=104) β the original array.
Output Specification:
Print a single integer β the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
Demo Input:
['2\n2 1\n', '3\n1 4 1\n']
Demo Output:
['1\n', '3\n']
Note:
none
|
```python
n = int(input())
arr = [int(i) for i in input().split()]
if sum(arr)%n ==0: print(n)
else: print(n-1)
```
| 3
|
|
445
|
A
|
DZY Loves Chessboard
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"implementation"
] | null | null |
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
|
The first line contains two space-separated integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
|
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
|
[
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] |
[
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] |
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
| 500
|
[
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,640,562,261
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 62
| 0
|
n, m = map(int, input().split())
inp = [input() for _ in range(n)]
for i in range(n):
for j in range(m):
if inp[i][j] == '-':
print('-', end='')
else:
print('B' if (i+j)%2==0 else 'W', end='')
print('')
|
Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
|
```python
n, m = map(int, input().split())
inp = [input() for _ in range(n)]
for i in range(n):
for j in range(m):
if inp[i][j] == '-':
print('-', end='')
else:
print('B' if (i+j)%2==0 else 'W', end='')
print('')
```
| 3
|
|
352
|
B
|
Jeff and Periods
|
PROGRAMMING
| 1,300
|
[
"implementation",
"sortings"
] | null | null |
One day Jeff got hold of an integer sequence *a*1, *a*2, ..., *a**n* of length *n*. The boy immediately decided to analyze the sequence. For that, he needs to find all values of *x*, for which these conditions hold:
- *x* occurs in sequence *a*. - Consider all positions of numbers *x* in the sequence *a* (such *i*, that *a**i*<==<=*x*). These numbers, sorted in the increasing order, must form an arithmetic progression.
Help Jeff, find all *x* that meet the problem conditions.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=105). The next line contains integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=105). The numbers are separated by spaces.
|
In the first line print integer *t* β the number of valid *x*. On each of the next *t* lines print two integers *x* and *p**x*, where *x* is current suitable value, *p**x* is the common difference between numbers in the progression (if *x* occurs exactly once in the sequence, *p**x* must equal 0). Print the pairs in the order of increasing *x*.
|
[
"1\n2\n",
"8\n1 2 1 3 1 2 1 5\n"
] |
[
"1\n2 0\n",
"4\n1 2\n2 4\n3 0\n5 0\n"
] |
In the first test 2 occurs exactly once in the sequence, ergo *p*<sub class="lower-index">2</sub>β=β0.
| 1,000
|
[
{
"input": "1\n2",
"output": "1\n2 0"
},
{
"input": "8\n1 2 1 3 1 2 1 5",
"output": "4\n1 2\n2 4\n3 0\n5 0"
},
{
"input": "3\n1 10 5",
"output": "3\n1 0\n5 0\n10 0"
},
{
"input": "4\n9 9 3 5",
"output": "3\n3 0\n5 0\n9 1"
},
{
"input": "6\n1 2 2 1 1 2",
"output": "0"
},
{
"input": "6\n2 6 3 8 7 2",
"output": "5\n2 5\n3 0\n6 0\n7 0\n8 0"
},
{
"input": "7\n2 1 2 1 2 1 2",
"output": "2\n1 2\n2 2"
},
{
"input": "8\n1 1 1 1 1 1 1 1",
"output": "1\n1 1"
},
{
"input": "9\n2 3 3 3 2 1 2 3 2",
"output": "1\n1 0"
},
{
"input": "10\n3 1 1 1 1 3 1 2 2 1",
"output": "2\n2 1\n3 5"
},
{
"input": "12\n10 9 8 7 7 8 9 10 10 9 8 7",
"output": "0"
}
] | 1,622,921,178
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 966
| 14,950,400
|
n= int(input())
t = list(map(int,input().split()))
u=[]
f={}
p=0
for j in range(n):
if t[j] not in f:
f[t[j]]=[0,j]
else:
if f[t[j]][0]==0:
f[t[j]][0]= j-f[t[j]][-1]
f[t[j]].append(j)
elif f[t[j]][0]!='a':
if j-f[t[j]][-1]==f[t[j]][0]:
f[t[j]].append(j)
else:
f[t[j]][0]='a'
p+=1
print(len(set(t))-p)
for j in sorted(list(f.keys())):
if f[j][0]!='a':
print(j,f[j][0])
|
Title: Jeff and Periods
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Jeff got hold of an integer sequence *a*1, *a*2, ..., *a**n* of length *n*. The boy immediately decided to analyze the sequence. For that, he needs to find all values of *x*, for which these conditions hold:
- *x* occurs in sequence *a*. - Consider all positions of numbers *x* in the sequence *a* (such *i*, that *a**i*<==<=*x*). These numbers, sorted in the increasing order, must form an arithmetic progression.
Help Jeff, find all *x* that meet the problem conditions.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=105). The next line contains integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=105). The numbers are separated by spaces.
Output Specification:
In the first line print integer *t* β the number of valid *x*. On each of the next *t* lines print two integers *x* and *p**x*, where *x* is current suitable value, *p**x* is the common difference between numbers in the progression (if *x* occurs exactly once in the sequence, *p**x* must equal 0). Print the pairs in the order of increasing *x*.
Demo Input:
['1\n2\n', '8\n1 2 1 3 1 2 1 5\n']
Demo Output:
['1\n2 0\n', '4\n1 2\n2 4\n3 0\n5 0\n']
Note:
In the first test 2 occurs exactly once in the sequence, ergo *p*<sub class="lower-index">2</sub>β=β0.
|
```python
n= int(input())
t = list(map(int,input().split()))
u=[]
f={}
p=0
for j in range(n):
if t[j] not in f:
f[t[j]]=[0,j]
else:
if f[t[j]][0]==0:
f[t[j]][0]= j-f[t[j]][-1]
f[t[j]].append(j)
elif f[t[j]][0]!='a':
if j-f[t[j]][-1]==f[t[j]][0]:
f[t[j]].append(j)
else:
f[t[j]][0]='a'
p+=1
print(len(set(t))-p)
for j in sorted(list(f.keys())):
if f[j][0]!='a':
print(j,f[j][0])
```
| 3
|
|
1,011
|
B
|
Planning The Expedition
|
PROGRAMMING
| 1,200
|
[
"binary search",
"brute force",
"implementation"
] | null | null |
Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant.
The warehouse has $m$ daily food packages. Each package has some food type $a_i$.
Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food.
Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different.
What is the maximum possible number of days the expedition can last, following the requirements above?
|
The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$)Β β the number of the expedition participants and the number of the daily food packages available.
The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package.
|
Print the single integerΒ β the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0.
|
[
"4 10\n1 5 2 1 1 1 2 5 7 2\n",
"100 1\n1\n",
"2 5\n5 4 3 2 1\n",
"3 9\n42 42 42 42 42 42 42 42 42\n"
] |
[
"2\n",
"0\n",
"1\n",
"3\n"
] |
In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$).
In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
| 1,000
|
[
{
"input": "4 10\n1 5 2 1 1 1 2 5 7 2",
"output": "2"
},
{
"input": "100 1\n1",
"output": "0"
},
{
"input": "2 5\n5 4 3 2 1",
"output": "1"
},
{
"input": "3 9\n42 42 42 42 42 42 42 42 42",
"output": "3"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "4 100\n84 99 66 69 86 94 89 96 98 93 93 82 87 93 91 100 69 99 93 81 99 84 75 100 86 88 98 100 84 96 44 70 94 91 85 78 86 79 45 88 91 78 98 94 81 87 93 72 96 88 96 97 96 62 86 72 94 84 80 98 88 90 93 73 73 98 78 50 91 96 97 82 85 90 87 41 97 82 97 77 100 100 92 83 98 81 70 81 74 78 84 79 98 98 55 99 97 99 79 98",
"output": "5"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "6 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "15"
},
{
"input": "1 1\n59",
"output": "1"
},
{
"input": "1 50\n39 1 46 21 23 28 100 32 63 63 18 15 40 29 34 49 56 74 47 42 96 97 59 62 76 62 69 61 36 21 66 18 92 58 63 85 5 6 77 75 91 66 38 10 66 43 20 74 37 83",
"output": "3"
},
{
"input": "1 100\n83 72 21 55 49 5 61 60 87 21 89 88 3 75 49 81 36 25 50 61 96 19 36 55 48 8 97 69 50 24 23 39 26 25 41 90 69 20 19 62 38 52 60 6 66 31 9 45 36 12 69 94 22 60 91 65 35 58 13 85 33 87 83 11 95 20 20 85 13 21 57 69 17 94 78 37 59 45 60 7 64 51 60 89 91 22 6 58 95 96 51 53 89 22 28 16 27 56 1 54",
"output": "5"
},
{
"input": "50 1\n75",
"output": "0"
},
{
"input": "50 50\n85 20 12 73 52 78 70 95 88 43 31 88 81 41 80 99 16 11 97 11 21 44 2 34 47 38 87 2 32 47 97 93 52 14 35 37 97 48 58 19 52 55 97 72 17 25 16 85 90 58",
"output": "1"
},
{
"input": "50 100\n2 37 74 32 99 75 73 86 67 33 62 30 15 21 51 41 73 75 67 39 90 10 56 74 72 26 38 65 75 55 46 99 34 49 92 82 11 100 15 71 75 12 22 56 47 74 20 98 59 65 14 76 1 40 89 36 43 93 83 73 75 100 50 95 27 10 72 51 25 69 15 3 57 60 84 99 31 44 12 61 69 95 51 31 28 36 57 35 31 52 44 19 79 12 27 27 7 81 68 1",
"output": "1"
},
{
"input": "100 1\n26",
"output": "0"
},
{
"input": "100 50\n8 82 62 11 85 57 5 32 99 92 77 2 61 86 8 88 10 28 83 4 68 79 8 64 56 98 4 88 22 54 30 60 62 79 72 38 17 28 32 16 62 26 56 44 72 33 22 84 77 45",
"output": "0"
},
{
"input": "100 100\n13 88 64 65 78 10 61 97 16 32 76 9 60 1 40 35 90 61 60 85 26 16 38 36 33 95 24 55 82 88 13 9 47 34 94 2 90 74 11 81 46 70 94 11 55 32 19 36 97 16 17 35 38 82 89 16 74 94 97 79 9 94 88 12 28 2 4 25 72 95 49 31 88 82 6 77 70 98 90 57 57 33 38 61 26 75 2 66 22 44 13 35 16 4 33 16 12 66 32 86",
"output": "1"
},
{
"input": "34 64\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "53 98\n1 1 2 2 2 2 2 1 2 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 2 1 2 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 2 2 2 2 2 2 1 1 2 2 1 2 1 2 1 2 1 1 2 2 2 1 1 2 1 2 1 1 1 1 2 2 2 2 2 1 1 2 2 2 1 1",
"output": "1"
},
{
"input": "17 8\n2 5 3 4 3 2 2 2",
"output": "0"
},
{
"input": "24 77\n8 6 10 4 6 6 4 10 9 7 7 5 5 4 6 7 10 6 3 4 6 6 4 9 4 6 2 5 3 4 4 1 4 6 6 8 1 1 6 4 6 2 5 7 7 2 4 4 10 1 10 9 2 3 8 1 10 4 3 9 3 8 3 5 6 3 4 9 5 3 4 1 1 6 1 2 1",
"output": "2"
},
{
"input": "65 74\n7 19 2 38 28 44 34 49 14 13 30 22 11 4 4 12 8 1 40 8 34 31 44 38 21 35 13 7 19 32 37 5 36 26 7 2 15 11 47 45 48 2 49 10 10 42 42 31 50 24 29 34 31 38 39 48 43 47 32 46 10 1 33 21 12 50 13 44 38 11 41 41 10 7",
"output": "1"
},
{
"input": "37 71\n50 93 15 80 82 23 35 90 70 73 55 23 23 6 86 63 38 70 38 52 88 34 25 75 32 19 6 98 31 38 21 8 66 8 59 71 7 80 69 23 17 70 6 40 72 5 48 59 18 1 48 91 17 41 11 27 53 95 87 31 62 94 94 60 38 99 70 50 81 86 44",
"output": "1"
},
{
"input": "35 4\n100 100 100 100",
"output": "0"
},
{
"input": "68 12\n100 100 100 99 99 100 100 100 99 99 99 99",
"output": "0"
},
{
"input": "91 33\n97 100 96 96 97 100 97 97 96 96 99 99 98 97 97 99 99 98 100 96 96 99 100 96 97 100 97 97 99 98 96 98 97",
"output": "0"
},
{
"input": "59 72\n99 96 96 93 94 97 93 96 100 99 93 99 96 92 92 97 93 100 92 100 91 96 99 100 97 98 93 93 96 100 97 99 100 100 91 93 96 91 93 100 95 96 92 97 91 91 99 100 91 95 95 100 92 93 98 93 95 92 95 100 91 95 99 95 92 91 100 93 98 98 96 99",
"output": "1"
},
{
"input": "9 35\n95 54 78 94 56 63 68 73 61 85 73 62 61 94 67 91 66 54 89 69 92 60 91 87 63 62 85 70 62 68 97 88 96 55 62",
"output": "2"
},
{
"input": "99 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "1 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
}
] | 1,532,724,778
| 1,378
|
Python 3
|
OK
|
TESTS
| 31
| 109
| 0
|
n, m = map(int, input().split())
packages = list(map(int, input().split()))
counts = dict()
for p in packages:
if p in counts:
counts[p] += 1
else:
counts[p] = 1
arrayCounts = []
for package, count in counts.items():
arrayCounts.append(count)
arrayCounts.sort()
arrayCounts.reverse()
for i in range(m//n+1):
days = i+1
people = 0
for type in arrayCounts:
people += type//days
if people < n:
break
print(i)
|
Title: Planning The Expedition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant.
The warehouse has $m$ daily food packages. Each package has some food type $a_i$.
Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food.
Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different.
What is the maximum possible number of days the expedition can last, following the requirements above?
Input Specification:
The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$)Β β the number of the expedition participants and the number of the daily food packages available.
The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package.
Output Specification:
Print the single integerΒ β the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0.
Demo Input:
['4 10\n1 5 2 1 1 1 2 5 7 2\n', '100 1\n1\n', '2 5\n5 4 3 2 1\n', '3 9\n42 42 42 42 42 42 42 42 42\n']
Demo Output:
['2\n', '0\n', '1\n', '3\n']
Note:
In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$).
In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
|
```python
n, m = map(int, input().split())
packages = list(map(int, input().split()))
counts = dict()
for p in packages:
if p in counts:
counts[p] += 1
else:
counts[p] = 1
arrayCounts = []
for package, count in counts.items():
arrayCounts.append(count)
arrayCounts.sort()
arrayCounts.reverse()
for i in range(m//n+1):
days = i+1
people = 0
for type in arrayCounts:
people += type//days
if people < n:
break
print(i)
```
| 3
|
|
146
|
A
|
Lucky Ticket
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya loves tickets very much. As we know, each ticket has a number that is a positive integer. Its length equals *n* (*n* is always even). Petya calls a ticket lucky if the ticket's number is a lucky number and the sum of digits in the first half (the sum of the first *n*<=/<=2 digits) equals the sum of digits in the second half (the sum of the last *n*<=/<=2 digits). Check if the given ticket is lucky.
|
The first line contains an even integer *n* (2<=β€<=*n*<=β€<=50) β the length of the ticket number that needs to be checked. The second line contains an integer whose length equals exactly *n* β the ticket number. The number may contain leading zeros.
|
On the first line print "YES" if the given ticket number is lucky. Otherwise, print "NO" (without the quotes).
|
[
"2\n47\n",
"4\n4738\n",
"4\n4774\n"
] |
[
"NO\n",
"NO\n",
"YES\n"
] |
In the first sample the sum of digits in the first half does not equal the sum of digits in the second half (4ββ β7).
In the second sample the ticket number is not the lucky number.
| 500
|
[
{
"input": "2\n47",
"output": "NO"
},
{
"input": "4\n4738",
"output": "NO"
},
{
"input": "4\n4774",
"output": "YES"
},
{
"input": "4\n4570",
"output": "NO"
},
{
"input": "6\n477477",
"output": "YES"
},
{
"input": "6\n777777",
"output": "YES"
},
{
"input": "20\n44444444444444444444",
"output": "YES"
},
{
"input": "2\n44",
"output": "YES"
},
{
"input": "10\n4745474547",
"output": "NO"
},
{
"input": "14\n77770004444444",
"output": "NO"
},
{
"input": "10\n4747777744",
"output": "YES"
},
{
"input": "10\n1234567890",
"output": "NO"
},
{
"input": "50\n44444444444444444444444444444444444444444444444444",
"output": "YES"
},
{
"input": "50\n44444444444444444444444444444444444444444444444447",
"output": "NO"
},
{
"input": "50\n74444444444444444444444444444444444444444444444444",
"output": "NO"
},
{
"input": "50\n07777777777777777777777777777777777777777777777770",
"output": "NO"
},
{
"input": "50\n77777777777777777777777777777777777777777777777777",
"output": "YES"
},
{
"input": "50\n44747747774474747747747447777447774747447477444474",
"output": "YES"
},
{
"input": "48\n447474444777444474747747744774447444747474774474",
"output": "YES"
},
{
"input": "32\n74474474777444474444747774474774",
"output": "YES"
},
{
"input": "40\n4747777444447747777447447747447474774777",
"output": "YES"
},
{
"input": "10\n4477477444",
"output": "YES"
},
{
"input": "18\n447747474447744747",
"output": "YES"
},
{
"input": "26\n44747744444774744774474447",
"output": "YES"
},
{
"input": "50\n44707747774474747747747447777447774747447477444474",
"output": "NO"
},
{
"input": "40\n4747777444447737777447447747447474774777",
"output": "NO"
},
{
"input": "36\n764477744747444444447747747474744444",
"output": "NO"
},
{
"input": "22\n4477407474777477744447",
"output": "NO"
},
{
"input": "32\n74274474777444474444747774474774",
"output": "NO"
},
{
"input": "16\n4744447974444747",
"output": "NO"
},
{
"input": "2\n11",
"output": "NO"
},
{
"input": "2\n22",
"output": "NO"
},
{
"input": "2\n33",
"output": "NO"
},
{
"input": "2\n74",
"output": "NO"
},
{
"input": "2\n55",
"output": "NO"
},
{
"input": "2\n66",
"output": "NO"
},
{
"input": "2\n77",
"output": "YES"
},
{
"input": "2\n88",
"output": "NO"
},
{
"input": "2\n99",
"output": "NO"
},
{
"input": "4\n4004",
"output": "NO"
},
{
"input": "14\n00077774444444",
"output": "NO"
},
{
"input": "6\n004444",
"output": "NO"
},
{
"input": "4\n0044",
"output": "NO"
},
{
"input": "14\n77771114444444",
"output": "NO"
},
{
"input": "14\n44444447777000",
"output": "NO"
},
{
"input": "6\n004774",
"output": "NO"
}
] | 1,479,306,428
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 124
| 0
|
n = int(input())
s = str(input())
a = 0
b = 0
for i, num in enumerate(s):
if num != '7' and num != '4':
print("NO")
a=-1
b=-2
break
else:
if i+1<=n/2:
a+=int(num)
else:
b+=int(num)
else:
if a==b:
print("YES")
else:
print("NO")
|
Title: Lucky Ticket
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya loves tickets very much. As we know, each ticket has a number that is a positive integer. Its length equals *n* (*n* is always even). Petya calls a ticket lucky if the ticket's number is a lucky number and the sum of digits in the first half (the sum of the first *n*<=/<=2 digits) equals the sum of digits in the second half (the sum of the last *n*<=/<=2 digits). Check if the given ticket is lucky.
Input Specification:
The first line contains an even integer *n* (2<=β€<=*n*<=β€<=50) β the length of the ticket number that needs to be checked. The second line contains an integer whose length equals exactly *n* β the ticket number. The number may contain leading zeros.
Output Specification:
On the first line print "YES" if the given ticket number is lucky. Otherwise, print "NO" (without the quotes).
Demo Input:
['2\n47\n', '4\n4738\n', '4\n4774\n']
Demo Output:
['NO\n', 'NO\n', 'YES\n']
Note:
In the first sample the sum of digits in the first half does not equal the sum of digits in the second half (4ββ β7).
In the second sample the ticket number is not the lucky number.
|
```python
n = int(input())
s = str(input())
a = 0
b = 0
for i, num in enumerate(s):
if num != '7' and num != '4':
print("NO")
a=-1
b=-2
break
else:
if i+1<=n/2:
a+=int(num)
else:
b+=int(num)
else:
if a==b:
print("YES")
else:
print("NO")
```
| 3
|
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=Γ<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=β€<=*n*<=β€<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,598,615,103
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 12
| 109
| 0
|
n=int(input())
x=int(n/2)
for i in range(1,n+1):
print("*"*x+'D'*(n-(2*x))+'*'*x)
if i <=int(n/2) :
x-=1
else :
x+=1
# print(x,i)
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=Γ<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=β€<=*n*<=β€<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
n=int(input())
x=int(n/2)
for i in range(1,n+1):
print("*"*x+'D'*(n-(2*x))+'*'*x)
if i <=int(n/2) :
x-=1
else :
x+=1
# print(x,i)
```
| 3
|
|
431
|
A
|
Black Square
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
|
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=β€<=*a*1,<=*a*2,<=*a*3,<=*a*4<=β€<=104).
The second line contains string *s* (1<=β€<=|*s*|<=β€<=105), where the *Ρ*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
|
Print a single integer β the total number of calories that Jury wastes.
|
[
"1 2 3 4\n123214\n",
"1 5 3 2\n11221\n"
] |
[
"13\n",
"13\n"
] |
none
| 500
|
[
{
"input": "1 2 3 4\n123214",
"output": "13"
},
{
"input": "1 5 3 2\n11221",
"output": "13"
},
{
"input": "5 5 5 1\n3422",
"output": "16"
},
{
"input": "4 3 2 1\n2",
"output": "3"
},
{
"input": "5651 6882 6954 4733\n2442313421",
"output": "60055"
},
{
"input": "0 0 0 0\n4132",
"output": "0"
},
{
"input": "3163 5778 83 7640\n11141442444",
"output": "64270"
},
{
"input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442",
"output": "420780"
},
{
"input": "0 0 0 0\n1",
"output": "0"
},
{
"input": "1 2 3 4\n4",
"output": "4"
},
{
"input": "2343 7653 1242 5432\n1",
"output": "2343"
},
{
"input": "2343 7653 1242 5432\n2",
"output": "7653"
},
{
"input": "2343 7653 1242 5432\n3",
"output": "1242"
},
{
"input": "2343 7653 1242 5432\n4",
"output": "5432"
},
{
"input": "1 2 3 4\n123412",
"output": "13"
},
{
"input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111",
"output": "2650"
},
{
"input": "1 2 3 4\n11111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "1 2 3 4\n23123231321231231231231231221232123121312321",
"output": "87"
},
{
"input": "1 2 3 4\n1111111111111222222222233333333333444444444444444",
"output": "126"
},
{
"input": "2 3 1 4\n121321232412342112312313213123123412131231231232",
"output": "105"
}
] | 1,694,442,986
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 62
| 102,400
|
k = list(map(int,input().split()))
s = str(input())
sum = 0
for i in s:
if i == "1":
sum += k[0]
elif i == "2":
sum += k[1]
elif i == "3":
sum += k[2]
elif i == "4":
sum += k[3]
print(sum)
|
Title: Black Square
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
Input Specification:
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=β€<=*a*1,<=*a*2,<=*a*3,<=*a*4<=β€<=104).
The second line contains string *s* (1<=β€<=|*s*|<=β€<=105), where the *Ρ*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Output Specification:
Print a single integer β the total number of calories that Jury wastes.
Demo Input:
['1 2 3 4\n123214\n', '1 5 3 2\n11221\n']
Demo Output:
['13\n', '13\n']
Note:
none
|
```python
k = list(map(int,input().split()))
s = str(input())
sum = 0
for i in s:
if i == "1":
sum += k[0]
elif i == "2":
sum += k[1]
elif i == "3":
sum += k[2]
elif i == "4":
sum += k[3]
print(sum)
```
| 3
|
|
652
|
C
|
Foe Pairs
|
PROGRAMMING
| 1,800
|
[
"combinatorics",
"sortings",
"two pointers"
] | null | null |
You are given a permutation *p* of length *n*. Also you are given *m* foe pairs (*a**i*,<=*b**i*) (1<=β€<=*a**i*,<=*b**i*<=β€<=*n*,<=*a**i*<=β <=*b**i*).
Your task is to count the number of different intervals (*x*,<=*y*) (1<=β€<=*x*<=β€<=*y*<=β€<=*n*) that do not contain any foe pairs. So you shouldn't count intervals (*x*,<=*y*) that contain at least one foe pair in it (the positions and order of the values from the foe pair are not important).
Consider some example: *p*<==<=[1,<=3,<=2,<=4] and foe pairs are {(3,<=2),<=(4,<=2)}. The interval (1,<=3) is incorrect because it contains a foe pair (3,<=2). The interval (1,<=4) is also incorrect because it contains two foe pairs (3,<=2) and (4,<=2). But the interval (1,<=2) is correct because it doesn't contain any foe pair.
|
The first line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=3Β·105) β the length of the permutation *p* and the number of foe pairs.
The second line contains *n* distinct integers *p**i* (1<=β€<=*p**i*<=β€<=*n*) β the elements of the permutation *p*.
Each of the next *m* lines contains two integers (*a**i*,<=*b**i*) (1<=β€<=*a**i*,<=*b**i*<=β€<=*n*,<=*a**i*<=β <=*b**i*) β the *i*-th foe pair. Note a foe pair can appear multiple times in the given list.
|
Print the only integer *c* β the number of different intervals (*x*,<=*y*) that does not contain any foe pairs.
Note that the answer can be too large, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
|
[
"4 2\n1 3 2 4\n3 2\n2 4\n",
"9 5\n9 7 2 3 1 4 6 5 8\n1 6\n4 5\n2 7\n7 2\n2 7\n"
] |
[
"5\n",
"20\n"
] |
In the first example the intervals from the answer are (1,β1), (1,β2), (2,β2), (3,β3) and (4,β4).
| 0
|
[
{
"input": "4 2\n1 3 2 4\n3 2\n2 4",
"output": "5"
},
{
"input": "9 5\n9 7 2 3 1 4 6 5 8\n1 6\n4 5\n2 7\n7 2\n2 7",
"output": "20"
},
{
"input": "2 1\n1 2\n1 2",
"output": "2"
},
{
"input": "10 3\n4 10 5 1 6 8 9 2 3 7\n10 5\n2 10\n4 1",
"output": "39"
},
{
"input": "50 10\n41 15 17 1 5 31 7 38 30 39 43 35 2 26 20 42 48 25 19 32 50 4 8 10 44 12 9 18 13 36 28 6 27 23 40 24 3 14 29 11 49 47 45 46 34 21 37 16 22 33\n13 48\n24 12\n2 32\n36 7\n19 20\n9 45\n35 47\n10 16\n4 49\n46 2",
"output": "608"
},
{
"input": "100 10\n19 55 91 50 31 23 60 84 38 1 22 51 27 76 28 98 11 44 61 63 15 93 52 3 66 16 53 36 18 62 35 85 78 37 73 64 87 74 46 26 82 69 49 33 83 89 56 67 71 25 39 94 96 17 21 6 47 68 34 42 57 81 13 10 54 2 48 80 20 77 4 5 59 30 90 95 45 75 8 88 24 41 40 14 97 32 7 9 65 70 100 99 72 58 92 29 79 12 86 43\n58 26\n10 52\n26 75\n51 9\n49 33\n55 6\n52 62\n82 53\n90 24\n12 7",
"output": "1589"
},
{
"input": "3 8\n1 2 3\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 3\n2 3",
"output": "3"
},
{
"input": "3 4\n1 2 3\n1 3\n1 2\n1 3\n2 3",
"output": "3"
}
] | 1,660,723,345
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 24
| 421
| 65,740,800
|
import sys
if __name__=='__main__':
n,m=map(int,input().split())
line=sys.stdin.readline()
pos={int(v):i for i,v in enumerate(line.split())}
check=[300004]*(n+1)
for line in sys.stdin.readlines():
a,b=map(int,line.split())
if pos[a]>pos[b]:
check[pos[b]]=min(check[pos[b]],pos[a])
else:
check[pos[a]]=min(check[pos[a]],pos[b])
# print(pos)
# print(check)
res,r=0,n
for l in range(n-1,-1,-1):
r=min(r,check[l])
res+=r-l
print(res)
|
Title: Foe Pairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a permutation *p* of length *n*. Also you are given *m* foe pairs (*a**i*,<=*b**i*) (1<=β€<=*a**i*,<=*b**i*<=β€<=*n*,<=*a**i*<=β <=*b**i*).
Your task is to count the number of different intervals (*x*,<=*y*) (1<=β€<=*x*<=β€<=*y*<=β€<=*n*) that do not contain any foe pairs. So you shouldn't count intervals (*x*,<=*y*) that contain at least one foe pair in it (the positions and order of the values from the foe pair are not important).
Consider some example: *p*<==<=[1,<=3,<=2,<=4] and foe pairs are {(3,<=2),<=(4,<=2)}. The interval (1,<=3) is incorrect because it contains a foe pair (3,<=2). The interval (1,<=4) is also incorrect because it contains two foe pairs (3,<=2) and (4,<=2). But the interval (1,<=2) is correct because it doesn't contain any foe pair.
Input Specification:
The first line contains two integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=3Β·105) β the length of the permutation *p* and the number of foe pairs.
The second line contains *n* distinct integers *p**i* (1<=β€<=*p**i*<=β€<=*n*) β the elements of the permutation *p*.
Each of the next *m* lines contains two integers (*a**i*,<=*b**i*) (1<=β€<=*a**i*,<=*b**i*<=β€<=*n*,<=*a**i*<=β <=*b**i*) β the *i*-th foe pair. Note a foe pair can appear multiple times in the given list.
Output Specification:
Print the only integer *c* β the number of different intervals (*x*,<=*y*) that does not contain any foe pairs.
Note that the answer can be too large, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
Demo Input:
['4 2\n1 3 2 4\n3 2\n2 4\n', '9 5\n9 7 2 3 1 4 6 5 8\n1 6\n4 5\n2 7\n7 2\n2 7\n']
Demo Output:
['5\n', '20\n']
Note:
In the first example the intervals from the answer are (1,β1), (1,β2), (2,β2), (3,β3) and (4,β4).
|
```python
import sys
if __name__=='__main__':
n,m=map(int,input().split())
line=sys.stdin.readline()
pos={int(v):i for i,v in enumerate(line.split())}
check=[300004]*(n+1)
for line in sys.stdin.readlines():
a,b=map(int,line.split())
if pos[a]>pos[b]:
check[pos[b]]=min(check[pos[b]],pos[a])
else:
check[pos[a]]=min(check[pos[a]],pos[b])
# print(pos)
# print(check)
res,r=0,n
for l in range(n-1,-1,-1):
r=min(r,check[l])
res+=r-l
print(res)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalizationΒ» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,688,989,558
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
n = int(input(""))
for a in range(0,n):
string = input("")
if len(string)>10:
slice = string[0] + str(len(string)-2) +string[-1]
print(slice)
else:
print(string)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalizationΒ» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
n = int(input(""))
for a in range(0,n):
string = input("")
if len(string)>10:
slice = string[0] + str(len(string)-2) +string[-1]
print(slice)
else:
print(string)
```
| 3.977
|
1,003
|
A
|
Polycarp's Pockets
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
|
The first line of the input contains one integer $n$ ($1 \le n \le 100$) β the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) β values of coins.
|
Print only one integer β the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
|
[
"6\n1 2 4 3 3 2\n",
"1\n100\n"
] |
[
"2\n",
"1\n"
] |
none
| 0
|
[
{
"input": "6\n1 2 4 3 3 2",
"output": "2"
},
{
"input": "1\n100",
"output": "1"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71",
"output": "51"
},
{
"input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29",
"output": "1"
},
{
"input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24",
"output": "2"
},
{
"input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6",
"output": "10"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "99"
},
{
"input": "7\n1 2 3 3 3 1 2",
"output": "3"
},
{
"input": "5\n1 2 3 4 5",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 1 1",
"output": "3"
},
{
"input": "12\n1 2 1 1 1 1 1 1 1 1 1 1",
"output": "11"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "14"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "16"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "10\n1 1 1 1 2 2 1 1 9 10",
"output": "6"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "56"
},
{
"input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92",
"output": "6"
},
{
"input": "10\n1 2 2 3 3 3 4 4 4 4",
"output": "4"
},
{
"input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21",
"output": "3"
},
{
"input": "5\n5 5 5 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 5 2 6",
"output": "3"
},
{
"input": "3\n58 59 58",
"output": "2"
},
{
"input": "9\n1 2 3 4 5 6 7 8 8",
"output": "2"
},
{
"input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "97"
},
{
"input": "3\n95 95 4",
"output": "2"
},
{
"input": "3\n2 2 5",
"output": "2"
}
] | 1,646,633,596
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 46
| 0
|
n= int(input())
a= list(map(int, input().split()))
x= [a.count(i) for i in a]
x.sort()
print(x[n-1])
|
Title: Polycarp's Pockets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 100$) β the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) β values of coins.
Output Specification:
Print only one integer β the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
Demo Input:
['6\n1 2 4 3 3 2\n', '1\n100\n']
Demo Output:
['2\n', '1\n']
Note:
none
|
```python
n= int(input())
a= list(map(int, input().split()))
x= [a.count(i) for i in a]
x.sort()
print(x[n-1])
```
| 3
|
|
632
|
C
|
The Smallest String Concatenation
|
PROGRAMMING
| 1,700
|
[
"sortings",
"strings"
] | null | null |
You're given a list of *n* strings *a*1,<=*a*2,<=...,<=*a**n*. You'd like to concatenate them together in some order such that the resulting string would be lexicographically smallest.
Given the list of strings, output the lexicographically smallest concatenation.
|
The first line contains integer *n* β the number of strings (1<=β€<=*n*<=β€<=5Β·104).
Each of the next *n* lines contains one string *a**i* (1<=β€<=|*a**i*|<=β€<=50) consisting of only lowercase English letters. The sum of string lengths will not exceed 5Β·104.
|
Print the only string *a* β the lexicographically smallest string concatenation.
|
[
"4\nabba\nabacaba\nbcd\ner\n",
"5\nx\nxx\nxxa\nxxaa\nxxaaa\n",
"3\nc\ncb\ncba\n"
] |
[
"abacabaabbabcder\n",
"xxaaaxxaaxxaxxx\n",
"cbacbc\n"
] |
none
| 0
|
[
{
"input": "4\nabba\nabacaba\nbcd\ner",
"output": "abacabaabbabcder"
},
{
"input": "5\nx\nxx\nxxa\nxxaa\nxxaaa",
"output": "xxaaaxxaaxxaxxx"
},
{
"input": "3\nc\ncb\ncba",
"output": "cbacbc"
},
{
"input": "10\naba\nabaaca\naba\nacaaaabbac\nabaacac\nb\ncabbcccaab\nbaacbb\nbcab\ncc",
"output": "abaabaabaacaabaacacacaaaabbacbaacbbbbcabcabbcccaabcc"
},
{
"input": "13\nclgknjjojyuvdtv\nclgknjjojyuvdtvzxz\nclgknjjojyuvdtvzxzxradqhm\ngvzpnckalbaubfviyhijosiixvxaydxagvymq\nclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymt\nbvwzpuut\nclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymth\nclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymtlkdl\nrbwvaayhhunlvmwexvkmqbquypsnjbdkkeytthekttywypud\nqlvkfkshkxyrfefigtngifxsuhpjgkb\nlhxtkfjrrwcvzuamizotupjqckaq\nenngvhxvpaoiyhctddyscasyqtilvbvgfphayykjeoylcvmjz\nxkazwk",
"output": "bvwzpuutclgknjjojyuvdtvclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymtclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymthclgknjjojyuvdtvjgcwarwvgilcctdiytmvmvfxxkezymtlkdlclgknjjojyuvdtvzxzclgknjjojyuvdtvzxzxradqhmenngvhxvpaoiyhctddyscasyqtilvbvgfphayykjeoylcvmjzgvzpnckalbaubfviyhijosiixvxaydxagvymqlhxtkfjrrwcvzuamizotupjqckaqqlvkfkshkxyrfefigtngifxsuhpjgkbrbwvaayhhunlvmwexvkmqbquypsnjbdkkeytthekttywypudxkazwk"
}
] | 1,543,909,120
| 3,880
|
Python 3
|
OK
|
TESTS
| 16
| 280
| 2,150,400
|
from functools import cmp_to_key
def cmp(x,y):
if x+y>y+x:
return 1
else:
return -1
a=[]
n=int(input())
for i in range(n):
a.append(input())
ans=""
for s in sorted(a,key=cmp_to_key(cmp)):
ans+=s
print(ans)
|
Title: The Smallest String Concatenation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You're given a list of *n* strings *a*1,<=*a*2,<=...,<=*a**n*. You'd like to concatenate them together in some order such that the resulting string would be lexicographically smallest.
Given the list of strings, output the lexicographically smallest concatenation.
Input Specification:
The first line contains integer *n* β the number of strings (1<=β€<=*n*<=β€<=5Β·104).
Each of the next *n* lines contains one string *a**i* (1<=β€<=|*a**i*|<=β€<=50) consisting of only lowercase English letters. The sum of string lengths will not exceed 5Β·104.
Output Specification:
Print the only string *a* β the lexicographically smallest string concatenation.
Demo Input:
['4\nabba\nabacaba\nbcd\ner\n', '5\nx\nxx\nxxa\nxxaa\nxxaaa\n', '3\nc\ncb\ncba\n']
Demo Output:
['abacabaabbabcder\n', 'xxaaaxxaaxxaxxx\n', 'cbacbc\n']
Note:
none
|
```python
from functools import cmp_to_key
def cmp(x,y):
if x+y>y+x:
return 1
else:
return -1
a=[]
n=int(input())
for i in range(n):
a.append(input())
ans=""
for s in sorted(a,key=cmp_to_key(cmp)):
ans+=s
print(ans)
```
| 3
|
|
926
|
E
|
Merge Equal Elements
|
PROGRAMMING
| 1,900
|
[
"constructive algorithms",
"data structures"
] | null | null |
You are given a sequence of positive integers *a*1,<=*a*2,<=...,<=*a**n*.
While possible, you perform the following operation: find a pair of equal consecutive elements. If there are more than one such pair, find the leftmost (with the smallest indices of elements). If the two integers are equal to *x*, delete both and insert a single integer *x*<=+<=1 on their place. This way the number of elements in the sequence is decreased by 1 on each step.
You stop performing the operation when there is no pair of equal consecutive elements.
For example, if the initial sequence is [5,<=2,<=1,<=1,<=2,<=2], then after the first operation you get [5,<=2,<=2,<=2,<=2], after the second β [5,<=3,<=2,<=2], after the third β [5,<=3,<=3], and finally after the fourth you get [5,<=4]. After that there are no equal consecutive elements left in the sequence, so you stop the process.
Determine the final sequence after you stop performing the operation.
|
The first line contains a single integer *n* (2<=β€<=*n*<=β€<=2Β·105) β the number of elements in the sequence.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=109).
|
In the first line print a single integer *k* β the number of elements in the sequence after you stop performing the operation.
In the second line print *k* integersΒ β the sequence after you stop performing the operation.
|
[
"6\n5 2 1 1 2 2\n",
"4\n1000000000 1000000000 1000000000 1000000000\n",
"7\n4 10 22 11 12 5 6\n"
] |
[
"2\n5 4 ",
"1\n1000000002 ",
"7\n4 10 22 11 12 5 6 "
] |
The first example is described in the statements.
In the second example the initial sequence is [1000000000,β1000000000,β1000000000,β1000000000]. After the first operation the sequence is equal to [1000000001,β1000000000,β1000000000]. After the second operation the sequence is [1000000001,β1000000001]. After the third operation the sequence is [1000000002].
In the third example there are no two equal consecutive elements initially, so the sequence does not change.
| 0
|
[
{
"input": "6\n5 2 1 1 2 2",
"output": "2\n5 4 "
},
{
"input": "4\n1000000000 1000000000 1000000000 1000000000",
"output": "1\n1000000002 "
},
{
"input": "7\n4 10 22 11 12 5 6",
"output": "7\n4 10 22 11 12 5 6 "
},
{
"input": "2\n1 1",
"output": "1\n2 "
},
{
"input": "3\n2 1 1",
"output": "1\n3 "
},
{
"input": "4\n3 2 1 1",
"output": "1\n4 "
},
{
"input": "7\n5 5 4 4 5 6 7",
"output": "3\n7 6 7 "
}
] | 1,548,090,077
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 75
| 374
| 18,022,400
|
n = int(input())
a = [int(x) for x in input().split()]
stack = []
i = 0
x = a[i]
while True:
if len(stack) == 0:
stack.append(x)
i += 1
if i == n:
break
x = a[i]
else:
if x == stack[-1]:
del stack[-1]
x += 1
else:
stack.append(x)
i += 1
if i == n:
break
x = a[i]
print(len(stack))
print(" ".join([str(x) for x in stack]))
|
Title: Merge Equal Elements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence of positive integers *a*1,<=*a*2,<=...,<=*a**n*.
While possible, you perform the following operation: find a pair of equal consecutive elements. If there are more than one such pair, find the leftmost (with the smallest indices of elements). If the two integers are equal to *x*, delete both and insert a single integer *x*<=+<=1 on their place. This way the number of elements in the sequence is decreased by 1 on each step.
You stop performing the operation when there is no pair of equal consecutive elements.
For example, if the initial sequence is [5,<=2,<=1,<=1,<=2,<=2], then after the first operation you get [5,<=2,<=2,<=2,<=2], after the second β [5,<=3,<=2,<=2], after the third β [5,<=3,<=3], and finally after the fourth you get [5,<=4]. After that there are no equal consecutive elements left in the sequence, so you stop the process.
Determine the final sequence after you stop performing the operation.
Input Specification:
The first line contains a single integer *n* (2<=β€<=*n*<=β€<=2Β·105) β the number of elements in the sequence.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=109).
Output Specification:
In the first line print a single integer *k* β the number of elements in the sequence after you stop performing the operation.
In the second line print *k* integersΒ β the sequence after you stop performing the operation.
Demo Input:
['6\n5 2 1 1 2 2\n', '4\n1000000000 1000000000 1000000000 1000000000\n', '7\n4 10 22 11 12 5 6\n']
Demo Output:
['2\n5 4 ', '1\n1000000002 ', '7\n4 10 22 11 12 5 6 ']
Note:
The first example is described in the statements.
In the second example the initial sequence is [1000000000,β1000000000,β1000000000,β1000000000]. After the first operation the sequence is equal to [1000000001,β1000000000,β1000000000]. After the second operation the sequence is [1000000001,β1000000001]. After the third operation the sequence is [1000000002].
In the third example there are no two equal consecutive elements initially, so the sequence does not change.
|
```python
n = int(input())
a = [int(x) for x in input().split()]
stack = []
i = 0
x = a[i]
while True:
if len(stack) == 0:
stack.append(x)
i += 1
if i == n:
break
x = a[i]
else:
if x == stack[-1]:
del stack[-1]
x += 1
else:
stack.append(x)
i += 1
if i == n:
break
x = a[i]
print(len(stack))
print(" ".join([str(x) for x in stack]))
```
| 3
|
|
330
|
A
|
Cakeminator
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
You are given a rectangular cake, represented as an *r*<=Γ<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=Γ<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
|
The first line contains two integers *r* and *c* (2<=β€<=*r*,<=*c*<=β€<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters β the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
|
Output the maximum number of cake cells that the cakeminator can eat.
|
[
"3 4\nS...\n....\n..S.\n"
] |
[
"8\n"
] |
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
| 500
|
[
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,618,667,790
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 216
| 0
|
n, m = [int(i) for i in input().split()]
mas = [input() for _ in range(n)]
count = 0
for i in range(n-1,-1,-1):
if 'S' not in mas[i]:
count += m
del mas[i]
n -= 1
for j in range(m-1, -1, -1):
flag = False
for i in range(n):
flag += 'S' == mas[i][j]
if not flag:
count += n
print(count)
|
Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=Γ<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=Γ<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=β€<=*r*,<=*c*<=β€<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters β the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
|
```python
n, m = [int(i) for i in input().split()]
mas = [input() for _ in range(n)]
count = 0
for i in range(n-1,-1,-1):
if 'S' not in mas[i]:
count += m
del mas[i]
n -= 1
for j in range(m-1, -1, -1):
flag = False
for i in range(n):
flag += 'S' == mas[i][j]
if not flag:
count += n
print(count)
```
| 3
|
|
987
|
A
|
Infinity Gauntlet
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You took a peek on Thanos wearing Infinity Gauntlet. In the Gauntlet there is a place for six Infinity Gems:
- the Power Gem of purple color, - the Time Gem of green color, - the Space Gem of blue color, - the Soul Gem of orange color, - the Reality Gem of red color, - the Mind Gem of yellow color.
Using colors of Gems you saw in the Gauntlet determine the names of absent Gems.
|
In the first line of input there is one integer $n$ ($0 \le n \le 6$)Β β the number of Gems in Infinity Gauntlet.
In next $n$ lines there are colors of Gems you saw. Words used for colors are: purple, green, blue, orange, red, yellow. It is guaranteed that all the colors are distinct. All colors are given in lowercase English letters.
|
In the first line output one integer $m$ ($0 \le m \le 6$)Β β the number of absent Gems.
Then in $m$ lines print the names of absent Gems, each on its own line. Words used for names are: Power, Time, Space, Soul, Reality, Mind. Names can be printed in any order. Keep the first letter uppercase, others lowercase.
|
[
"4\nred\npurple\nyellow\norange\n",
"0\n"
] |
[
"2\nSpace\nTime\n",
"6\nTime\nMind\nSoul\nPower\nReality\nSpace\n"
] |
In the first sample Thanos already has Reality, Power, Mind and Soul Gems, so he needs two more: Time and Space.
In the second sample Thanos doesn't have any Gems, so he needs all six.
| 500
|
[
{
"input": "4\nred\npurple\nyellow\norange",
"output": "2\nSpace\nTime"
},
{
"input": "0",
"output": "6\nMind\nSpace\nPower\nTime\nReality\nSoul"
},
{
"input": "6\npurple\nblue\nyellow\nred\ngreen\norange",
"output": "0"
},
{
"input": "1\npurple",
"output": "5\nTime\nReality\nSoul\nSpace\nMind"
},
{
"input": "3\nblue\norange\npurple",
"output": "3\nTime\nReality\nMind"
},
{
"input": "2\nyellow\nred",
"output": "4\nPower\nSoul\nSpace\nTime"
},
{
"input": "1\ngreen",
"output": "5\nReality\nSpace\nPower\nSoul\nMind"
},
{
"input": "2\npurple\ngreen",
"output": "4\nReality\nMind\nSpace\nSoul"
},
{
"input": "1\nblue",
"output": "5\nPower\nReality\nSoul\nTime\nMind"
},
{
"input": "2\npurple\nblue",
"output": "4\nMind\nSoul\nTime\nReality"
},
{
"input": "2\ngreen\nblue",
"output": "4\nReality\nMind\nPower\nSoul"
},
{
"input": "3\npurple\ngreen\nblue",
"output": "3\nMind\nReality\nSoul"
},
{
"input": "1\norange",
"output": "5\nReality\nTime\nPower\nSpace\nMind"
},
{
"input": "2\npurple\norange",
"output": "4\nReality\nMind\nTime\nSpace"
},
{
"input": "2\norange\ngreen",
"output": "4\nSpace\nMind\nReality\nPower"
},
{
"input": "3\norange\npurple\ngreen",
"output": "3\nReality\nSpace\nMind"
},
{
"input": "2\norange\nblue",
"output": "4\nTime\nMind\nReality\nPower"
},
{
"input": "3\nblue\ngreen\norange",
"output": "3\nPower\nMind\nReality"
},
{
"input": "4\nblue\norange\ngreen\npurple",
"output": "2\nMind\nReality"
},
{
"input": "1\nred",
"output": "5\nTime\nSoul\nMind\nPower\nSpace"
},
{
"input": "2\nred\npurple",
"output": "4\nMind\nSpace\nTime\nSoul"
},
{
"input": "2\nred\ngreen",
"output": "4\nMind\nSpace\nPower\nSoul"
},
{
"input": "3\nred\npurple\ngreen",
"output": "3\nSoul\nSpace\nMind"
},
{
"input": "2\nblue\nred",
"output": "4\nMind\nTime\nPower\nSoul"
},
{
"input": "3\nred\nblue\npurple",
"output": "3\nTime\nMind\nSoul"
},
{
"input": "3\nred\nblue\ngreen",
"output": "3\nSoul\nPower\nMind"
},
{
"input": "4\npurple\nblue\ngreen\nred",
"output": "2\nMind\nSoul"
},
{
"input": "2\norange\nred",
"output": "4\nPower\nMind\nTime\nSpace"
},
{
"input": "3\nred\norange\npurple",
"output": "3\nMind\nSpace\nTime"
},
{
"input": "3\nred\norange\ngreen",
"output": "3\nMind\nSpace\nPower"
},
{
"input": "4\nred\norange\ngreen\npurple",
"output": "2\nSpace\nMind"
},
{
"input": "3\nblue\norange\nred",
"output": "3\nPower\nMind\nTime"
},
{
"input": "4\norange\nblue\npurple\nred",
"output": "2\nTime\nMind"
},
{
"input": "4\ngreen\norange\nred\nblue",
"output": "2\nMind\nPower"
},
{
"input": "5\npurple\norange\nblue\nred\ngreen",
"output": "1\nMind"
},
{
"input": "1\nyellow",
"output": "5\nPower\nSoul\nReality\nSpace\nTime"
},
{
"input": "2\npurple\nyellow",
"output": "4\nTime\nReality\nSpace\nSoul"
},
{
"input": "2\ngreen\nyellow",
"output": "4\nSpace\nReality\nPower\nSoul"
},
{
"input": "3\npurple\nyellow\ngreen",
"output": "3\nSoul\nReality\nSpace"
},
{
"input": "2\nblue\nyellow",
"output": "4\nTime\nReality\nPower\nSoul"
},
{
"input": "3\nyellow\nblue\npurple",
"output": "3\nSoul\nReality\nTime"
},
{
"input": "3\ngreen\nyellow\nblue",
"output": "3\nSoul\nReality\nPower"
},
{
"input": "4\nyellow\nblue\ngreen\npurple",
"output": "2\nReality\nSoul"
},
{
"input": "2\nyellow\norange",
"output": "4\nTime\nSpace\nReality\nPower"
},
{
"input": "3\nyellow\npurple\norange",
"output": "3\nSpace\nReality\nTime"
},
{
"input": "3\norange\nyellow\ngreen",
"output": "3\nSpace\nReality\nPower"
},
{
"input": "4\ngreen\nyellow\norange\npurple",
"output": "2\nSpace\nReality"
},
{
"input": "3\nyellow\nblue\norange",
"output": "3\nTime\nReality\nPower"
},
{
"input": "4\norange\npurple\nblue\nyellow",
"output": "2\nReality\nTime"
},
{
"input": "4\nblue\norange\nyellow\ngreen",
"output": "2\nReality\nPower"
},
{
"input": "5\ngreen\nyellow\norange\nblue\npurple",
"output": "1\nReality"
},
{
"input": "3\nyellow\npurple\nred",
"output": "3\nTime\nSoul\nSpace"
},
{
"input": "3\nred\ngreen\nyellow",
"output": "3\nPower\nSoul\nSpace"
},
{
"input": "4\nred\npurple\ngreen\nyellow",
"output": "2\nSpace\nSoul"
},
{
"input": "3\nred\nyellow\nblue",
"output": "3\nPower\nSoul\nTime"
},
{
"input": "4\nblue\nyellow\nred\npurple",
"output": "2\nTime\nSoul"
},
{
"input": "4\nblue\nyellow\nred\ngreen",
"output": "2\nSoul\nPower"
},
{
"input": "5\nred\nyellow\ngreen\nblue\npurple",
"output": "1\nSoul"
},
{
"input": "3\nred\nyellow\norange",
"output": "3\nPower\nSpace\nTime"
},
{
"input": "4\norange\ngreen\nyellow\nred",
"output": "2\nPower\nSpace"
},
{
"input": "5\norange\nred\ngreen\nyellow\npurple",
"output": "1\nSpace"
},
{
"input": "4\nyellow\nred\norange\nblue",
"output": "2\nTime\nPower"
},
{
"input": "5\npurple\nblue\norange\nyellow\nred",
"output": "1\nTime"
},
{
"input": "5\norange\nblue\nyellow\nred\ngreen",
"output": "1\nPower"
}
] | 1,654,885,280
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 64
| 46
| 0
|
dict1={"purple":"Power", "green":"Time", "blue":"Space", "orange":"Soul", "red":"Reality", "yellow":"Mind"}
n=int(input())
n_list=[]
print(6-n)
for i in range(n):
g=input()
n_list.append(g)
for k,v in dict1.items():
if k not in n_list:
print(v)
|
Title: Infinity Gauntlet
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You took a peek on Thanos wearing Infinity Gauntlet. In the Gauntlet there is a place for six Infinity Gems:
- the Power Gem of purple color, - the Time Gem of green color, - the Space Gem of blue color, - the Soul Gem of orange color, - the Reality Gem of red color, - the Mind Gem of yellow color.
Using colors of Gems you saw in the Gauntlet determine the names of absent Gems.
Input Specification:
In the first line of input there is one integer $n$ ($0 \le n \le 6$)Β β the number of Gems in Infinity Gauntlet.
In next $n$ lines there are colors of Gems you saw. Words used for colors are: purple, green, blue, orange, red, yellow. It is guaranteed that all the colors are distinct. All colors are given in lowercase English letters.
Output Specification:
In the first line output one integer $m$ ($0 \le m \le 6$)Β β the number of absent Gems.
Then in $m$ lines print the names of absent Gems, each on its own line. Words used for names are: Power, Time, Space, Soul, Reality, Mind. Names can be printed in any order. Keep the first letter uppercase, others lowercase.
Demo Input:
['4\nred\npurple\nyellow\norange\n', '0\n']
Demo Output:
['2\nSpace\nTime\n', '6\nTime\nMind\nSoul\nPower\nReality\nSpace\n']
Note:
In the first sample Thanos already has Reality, Power, Mind and Soul Gems, so he needs two more: Time and Space.
In the second sample Thanos doesn't have any Gems, so he needs all six.
|
```python
dict1={"purple":"Power", "green":"Time", "blue":"Space", "orange":"Soul", "red":"Reality", "yellow":"Mind"}
n=int(input())
n_list=[]
print(6-n)
for i in range(n):
g=input()
n_list.append(g)
for k,v in dict1.items():
if k not in n_list:
print(v)
```
| 3
|
|
279
|
B
|
Books
|
PROGRAMMING
| 1,400
|
[
"binary search",
"brute force",
"implementation",
"two pointers"
] | null | null |
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
|
The first line contains two integers *n* and *t* (1<=β€<=*n*<=β€<=105;Β 1<=β€<=*t*<=β€<=109) β the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
|
Print a single integer β the maximum number of books Valera can read.
|
[
"4 5\n3 1 2 1\n",
"3 3\n2 2 3\n"
] |
[
"3\n",
"1\n"
] |
none
| 1,000
|
[
{
"input": "4 5\n3 1 2 1",
"output": "3"
},
{
"input": "3 3\n2 2 3",
"output": "1"
},
{
"input": "1 3\n5",
"output": "0"
},
{
"input": "1 10\n4",
"output": "1"
},
{
"input": "2 10\n6 4",
"output": "2"
},
{
"input": "6 10\n2 3 4 2 1 1",
"output": "4"
},
{
"input": "7 13\n6 8 14 9 4 11 10",
"output": "2"
},
{
"input": "10 15\n10 9 1 1 5 10 5 3 7 2",
"output": "3"
},
{
"input": "20 30\n8 1 2 6 9 4 1 9 9 10 4 7 8 9 5 7 1 8 7 4",
"output": "6"
},
{
"input": "30 60\n16 13 22 38 13 35 17 17 20 38 12 19 9 22 20 3 35 34 34 21 35 40 22 3 27 19 12 4 8 19",
"output": "4"
},
{
"input": "100 100\n75 92 18 6 81 67 7 92 100 65 82 32 50 67 85 31 80 91 84 63 39 52 92 81 1 98 24 12 43 48 17 86 51 72 48 95 45 50 12 66 19 79 49 89 34 1 97 75 20 33 96 27 42 23 73 71 93 1 85 19 66 14 17 61 20 39 36 33 42 61 56 64 23 91 80 99 40 74 13 18 98 85 74 39 62 84 46 74 50 23 38 11 79 14 9 25 66 100 25 52",
"output": "3"
},
{
"input": "10 1\n4418 7528 8170 1736 1317 3205 8183 4995 8039 4708",
"output": "0"
},
{
"input": "50 2\n124 214 63 73 996 760 38 571 451 300 970 1 706 937 837 494 619 88 851 411 957 990 842 613 821 649 627 34 693 678 734 116 816 985 705 940 499 493 922 967 854 439 112 644 961 438 189 572 655 550",
"output": "1"
}
] | 1,687,020,706
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 186
| 13,824,000
|
p=lambda:list(map(int,input().split()))
n,t=p()
l=p()
i=j=s=0
for j in range(n):
s+=l[j]
if s>t:
s-=l[i]
i+=1
print(n-i)
|
Title: Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
Input Specification:
The first line contains two integers *n* and *t* (1<=β€<=*n*<=β€<=105;Β 1<=β€<=*t*<=β€<=109) β the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
Output Specification:
Print a single integer β the maximum number of books Valera can read.
Demo Input:
['4 5\n3 1 2 1\n', '3 3\n2 2 3\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
p=lambda:list(map(int,input().split()))
n,t=p()
l=p()
i=j=s=0
for j in range(n):
s+=l[j]
if s>t:
s-=l[i]
i+=1
print(n-i)
```
| 3
|
|
474
|
A
|
Keyboard
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Our good friend Mole is trying to code a big message. He is typing on an unusual keyboard with characters arranged in following way:
Unfortunately Mole is blind, so sometimes it is problem for him to put his hands accurately. He accidentally moved both his hands with one position to the left or to the right. That means that now he presses not a button he wants, but one neighboring button (left or right, as specified in input).
We have a sequence of characters he has typed and we want to find the original message.
|
First line of the input contains one letter describing direction of shifting ('L' or 'R' respectively for left or right).
Second line contains a sequence of characters written by Mole. The size of this sequence will be no more than 100. Sequence contains only symbols that appear on Mole's keyboard. It doesn't contain spaces as there is no space on Mole's keyboard.
It is guaranteed that even though Mole hands are moved, he is still pressing buttons on keyboard and not hitting outside it.
|
Print a line that contains the original message.
|
[
"R\ns;;upimrrfod;pbr\n"
] |
[
"allyouneedislove\n"
] |
none
| 500
|
[
{
"input": "R\ns;;upimrrfod;pbr",
"output": "allyouneedislove"
},
{
"input": "R\nwertyuiop;lkjhgfdsxcvbnm,.",
"output": "qwertyuiolkjhgfdsazxcvbnm,"
},
{
"input": "L\nzxcvbnm,kjhgfdsaqwertyuio",
"output": "xcvbnm,.lkjhgfdswertyuiop"
},
{
"input": "R\nbubbuduppudup",
"output": "vyvvysyooysyo"
},
{
"input": "L\ngggggggggggggggggggggggggggggggggggggggggg",
"output": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh"
},
{
"input": "R\ngggggggggggggggggggggggggggggggggggggggggg",
"output": "ffffffffffffffffffffffffffffffffffffffffff"
},
{
"input": "L\nggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh"
},
{
"input": "R\nggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff"
},
{
"input": "L\nxgwurenkxkiau,c,vonei.zltazmnkhqtwuogkgvgckvja,z.rhanuy.ybebmzcfwozkwvuuiolaqlgvvvewnbuinrncgjwjdsfw",
"output": "cheitrmlclosi.v.bpmro/x;ysx,mljwyeiphlhbhvlbks.x/tjsmiu/unrn,xvgepxlebiiop;sw;hbbbremniomtmvhkekfdge"
},
{
"input": "L\nuoz.vmks,wxrb,nwcvdzh.m,hwsios.lvu,ktes,,ythddhm.sh,d,c,cfj.wqam,bowofbyx,jathqayhreqvixvbmgdokofmym",
"output": "ipx/b,ld.ectn.mevbfxj/,.jedopd/;bi.lyrd..uyjffj,/dj.f.v.vgk/ews,.npepgnuc.ksyjwsujtrwbocbn,hfplpg,u,"
},
{
"input": "R\noedjyrvuw/rn.v.hdwndbiposiewgsn.pnyf;/tsdohp,hrtd/mx,;coj./billd..mwbneohcikrdes/ucjr,wspthleyp,..f,",
"output": "iwshtecyq.eb,c,gsqbsvuoiauwqfab,obtdl.rasigomgers.nzmlxih,.vukks,,nqvbwigxujeswa.yxhemqaorgkwtom,,dm"
},
{
"input": "R\nvgj;o;ijrtfyck,dthccioltcx,crub;oceooognsuvfx/kgo.fbsudv,yod.erdrxhbeiyltxhnrobbb;ydrgroefcr/f;uvdjd",
"output": "cfhliluherdtxjmsrgxxuikrxzmxeyvlixwiiifbaycdz.jfi,dvayscmtis,wesezgvwutkrzgbeivvvltsefeiwdxe.dlycshs"
},
{
"input": "L\nqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq",
"output": "wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww"
},
{
"input": "L\noooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo",
"output": "pppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppp"
},
{
"input": "L\n,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,",
"output": "...................................................................................................."
},
{
"input": "L\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx"
},
{
"input": "R\noooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo",
"output": "iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii"
},
{
"input": "R\nwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww",
"output": "qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq"
},
{
"input": "R\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz"
},
{
"input": "L\nq",
"output": "w"
},
{
"input": "L\no",
"output": "p"
},
{
"input": "L\n,",
"output": "."
},
{
"input": "L\nz",
"output": "x"
},
{
"input": "R\n.",
"output": ","
},
{
"input": "R\no",
"output": "i"
},
{
"input": "R\nw",
"output": "q"
},
{
"input": "R\nx",
"output": "z"
},
{
"input": "R\n,./",
"output": "m,."
},
{
"input": "R\nwertuk;;/",
"output": "qweryjll."
},
{
"input": "L\n..",
"output": "//"
}
] | 1,680,827,767
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 46
| 0
|
a = input()
b = list(input())
key = list("qwertyuiopasdfghjkl;zxcvbnm,./")
if a =="L":
d=1
else:
d=-1
n=[]
for i in range(len(b)):
e = b[i]
f = key.index(e)
n.append(key[f+d])
print(''.join(n))
|
Title: Keyboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Our good friend Mole is trying to code a big message. He is typing on an unusual keyboard with characters arranged in following way:
Unfortunately Mole is blind, so sometimes it is problem for him to put his hands accurately. He accidentally moved both his hands with one position to the left or to the right. That means that now he presses not a button he wants, but one neighboring button (left or right, as specified in input).
We have a sequence of characters he has typed and we want to find the original message.
Input Specification:
First line of the input contains one letter describing direction of shifting ('L' or 'R' respectively for left or right).
Second line contains a sequence of characters written by Mole. The size of this sequence will be no more than 100. Sequence contains only symbols that appear on Mole's keyboard. It doesn't contain spaces as there is no space on Mole's keyboard.
It is guaranteed that even though Mole hands are moved, he is still pressing buttons on keyboard and not hitting outside it.
Output Specification:
Print a line that contains the original message.
Demo Input:
['R\ns;;upimrrfod;pbr\n']
Demo Output:
['allyouneedislove\n']
Note:
none
|
```python
a = input()
b = list(input())
key = list("qwertyuiopasdfghjkl;zxcvbnm,./")
if a =="L":
d=1
else:
d=-1
n=[]
for i in range(len(b)):
e = b[i]
f = key.index(e)
n.append(key[f+d])
print(''.join(n))
```
| 3
|
|
760
|
A
|
Petr and a calendar
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
|
The only line contain two integers *m* and *d* (1<=β€<=*m*<=β€<=12, 1<=β€<=*d*<=β€<=7)Β β the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
|
Print single integer: the number of columns the table should have.
|
[
"1 7\n",
"1 1\n",
"11 6\n"
] |
[
"6\n",
"5\n",
"5\n"
] |
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
| 500
|
[
{
"input": "1 7",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "1 2",
"output": "5"
},
{
"input": "1 3",
"output": "5"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "6"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "2 4",
"output": "5"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "3 1",
"output": "5"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "5"
},
{
"input": "3 4",
"output": "5"
},
{
"input": "3 5",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "3 7",
"output": "6"
},
{
"input": "4 1",
"output": "5"
},
{
"input": "4 2",
"output": "5"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "4 5",
"output": "5"
},
{
"input": "4 6",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "5"
},
{
"input": "5 3",
"output": "5"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "5 5",
"output": "5"
},
{
"input": "5 6",
"output": "6"
},
{
"input": "5 7",
"output": "6"
},
{
"input": "6 1",
"output": "5"
},
{
"input": "6 2",
"output": "5"
},
{
"input": "6 3",
"output": "5"
},
{
"input": "6 4",
"output": "5"
},
{
"input": "6 5",
"output": "5"
},
{
"input": "6 6",
"output": "5"
},
{
"input": "6 7",
"output": "6"
},
{
"input": "7 1",
"output": "5"
},
{
"input": "7 2",
"output": "5"
},
{
"input": "7 3",
"output": "5"
},
{
"input": "7 4",
"output": "5"
},
{
"input": "7 5",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "8 1",
"output": "5"
},
{
"input": "8 2",
"output": "5"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "5"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "8 7",
"output": "6"
},
{
"input": "9 1",
"output": "5"
},
{
"input": "9 2",
"output": "5"
},
{
"input": "9 3",
"output": "5"
},
{
"input": "9 4",
"output": "5"
},
{
"input": "9 5",
"output": "5"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "10 1",
"output": "5"
},
{
"input": "10 2",
"output": "5"
},
{
"input": "10 3",
"output": "5"
},
{
"input": "10 4",
"output": "5"
},
{
"input": "10 5",
"output": "5"
},
{
"input": "10 6",
"output": "6"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "11 1",
"output": "5"
},
{
"input": "11 2",
"output": "5"
},
{
"input": "11 3",
"output": "5"
},
{
"input": "11 4",
"output": "5"
},
{
"input": "11 5",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "12 1",
"output": "5"
},
{
"input": "12 2",
"output": "5"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "12 4",
"output": "5"
},
{
"input": "12 5",
"output": "5"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 7",
"output": "6"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "6 6",
"output": "5"
}
] | 1,594,001,788
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 104
| 108
| 6,758,400
|
import math
m, d = map(int, input().split())
a = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
print(math.ceil((a[m-1]+d-1)/7))
|
Title: Petr and a calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
Input Specification:
The only line contain two integers *m* and *d* (1<=β€<=*m*<=β€<=12, 1<=β€<=*d*<=β€<=7)Β β the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
Output Specification:
Print single integer: the number of columns the table should have.
Demo Input:
['1 7\n', '1 1\n', '11 6\n']
Demo Output:
['6\n', '5\n', '5\n']
Note:
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
|
```python
import math
m, d = map(int, input().split())
a = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
print(math.ceil((a[m-1]+d-1)/7))
```
| 3
|
|
733
|
A
|
Grasshopper And the String
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
|
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
|
Print single integer *a*Β β the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
|
[
"ABABBBACFEYUKOTT\n",
"AAA\n"
] |
[
"4",
"1"
] |
none
| 500
|
[
{
"input": "ABABBBACFEYUKOTT",
"output": "4"
},
{
"input": "AAA",
"output": "1"
},
{
"input": "A",
"output": "1"
},
{
"input": "B",
"output": "2"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIKLMJNHGTRWSDZXCVBNMHGFDSXVWRTPPPLKMNBXIUOIUOIUOIUOOIU",
"output": "39"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIAEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOI",
"output": "1"
},
{
"input": "KMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVCKMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVC",
"output": "85"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZ",
"output": "18"
},
{
"input": "PKLKBWTXVJ",
"output": "11"
},
{
"input": "CFHFPTGMOKXVLJJZJDQW",
"output": "12"
},
{
"input": "TXULTFSBUBFLRNQORMMULWNVLPWTYJXZBPBGAWNX",
"output": "9"
},
{
"input": "DAIUSEAUEUYUWEIOOEIOUYVYYOPEEWEBZOOOAOXUOIEUKYYOJOYAUYUUIYUXOUJLGIYEIIYUOCUAACRY",
"output": "4"
},
{
"input": "VRPHBNWNWVWBWMFJJDCTJQJDJBKSJRZLVQRVVFLTZFSGCGDXCWQVWWWMFVCQHPKXXVRKTGWGPSMQTPKNDQJHNSKLXPCXDJDQDZZD",
"output": "101"
},
{
"input": "SGDDFCDRDWGPNNFBBZZJSPXFYMZKPRXTCHVJSJJBWZXXQMDZBNKDHRGSRLGLRKPMWXNSXJPNJLDPXBSRCQMHJKPZNTPNTZXNPCJC",
"output": "76"
},
{
"input": "NVTQVNLGWFDBCBKSDLTBGWBMNQZWZQJWNGVCTCQBGWNTYJRDBPZJHXCXFMIXNRGSTXHQPCHNFQPCMDZWJGLJZWMRRFCVLBKDTDSC",
"output": "45"
},
{
"input": "SREZXQFVPQCLRCQGMKXCBRWKYZKWKRMZGXPMKWNMFZTRDPHJFCSXVPPXWKZMZTBFXGNLPLHZIPLFXNRRQFDTLFPKBGCXKTMCFKKT",
"output": "48"
},
{
"input": "ICKJKMVPDNZPLKDSLTPZNRLSQSGHQJQQPJJSNHNWVDLJRLZEJSXZDPHYXGGWXHLCTVQSKWNWGTLJMOZVJNZPVXGVPJKHFVZTGCCX",
"output": "47"
},
{
"input": "XXFPZDRPXLNHGDVCBDKJMKLGUQZXLLWYLOKFZVGXVNPJWZZZNRMQBRJCZTSDRHSNCVDMHKVXCXPCRBWSJCJWDRDPVZZLCZRTDRYA",
"output": "65"
},
{
"input": "HDDRZDKCHHHEDKHZMXQSNQGSGNNSCCPVJFGXGNCEKJMRKSGKAPQWPCWXXWHLSMRGSJWEHWQCSJJSGLQJXGVTBYALWMLKTTJMFPFS",
"output": "28"
},
{
"input": "PXVKJHXVDPWGLHWFWMJPMCCNHCKSHCPZXGIHHNMYNFQBUCKJJTXXJGKRNVRTQFDFMLLGPQKFOVNNLTNDIEXSARRJKGSCZKGGJCBW",
"output": "35"
},
{
"input": "EXNMTTFPJLDHXDQBJJRDRYBZVFFHUDCHCPNFZWXSMZXNFVJGHZWXVBRQFNUIDVLZOVPXQNVMFNBTJDSCKRLNGXPSADTGCAHCBJKL",
"output": "30"
},
{
"input": "NRNLSQQJGIJBCZFTNKJCXMGPARGWXPSHZXOBNSFOLDQVXTVAGJZNLXULHBRDGMNQKQGWMRRDPYCSNFVPUFTFBUBRXVJGNGSPJKLL",
"output": "19"
},
{
"input": "SRHOKCHQQMVZKTCVQXJJCFGYFXGMBZSZFNAFETXILZHPGHBWZRZQFMGSEYRUDVMCIQTXTBTSGFTHRRNGNTHHWWHCTDFHSVARMCMB",
"output": "30"
},
{
"input": "HBSVZHDKGNIRQUBYKYHUPJCEETGFMVBZJTHYHFQPFBVBSMQACYAVWZXSBGNKWXFNMQJFMSCHJVWBZXZGSNBRUHTHAJKVLEXFBOFB",
"output": "34"
},
{
"input": "NXKMUGOPTUQNSRYTKUKSCWCRQSZKKFPYUMDIBJAHJCEKZJVWZAWOLOEFBFXLQDDPNNZKCQHUPBFVDSXSUCVLMZXQROYQYIKPQPWR",
"output": "17"
},
{
"input": "TEHJDICFNOLQVQOAREVAGUAWODOCXJXIHYXFAEPEXRHPKEIIRCRIVASKNTVYUYDMUQKSTSSBYCDVZKDDHTSDWJWACPCLYYOXGCLT",
"output": "15"
},
{
"input": "LCJJUZZFEIUTMSEXEYNOOAIZMORQDOANAMUCYTFRARDCYHOYOPHGGYUNOGNXUAOYSEMXAZOOOFAVHQUBRNGORSPNQWZJYQQUNPEB",
"output": "9"
},
{
"input": "UUOKAOOJBXUTSMOLOOOOSUYYFTAVBNUXYFVOOGCGZYQEOYISIYOUULUAIJUYVVOENJDOCLHOSOHIHDEJOIGZNIXEMEGZACHUAQFW",
"output": "5"
},
{
"input": "OUUBEHXOOURMOAIAEHXCUOIYHUJEVAWYRCIIAGDRIPUIPAIUYAIWJEVYEYYUYBYOGVYESUJCFOJNUAHIOOKBUUHEJFEWPOEOUHYA",
"output": "4"
},
{
"input": "EMNOYEEUIOUHEWZITIAEZNCJUOUAOQEAUYEIHYUSUYUUUIAEDIOOERAEIRBOJIEVOMECOGAIAIUIYYUWYIHIOWVIJEYUEAFYULSE",
"output": "5"
},
{
"input": "BVOYEAYOIEYOREJUYEUOEOYIISYAEOUYAAOIOEOYOOOIEFUAEAAESUOOIIEUAAGAEISIAPYAHOOEYUJHUECGOYEIDAIRTBHOYOYA",
"output": "5"
},
{
"input": "GOIEOAYIEYYOOEOAIAEOOUWYEIOTNYAANAYOOXEEOEAVIOIAAIEOIAUIAIAAUEUAOIAEUOUUZYIYAIEUEGOOOOUEIYAEOSYAEYIO",
"output": "3"
},
{
"input": "AUEAOAYIAOYYIUIOAULIOEUEYAIEYYIUOEOEIEYRIYAYEYAEIIMMAAEAYAAAAEOUICAUAYOUIAOUIAIUOYEOEEYAEYEYAAEAOYIY",
"output": "3"
},
{
"input": "OAIIYEYYAOOEIUOEEIOUOIAEFIOAYETUYIOAAAEYYOYEYOEAUIIUEYAYYIIAOIEEYGYIEAAOOWYAIEYYYIAOUUOAIAYAYYOEUEOY",
"output": "2"
},
{
"input": "EEEAOEOEEIOUUUEUEAAOEOIUYJEYAIYIEIYYEAUOIIYIUOOEUCYEOOOYYYIUUAYIAOEUEIEAOUOIAACAOOUAUIYYEAAAOOUYIAAE",
"output": "2"
},
{
"input": "AYEYIIEUIYOYAYEUEIIIEUYUUAUEUIYAIAAUYONIEYIUIAEUUOUOYYOUUUIUIAEYEOUIIUOUUEOAIUUYAAEOAAEOYUUIYAYRAIII",
"output": "2"
},
{
"input": "YOOAAUUAAAYEUYIUIUYIUOUAEIEEIAUEOAUIIAAIUYEUUOYUIYEAYAAAYUEEOEEAEOEEYYOUAEUYEEAIIYEUEYJOIIYUIOIUOIEE",
"output": "2"
},
{
"input": "UYOIIIAYOOAIUUOOEEUYIOUAEOOEIOUIAIEYOAEAIOOEOOOIUYYUYIAAUIOUYYOOUAUIEYYUOAAUUEAAIEUIAUEUUIAUUOYOAYIU",
"output": "1"
},
{
"input": "ABBABBB",
"output": "4"
},
{
"input": "ABCD",
"output": "4"
},
{
"input": "XXYC",
"output": "3"
},
{
"input": "YYY",
"output": "1"
},
{
"input": "ABABBBBBBB",
"output": "8"
},
{
"input": "YYYY",
"output": "1"
},
{
"input": "YYYYY",
"output": "1"
},
{
"input": "AXXX",
"output": "4"
},
{
"input": "YYYYYYY",
"output": "1"
},
{
"input": "BYYBBB",
"output": "4"
},
{
"input": "YYYYYYYYY",
"output": "1"
},
{
"input": "CAAAAA",
"output": "2"
},
{
"input": "CCCACCCC",
"output": "5"
},
{
"input": "ABABBBACFEYUKOTTTT",
"output": "5"
},
{
"input": "AABBYYYYYYYY",
"output": "3"
},
{
"input": "BYBACYC",
"output": "2"
},
{
"input": "Y",
"output": "1"
},
{
"input": "ABBBBBB",
"output": "7"
},
{
"input": "BACDYDI",
"output": "3"
},
{
"input": "XEXXXXXXXXXXXXXXX",
"output": "16"
},
{
"input": "TTYTT",
"output": "3"
},
{
"input": "AAYBC",
"output": "3"
},
{
"input": "ABABBBACFEYUKOTTTTT",
"output": "6"
},
{
"input": "YYAYY",
"output": "1"
},
{
"input": "YZZY",
"output": "3"
},
{
"input": "YY",
"output": "1"
},
{
"input": "ZZYZZ",
"output": "3"
},
{
"input": "YBBBY",
"output": "4"
},
{
"input": "BBBACCCCCCC",
"output": "8"
},
{
"input": "YBBBBY",
"output": "5"
},
{
"input": "YYYYYYYYYY",
"output": "1"
},
{
"input": "ABABBBBBBBBBBBB",
"output": "13"
}
] | 1,585,643,922
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 70
| 156
| 0
|
l=['A','U','O','I','E','Y']
s=input()
c=0
m=0
for i in s:
if(i in l):
m=max(m,c)
c=0
else:
c=c+1
m=max(c,m)
print(m+1)
|
Title: Grasshopper And the String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
Input Specification:
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
Output Specification:
Print single integer *a*Β β the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
Demo Input:
['ABABBBACFEYUKOTT\n', 'AAA\n']
Demo Output:
['4', '1']
Note:
none
|
```python
l=['A','U','O','I','E','Y']
s=input()
c=0
m=0
for i in s:
if(i in l):
m=max(m,c)
c=0
else:
c=c+1
m=max(c,m)
print(m+1)
```
| 3
|
|
955
|
B
|
Not simply beatiful strings
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Let's call a string adorable if its letters can be realigned in such a way that they form two consequent groups of equal symbols (note that different groups must contain different symbols). For example, ababa is adorable (you can transform it to aaabb, where the first three letters form a group of *a*-s and others β a group of *b*-s), but cccc is not since in each possible consequent partition letters in these two groups coincide.
You're given a string *s*. Check whether it can be split into two non-empty subsequences such that the strings formed by these subsequences are adorable. Here a subsequence is an arbitrary set of indexes of the string.
|
The only line contains *s* (1<=β€<=|*s*|<=β€<=105) consisting of lowercase latin letters.
|
Print Β«YesΒ» if the string can be split according to the criteria above or Β«NoΒ» otherwise.
Each letter can be printed in arbitrary case.
|
[
"ababa\n",
"zzcxx\n",
"yeee\n"
] |
[
"Yes\n",
"Yes\n",
"No\n"
] |
In sample case two zzcxx can be split into subsequences zc and zxx each of which is adorable.
There's no suitable partition in sample case three.
| 1,000
|
[
{
"input": "ababa",
"output": "Yes"
},
{
"input": "zzcxx",
"output": "Yes"
},
{
"input": "yeee",
"output": "No"
},
{
"input": "a",
"output": "No"
},
{
"input": "bbab",
"output": "No"
},
{
"input": "abcd",
"output": "Yes"
},
{
"input": "abc",
"output": "No"
},
{
"input": "abcdaaaa",
"output": "Yes"
},
{
"input": "aaaaaaaaaaaaaaa",
"output": "No"
},
{
"input": "adb",
"output": "No"
},
{
"input": "dcccbad",
"output": "Yes"
},
{
"input": "bcbccccccca",
"output": "Yes"
},
{
"input": "abcdefgh",
"output": "No"
},
{
"input": "aabcdef",
"output": "No"
},
{
"input": "aabc",
"output": "Yes"
},
{
"input": "ssab",
"output": "Yes"
},
{
"input": "ccdd",
"output": "Yes"
},
{
"input": "abcc",
"output": "Yes"
},
{
"input": "ab",
"output": "No"
},
{
"input": "abcde",
"output": "No"
},
{
"input": "aa",
"output": "No"
},
{
"input": "aaabbb",
"output": "Yes"
},
{
"input": "bbbba",
"output": "No"
},
{
"input": "abbbc",
"output": "Yes"
},
{
"input": "baabaa",
"output": "Yes"
},
{
"input": "abacabadde",
"output": "No"
},
{
"input": "aabbcc",
"output": "Yes"
},
{
"input": "abbc",
"output": "Yes"
},
{
"input": "aaaaaaabbbbbbcder",
"output": "No"
},
{
"input": "aabb",
"output": "Yes"
},
{
"input": "aabbccddee",
"output": "No"
},
{
"input": "abca",
"output": "Yes"
},
{
"input": "aaabbbccc",
"output": "Yes"
}
] | 1,521,823,735
| 835
|
Python 3
|
OK
|
TESTS
| 56
| 155
| 7,270,400
|
s = input()
l = list(set(s))
ans = 1
if (len(l)>4) or (len(l)<=1):
ans = 0
else:
if len(l)==2:
c1=0
c0=0
for i in range(len(s)):
if s[i]==l[0]:
c0+=1
else:
c1+=1
if (c1<2) or (c0<2):
ans = 0
if (len(l)==3):
c1 = 0
c2 = 0
c0 = 0
for i in range(len(s)):
if s[i]==l[0]:
c0+=1
if s[i]==l[1]:
c1+=1
if s[i]==l[2]:
c2+=1
if (c1+c2+c0)<4:
ans = 0
if (ans==0):
print('No')
else:
print('Yes')
|
Title: Not simply beatiful strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's call a string adorable if its letters can be realigned in such a way that they form two consequent groups of equal symbols (note that different groups must contain different symbols). For example, ababa is adorable (you can transform it to aaabb, where the first three letters form a group of *a*-s and others β a group of *b*-s), but cccc is not since in each possible consequent partition letters in these two groups coincide.
You're given a string *s*. Check whether it can be split into two non-empty subsequences such that the strings formed by these subsequences are adorable. Here a subsequence is an arbitrary set of indexes of the string.
Input Specification:
The only line contains *s* (1<=β€<=|*s*|<=β€<=105) consisting of lowercase latin letters.
Output Specification:
Print Β«YesΒ» if the string can be split according to the criteria above or Β«NoΒ» otherwise.
Each letter can be printed in arbitrary case.
Demo Input:
['ababa\n', 'zzcxx\n', 'yeee\n']
Demo Output:
['Yes\n', 'Yes\n', 'No\n']
Note:
In sample case two zzcxx can be split into subsequences zc and zxx each of which is adorable.
There's no suitable partition in sample case three.
|
```python
s = input()
l = list(set(s))
ans = 1
if (len(l)>4) or (len(l)<=1):
ans = 0
else:
if len(l)==2:
c1=0
c0=0
for i in range(len(s)):
if s[i]==l[0]:
c0+=1
else:
c1+=1
if (c1<2) or (c0<2):
ans = 0
if (len(l)==3):
c1 = 0
c2 = 0
c0 = 0
for i in range(len(s)):
if s[i]==l[0]:
c0+=1
if s[i]==l[1]:
c1+=1
if s[i]==l[2]:
c2+=1
if (c1+c2+c0)<4:
ans = 0
if (ans==0):
print('No')
else:
print('Yes')
```
| 3
|
|
835
|
A
|
Key races
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
|
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=β€<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=β€<=1000)Β β the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
|
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
|
[
"5 1 2 1 2\n",
"3 3 1 1 1\n",
"4 5 3 1 5\n"
] |
[
"First\n",
"Second\n",
"Friendship\n"
] |
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participantΒ β in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participantΒ β in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participantΒ β in 22 milliseconds. So, it is be a draw.
| 500
|
[
{
"input": "5 1 2 1 2",
"output": "First"
},
{
"input": "3 3 1 1 1",
"output": "Second"
},
{
"input": "4 5 3 1 5",
"output": "Friendship"
},
{
"input": "1000 1000 1000 1000 1000",
"output": "Friendship"
},
{
"input": "1 1 1 1 1",
"output": "Friendship"
},
{
"input": "8 8 1 1 1",
"output": "Second"
},
{
"input": "15 14 32 65 28",
"output": "First"
},
{
"input": "894 197 325 232 902",
"output": "First"
},
{
"input": "1 2 8 8 5",
"output": "Friendship"
},
{
"input": "37 261 207 1 1000",
"output": "Friendship"
},
{
"input": "29 344 406 900 1",
"output": "Friendship"
},
{
"input": "1 2 8 9 8",
"output": "First"
},
{
"input": "2 9 8 8 9",
"output": "Friendship"
},
{
"input": "213 480 811 134 745",
"output": "First"
},
{
"input": "2 313 856 964 421",
"output": "Friendship"
},
{
"input": "1 10 2 6 10",
"output": "Friendship"
},
{
"input": "2 7 6 2 3",
"output": "Friendship"
},
{
"input": "637 324 69 612 998",
"output": "Second"
},
{
"input": "13 849 819 723 918",
"output": "Friendship"
},
{
"input": "9 5 7 8 7",
"output": "First"
},
{
"input": "6 5 7 10 4",
"output": "Friendship"
},
{
"input": "61 464 623 89 548",
"output": "First"
},
{
"input": "641 31 29 161 802",
"output": "Friendship"
},
{
"input": "3 3 1 6 9",
"output": "Friendship"
},
{
"input": "2 3 9 8 2",
"output": "Friendship"
},
{
"input": "485 117 368 567 609",
"output": "First"
},
{
"input": "4 202 512 995 375",
"output": "Friendship"
},
{
"input": "424 41 41 909 909",
"output": "Friendship"
},
{
"input": "884 913 263 641 265",
"output": "Second"
},
{
"input": "12 462 8 311 327",
"output": "Second"
},
{
"input": "436 306 266 493 580",
"output": "Second"
},
{
"input": "69 1 2 1 2",
"output": "First"
}
] | 1,610,458,255
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 77
| 0
|
s,v1,v2,t1,t2=map(int,input().split())
first=s*v1+2*t1
second=s*v2+2*t2
if first > second:
print ("Second")
if first < second:
print("First")
if first ==second:
print("Friendship")
|
Title: Key races
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
Input Specification:
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=β€<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=β€<=1000)Β β the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
Output Specification:
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
Demo Input:
['5 1 2 1 2\n', '3 3 1 1 1\n', '4 5 3 1 5\n']
Demo Output:
['First\n', 'Second\n', 'Friendship\n']
Note:
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participantΒ β in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participantΒ β in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participantΒ β in 22 milliseconds. So, it is be a draw.
|
```python
s,v1,v2,t1,t2=map(int,input().split())
first=s*v1+2*t1
second=s*v2+2*t2
if first > second:
print ("Second")
if first < second:
print("First")
if first ==second:
print("Friendship")
```
| 3
|
|
686
|
A
|
Free Ice Cream
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
|
The first line contains two space-separated integers *n* and *x* (1<=β€<=*n*<=β€<=1000, 0<=β€<=*x*<=β€<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=β€<=*d**i*<=β€<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
|
Print two space-separated integersΒ β number of ice cream packs left after all operations, and number of kids that left the house in distress.
|
[
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] |
[
"22 1\n",
"3 2\n"
] |
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
| 500
|
[
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,603,927,446
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 156
| 1,433,600
|
def solve(test):
ans = 0
n, x = map(int, input().split())
for i in range(n):
c = input().split()
if c[0] == '+':
x += int(c[1])
elif int(c[1]) > x:
ans += 1
else:
x -= int(c[1])
print(x, ans)
t = 1
#t = int(input())
for _ in range(t):
solve(_ + 1)
|
Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=β€<=*n*<=β€<=1000, 0<=β€<=*x*<=β€<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=β€<=*d**i*<=β€<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integersΒ β number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
|
```python
def solve(test):
ans = 0
n, x = map(int, input().split())
for i in range(n):
c = input().split()
if c[0] == '+':
x += int(c[1])
elif int(c[1]) > x:
ans += 1
else:
x -= int(c[1])
print(x, ans)
t = 1
#t = int(input())
for _ in range(t):
solve(_ + 1)
```
| 3
|
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave ViΔkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town ViΔkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1Β·2Β·3Β·...Β·(*x*<=-<=1)Β·*x*. For example 4!<==<=1Β·2Β·3Β·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=β€<=*A*,<=*B*<=β€<=109,<=*min*(*A*,<=*B*)<=β€<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4!β=β1Β·2Β·3Β·4β=β24. 3!β=β1Β·2Β·3β=β6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,690,380,223
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 46
| 0
|
import math as m
a,b=map(int,input().split())
c=min(a,b)
print(m.factorial(c))
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave ViΔkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town ViΔkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1Β·2Β·3Β·...Β·(*x*<=-<=1)Β·*x*. For example 4!<==<=1Β·2Β·3Β·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=β€<=*A*,<=*B*<=β€<=109,<=*min*(*A*,<=*B*)<=β€<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4!β=β1Β·2Β·3Β·4β=β24. 3!β=β1Β·2Β·3β=β6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
import math as m
a,b=map(int,input().split())
c=min(a,b)
print(m.factorial(c))
```
| 3
|
|
75
|
A
|
Life Without Zeros
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Life Without Zeros
|
2
|
256
|
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
|
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=β€<=*a*,<=*b*<=β€<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
|
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
|
[
"101\n102\n",
"105\n106\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "101\n102",
"output": "YES"
},
{
"input": "105\n106",
"output": "NO"
},
{
"input": "544\n397",
"output": "YES"
},
{
"input": "822\n280",
"output": "NO"
},
{
"input": "101\n413",
"output": "NO"
},
{
"input": "309\n139",
"output": "NO"
},
{
"input": "693\n970",
"output": "NO"
},
{
"input": "981\n1",
"output": "YES"
},
{
"input": "352\n276",
"output": "YES"
},
{
"input": "164\n691",
"output": "YES"
},
{
"input": "110036\n43",
"output": "YES"
},
{
"input": "100\n1000",
"output": "NO"
},
{
"input": "1000000000\n1000000000",
"output": "YES"
},
{
"input": "999999999\n999999999",
"output": "YES"
},
{
"input": "6\n4",
"output": "NO"
},
{
"input": "123456\n876543",
"output": "YES"
},
{
"input": "1234567\n9876543",
"output": "NO"
},
{
"input": "1111111\n1119111",
"output": "NO"
},
{
"input": "10502405\n40403403",
"output": "YES"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "5\n4",
"output": "YES"
},
{
"input": "1\n6",
"output": "YES"
},
{
"input": "40\n17",
"output": "NO"
},
{
"input": "35\n81",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "2081\n7450",
"output": "NO"
},
{
"input": "84355694\n373629503",
"output": "NO"
},
{
"input": "885992048\n510468672",
"output": "NO"
},
{
"input": "540144752\n647307841",
"output": "NO"
},
{
"input": "341781108\n784147010",
"output": "NO"
},
{
"input": "960440938\n572334653",
"output": "NO"
},
{
"input": "657414510\n768771903",
"output": "NO"
},
{
"input": "501871728\n725074574",
"output": "NO"
},
{
"input": "968\n851",
"output": "YES"
},
{
"input": "943\n939",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "611\n41",
"output": "YES"
},
{
"input": "737\n289",
"output": "NO"
},
{
"input": "168\n571",
"output": "YES"
},
{
"input": "868\n463",
"output": "YES"
},
{
"input": "815732007\n913882008",
"output": "NO"
},
{
"input": "459039901\n453033850",
"output": "NO"
},
{
"input": "975305404\n484601256",
"output": "NO"
}
] | 1,683,477,112
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 92
| 0
|
a = (input())
b = (input())
res = int(a)+int(b)
a = a.replace("0",'')
b = b.replace("0",'')
res = str(res)
res = res.replace("0",'')
res = int(res)
a = int(a)
b = int(b)
if res == (a+b):
print("YES")
else:
print("NO")
|
Title: Life Without Zeros
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
Input Specification:
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=β€<=*a*,<=*b*<=β€<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
Output Specification:
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
Demo Input:
['101\n102\n', '105\n106\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
a = (input())
b = (input())
res = int(a)+int(b)
a = a.replace("0",'')
b = b.replace("0",'')
res = str(res)
res = res.replace("0",'')
res = int(res)
a = int(a)
b = int(b)
if res == (a+b):
print("YES")
else:
print("NO")
```
| 3.977
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,696,160,479
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 40
| 62
| 0
|
str = list(input())
n = len(str)
hello = "hello"
counter = 0
for i in range(0,n):
if(counter < 5 and str[i] == hello[counter]):
counter += 1
if(counter >= 5):
print("YES")
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
str = list(input())
n = len(str)
hello = "hello"
counter = 0
for i in range(0,n):
if(counter < 5 and str[i] == hello[counter]):
counter += 1
if(counter >= 5):
print("YES")
else:
print("NO")
```
| 3.969
|
166
|
A
|
Rank List
|
PROGRAMMING
| 1,100
|
[
"binary search",
"implementation",
"sortings"
] | null | null |
Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place.
You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=><=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=<<=*t**b*.
It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place.
Your task is to count what number of teams from the given list shared the *k*-th place.
|
The first line contains two integers *n* and *k* (1<=β€<=*k*<=β€<=*n*<=β€<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=β€<=*p**i*,<=*t**i*<=β€<=50) β the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces.
|
In the only line print the sought number of teams that got the *k*-th place in the final results' table.
|
[
"7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n",
"5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n"
] |
[
"3\n",
"4\n"
] |
The final results' table for the first sample is:
- 1-3 places β 4 solved problems, the penalty time equals 10 - 4 place β 3 solved problems, the penalty time equals 20 - 5-6 places β 2 solved problems, the penalty time equals 1 - 7 place β 1 solved problem, the penalty time equals 10
The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams.
The final table for the second sample is:
- 1 place β 5 solved problems, the penalty time equals 3 - 2-5 places β 3 solved problems, the penalty time equals 1
The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams.
| 500
|
[
{
"input": "7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10",
"output": "3"
},
{
"input": "5 4\n3 1\n3 1\n5 3\n3 1\n3 1",
"output": "4"
},
{
"input": "5 1\n2 2\n1 1\n1 1\n1 1\n2 2",
"output": "2"
},
{
"input": "6 3\n2 2\n3 1\n2 2\n4 5\n2 2\n4 5",
"output": "1"
},
{
"input": "5 5\n3 1\n10 2\n2 2\n1 10\n10 2",
"output": "1"
},
{
"input": "3 2\n3 3\n3 3\n3 3",
"output": "3"
},
{
"input": "4 3\n10 3\n6 10\n5 2\n5 2",
"output": "2"
},
{
"input": "5 3\n10 10\n10 10\n1 1\n10 10\n4 3",
"output": "3"
},
{
"input": "3 1\n2 1\n1 1\n1 2",
"output": "1"
},
{
"input": "1 1\n28 28",
"output": "1"
},
{
"input": "2 2\n1 2\n1 2",
"output": "2"
},
{
"input": "5 3\n2 3\n4 2\n5 3\n2 4\n3 5",
"output": "1"
},
{
"input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8",
"output": "1"
},
{
"input": "50 6\n11 20\n18 13\n1 13\n3 11\n4 17\n15 10\n15 8\n9 16\n11 17\n16 3\n3 20\n14 13\n12 15\n9 10\n14 2\n12 12\n13 17\n6 10\n20 9\n2 8\n13 7\n7 20\n15 3\n1 20\n2 13\n2 5\n14 7\n10 13\n15 12\n15 5\n17 6\n9 11\n18 5\n10 1\n15 14\n3 16\n6 12\n4 1\n14 9\n7 14\n8 17\n17 13\n4 6\n19 16\n5 6\n3 15\n4 19\n15 20\n2 10\n20 10",
"output": "1"
},
{
"input": "50 12\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "50"
},
{
"input": "50 28\n2 2\n1 1\n2 1\n1 2\n1 1\n1 1\n1 1\n2 2\n2 2\n2 2\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n2 2\n2 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 1\n1 1\n2 2\n2 1\n2 1\n2 2\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n2 1\n1 1\n2 2\n2 2\n2 2\n2 2",
"output": "13"
},
{
"input": "50 40\n2 3\n3 1\n2 1\n2 1\n2 1\n3 1\n1 1\n1 2\n2 3\n1 3\n1 3\n2 1\n3 1\n1 1\n3 1\n3 1\n2 2\n1 1\n3 3\n3 1\n3 2\n2 3\n3 3\n3 1\n1 3\n2 3\n2 1\n3 2\n3 3\n3 1\n2 1\n2 2\n1 3\n3 3\n1 1\n3 2\n1 2\n2 3\n2 1\n2 2\n3 2\n1 3\n3 1\n1 1\n3 3\n2 3\n2 1\n2 3\n2 3\n1 2",
"output": "5"
},
{
"input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3",
"output": "1"
},
{
"input": "50 32\n6 6\n4 2\n5 5\n1 1\n2 4\n6 5\n2 3\n6 5\n2 3\n6 3\n1 4\n1 6\n3 3\n2 4\n3 2\n6 2\n4 1\n3 3\n3 1\n5 5\n1 2\n2 1\n5 4\n3 1\n4 4\n5 6\n4 1\n2 5\n3 1\n4 6\n2 3\n1 1\n6 5\n2 6\n3 3\n2 6\n2 3\n2 6\n3 4\n2 6\n4 5\n5 4\n1 6\n3 2\n5 1\n4 1\n4 6\n4 2\n1 2\n5 2",
"output": "1"
},
{
"input": "50 48\n5 1\n6 4\n3 2\n2 1\n4 7\n3 6\n7 1\n7 5\n6 5\n5 6\n4 7\n5 7\n5 7\n5 5\n7 3\n3 5\n4 3\n5 4\n6 2\n1 6\n6 3\n6 5\n5 2\n4 2\n3 1\n1 1\n5 6\n1 3\n6 5\n3 7\n1 5\n7 5\n6 5\n3 6\n2 7\n5 3\n5 3\n4 7\n5 2\n6 5\n5 7\n7 1\n2 3\n5 5\n2 6\n4 1\n6 2\n6 5\n3 3\n1 6",
"output": "1"
},
{
"input": "50 8\n5 3\n7 3\n4 3\n7 4\n2 2\n4 4\n5 4\n1 1\n7 7\n4 8\n1 1\n6 3\n1 5\n7 3\n6 5\n4 5\n8 6\n3 6\n2 1\n3 2\n2 5\n7 6\n5 8\n1 3\n5 5\n8 4\n4 5\n4 4\n8 8\n7 2\n7 2\n3 6\n2 8\n8 3\n3 2\n4 5\n8 1\n3 2\n8 7\n6 3\n2 3\n5 1\n3 4\n7 2\n6 3\n7 3\n3 3\n6 4\n2 2\n5 1",
"output": "3"
},
{
"input": "20 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "20"
},
{
"input": "20 20\n1 2\n2 2\n1 1\n2 1\n2 2\n1 1\n1 1\n2 1\n1 1\n1 2\n2 2\n1 2\n1 2\n2 2\n2 2\n1 2\n2 1\n2 1\n1 2\n2 2",
"output": "6"
},
{
"input": "30 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "30"
},
{
"input": "30 22\n2 1\n1 2\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n2 2\n1 2\n2 2\n1 2\n1 2\n2 1\n1 2\n2 2\n2 2\n1 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 2\n2 2\n1 2\n2 2\n2 1\n1 1",
"output": "13"
},
{
"input": "30 22\n1 1\n1 3\n2 3\n3 1\n2 3\n3 1\n1 2\n3 3\n2 1\n2 1\n2 2\n3 1\n3 2\n2 3\n3 1\n1 3\n2 3\n3 1\n1 2\n1 2\n2 3\n2 1\n3 3\n3 2\n1 3\n3 3\n3 3\n3 3\n3 3\n3 1",
"output": "5"
},
{
"input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3",
"output": "1"
},
{
"input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8",
"output": "1"
},
{
"input": "50 22\n29 15\n18 10\n6 23\n38 28\n34 40\n40 1\n16 26\n22 33\n14 30\n26 7\n15 16\n22 40\n14 15\n6 28\n32 27\n33 3\n38 22\n40 17\n16 27\n21 27\n34 26\n5 15\n34 9\n38 23\n7 36\n17 6\n19 37\n40 1\n10 28\n9 14\n8 31\n40 8\n14 2\n24 16\n38 33\n3 37\n2 9\n21 21\n40 26\n28 33\n24 31\n10 12\n27 27\n17 4\n38 5\n21 31\n5 12\n29 7\n39 12\n26 14",
"output": "1"
},
{
"input": "50 14\n4 20\n37 50\n46 19\n20 25\n47 10\n6 34\n12 41\n47 9\n22 28\n41 34\n47 40\n12 42\n9 4\n15 15\n27 8\n38 9\n4 17\n8 13\n47 7\n9 38\n30 48\n50 7\n41 34\n23 11\n16 37\n2 32\n18 46\n37 48\n47 41\n13 9\n24 50\n46 14\n33 49\n9 50\n35 30\n49 44\n42 49\n39 15\n33 42\n3 18\n44 15\n44 28\n9 17\n16 4\n10 36\n4 22\n47 17\n24 12\n2 31\n6 30",
"output": "2"
},
{
"input": "2 1\n50 50\n50 50",
"output": "2"
},
{
"input": "2 2\n50 50\n50 50",
"output": "2"
},
{
"input": "2 1\n50 50\n50 49",
"output": "1"
},
{
"input": "2 2\n50 50\n50 49",
"output": "1"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50",
"output": "50"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n49 50",
"output": "1"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 49",
"output": "49"
},
{
"input": "10 1\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4",
"output": "1"
},
{
"input": "4 3\n1 1\n1 2\n2 1\n2 2",
"output": "1"
},
{
"input": "4 2\n1 2\n1 3\n1 5\n1 2",
"output": "2"
},
{
"input": "6 1\n4 3\n4 2\n5 1\n5 2\n5 3\n5 3",
"output": "1"
},
{
"input": "5 3\n2 1\n1 3\n1 2\n1 1\n1 1",
"output": "2"
},
{
"input": "3 1\n1 1\n1 2\n1 3",
"output": "1"
},
{
"input": "10 10\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4",
"output": "4"
},
{
"input": "5 1\n5 5\n5 6\n5 7\n5 8\n5 5",
"output": "2"
},
{
"input": "4 1\n1 1\n1 1\n1 2\n1 3",
"output": "2"
}
] | 1,672,165,516
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 92
| 0
|
a,b = map(int,input().split())
mat = []
for i in range(a) :
arr = list(map(int,input().split()))
mat.append(arr)
mat = sorted(mat, key = lambda x : (-x[0],x[1]))
print(mat.count(mat[b-1]))
|
Title: Rank List
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place.
You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=><=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=<<=*t**b*.
It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place.
Your task is to count what number of teams from the given list shared the *k*-th place.
Input Specification:
The first line contains two integers *n* and *k* (1<=β€<=*k*<=β€<=*n*<=β€<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=β€<=*p**i*,<=*t**i*<=β€<=50) β the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces.
Output Specification:
In the only line print the sought number of teams that got the *k*-th place in the final results' table.
Demo Input:
['7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n', '5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n']
Demo Output:
['3\n', '4\n']
Note:
The final results' table for the first sample is:
- 1-3 places β 4 solved problems, the penalty time equals 10 - 4 place β 3 solved problems, the penalty time equals 20 - 5-6 places β 2 solved problems, the penalty time equals 1 - 7 place β 1 solved problem, the penalty time equals 10
The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams.
The final table for the second sample is:
- 1 place β 5 solved problems, the penalty time equals 3 - 2-5 places β 3 solved problems, the penalty time equals 1
The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams.
|
```python
a,b = map(int,input().split())
mat = []
for i in range(a) :
arr = list(map(int,input().split()))
mat.append(arr)
mat = sorted(mat, key = lambda x : (-x[0],x[1]))
print(mat.count(mat[b-1]))
```
| 3
|
|
294
|
A
|
Shaass and Oskols
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
|
The first line of the input contains an integer *n*, (1<=β€<=*n*<=β€<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=β€<=*a**i*<=β€<=100).
The third line contains an integer *m*, (0<=β€<=*m*<=β€<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=β€<=*x**i*<=β€<=*n*,<=1<=β€<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
|
On the *i*-th line of the output print the number of birds on the *i*-th wire.
|
[
"5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n",
"3\n2 4 1\n1\n2 2\n"
] |
[
"0\n12\n5\n0\n16\n",
"3\n0\n3\n"
] |
none
| 500
|
[
{
"input": "5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6",
"output": "0\n12\n5\n0\n16"
},
{
"input": "3\n2 4 1\n1\n2 2",
"output": "3\n0\n3"
},
{
"input": "5\n58 51 45 27 48\n5\n4 9\n5 15\n4 5\n5 8\n1 43",
"output": "0\n66\n57\n7\n0"
},
{
"input": "10\n48 53 10 28 91 56 81 2 67 52\n2\n2 40\n6 51",
"output": "87\n0\n23\n28\n141\n0\n86\n2\n67\n52"
},
{
"input": "2\n72 45\n6\n1 69\n2 41\n1 19\n2 7\n1 5\n2 1",
"output": "0\n0"
},
{
"input": "10\n95 54 36 39 98 30 19 24 14 12\n3\n9 5\n8 15\n7 5",
"output": "95\n54\n36\n39\n98\n34\n0\n28\n13\n21"
},
{
"input": "100\n95 15 25 18 64 62 23 59 70 84 50 26 87 35 75 86 0 22 77 60 66 41 21 9 75 50 25 3 69 14 39 68 64 46 59 99 2 0 21 76 90 12 61 42 6 91 36 39 47 41 93 81 66 57 70 36 68 89 52 1 19 93 67 22 76 20 8 81 98 18 100 73 61 93 75 80 53 72 40 20 2 86 33 59 27 16 11 26 55 44 47 55 94 58 2 55 82 22 9 95\n0",
"output": "95\n15\n25\n18\n64\n62\n23\n59\n70\n84\n50\n26\n87\n35\n75\n86\n0\n22\n77\n60\n66\n41\n21\n9\n75\n50\n25\n3\n69\n14\n39\n68\n64\n46\n59\n99\n2\n0\n21\n76\n90\n12\n61\n42\n6\n91\n36\n39\n47\n41\n93\n81\n66\n57\n70\n36\n68\n89\n52\n1\n19\n93\n67\n22\n76\n20\n8\n81\n98\n18\n100\n73\n61\n93\n75\n80\n53\n72\n40\n20\n2\n86\n33\n59\n27\n16\n11\n26\n55\n44\n47\n55\n94\n58\n2\n55\n82\n22\n9\n95"
},
{
"input": "1\n100\n1\n1 100",
"output": "0"
},
{
"input": "1\n100\n1\n1 1",
"output": "0"
},
{
"input": "1\n50\n1\n1 25",
"output": "0"
},
{
"input": "2\n50 0\n1\n1 1",
"output": "0\n49"
},
{
"input": "1\n10\n0",
"output": "10"
}
] | 1,643,201,731
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n=int(input())
s=input()
s=s.split()
l=[]
for i in range(n):
l.append(int(s[i]))
m = int(input())
for i in range(m):
ss=input()
ss=ss.split()
xi=int(ss[0])
yi=int(ss[1])
ox=l[xi-1]
l[xi-1]-=yi
if xi-2>=0:
l[xi-2]+=(yi-1)
ox=ox-yi
l[xi-1]-=ox
if xi-1<n-1:
l[xi]+=ox
for j in l:
print(j)
|
Title: Shaass and Oskols
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
Input Specification:
The first line of the input contains an integer *n*, (1<=β€<=*n*<=β€<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=β€<=*a**i*<=β€<=100).
The third line contains an integer *m*, (0<=β€<=*m*<=β€<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=β€<=*x**i*<=β€<=*n*,<=1<=β€<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
Output Specification:
On the *i*-th line of the output print the number of birds on the *i*-th wire.
Demo Input:
['5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n', '3\n2 4 1\n1\n2 2\n']
Demo Output:
['0\n12\n5\n0\n16\n', '3\n0\n3\n']
Note:
none
|
```python
n=int(input())
s=input()
s=s.split()
l=[]
for i in range(n):
l.append(int(s[i]))
m = int(input())
for i in range(m):
ss=input()
ss=ss.split()
xi=int(ss[0])
yi=int(ss[1])
ox=l[xi-1]
l[xi-1]-=yi
if xi-2>=0:
l[xi-2]+=(yi-1)
ox=ox-yi
l[xi-1]-=ox
if xi-1<n-1:
l[xi]+=ox
for j in l:
print(j)
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,663,230,255
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 31
| 0
|
s=list(input())
n='NO'
for i in range(len(s)):
if s[i]=='h' :
for i_1 in range(i,len(s)):
if s[i_1]=='e' :
for i_2 in range(i_1,len(s)):
if s[i_2]=='l' :
for i_3 in range(i_2+1,len(s)):
if s[i_3]=='l' :
for i_4 in range(i_3,len(s)):
if s[i_4]=='o' :
n='YES'
break
continue
continue
continue
print(n)
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
s=list(input())
n='NO'
for i in range(len(s)):
if s[i]=='h' :
for i_1 in range(i,len(s)):
if s[i_1]=='e' :
for i_2 in range(i_1,len(s)):
if s[i_2]=='l' :
for i_3 in range(i_2+1,len(s)):
if s[i_3]=='l' :
for i_4 in range(i_3,len(s)):
if s[i_4]=='o' :
n='YES'
break
continue
continue
continue
print(n)
```
| 3.9845
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=β€<=*n*<=β€<=2000;Β 1<=β€<=*k*<=β€<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=β€<=*y**i*<=β€<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number β the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,674,326,274
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 35
| 62
| 1,638,400
|
fristNum,secondNum=map(int,input().split())
listNum=list(map(int,input().split()))
counts=0
for i in range(fristNum):
if(listNum[i]+secondNum <= 5):
counts+=1
print(counts//3)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=β€<=*n*<=β€<=2000;Β 1<=β€<=*k*<=β€<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=β€<=*y**i*<=β€<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number β the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
fristNum,secondNum=map(int,input().split())
listNum=list(map(int,input().split()))
counts=0
for i in range(fristNum):
if(listNum[i]+secondNum <= 5):
counts+=1
print(counts//3)
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,539,353,643
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 171
| 512,000
|
import re
k=input()
helloRegex=re.compile(r'(h)+((\w)?)+(e)+((\w)?)+(l)+((\w)?)+(l)+((\w)?)+(o)+')
if helloRegex.search(k)== None :
print('NO')
else :
print('YES')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
import re
k=input()
helloRegex=re.compile(r'(h)+((\w)?)+(e)+((\w)?)+(l)+((\w)?)+(l)+((\w)?)+(o)+')
if helloRegex.search(k)== None :
print('NO')
else :
print('YES')
```
| 3.913546
|
278
|
A
|
Circle Line
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations:
- *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station.
The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*.
|
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=β€<=*d**i*<=β€<=100) β the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=β€<=*s*,<=*t*<=β€<=*n*) β the numbers of stations, between which you need to find the shortest distance. These numbers can be the same.
The numbers in the lines are separated by single spaces.
|
Print a single number β the length of the shortest path between stations number *s* and *t*.
|
[
"4\n2 3 4 9\n1 3\n",
"4\n5 8 2 100\n4 1\n",
"3\n1 1 1\n3 1\n",
"3\n31 41 59\n1 1\n"
] |
[
"5\n",
"15\n",
"1\n",
"0\n"
] |
In the first sample the length of path 1βββ2βββ3 equals 5, the length of path 1βββ4βββ3 equals 13.
In the second sample the length of path 4βββ1 is 100, the length of path 4βββ3βββ2βββ1 is 15.
In the third sample the length of path 3βββ1 is 1, the length of path 3βββ2βββ1 is 2.
In the fourth sample the numbers of stations are the same, so the shortest distance equals 0.
| 500
|
[
{
"input": "4\n2 3 4 9\n1 3",
"output": "5"
},
{
"input": "4\n5 8 2 100\n4 1",
"output": "15"
},
{
"input": "3\n1 1 1\n3 1",
"output": "1"
},
{
"input": "3\n31 41 59\n1 1",
"output": "0"
},
{
"input": "5\n16 13 10 30 15\n4 2",
"output": "23"
},
{
"input": "6\n89 82 87 32 67 33\n4 4",
"output": "0"
},
{
"input": "7\n2 3 17 10 2 2 2\n4 2",
"output": "18"
},
{
"input": "3\n4 37 33\n3 3",
"output": "0"
},
{
"input": "8\n87 40 96 7 86 86 72 97\n6 8",
"output": "158"
},
{
"input": "10\n91 94 75 99 100 91 79 86 79 92\n2 8",
"output": "348"
},
{
"input": "19\n1 1 1 1 2 1 1 1 1 1 2 1 3 2 2 1 1 1 2\n7 7",
"output": "0"
},
{
"input": "34\n96 65 24 99 74 76 97 93 99 69 94 82 92 91 98 83 95 97 96 81 90 95 86 87 43 78 88 86 82 62 76 99 83 96\n21 16",
"output": "452"
},
{
"input": "50\n75 98 65 75 99 89 84 65 9 53 62 61 61 53 80 7 6 47 86 1 89 27 67 1 31 39 53 92 19 20 76 41 60 15 29 94 76 82 87 89 93 38 42 6 87 36 100 97 93 71\n2 6",
"output": "337"
},
{
"input": "99\n1 15 72 78 23 22 26 98 7 2 75 58 100 98 45 79 92 69 79 72 33 88 62 9 15 87 17 73 68 54 34 89 51 91 28 44 20 11 74 7 85 61 30 46 95 72 36 18 48 22 42 46 29 46 86 53 96 55 98 34 60 37 75 54 1 81 20 68 84 19 18 18 75 84 86 57 73 34 23 43 81 87 47 96 57 41 69 1 52 44 54 7 85 35 5 1 19 26 7\n4 64",
"output": "1740"
},
{
"input": "100\n33 63 21 27 49 82 86 93 43 55 4 72 89 85 5 34 80 7 23 13 21 49 22 73 89 65 81 25 6 92 82 66 58 88 48 96 1 1 16 48 67 96 84 63 87 76 20 100 36 4 31 41 35 62 55 76 74 70 68 41 4 16 39 81 2 41 34 73 66 57 41 89 78 93 68 96 87 47 92 60 40 58 81 12 19 74 56 83 56 61 83 97 26 92 62 52 39 57 89 95\n71 5",
"output": "2127"
},
{
"input": "100\n95 98 99 81 98 96 100 92 96 90 99 91 98 98 91 78 97 100 96 98 87 93 96 99 91 92 96 92 90 97 85 83 99 95 66 91 87 89 100 95 100 88 99 84 96 79 99 100 94 100 99 99 92 89 99 91 100 94 98 97 91 92 90 87 84 99 97 98 93 100 90 85 75 95 86 71 98 93 91 87 92 95 98 94 95 94 100 98 96 100 97 96 95 95 86 86 94 97 98 96\n67 57",
"output": "932"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 97 100 100 100 100 100 99 100 100 99 99 100 99 100 100 100 100 100 100 100 100 100 97 99 98 98 100 98 98 100 99 100 100 100 100 99 100 98 100 99 98 99 98 98 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 98 100 99 99 100 96 100 96 100 99 100 100 99 100 99 100 100 100 99 100 100 100 100 98 98 97 100 100 99 98\n16 6",
"output": "997"
},
{
"input": "100\n3 6 23 4 23 1 2 14 2 3 3 9 17 8 10 5 1 14 8 5 7 4 13 8 5 6 24 3 12 3 4 9 2 8 2 1 2 1 3 2 1 6 14 23 8 6 3 5 7 8 18 9 2 5 22 6 13 16 2 4 31 20 4 3 3 6 6 1 1 18 5 11 1 14 4 16 6 37 11 1 8 3 7 11 21 14 3 3 12 2 5 1 9 16 3 1 3 4 4 2\n98 24",
"output": "195"
},
{
"input": "100\n1 1 3 1 1 2 1 2 1 1 2 2 2 1 1 1 1 1 1 3 1 1 1 3 1 3 3 1 1 2 1 1 1 1 1 2 1 1 1 4 1 1 3 3 2 1 1 1 1 1 2 2 1 3 1 1 1 2 4 1 1 2 5 2 1 1 2 1 1 1 2 3 1 1 1 1 2 1 1 1 1 2 1 1 1 1 1 2 2 3 1 7 3 1 3 1 2 1 2 1\n49 10",
"output": "60"
},
{
"input": "100\n75 62 31 96 62 76 93 96 72 67 88 35 67 34 60 56 95 86 82 48 64 61 74 100 56 98 76 98 78 55 53 10 12 78 58 45 86 90 93 77 69 73 88 66 92 88 33 50 95 69 89 12 93 57 93 89 59 53 71 86 15 13 61 93 24 100 58 76 46 95 76 82 50 20 79 38 5 72 99 81 55 90 90 65 85 44 63 39 6 34 98 72 88 30 59 73 84 61 25 67\n86 25",
"output": "2523"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n1 51",
"output": "5000"
},
{
"input": "4\n1 1 1 1\n2 4",
"output": "2"
},
{
"input": "4\n1 1 2 1\n2 4",
"output": "2"
}
] | 1,583,840,092
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 23
| 218
| 0
|
num = int(input())
stations = list(map(int,list(input().split())))
points = sorted(list(map(int,list(input().split()))))
sum1 = sum(stations[points[0]-1:points[1]-1])
sum2 = sum(stations) - sum(stations[points[0]-1:points[1]-1])
if sum1 < sum2:
print(sum1)
else:
print(sum2)
|
Title: Circle Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations:
- *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station.
The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*.
Input Specification:
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=β€<=*d**i*<=β€<=100) β the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=β€<=*s*,<=*t*<=β€<=*n*) β the numbers of stations, between which you need to find the shortest distance. These numbers can be the same.
The numbers in the lines are separated by single spaces.
Output Specification:
Print a single number β the length of the shortest path between stations number *s* and *t*.
Demo Input:
['4\n2 3 4 9\n1 3\n', '4\n5 8 2 100\n4 1\n', '3\n1 1 1\n3 1\n', '3\n31 41 59\n1 1\n']
Demo Output:
['5\n', '15\n', '1\n', '0\n']
Note:
In the first sample the length of path 1βββ2βββ3 equals 5, the length of path 1βββ4βββ3 equals 13.
In the second sample the length of path 4βββ1 is 100, the length of path 4βββ3βββ2βββ1 is 15.
In the third sample the length of path 3βββ1 is 1, the length of path 3βββ2βββ1 is 2.
In the fourth sample the numbers of stations are the same, so the shortest distance equals 0.
|
```python
num = int(input())
stations = list(map(int,list(input().split())))
points = sorted(list(map(int,list(input().split()))))
sum1 = sum(stations[points[0]-1:points[1]-1])
sum2 = sum(stations) - sum(stations[points[0]-1:points[1]-1])
if sum1 < sum2:
print(sum1)
else:
print(sum2)
```
| 3
|
|
615
|
A
|
Bulbs
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs?
If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
|
The first line of the input contains integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100)Β β the number of buttons and the number of bulbs respectively.
Each of the next *n* lines contains *x**i* (0<=β€<=*x**i*<=β€<=*m*)Β β the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=β€<=*y**ij*<=β€<=*m*)Β β the numbers of these bulbs.
|
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
|
[
"3 4\n2 1 4\n3 1 3 1\n1 2\n",
"3 3\n1 1\n1 2\n1 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
| 500
|
[
{
"input": "3 4\n2 1 4\n3 1 3 1\n1 2",
"output": "YES"
},
{
"input": "3 3\n1 1\n1 2\n1 1",
"output": "NO"
},
{
"input": "3 4\n1 1\n1 2\n1 3",
"output": "NO"
},
{
"input": "1 5\n5 1 2 3 4 5",
"output": "YES"
},
{
"input": "1 5\n5 4 4 1 2 3",
"output": "NO"
},
{
"input": "1 5\n5 1 1 1 1 5",
"output": "NO"
},
{
"input": "2 5\n4 3 1 4 2\n4 2 3 4 5",
"output": "YES"
},
{
"input": "5 7\n2 6 7\n5 1 1 1 1 1\n3 6 5 4\n0\n4 4 3 2 1",
"output": "YES"
},
{
"input": "100 100\n0\n0\n0\n1 53\n0\n0\n1 34\n1 54\n0\n1 14\n0\n1 33\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 82\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n1 26\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n0\n0\n0\n1 3\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 40\n0\n0\n0\n1 26\n0\n0\n0\n0\n0\n1 97\n0\n1 5\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "5 6\n3 1 2 6\n3 1 2 6\n1 1\n2 3 4\n3 1 5 6",
"output": "YES"
},
{
"input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "NO"
},
{
"input": "1 4\n3 1 2 3",
"output": "NO"
},
{
"input": "1 4\n3 2 3 4",
"output": "NO"
},
{
"input": "2 4\n3 2 3 4\n1 1",
"output": "YES"
},
{
"input": "2 4\n3 1 2 3\n1 4",
"output": "YES"
},
{
"input": "5 1\n0\n0\n0\n0\n0",
"output": "NO"
},
{
"input": "1 1\n0",
"output": "NO"
},
{
"input": "1 10\n10 1 2 3 4 5 6 7 8 9 10",
"output": "YES"
},
{
"input": "1 1\n1 1",
"output": "YES"
},
{
"input": "1 100\n99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99",
"output": "NO"
},
{
"input": "1 3\n3 1 2 1",
"output": "NO"
},
{
"input": "1 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "YES"
}
] | 1,666,107,144
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 46
| 0
|
a,b=map(int,input().split())
g=set()
for i in range(a):
n=list(map(int,input().split()))
n.pop(0)
g.update(n)
print(['NO','YES'][len(g) == b])
|
Title: Bulbs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs?
If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
Input Specification:
The first line of the input contains integers *n* and *m* (1<=β€<=*n*,<=*m*<=β€<=100)Β β the number of buttons and the number of bulbs respectively.
Each of the next *n* lines contains *x**i* (0<=β€<=*x**i*<=β€<=*m*)Β β the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=β€<=*y**ij*<=β€<=*m*)Β β the numbers of these bulbs.
Output Specification:
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
Demo Input:
['3 4\n2 1 4\n3 1 3 1\n1 2\n', '3 3\n1 1\n1 2\n1 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
|
```python
a,b=map(int,input().split())
g=set()
for i in range(a):
n=list(map(int,input().split()))
n.pop(0)
g.update(n)
print(['NO','YES'][len(g) == b])
```
| 3
|
|
920
|
C
|
Swap Adjacent Elements
|
PROGRAMMING
| 1,400
|
[
"dfs and similar",
"greedy",
"math",
"sortings",
"two pointers"
] | null | null |
You have an array *a* consisting of *n* integers. Each integer from 1 to *n* appears exactly once in this array.
For some indices *i* (1<=β€<=*i*<=β€<=*n*<=-<=1) it is possible to swap *i*-th element with (*i*<=+<=1)-th, for other indices it is not possible. You may perform any number of swapping operations any order. There is no limit on the number of times you swap *i*-th element with (*i*<=+<=1)-th (if the position is not forbidden).
Can you make this array sorted in ascending order performing some sequence of swapping operations?
|
The first line contains one integer *n* (2<=β€<=*n*<=β€<=200000) β the number of elements in the array.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=200000) β the elements of the array. Each integer from 1 to *n* appears exactly once.
The third line contains a string of *n*<=-<=1 characters, each character is either 0 or 1. If *i*-th character is 1, then you can swap *i*-th element with (*i*<=+<=1)-th any number of times, otherwise it is forbidden to swap *i*-th element with (*i*<=+<=1)-th.
|
If it is possible to sort the array in ascending order using any sequence of swaps you are allowed to make, print YES. Otherwise, print NO.
|
[
"6\n1 2 5 3 4 6\n01110\n",
"6\n1 2 5 3 4 6\n01010\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example you may swap *a*<sub class="lower-index">3</sub> and *a*<sub class="lower-index">4</sub>, and then swap *a*<sub class="lower-index">4</sub> and *a*<sub class="lower-index">5</sub>.
| 0
|
[
{
"input": "6\n1 2 5 3 4 6\n01110",
"output": "YES"
},
{
"input": "6\n1 2 5 3 4 6\n01010",
"output": "NO"
},
{
"input": "6\n1 6 3 4 5 2\n01101",
"output": "NO"
},
{
"input": "6\n2 3 1 4 5 6\n01111",
"output": "NO"
},
{
"input": "4\n2 3 1 4\n011",
"output": "NO"
},
{
"input": "2\n2 1\n0",
"output": "NO"
},
{
"input": "5\n1 2 4 5 3\n0101",
"output": "NO"
},
{
"input": "5\n1 2 4 5 3\n0001",
"output": "NO"
},
{
"input": "5\n1 4 5 2 3\n0110",
"output": "NO"
},
{
"input": "5\n4 5 1 2 3\n0111",
"output": "NO"
},
{
"input": "3\n3 1 2\n10",
"output": "NO"
},
{
"input": "5\n2 3 4 5 1\n0011",
"output": "NO"
},
{
"input": "16\n3 4 14 16 11 7 13 9 10 8 6 5 15 12 1 2\n111111101111111",
"output": "NO"
},
{
"input": "5\n1 5 3 4 2\n1101",
"output": "NO"
},
{
"input": "6\n6 1 2 3 4 5\n11101",
"output": "NO"
},
{
"input": "3\n2 3 1\n01",
"output": "NO"
},
{
"input": "6\n1 6 3 4 5 2\n01110",
"output": "NO"
},
{
"input": "7\n1 7 3 4 5 6 2\n010001",
"output": "NO"
},
{
"input": "5\n5 2 3 4 1\n1001",
"output": "NO"
},
{
"input": "4\n1 3 4 2\n001",
"output": "NO"
},
{
"input": "5\n4 5 1 2 3\n1011",
"output": "NO"
},
{
"input": "6\n1 5 3 4 2 6\n11011",
"output": "NO"
},
{
"input": "5\n1 4 2 5 3\n1101",
"output": "NO"
},
{
"input": "5\n3 2 4 1 5\n1010",
"output": "NO"
},
{
"input": "6\n1 4 3 5 6 2\n01101",
"output": "NO"
},
{
"input": "6\n2 3 4 5 1 6\n00010",
"output": "NO"
},
{
"input": "10\n5 2 7 9 1 10 3 4 6 8\n111101000",
"output": "NO"
},
{
"input": "5\n2 4 3 1 5\n0110",
"output": "NO"
},
{
"input": "4\n3 1 2 4\n100",
"output": "NO"
},
{
"input": "6\n1 5 3 4 2 6\n01010",
"output": "NO"
},
{
"input": "4\n3 1 2 4\n101",
"output": "NO"
},
{
"input": "4\n2 4 3 1\n011",
"output": "NO"
},
{
"input": "4\n2 3 4 1\n001",
"output": "NO"
},
{
"input": "4\n3 4 1 2\n011",
"output": "NO"
},
{
"input": "5\n2 4 1 3 5\n0110",
"output": "NO"
},
{
"input": "4\n1 3 4 2\n101",
"output": "NO"
},
{
"input": "20\n20 19 18 17 16 15 1 2 3 4 5 14 13 12 11 10 9 8 7 6\n1111111011111111111",
"output": "NO"
},
{
"input": "6\n6 5 4 1 2 3\n11100",
"output": "NO"
},
{
"input": "5\n2 3 5 1 4\n0011",
"output": "NO"
},
{
"input": "4\n1 4 2 3\n010",
"output": "NO"
},
{
"input": "6\n1 6 3 4 5 2\n01001",
"output": "NO"
},
{
"input": "7\n1 7 2 4 3 5 6\n011110",
"output": "NO"
},
{
"input": "5\n1 3 4 2 5\n0010",
"output": "NO"
},
{
"input": "5\n5 4 3 1 2\n1110",
"output": "NO"
},
{
"input": "5\n2 5 4 3 1\n0111",
"output": "NO"
},
{
"input": "4\n2 3 4 1\n101",
"output": "NO"
},
{
"input": "5\n1 4 5 2 3\n1011",
"output": "NO"
},
{
"input": "5\n1 3 2 5 4\n1110",
"output": "NO"
},
{
"input": "6\n3 2 4 1 5 6\n10111",
"output": "NO"
},
{
"input": "7\n3 1 7 4 5 2 6\n101110",
"output": "NO"
},
{
"input": "10\n5 4 10 9 2 1 6 7 3 8\n011111111",
"output": "NO"
},
{
"input": "5\n1 5 3 2 4\n1110",
"output": "NO"
},
{
"input": "4\n2 3 4 1\n011",
"output": "NO"
},
{
"input": "5\n5 4 3 2 1\n0000",
"output": "NO"
},
{
"input": "12\n6 9 11 1 12 7 5 8 10 4 3 2\n11111111110",
"output": "NO"
},
{
"input": "5\n3 1 5 2 4\n1011",
"output": "NO"
},
{
"input": "5\n4 5 1 2 3\n1110",
"output": "NO"
},
{
"input": "10\n1 2 3 4 5 6 8 9 7 10\n000000000",
"output": "NO"
},
{
"input": "6\n5 6 3 2 4 1\n01111",
"output": "NO"
},
{
"input": "5\n1 3 4 2 5\n0100",
"output": "NO"
},
{
"input": "4\n2 1 4 3\n100",
"output": "NO"
},
{
"input": "6\n1 2 3 4 6 5\n00000",
"output": "NO"
},
{
"input": "6\n4 6 5 3 2 1\n01111",
"output": "NO"
},
{
"input": "5\n3 1 4 5 2\n1001",
"output": "NO"
},
{
"input": "5\n5 2 3 1 4\n1011",
"output": "NO"
},
{
"input": "3\n2 3 1\n10",
"output": "NO"
},
{
"input": "10\n6 5 9 4 3 2 8 10 7 1\n111111110",
"output": "NO"
},
{
"input": "7\n1 2 7 3 4 5 6\n111101",
"output": "NO"
},
{
"input": "6\n5 6 1 2 4 3\n11101",
"output": "NO"
},
{
"input": "6\n4 6 3 5 2 1\n11110",
"output": "NO"
},
{
"input": "5\n5 4 2 3 1\n1110",
"output": "NO"
},
{
"input": "2\n2 1\n1",
"output": "YES"
},
{
"input": "3\n1 3 2\n10",
"output": "NO"
},
{
"input": "5\n3 4 5 1 2\n1110",
"output": "NO"
},
{
"input": "5\n3 4 2 1 5\n0110",
"output": "NO"
},
{
"input": "6\n6 1 2 3 4 5\n10001",
"output": "NO"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10\n000000000",
"output": "YES"
},
{
"input": "3\n3 2 1\n00",
"output": "NO"
},
{
"input": "5\n5 4 3 2 1\n1110",
"output": "NO"
},
{
"input": "6\n3 1 2 5 6 4\n10011",
"output": "NO"
},
{
"input": "6\n3 2 1 6 5 4\n11000",
"output": "NO"
},
{
"input": "2\n1 2\n0",
"output": "YES"
},
{
"input": "2\n1 2\n1",
"output": "YES"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 10 11\n0000000000",
"output": "YES"
},
{
"input": "4\n2 4 3 1\n101",
"output": "NO"
},
{
"input": "4\n3 4 1 2\n101",
"output": "NO"
},
{
"input": "3\n1 3 2\n01",
"output": "YES"
},
{
"input": "6\n6 2 3 1 4 5\n11110",
"output": "NO"
},
{
"input": "3\n2 1 3\n01",
"output": "NO"
},
{
"input": "5\n1 5 4 3 2\n0111",
"output": "YES"
},
{
"input": "6\n1 2 6 3 4 5\n11110",
"output": "NO"
},
{
"input": "7\n2 3 1 7 6 5 4\n011111",
"output": "NO"
},
{
"input": "6\n5 6 1 2 3 4\n01111",
"output": "NO"
},
{
"input": "4\n1 2 4 3\n001",
"output": "YES"
},
{
"input": "6\n1 2 3 6 4 5\n11001",
"output": "NO"
},
{
"input": "11\n9 8 10 11 1 2 3 4 5 6 7\n1101111111",
"output": "NO"
},
{
"input": "5\n1 5 3 4 2\n0101",
"output": "NO"
},
{
"input": "10\n9 1 2 3 7 8 5 6 4 10\n110111100",
"output": "NO"
},
{
"input": "7\n1 2 7 3 4 5 6\n111011",
"output": "NO"
},
{
"input": "10\n3 10 1 2 6 4 5 7 8 9\n111111001",
"output": "NO"
},
{
"input": "10\n1 3 6 5 2 9 7 8 4 10\n001101111",
"output": "NO"
},
{
"input": "10\n1 8 9 7 6 10 4 2 3 5\n111111101",
"output": "NO"
},
{
"input": "7\n1 2 5 3 6 4 7\n111011",
"output": "NO"
},
{
"input": "4\n2 4 3 1\n100",
"output": "NO"
},
{
"input": "6\n1 2 3 4 6 5\n00001",
"output": "YES"
},
{
"input": "6\n2 1 3 4 5 6\n10000",
"output": "YES"
},
{
"input": "5\n3 2 1 5 4\n1100",
"output": "NO"
},
{
"input": "9\n2 1 3 6 5 4 7 9 8\n10011001",
"output": "YES"
},
{
"input": "8\n2 6 4 1 5 7 3 8\n1010010",
"output": "NO"
},
{
"input": "5\n1 2 4 5 3\n1101",
"output": "NO"
},
{
"input": "6\n1 3 5 2 4 6\n00110",
"output": "NO"
},
{
"input": "6\n1 3 6 2 4 5\n10111",
"output": "NO"
},
{
"input": "9\n9 8 7 6 5 4 3 1 2\n11111110",
"output": "NO"
},
{
"input": "10\n6 7 8 9 10 1 2 3 4 5\n111111110",
"output": "NO"
},
{
"input": "8\n6 1 7 8 3 2 5 4\n1011111",
"output": "NO"
},
{
"input": "70\n4 65 66 30 67 16 39 35 57 14 42 51 5 21 61 53 63 13 60 29 68 70 69 46 20 2 43 47 49 52 26 44 54 62 25 19 12 28 27 24 18 36 6 33 7 8 11 1 45 32 64 38 23 22 56 59 15 9 41 37 40 55 3 31 34 48 50 10 17 58\n111111101101111111111110101111111111111101101111010010110011011110010",
"output": "NO"
},
{
"input": "5\n5 3 2 4 1\n0100",
"output": "NO"
},
{
"input": "6\n3 2 6 5 1 4\n11011",
"output": "NO"
},
{
"input": "6\n1 2 4 5 6 3\n10011",
"output": "NO"
},
{
"input": "7\n1 7 3 2 5 6 4\n111001",
"output": "NO"
}
] | 1,518,262,219
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 139
| 249
| 20,480,000
|
n=int(input())
a=input().split()
b=input()+'1'
c=[]
k=0
for u in b:
c.append(k)
if u=='0':
k+=1
for i in range(0,n):
if c[i]!=c[int(a[i])-1]:
print('NO')
exit()
print('YES')
exit()
|
Title: Swap Adjacent Elements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have an array *a* consisting of *n* integers. Each integer from 1 to *n* appears exactly once in this array.
For some indices *i* (1<=β€<=*i*<=β€<=*n*<=-<=1) it is possible to swap *i*-th element with (*i*<=+<=1)-th, for other indices it is not possible. You may perform any number of swapping operations any order. There is no limit on the number of times you swap *i*-th element with (*i*<=+<=1)-th (if the position is not forbidden).
Can you make this array sorted in ascending order performing some sequence of swapping operations?
Input Specification:
The first line contains one integer *n* (2<=β€<=*n*<=β€<=200000) β the number of elements in the array.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=β€<=*a**i*<=β€<=200000) β the elements of the array. Each integer from 1 to *n* appears exactly once.
The third line contains a string of *n*<=-<=1 characters, each character is either 0 or 1. If *i*-th character is 1, then you can swap *i*-th element with (*i*<=+<=1)-th any number of times, otherwise it is forbidden to swap *i*-th element with (*i*<=+<=1)-th.
Output Specification:
If it is possible to sort the array in ascending order using any sequence of swaps you are allowed to make, print YES. Otherwise, print NO.
Demo Input:
['6\n1 2 5 3 4 6\n01110\n', '6\n1 2 5 3 4 6\n01010\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example you may swap *a*<sub class="lower-index">3</sub> and *a*<sub class="lower-index">4</sub>, and then swap *a*<sub class="lower-index">4</sub> and *a*<sub class="lower-index">5</sub>.
|
```python
n=int(input())
a=input().split()
b=input()+'1'
c=[]
k=0
for u in b:
c.append(k)
if u=='0':
k+=1
for i in range(0,n):
if c[i]!=c[int(a[i])-1]:
print('NO')
exit()
print('YES')
exit()
```
| 3
|
|
522
|
B
|
Photo to Remember
|
PROGRAMMING
| 1,100
|
[
"*special",
"data structures",
"dp",
"implementation"
] | null | null |
One day *n* friends met at a party, they hadn't seen each other for a long time and so they decided to make a group photo together.
Simply speaking, the process of taking photos can be described as follows. On the photo, each photographed friend occupies a rectangle of pixels: the *i*-th of them occupies the rectangle of width *w**i* pixels and height *h**i* pixels. On the group photo everybody stands in a line, thus the minimum pixel size of the photo including all the photographed friends, is *W*<=Γ<=*H*, where *W* is the total sum of all widths and *H* is the maximum height of all the photographed friends.
As is usually the case, the friends made *n* photos β the *j*-th (1<=β€<=*j*<=β€<=*n*) photo had everybody except for the *j*-th friend as he was the photographer.
Print the minimum size of each made photo in pixels.
|
The first line contains integer *n* (2<=β€<=*n*<=β€<=200<=000) β the number of friends.
Then *n* lines follow: the *i*-th line contains information about the *i*-th friend. The line contains a pair of integers *w**i*,<=*h**i* (1<=β€<=*w**i*<=β€<=10,<=1<=β€<=*h**i*<=β€<=1000) β the width and height in pixels of the corresponding rectangle.
|
Print *n* space-separated numbers *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* β the total number of pixels on the minimum photo containing all friends expect for the *i*-th one.
|
[
"3\n1 10\n5 5\n10 1\n",
"3\n2 1\n1 2\n2 1\n"
] |
[
"75 110 60 ",
"6 4 6 "
] |
none
| 1,000
|
[
{
"input": "3\n1 10\n5 5\n10 1",
"output": "75 110 60 "
},
{
"input": "3\n2 1\n1 2\n2 1",
"output": "6 4 6 "
},
{
"input": "2\n1 5\n2 3",
"output": "6 5 "
},
{
"input": "2\n2 3\n1 1",
"output": "1 6 "
},
{
"input": "3\n1 10\n2 10\n3 10",
"output": "50 40 30 "
},
{
"input": "3\n2 10\n1 9\n3 7",
"output": "36 50 30 "
},
{
"input": "3\n1 1\n3 2\n2 3",
"output": "15 9 8 "
},
{
"input": "3\n3 123\n1 456\n2 789",
"output": "2367 3945 1824 "
},
{
"input": "3\n2 987\n3 654\n1 321",
"output": "2616 2961 4935 "
},
{
"input": "3\n3 143\n2 543\n1 893",
"output": "2679 3572 2715 "
},
{
"input": "2\n1 1\n1 2",
"output": "2 1 "
},
{
"input": "3\n2 22\n1 11\n2 22",
"output": "66 88 66 "
},
{
"input": "3\n1 11\n1 12\n1 13",
"output": "26 26 24 "
},
{
"input": "3\n1 11\n1 12\n2 10",
"output": "36 33 24 "
},
{
"input": "10\n6 20\n1 175\n1 758\n1 169\n2 490\n2 600\n4 463\n7 377\n9 40\n4 961",
"output": "29791 34596 34596 34596 33635 33635 31713 28830 26908 25014 "
},
{
"input": "10\n8 158\n1 709\n6 766\n4 335\n5 356\n2 972\n1 108\n4 235\n3 631\n1 414",
"output": "26244 33048 28188 30132 29160 25278 33048 30132 31104 33048 "
},
{
"input": "10\n7 549\n9 115\n8 141\n3 650\n5 730\n3 841\n7 18\n9 170\n2 217\n1 155",
"output": "39527 37845 38686 42891 41209 37230 39527 37845 43732 44573 "
},
{
"input": "10\n6 386\n9 816\n9 268\n9 481\n8 284\n10 715\n9 351\n7 580\n4 327\n7 392",
"output": "58752 49335 56304 56304 57120 55488 56304 57936 60384 57936 "
},
{
"input": "10\n9 292\n4 6\n6 638\n8 461\n10 970\n10 488\n9 769\n10 644\n8 280\n5 334",
"output": "67900 72750 70810 68870 53061 66930 67900 66930 68870 71780 "
},
{
"input": "10\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000",
"output": "90000 90000 90000 90000 90000 90000 90000 90000 90000 90000 "
}
] | 1,677,174,837
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 904
| 12,697,600
|
n = int(input())
W = 0
pers = []
H1 = 0; H2 = 0
I = 0
for i in range(n):
w, h = map(int, input().split())
pers.append([w,h])
W += w
if h > H2:
H2 = h
I = i
for i in range(n):
if i == I:
continue
w, h = pers[i]
if H2 >= h > H1:
H1 = h
for i in range(0, n):
if i == I:
print((W-pers[i][0])*H1, end = " ")
else:
print((W-pers[i][0])*H2, end = " ")
|
Title: Photo to Remember
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day *n* friends met at a party, they hadn't seen each other for a long time and so they decided to make a group photo together.
Simply speaking, the process of taking photos can be described as follows. On the photo, each photographed friend occupies a rectangle of pixels: the *i*-th of them occupies the rectangle of width *w**i* pixels and height *h**i* pixels. On the group photo everybody stands in a line, thus the minimum pixel size of the photo including all the photographed friends, is *W*<=Γ<=*H*, where *W* is the total sum of all widths and *H* is the maximum height of all the photographed friends.
As is usually the case, the friends made *n* photos β the *j*-th (1<=β€<=*j*<=β€<=*n*) photo had everybody except for the *j*-th friend as he was the photographer.
Print the minimum size of each made photo in pixels.
Input Specification:
The first line contains integer *n* (2<=β€<=*n*<=β€<=200<=000) β the number of friends.
Then *n* lines follow: the *i*-th line contains information about the *i*-th friend. The line contains a pair of integers *w**i*,<=*h**i* (1<=β€<=*w**i*<=β€<=10,<=1<=β€<=*h**i*<=β€<=1000) β the width and height in pixels of the corresponding rectangle.
Output Specification:
Print *n* space-separated numbers *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* β the total number of pixels on the minimum photo containing all friends expect for the *i*-th one.
Demo Input:
['3\n1 10\n5 5\n10 1\n', '3\n2 1\n1 2\n2 1\n']
Demo Output:
['75 110 60 ', '6 4 6 ']
Note:
none
|
```python
n = int(input())
W = 0
pers = []
H1 = 0; H2 = 0
I = 0
for i in range(n):
w, h = map(int, input().split())
pers.append([w,h])
W += w
if h > H2:
H2 = h
I = i
for i in range(n):
if i == I:
continue
w, h = pers[i]
if H2 >= h > H1:
H1 = h
for i in range(0, n):
if i == I:
print((W-pers[i][0])*H1, end = " ")
else:
print((W-pers[i][0])*H2, end = " ")
```
| 3
|
|
977
|
A
|
Wrong Subtraction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Little girl Tanya is learning how to decrease a number by one, but she does it wrong with a number consisting of two or more digits. Tanya subtracts one from a number by the following algorithm:
- if the last digit of the number is non-zero, she decreases the number by one; - if the last digit of the number is zero, she divides the number by 10 (i.e. removes the last digit).
You are given an integer number $n$. Tanya will subtract one from it $k$ times. Your task is to print the result after all $k$ subtractions.
It is guaranteed that the result will be positive integer number.
|
The first line of the input contains two integer numbers $n$ and $k$ ($2 \le n \le 10^9$, $1 \le k \le 50$) β the number from which Tanya will subtract and the number of subtractions correspondingly.
|
Print one integer number β the result of the decreasing $n$ by one $k$ times.
It is guaranteed that the result will be positive integer number.
|
[
"512 4\n",
"1000000000 9\n"
] |
[
"50\n",
"1\n"
] |
The first example corresponds to the following sequence: $512 \rightarrow 511 \rightarrow 510 \rightarrow 51 \rightarrow 50$.
| 0
|
[
{
"input": "512 4",
"output": "50"
},
{
"input": "1000000000 9",
"output": "1"
},
{
"input": "131203 11",
"output": "12"
},
{
"input": "999999999 50",
"output": "9999"
},
{
"input": "999999999 49",
"output": "99990"
},
{
"input": "131203 9",
"output": "130"
},
{
"input": "900000000 16",
"output": "1"
},
{
"input": "909090909 50",
"output": "3"
},
{
"input": "1001 2",
"output": "100"
},
{
"input": "5 2",
"output": "3"
},
{
"input": "2 1",
"output": "1"
}
] | 1,697,101,461
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 11
| 77
| 0
|
n, k = [int(z) for z in input().split(" ")]
for i in range(1,k+1):
if(n%10!=0):
n=n-1
else:
n=n/10
print(int(n))
|
Title: Wrong Subtraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Tanya is learning how to decrease a number by one, but she does it wrong with a number consisting of two or more digits. Tanya subtracts one from a number by the following algorithm:
- if the last digit of the number is non-zero, she decreases the number by one; - if the last digit of the number is zero, she divides the number by 10 (i.e. removes the last digit).
You are given an integer number $n$. Tanya will subtract one from it $k$ times. Your task is to print the result after all $k$ subtractions.
It is guaranteed that the result will be positive integer number.
Input Specification:
The first line of the input contains two integer numbers $n$ and $k$ ($2 \le n \le 10^9$, $1 \le k \le 50$) β the number from which Tanya will subtract and the number of subtractions correspondingly.
Output Specification:
Print one integer number β the result of the decreasing $n$ by one $k$ times.
It is guaranteed that the result will be positive integer number.
Demo Input:
['512 4\n', '1000000000 9\n']
Demo Output:
['50\n', '1\n']
Note:
The first example corresponds to the following sequence: $512 \rightarrow 511 \rightarrow 510 \rightarrow 51 \rightarrow 50$.
|
```python
n, k = [int(z) for z in input().split(" ")]
for i in range(1,k+1):
if(n%10!=0):
n=n-1
else:
n=n/10
print(int(n))
```
| 3
|
|
385
|
A
|
Bear and Raspberry
|
PROGRAMMING
| 1,000
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=β€<=*i*<=β€<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=β€<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
|
The first line contains two space-separated integers, *n* and *c* (2<=β€<=*n*<=β€<=100,<=0<=β€<=*c*<=β€<=100), β the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=β€<=*x**i*<=β€<=100), the price of a honey barrel on day *i*.
|
Print a single integer β the answer to the problem.
|
[
"5 1\n5 10 7 3 20\n",
"6 2\n100 1 10 40 10 40\n",
"3 0\n1 2 3\n"
] |
[
"3\n",
"97\n",
"0\n"
] |
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
| 500
|
[
{
"input": "5 1\n5 10 7 3 20",
"output": "3"
},
{
"input": "6 2\n100 1 10 40 10 40",
"output": "97"
},
{
"input": "3 0\n1 2 3",
"output": "0"
},
{
"input": "2 0\n2 1",
"output": "1"
},
{
"input": "10 5\n10 1 11 2 12 3 13 4 14 5",
"output": "4"
},
{
"input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77",
"output": "87"
},
{
"input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93",
"output": "84"
},
{
"input": "6 100\n10 9 8 7 6 5",
"output": "0"
},
{
"input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46",
"output": "78"
},
{
"input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44",
"output": "0"
},
{
"input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62",
"output": "4"
},
{
"input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71",
"output": "0"
},
{
"input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1",
"output": "0"
},
{
"input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27",
"output": "63"
},
{
"input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22",
"output": "38"
},
{
"input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83",
"output": "91"
},
{
"input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14",
"output": "79"
},
{
"input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24",
"output": "91"
},
{
"input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49",
"output": "83"
},
{
"input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70",
"output": "94"
},
{
"input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42",
"output": "43"
},
{
"input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0",
"output": "100"
},
{
"input": "3 1\n1 2 3",
"output": "0"
},
{
"input": "3 2\n3 3 3",
"output": "0"
},
{
"input": "3 3\n3 2 1",
"output": "0"
},
{
"input": "3 100\n1 2 3",
"output": "0"
},
{
"input": "2 100\n0 0",
"output": "0"
},
{
"input": "2 90\n10 5",
"output": "0"
},
{
"input": "2 5\n5 4",
"output": "0"
},
{
"input": "3 1\n19 20 1",
"output": "18"
},
{
"input": "5 1\n5 10 7 4 20",
"output": "2"
},
{
"input": "5 1\n1 2 3 4 5",
"output": "0"
}
] | 1,605,011,415
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 187
| 0
|
n,c=map(int,input().split())
x=list(map(int,input().split()))
e=0
for i in range(n-1):
e=max(e,x[i]-x[i+1]-c)
print(e)
|
Title: Bear and Raspberry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=β€<=*i*<=β€<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=β€<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
Input Specification:
The first line contains two space-separated integers, *n* and *c* (2<=β€<=*n*<=β€<=100,<=0<=β€<=*c*<=β€<=100), β the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=β€<=*x**i*<=β€<=100), the price of a honey barrel on day *i*.
Output Specification:
Print a single integer β the answer to the problem.
Demo Input:
['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n']
Demo Output:
['3\n', '97\n', '0\n']
Note:
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
|
```python
n,c=map(int,input().split())
x=list(map(int,input().split()))
e=0
for i in range(n-1):
e=max(e,x[i]-x[i+1]-c)
print(e)
```
| 3
|
|
103
|
A
|
Testing Pants for Sadness
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation",
"math"
] |
A. Testing Pants for Sadness
|
2
|
256
|
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
|
The first line contains a positive integer *n* (1<=β€<=*n*<=β€<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=β€<=*a**i*<=β€<=109), the number of answer variants to question *i*.
|
Print a single number β the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
[
"2\n1 1\n",
"2\n2 2\n",
"1\n10\n"
] |
[
"2",
"5",
"10"
] |
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
| 500
|
[
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n2 2",
"output": "5"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "3\n2 4 1",
"output": "10"
},
{
"input": "4\n5 5 3 1",
"output": "22"
},
{
"input": "2\n1000000000 1000000000",
"output": "2999999999"
},
{
"input": "10\n5 7 8 1 10 3 6 4 10 6",
"output": "294"
},
{
"input": "100\n5 7 5 3 5 4 6 5 3 6 4 6 6 2 1 9 6 5 3 8 4 10 1 9 1 3 7 6 5 5 8 8 7 7 8 9 2 10 3 5 4 2 6 10 2 6 9 6 1 9 3 7 7 8 3 9 9 5 10 10 3 10 7 8 3 9 8 3 2 4 10 2 1 1 7 3 9 10 4 6 9 8 2 1 4 10 1 10 6 8 7 5 3 3 6 2 7 10 3 8",
"output": "24212"
},
{
"input": "100\n96 23 25 62 34 30 85 15 26 61 59 87 34 99 60 41 52 73 63 84 50 89 42 29 87 99 19 94 84 43 82 90 41 100 60 61 99 49 26 3 97 5 24 34 51 59 69 61 11 41 72 60 33 36 18 29 82 53 18 80 52 98 38 32 56 95 55 79 32 80 37 64 45 13 62 80 70 29 1 58 88 24 79 68 41 80 12 72 52 39 64 19 54 56 70 58 19 3 83 62",
"output": "261115"
},
{
"input": "100\n883 82 79 535 478 824 700 593 262 385 403 183 176 386 126 648 710 516 922 97 800 728 372 9 954 911 975 526 476 3 74 459 471 174 295 831 698 21 927 698 580 856 712 430 5 473 592 40 301 230 763 266 38 213 393 70 333 779 811 249 130 456 763 657 578 699 939 660 898 918 438 855 892 85 35 232 54 593 849 777 917 979 796 322 473 887 284 105 522 415 86 480 80 592 516 227 680 574 488 644",
"output": "2519223"
},
{
"input": "100\n6659 5574 5804 7566 7431 1431 3871 6703 200 300 3523 3580 8500 2312 4812 3149 3324 5846 8965 5758 5831 1341 7733 4477 355 3024 2941 9938 1494 16 1038 8262 9938 9230 5192 8113 7575 7696 5566 2884 8659 1951 1253 6480 3877 3707 5482 3825 5359 44 3219 3258 1785 5478 4525 5950 2417 1991 8885 4264 8769 2961 7107 8904 5097 2319 5713 8811 9723 8677 2153 3237 7174 9528 9260 7390 3050 6823 6239 5222 4602 933 7823 4198 8304 244 5845 3189 4490 3216 7877 6323 1938 4597 880 1206 1691 1405 4122 5950",
"output": "24496504"
},
{
"input": "50\n515844718 503470143 928669067 209884122 322869098 241621928 844696197 105586164 552680307 968792756 135928721 842094825 298782438 829020472 791637138 285482545 811025527 428952878 887796419 11883658 546401594 6272027 100292274 308219869 372132044 955814846 644008184 521195760 919389466 215065725 687764134 655750167 181397022 404292682 643251185 776299412 741398345 865144798 369796727 673902099 124966684 35796775 794385099 594562033 550366869 868093561 695094388 580789105 755076935 198783899",
"output": "685659563557"
},
{
"input": "10\n12528238 329065023 620046219 303914458 356423530 751571368 72944261 883971060 123105651 868129460",
"output": "27409624352"
},
{
"input": "1\n84355694",
"output": "84355694"
},
{
"input": "2\n885992042 510468669",
"output": "1906929379"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n2 1 2 2 2 2 1 2 2 1 2 2 2 1 2 1 2 2 1 2 2 2 2 2 2 1 2 1 1 2 1 1 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 2 2 1 1 1 2 2 1 1 2 1 1 2 2 2 2 1 2 2 2 1 2 1 2 2 1 2 1 1 1 2 2 1 2 1 2 1 1 1 2 1 2 2 2 1 1 1",
"output": "2686"
},
{
"input": "100\n1 3 2 1 1 2 1 3 2 2 3 1 1 1 2 2 1 3 3 1 1 2 2 3 2 1 3 1 3 2 1 1 3 3 2 1 2 2 2 3 2 2 3 2 2 3 2 1 3 1 1 2 1 3 2 2 1 1 1 1 1 1 3 1 2 3 1 1 1 1 1 2 3 3 1 1 1 1 2 3 3 1 3 2 2 3 2 1 3 2 2 3 1 1 3 2 3 2 3 1",
"output": "4667"
}
] | 1,616,750,795
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 124
| 0
|
try:
t=int(input())
a=[int(i) for i in input().split()]
c=0
j=[]
for i in range(t):
c=(a[i]-1)*(i+1)+1
j.append(c)
print(sum(j))
except:
pass
|
Title: Testing Pants for Sadness
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
Input Specification:
The first line contains a positive integer *n* (1<=β€<=*n*<=β€<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=β€<=*a**i*<=β€<=109), the number of answer variants to question *i*.
Output Specification:
Print a single number β the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specificator.
Demo Input:
['2\n1 1\n', '2\n2 2\n', '1\n10\n']
Demo Output:
['2', '5', '10']
Note:
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
|
```python
try:
t=int(input())
a=[int(i) for i in input().split()]
c=0
j=[]
for i in range(t):
c=(a[i]-1)*(i+1)+1
j.append(c)
print(sum(j))
except:
pass
```
| 3.969
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=β€<=*n*<=β€<=100) β the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=β€<=*p**i*<=β€<=100) β the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3Β·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,685,737,550
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n=int(input())
x=input()
num=x.split(" ")
sum=0
for m in num:
sum+=int(m)
print(sum/n)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=β€<=*n*<=β€<=100) β the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=β€<=*p**i*<=β€<=100) β the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3Β·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
n=int(input())
x=input()
num=x.split(" ")
sum=0
for m in num:
sum+=int(m)
print(sum/n)
```
| 3
|
|
415
|
B
|
Mashmokh and Tokens
|
PROGRAMMING
| 1,500
|
[
"binary search",
"greedy",
"implementation",
"math"
] | null | null |
Bimokh is Mashmokh's boss. For the following *n* days he decided to pay to his workers in a new way. At the beginning of each day he will give each worker a certain amount of tokens. Then at the end of each day each worker can give some of his tokens back to get a certain amount of money. The worker can save the rest of tokens but he can't use it in any other day to get more money. If a worker gives back *w* tokens then he'll get dollars.
Mashmokh likes the tokens however he likes money more. That's why he wants to save as many tokens as possible so that the amount of money he gets is maximal possible each day. He has *n* numbers *x*1,<=*x*2,<=...,<=*x**n*. Number *x**i* is the number of tokens given to each worker on the *i*-th day. Help him calculate for each of *n* days the number of tokens he can save.
|
The first line of input contains three space-separated integers *n*,<=*a*,<=*b*Β (1<=β€<=*n*<=β€<=105;Β 1<=β€<=*a*,<=*b*<=β€<=109). The second line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n*Β (1<=β€<=*x**i*<=β€<=109).
|
Output *n* space-separated integers. The *i*-th of them is the number of tokens Mashmokh can save on the *i*-th day.
|
[
"5 1 4\n12 6 11 9 1\n",
"3 1 2\n1 2 3\n",
"1 1 1\n1\n"
] |
[
"0 2 3 1 1 ",
"1 0 1 ",
"0 "
] |
none
| 1,000
|
[
{
"input": "5 1 4\n12 6 11 9 1",
"output": "0 2 3 1 1 "
},
{
"input": "3 1 2\n1 2 3",
"output": "1 0 1 "
},
{
"input": "1 1 1\n1",
"output": "0 "
},
{
"input": "1 1 1000000000\n1000000000",
"output": "0 "
},
{
"input": "1 1 1000000000\n999999999",
"output": "999999999 "
},
{
"input": "10 1 100000000\n999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999",
"output": "99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 "
}
] | 1,585,900,613
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 47
| 326
| 12,800,000
|
import math
n,a,b=map(int,input().split())
arr = list(map(int,input().split()))
for i in range(n):
x=(math.floor(arr[i]*a/b))
arr[i]-=(math.ceil(x*b/a))
print(*arr)
|
Title: Mashmokh and Tokens
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bimokh is Mashmokh's boss. For the following *n* days he decided to pay to his workers in a new way. At the beginning of each day he will give each worker a certain amount of tokens. Then at the end of each day each worker can give some of his tokens back to get a certain amount of money. The worker can save the rest of tokens but he can't use it in any other day to get more money. If a worker gives back *w* tokens then he'll get dollars.
Mashmokh likes the tokens however he likes money more. That's why he wants to save as many tokens as possible so that the amount of money he gets is maximal possible each day. He has *n* numbers *x*1,<=*x*2,<=...,<=*x**n*. Number *x**i* is the number of tokens given to each worker on the *i*-th day. Help him calculate for each of *n* days the number of tokens he can save.
Input Specification:
The first line of input contains three space-separated integers *n*,<=*a*,<=*b*Β (1<=β€<=*n*<=β€<=105;Β 1<=β€<=*a*,<=*b*<=β€<=109). The second line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n*Β (1<=β€<=*x**i*<=β€<=109).
Output Specification:
Output *n* space-separated integers. The *i*-th of them is the number of tokens Mashmokh can save on the *i*-th day.
Demo Input:
['5 1 4\n12 6 11 9 1\n', '3 1 2\n1 2 3\n', '1 1 1\n1\n']
Demo Output:
['0 2 3 1 1 ', '1 0 1 ', '0 ']
Note:
none
|
```python
import math
n,a,b=map(int,input().split())
arr = list(map(int,input().split()))
for i in range(n):
x=(math.floor(arr[i]*a/b))
arr[i]-=(math.ceil(x*b/a))
print(*arr)
```
| 3
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length β (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line β the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,628,843,897
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 77
| 6,758,400
|
line1 = input()
line2 = input()
output = []
for i in range(0,len(line1)):
if line1[i] == line2[i]:
output.append(0)
else:
output.append(1)
print(int(output[i]),end = "")
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length β (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line β the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
line1 = input()
line2 = input()
output = []
for i in range(0,len(line1)):
if line1[i] == line2[i]:
output.append(0)
else:
output.append(1)
print(int(output[i]),end = "")
```
| 3.968161
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
|
Output one number β the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,634,821,185
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 4,300,800
|
height, width = map(int, input().split())
print(int ((height * width) / 2))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
Output Specification:
Output one number β the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
height, width = map(int, input().split())
print(int ((height * width) / 2))
```
| 3.968989
|
999
|
C
|
Alphabetic Removals
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
You are given a string $s$ consisting of $n$ lowercase Latin letters. Polycarp wants to remove exactly $k$ characters ($k \le n$) from the string $s$. Polycarp uses the following algorithm $k$ times:
- if there is at least one letter 'a', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - if there is at least one letter 'b', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - ... - remove the leftmost occurrence of the letter 'z' and stop the algorithm.
This algorithm removes a single letter from the string. Polycarp performs this algorithm exactly $k$ times, thus removing exactly $k$ characters.
Help Polycarp find the resulting string.
|
The first line of input contains two integers $n$ and $k$ ($1 \le k \le n \le 4 \cdot 10^5$) β the length of the string and the number of letters Polycarp will remove.
The second line contains the string $s$ consisting of $n$ lowercase Latin letters.
|
Print the string that will be obtained from $s$ after Polycarp removes exactly $k$ letters using the above algorithm $k$ times.
If the resulting string is empty, print nothing. It is allowed to print nothing or an empty line (line break).
|
[
"15 3\ncccaabababaccbc\n",
"15 9\ncccaabababaccbc\n",
"1 1\nu\n"
] |
[
"cccbbabaccbc\n",
"cccccc\n",
""
] |
none
| 0
|
[
{
"input": "15 3\ncccaabababaccbc",
"output": "cccbbabaccbc"
},
{
"input": "15 9\ncccaabababaccbc",
"output": "cccccc"
},
{
"input": "5 2\nzyzyx",
"output": "zzy"
},
{
"input": "4 3\nhack",
"output": "k"
},
{
"input": "4 3\nzzzz",
"output": "z"
},
{
"input": "6 5\naaccdd",
"output": "d"
},
{
"input": "2 1\nzz",
"output": "z"
},
{
"input": "14 5\nhxehmvkybeklnj",
"output": "xmvkyklnj"
}
] | 1,686,331,453
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 44
| 77
| 6,860,800
|
n,k=map(int,input().split())
s=input()
for j in range(ord('a'), ord('z') + 1):
i=len(s)
s=s.replace(chr(j), "",k)
j=len(s)
k-=(i-j)
if k==0:
break
print(s)
|
Title: Alphabetic Removals
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string $s$ consisting of $n$ lowercase Latin letters. Polycarp wants to remove exactly $k$ characters ($k \le n$) from the string $s$. Polycarp uses the following algorithm $k$ times:
- if there is at least one letter 'a', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - if there is at least one letter 'b', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - ... - remove the leftmost occurrence of the letter 'z' and stop the algorithm.
This algorithm removes a single letter from the string. Polycarp performs this algorithm exactly $k$ times, thus removing exactly $k$ characters.
Help Polycarp find the resulting string.
Input Specification:
The first line of input contains two integers $n$ and $k$ ($1 \le k \le n \le 4 \cdot 10^5$) β the length of the string and the number of letters Polycarp will remove.
The second line contains the string $s$ consisting of $n$ lowercase Latin letters.
Output Specification:
Print the string that will be obtained from $s$ after Polycarp removes exactly $k$ letters using the above algorithm $k$ times.
If the resulting string is empty, print nothing. It is allowed to print nothing or an empty line (line break).
Demo Input:
['15 3\ncccaabababaccbc\n', '15 9\ncccaabababaccbc\n', '1 1\nu\n']
Demo Output:
['cccbbabaccbc\n', 'cccccc\n', '']
Note:
none
|
```python
n,k=map(int,input().split())
s=input()
for j in range(ord('a'), ord('z') + 1):
i=len(s)
s=s.replace(chr(j), "",k)
j=len(s)
k-=(i-j)
if k==0:
break
print(s)
```
| 3
|
|
339
|
B
|
Xenia and Ringroad
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time.
|
The first line contains two integers *n* and *m* (2<=β€<=*n*<=β€<=105,<=1<=β€<=*m*<=β€<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=β€<=*a**i*<=β€<=*n*). Note that Xenia can have multiple consecutive tasks in one house.
|
Print a single integer β the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"4 3\n3 2 3\n",
"4 3\n2 3 3\n"
] |
[
"6\n",
"2\n"
] |
In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1βββ2βββ3βββ4βββ1βββ2βββ3. This is optimal sequence. So, she needs 6 time units.
| 1,000
|
[
{
"input": "4 3\n3 2 3",
"output": "6"
},
{
"input": "4 3\n2 3 3",
"output": "2"
},
{
"input": "2 2\n1 1",
"output": "0"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "100 100\n56 46 1 47 5 86 45 35 81 1 31 70 67 70 62 99 100 47 44 33 78 35 32 37 92 12 95 18 3 22 54 24 22 90 25 22 78 88 51 92 46 84 15 29 28 40 8 5 93 68 77 47 45 76 85 39 84 94 52 69 93 64 31 60 99 17 51 59 62 37 46 47 86 60 88 14 68 22 47 93 50 10 55 87 46 50 43 63 44 43 61 65 91 43 33 97 67 57 66 70",
"output": "4869"
},
{
"input": "78 58\n23 14 73 45 47 14 27 59 65 39 15 23 5 1 50 37 3 51 46 69 75 65 45 68 48 59 77 39 53 21 72 33 46 32 34 5 69 55 56 53 47 31 32 5 42 23 76 15 2 77 65 24 16 68 61 28 55 10",
"output": "2505"
},
{
"input": "14 54\n9 13 14 9 5 12 4 7 3 14 5 12 13 1 1 11 10 2 7 9 5 2 2 8 10 7 3 9 5 11 2 2 6 12 11 5 4 11 11 6 2 11 14 13 8 7 13 9 4 9 11 3 7 13",
"output": "362"
},
{
"input": "100 100\n48 73 63 16 49 88 36 17 66 6 87 13 94 52 58 70 71 52 7 70 25 42 24 36 57 9 79 26 75 39 13 14 38 26 33 66 88 28 75 98 53 48 67 54 63 25 69 87 88 32 72 17 36 35 29 67 74 89 70 47 20 90 78 13 94 57 32 73 29 74 45 78 85 64 81 56 12 65 19 67 34 86 55 71 41 33 76 13 100 47 44 76 86 78 37 15 26 98 83 98",
"output": "4997"
},
{
"input": "99 100\n88 65 10 91 18 35 58 49 42 2 22 57 74 31 53 24 27 93 45 4 71 2 69 39 21 90 97 89 45 73 20 45 82 98 35 90 37 76 68 26 21 65 95 63 24 74 50 59 3 93 65 6 30 37 62 71 18 88 40 12 56 40 89 56 38 71 90 41 97 43 44 23 19 22 10 80 3 24 32 85 26 65 70 60 76 85 66 68 74 11 64 88 12 63 16 15 79 57 93 58",
"output": "4809"
},
{
"input": "65 100\n53 14 5 10 32 60 31 52 52 56 38 6 8 17 52 23 59 3 18 28 15 2 46 26 8 2 40 6 58 30 28 46 49 23 47 24 9 53 3 47 55 12 36 49 12 24 54 55 58 7 50 42 15 4 58 49 34 40 19 4 59 19 31 17 35 65 36 50 45 5 33 11 29 52 55 40 48 11 32 41 31 7 46 55 32 41 56 51 39 13 5 59 58 34 38 50 55 10 43 30",
"output": "3149"
},
{
"input": "10 100\n7 6 2 10 7 2 3 8 10 4 6 1 4 5 7 10 1 2 3 5 4 10 8 2 3 3 6 8 3 9 4 1 9 10 1 2 5 1 8 8 5 9 2 8 1 2 3 2 1 10 10 7 1 3 2 2 7 1 6 6 6 9 2 3 1 7 2 2 9 7 3 3 2 10 7 4 7 3 3 3 2 4 4 2 2 8 4 1 10 10 5 10 6 10 6 10 3 10 8 9",
"output": "428"
},
{
"input": "2 100\n1 1 2 2 2 2 1 2 1 2 2 2 1 1 2 2 2 2 1 1 2 1 2 2 1 1 2 2 2 1 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 1 1 2 2 1 2 1 2 2 2 1 1 1 1 1 2 2 2 1 1 2 2 1 1 2 2 1 1 2 1 1 1 1 2 2 1 1 1 2 1 1 1 1 1 1 1 2",
"output": "47"
},
{
"input": "67 100\n49 5 25 48 37 55 5 33 14 30 59 28 57 46 45 32 47 22 40 28 58 34 27 29 4 52 63 44 31 65 42 61 11 17 32 17 18 1 12 33 38 11 59 46 43 55 23 30 23 2 42 21 45 51 30 19 35 15 10 30 13 21 32 34 33 3 5 59 23 63 6 9 20 43 64 3 42 41 40 4 14 20 40 33 25 44 1 2 50 46 13 10 3 20 22 64 28 42 58 30",
"output": "3245"
},
{
"input": "100 100\n81 62 26 90 7 87 60 35 75 81 54 94 53 71 64 80 58 83 53 70 40 96 87 50 37 63 5 77 83 75 53 28 22 98 52 45 72 70 62 21 1 99 37 93 16 98 68 27 96 37 21 83 92 23 62 96 85 31 85 66 38 77 45 16 90 86 6 21 75 42 18 60 2 17 51 61 94 68 97 79 17 59 66 14 87 78 70 40 63 78 58 22 87 7 90 17 20 97 9 31",
"output": "5530"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 10\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "2 10\n1 1 1 2 2 2 1 1 1 2",
"output": "3"
},
{
"input": "3 6\n1 2 3 3 2 1",
"output": "6"
}
] | 1,699,620,678
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 29
| 154
| 12,185,600
|
n,m = map(int, input().split(" "))
x=0
work = [int(x) for x in input().split()[:m]]
pos=1
for i in range(len(work)):
if(pos>work[i]):
x+=(n-(pos-work[i]))
pos=work[i]
else:
x+=((work[i]-pos))
pos=work[i]
print(x)
|
Title: Xenia and Ringroad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time.
Input Specification:
The first line contains two integers *n* and *m* (2<=β€<=*n*<=β€<=105,<=1<=β€<=*m*<=β€<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=β€<=*a**i*<=β€<=*n*). Note that Xenia can have multiple consecutive tasks in one house.
Output Specification:
Print a single integer β the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n3 2 3\n', '4 3\n2 3 3\n']
Demo Output:
['6\n', '2\n']
Note:
In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1βββ2βββ3βββ4βββ1βββ2βββ3. This is optimal sequence. So, she needs 6 time units.
|
```python
n,m = map(int, input().split(" "))
x=0
work = [int(x) for x in input().split()[:m]]
pos=1
for i in range(len(work)):
if(pos>work[i]):
x+=(n-(pos-work[i]))
pos=work[i]
else:
x+=((work[i]-pos))
pos=work[i]
print(x)
```
| 3
|
|
80
|
A
|
Panoramix's Prediction
|
PROGRAMMING
| 800
|
[
"brute force"
] |
A. Panoramix's Prediction
|
2
|
256
|
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 isΒ not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
|
The first and only input line contains two positive integers β *n* and *m* (2<=β€<=*n*<=<<=*m*<=β€<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=β€<=*n*<=<<=*m*<=β€<=4.
|
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
|
[
"3 5\n",
"7 11\n",
"7 9\n"
] |
[
"YES",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,668,449,389
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 184
| 0
|
def is_prime(n):
return n > 1 and all(n % i != 0 for i in range(2, int(n**0.5)+1))
n, m = map(int, input().split())
next_prime = n + 1
while not is_prime(next_prime):
next_prime += 1
print("YES" if next_prime == m else "NO")
|
Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 isΒ not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers β *n* and *m* (2<=β€<=*n*<=<<=*m*<=β€<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=β€<=*n*<=<<=*m*<=β€<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none
|
```python
def is_prime(n):
return n > 1 and all(n % i != 0 for i in range(2, int(n**0.5)+1))
n, m = map(int, input().split())
next_prime = n + 1
while not is_prime(next_prime):
next_prime += 1
print("YES" if next_prime == m else "NO")
```
| 3.954
|
44
|
A
|
Indian Summer
|
PROGRAMMING
| 900
|
[
"implementation"
] |
A. Indian Summer
|
2
|
256
|
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy β she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
|
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100) β the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
|
Output the single number β the number of Alyona's leaves.
|
[
"5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n",
"3\noak yellow\noak yellow\noak yellow\n"
] |
[
"4\n",
"1\n"
] |
none
| 0
|
[
{
"input": "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green",
"output": "4"
},
{
"input": "3\noak yellow\noak yellow\noak yellow",
"output": "1"
},
{
"input": "5\nxbnbkzn hp\nkaqkl vrgzbvqstu\nj aqidx\nhos gyul\nwefxmh tygpluae",
"output": "5"
},
{
"input": "1\nqvwli hz",
"output": "1"
},
{
"input": "4\nsrhk x\nsrhk x\nqfoe vnrjuab\nqfoe vnrjuab",
"output": "2"
},
{
"input": "4\nsddqllmmpk syded\nfprsq fnenjnaz\nn hdej\nsddqllmmpk syded",
"output": "3"
},
{
"input": "17\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw",
"output": "1"
},
{
"input": "18\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nb d\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp",
"output": "2"
},
{
"input": "13\nsvpzwtwn rykzfdce\nqweiyeck jkreouy\nhk nnli\ntwxrnbbdt vtuv\nxokqjtylly sz\nesdt dbfidjslq\ng ybqgomvw\nxcpfjmf zcqvz\nifajadhj invzueip\nvdemdnxifb hckwebmi\nsdpnhipam wvowzavh\nuqdlfskhgo vunbpghae\ne dtigwnb",
"output": "13"
},
{
"input": "20\nm vkfh\nvptikamead mvx\nitu mf\nklruxckw aqega\nekqkd enjllwol\ncc uybfdh\nimrfdngvo u\ne uh\ntwt jsslcfuogk\nbljwqsag tuqbdn\nqcv q\nasx gzhvwwmajj\nqcv q\nekqkd enjllwol\nasx gzhvwwmajj\nks vv\nkzyfi cn\ncc uybfdh\nitu mf\ncjbjhtbyvk vatwfmux",
"output": "15"
},
{
"input": "2\nab ab\na bab",
"output": "2"
}
] | 1,648,745,376
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 92
| 0
|
n = int(input())
mySet = set(())
for i in range(n):
s = input()
mySet.add(s)
print(len(mySet))
|
Title: Indian Summer
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy β she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
Input Specification:
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100) β the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
Output Specification:
Output the single number β the number of Alyona's leaves.
Demo Input:
['5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n', '3\noak yellow\noak yellow\noak yellow\n']
Demo Output:
['4\n', '1\n']
Note:
none
|
```python
n = int(input())
mySet = set(())
for i in range(n):
s = input()
mySet.add(s)
print(len(mySet))
```
| 3.977
|
251
|
A
|
Points on Line
|
PROGRAMMING
| 1,300
|
[
"binary search",
"combinatorics",
"two pointers"
] | null | null |
Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter.
|
The first line contains two integers: *n* and *d* (1<=β€<=*n*<=β€<=105;Β 1<=β€<=*d*<=β€<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 β the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase.
|
Print a single integer β the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"4 3\n1 2 3 4\n",
"4 2\n-3 -2 -1 0\n",
"5 19\n1 10 20 30 50\n"
] |
[
"4\n",
"2\n",
"1\n"
] |
In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}.
| 500
|
[
{
"input": "4 3\n1 2 3 4",
"output": "4"
},
{
"input": "4 2\n-3 -2 -1 0",
"output": "2"
},
{
"input": "5 19\n1 10 20 30 50",
"output": "1"
},
{
"input": "10 5\n31 36 43 47 48 50 56 69 71 86",
"output": "2"
},
{
"input": "10 50\n1 4 20 27 65 79 82 83 99 100",
"output": "25"
},
{
"input": "10 90\n24 27 40 41 61 69 73 87 95 97",
"output": "120"
},
{
"input": "100 100\n-98 -97 -96 -93 -92 -91 -90 -87 -86 -84 -81 -80 -79 -78 -76 -75 -73 -71 -69 -67 -65 -64 -63 -62 -61 -54 -51 -50 -49 -48 -46 -45 -44 -37 -36 -33 -30 -28 -27 -16 -15 -13 -12 -10 -9 -7 -6 -5 -4 2 3 5 8 9 10 11 13 14 15 16 17 19 22 24 25 26 27 28 30 31 32 36 40 43 45 46 47 50 51 52 53 58 60 63 69 70 73 78 80 81 82 85 88 89 90 91 95 96 97 99",
"output": "79351"
},
{
"input": "1 14751211\n847188590",
"output": "0"
},
{
"input": "2 1000000000\n-907894512 -289906312",
"output": "0"
},
{
"input": "2 1000000000\n-14348867 1760823",
"output": "0"
},
{
"input": "3 1000000000\n-5 -1 1",
"output": "1"
}
] | 1,597,716,831
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 39
| 466
| 10,444,800
|
import sys
input = sys.stdin.readline
def inInt():
return int(input())
def inStr():
return input().strip("\n")
def inIList():
return(list(map(int,input().split())))
def inSList():
return(input().split())
def solve(case, d):
ans = 0
j = 0
for i in range(len(case)):
while case[i] - case[j] > d:j += 1
ans += int((i - j) * (i - j - 1)/2)
print(ans)
nums = inIList()
case = inIList()
solve(case, nums[1])
|
Title: Points on Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter.
Input Specification:
The first line contains two integers: *n* and *d* (1<=β€<=*n*<=β€<=105;Β 1<=β€<=*d*<=β€<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 β the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase.
Output Specification:
Print a single integer β the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n1 2 3 4\n', '4 2\n-3 -2 -1 0\n', '5 19\n1 10 20 30 50\n']
Demo Output:
['4\n', '2\n', '1\n']
Note:
In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}.
|
```python
import sys
input = sys.stdin.readline
def inInt():
return int(input())
def inStr():
return input().strip("\n")
def inIList():
return(list(map(int,input().split())))
def inSList():
return(input().split())
def solve(case, d):
ans = 0
j = 0
for i in range(len(case)):
while case[i] - case[j] > d:j += 1
ans += int((i - j) * (i - j - 1)/2)
print(ans)
nums = inIList()
case = inIList()
solve(case, nums[1])
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,692,594,764
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 0
|
stroka = input()
counter1=0
counter2=0
for char in stroka:
if char.isupper():
counter1+=1
else:
counter2+=1
if counter2>counter1 or counter1==counter2:
stroka = stroka.lower()
elif counter1>counter2:
stroka=stroka.upper()
print(stroka)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* β it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
stroka = input()
counter1=0
counter2=0
for char in stroka:
if char.isupper():
counter1+=1
else:
counter2+=1
if counter2>counter1 or counter1==counter2:
stroka = stroka.lower()
elif counter1>counter2:
stroka=stroka.upper()
print(stroka)
```
| 3.969
|
462
|
A
|
Appleman and Easy Task
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] | null | null |
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=Γ<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
|
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
|
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
|
[
"3\nxxo\nxox\noxx\n",
"4\nxxxo\nxoxo\noxox\nxxxx\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "3\nxxo\nxox\noxx",
"output": "YES"
},
{
"input": "4\nxxxo\nxoxo\noxox\nxxxx",
"output": "NO"
},
{
"input": "1\no",
"output": "YES"
},
{
"input": "2\nox\nxo",
"output": "YES"
},
{
"input": "2\nxx\nxo",
"output": "NO"
},
{
"input": "3\nooo\noxo\nxoo",
"output": "NO"
},
{
"input": "3\nxxx\nxxo\nxxo",
"output": "NO"
},
{
"input": "4\nxooo\nooxo\noxoo\nooox",
"output": "YES"
},
{
"input": "4\noooo\noxxo\nxoxo\noooo",
"output": "NO"
},
{
"input": "5\noxoxo\nxxxxx\noxoxo\nxxxxx\noxoxo",
"output": "YES"
},
{
"input": "5\nxxxox\nxxxxo\nxoxox\noxoxx\nxoxxx",
"output": "NO"
},
{
"input": "10\nxoxooooooo\noxxoxxxxxo\nxxooxoooxo\noooxxoxoxo\noxxxooooxo\noxooooxxxo\noxoxoxxooo\noxoooxooxx\noxxxxxoxxo\noooooooxox",
"output": "YES"
},
{
"input": "10\nxxxxxxxoox\nxooxxooooo\noxoooxxooo\nxoxxxxxxxx\nxxoxooxxox\nooxoxxooox\nooxxxxxooo\nxxxxoxooox\nxoxxooxxxx\noooooxxoxo",
"output": "NO"
},
{
"input": "19\noxoxoxoxooxoooxxoox\nxxxxxxxxoxxoxoooooo\noxoxoxooxxxooxxxooo\nxxoxxxooxooxxxoxxox\noxoxooxxxooooxxoxox\nxxxoooxoxxoxxoxxxoo\noxooxxxoooooxxoooxo\nxxooxooxoxxoxxoxxoo\noxxxxooooxxxooooxxx\nooxooxoxxoxxoxooxoo\nxxxooooxxxooooxoxox\noooxoxooxxoxooxooxx\nxxoooxxxooooxxoooxo\nooxxxooxoxooxooxxxx\nxoxoxxooxoxxxooxoxo\nxoxxoxoxooxooxxxxxx\noooxxxooxxxooxoxoxo\nxoooooxoxooxxxxxxxo\nxooxxoooxxoxoxoxoxx",
"output": "NO"
},
{
"input": "12\nxxooxxoxxxoo\nxxoooxoxoxoo\nooxoxoxxooxx\nooxxooooxoxo\nxxxxxxxxoxxx\noxooooxxxooo\noxxoxoxoooxx\nxxxxxxxooxox\noxoooooxoxxx\nxxooxxoxxoxx\noxxxxxxxooxx\nooxoxooxxooo",
"output": "NO"
},
{
"input": "2\noo\nxx",
"output": "NO"
}
] | 1,638,421,897
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 61
| 0
|
def solve(n, arr):
for i in range(n):
for j in range(n):
cnt = 0
for x, y in [(-1, 0), (0, 1), (1, 0), (0, -1)]:
ni, nj = x + i, y + j
if ni >= 0 and ni < n and nj >= 0 and nj < n:
if arr[ni][nj] == "o":
cnt += 1
if cnt % 2 != 0:
return "NO"
return "YES"
n = int(input())
arr = []
for i in range(n):
temp = input()
arr.append(list(temp))
print(solve(n, arr))
|
Title: Appleman and Easy Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=Γ<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
Input Specification:
The first line contains an integer *n* (1<=β€<=*n*<=β€<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
Output Specification:
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
Demo Input:
['3\nxxo\nxox\noxx\n', '4\nxxxo\nxoxo\noxox\nxxxx\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
def solve(n, arr):
for i in range(n):
for j in range(n):
cnt = 0
for x, y in [(-1, 0), (0, 1), (1, 0), (0, -1)]:
ni, nj = x + i, y + j
if ni >= 0 and ni < n and nj >= 0 and nj < n:
if arr[ni][nj] == "o":
cnt += 1
if cnt % 2 != 0:
return "NO"
return "YES"
n = int(input())
arr = []
for i in range(n):
temp = input()
arr.append(list(temp))
print(solve(n, arr))
```
| 3
|
|
94
|
A
|
Restoring Password
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] |
A. Restoring Password
|
2
|
256
|
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" β thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
|
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
|
Print one line containing 8 characters β The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
|
[
"01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n",
"10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n"
] |
[
"12345678\n",
"30234919\n"
] |
none
| 500
|
[
{
"input": "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110",
"output": "12345678"
},
{
"input": "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000",
"output": "30234919"
},
{
"input": "00010101101110110101100110101100010101100010101111000101011010011010110010000011\n0101010110\n0001001101\n1001101011\n0000100011\n0010101111\n1110110101\n0001010110\n0110111000\n0000111110\n0010000011",
"output": "65264629"
},
{
"input": "10100100010010010011011001101000100100110110011010011001101011000100110110011010\n1111110011\n1001000111\n1001000100\n1100010011\n0110011010\n0010000001\n1110101110\n0010000110\n0010010011\n1010010001",
"output": "98484434"
},
{
"input": "00101100011111010001001000000110110000000110010011001111111010110010001011000000\n0010000001\n0110010011\n0010000010\n1011001000\n0011111110\n0110001000\n1111010001\n1011000000\n0000100110\n0010110001",
"output": "96071437"
},
{
"input": "10001110111110000001000010001010001110110000100010100010111101101101010000100010\n0000010110\n1101010111\n1000101111\n0001011110\n0011110101\n0101100100\n0110110101\n0000100010\n1000111011\n1110000001",
"output": "89787267"
},
{
"input": "10010100011001010001010101001101010100110100111011001010111100011001000010100000\n0011100000\n1001100100\n0001100100\n0010100000\n0101010011\n0010101110\n0010101111\n0100111011\n1001010001\n1111111110",
"output": "88447623"
},
{
"input": "01101100111000000101011011001110000001011111111000111111100001011010001001011001\n1000000101\n0101101000\n0101110101\n1101011110\n0000101100\n1111111000\n0001001101\n0110111011\n0110110011\n1001011001",
"output": "80805519"
},
{
"input": "11100011000100010110010011101010101010011110001100011010111110011000011010110111\n1110001100\n0110101111\n0100111010\n0101000000\n1001100001\n1010101001\n0000100010\n1010110111\n1100011100\n0100010110",
"output": "09250147"
},
{
"input": "10000110110000010100000010001000111101110110101011110111000100001101000000100010\n0000010100\n0000110001\n0110101011\n1101110001\n1000011011\n0000110100\n0011110111\n1000110010\n0000100010\n0000011011",
"output": "40862358"
},
{
"input": "01000000010000000110100101000110110000100100000001101100001000011111111001010001\n1011000010\n1111101010\n0111110011\n0000000110\n0000001001\n0001111111\n0110010010\n0100000001\n1011001000\n1001010001",
"output": "73907059"
},
{
"input": "01111000111110011001110101110011110000111110010001101100110110100111101011001101\n1110010001\n1001100000\n1100001000\n1010011110\n1011001101\n0111100011\n1101011100\n1110011001\n1111000011\n0010000101",
"output": "57680434"
},
{
"input": "01001100101000100010001011110001000101001001100010010000001001001100101001011111\n1001011111\n1110010111\n0111101011\n1000100010\n0011100101\n0100000010\n0010111100\n0100010100\n1001100010\n0100110010",
"output": "93678590"
},
{
"input": "01110111110000111011101010110110101011010100110111000011101101110101011101001000\n0110000101\n1010101101\n1101010111\n1101011100\n0100110111\n0111011111\n1100011001\n0111010101\n0000111011\n1101001000",
"output": "58114879"
},
{
"input": "11101001111100110101110011010100110011011110100111010110110011000111000011001101\n1100011100\n1100110101\n1011101000\n0011011110\n0011001101\n0100010001\n1110100111\n1010101100\n1110110100\n0101101100",
"output": "61146904"
},
{
"input": "10101010001011010001001001011000100101100001011011101010101110101010001010101000\n0010110101\n1010011010\n1010101000\n1011010001\n1010101011\n0010010110\n0110100010\n1010100101\n0001011011\n0110100001",
"output": "23558422"
},
{
"input": "11110101001100010000110100001110101011011111010100110001000001001010001001101111\n0101101100\n1001101111\n1010101101\n0100101000\n1111110000\n0101010010\n1100010000\n1111010100\n1101000011\n1011111111",
"output": "76827631"
},
{
"input": "10001100110000110111100011001101111110110011110101000011011100001101110000110111\n0011110101\n0101100011\n1000110011\n1011011001\n0111111011\n0101111011\n0000110111\n0100001110\n1000000111\n0110110111",
"output": "26240666"
},
{
"input": "10000100010000111101100100111101111011101000001001100001000110000010010000111101\n1001001111\n0000111101\n1000010001\n0110011101\n0110101000\n1011111001\n0111101110\n1000001001\n1101011111\n0001010100",
"output": "21067271"
},
{
"input": "01101111000110111100011011110001101111001010001100101000110001010101100100000010\n1010001100\n0011010011\n0101010110\n1111001100\n1100011000\n0100101100\n1001100101\n0110111100\n0011001101\n0100000010",
"output": "77770029"
},
{
"input": "10100111011010001011111000000111100000010101000011000010111101010000111010011101\n1010011101\n1010111111\n0110100110\n1111000100\n1110000001\n0000101111\n0011111000\n1000110001\n0101000011\n1010001011",
"output": "09448580"
},
{
"input": "10000111111000011111001010101010010011111001001111000010010100100011000010001100\n1101101110\n1001001111\n0000100101\n1100111010\n0010101010\n1110000110\n1100111101\n0010001100\n1110000001\n1000011111",
"output": "99411277"
},
{
"input": "10110110111011001111101100111100111111011011011011001111110110010011100010000111\n0111010011\n0111101100\n1001101010\n0101000101\n0010000111\n0011111101\n1011001111\n1101111000\n1011011011\n1001001110",
"output": "86658594"
},
{
"input": "01001001100101100011110110111100000110001111001000100000110111110010000000011000\n0100100110\n1000001011\n1000111110\n0000011000\n0101100011\n1101101111\n1111001000\n1011011001\n1000001101\n0010101000",
"output": "04536863"
},
{
"input": "10010100011101000011100100001100101111000010111100000010010000001001001101011101\n1001000011\n1101000011\n1001010001\n1101011101\n1000010110\n0011111101\n0010111100\n0000100100\n1010001000\n0101000110",
"output": "21066773"
},
{
"input": "01111111110101111111011111111111010010000001100000101000100100111001011010001001\n0111111111\n0101111111\n0100101101\n0001100000\n0011000101\n0011100101\n1101001000\n0010111110\n1010001001\n1111000111",
"output": "01063858"
},
{
"input": "00100011111001001010001111000011101000001110100000000100101011101000001001001010\n0010001111\n1001001010\n1010011001\n0011100111\n1000111000\n0011110000\n0000100010\n0001001010\n1111110111\n1110100000",
"output": "01599791"
},
{
"input": "11011101000100110100110011010101100011111010011010010011010010010010100110101111\n0100110100\n1001001010\n0001111101\n1101011010\n1101110100\n1100110101\n0110101111\n0110001111\n0001101000\n1010011010",
"output": "40579016"
},
{
"input": "10000010111101110110011000111110000011100110001111100100000111000011011000001011\n0111010100\n1010110110\n1000001110\n1110000100\n0110001111\n1101110110\n1100001101\n1000001011\n0000000101\n1001000001",
"output": "75424967"
},
{
"input": "11101100101110111110111011111010001111111111000001001001000010001111111110110010\n0101100001\n1111010011\n1110111110\n0100110100\n1110011111\n1000111111\n0010010000\n1110110010\n0011000010\n1111000001",
"output": "72259657"
},
{
"input": "01011110100101111010011000001001100000101001110011010111101011010000110110010101\n0100111100\n0101110011\n0101111010\n0110000010\n0101001111\n1101000011\n0110010101\n0111011010\n0001101110\n1001110011",
"output": "22339256"
},
{
"input": "01100000100101111000100001100010000110000010100100100001100000110011101001110000\n0101111000\n1001110000\n0001000101\n0110110111\n0010100100\n1000011000\n1101110110\n0110000010\n0001011010\n0011001110",
"output": "70554591"
},
{
"input": "11110011011000001001111100110101001000010100100000110011001110011111100100100001\n1010011000\n1111001101\n0100100001\n1111010011\n0100100000\n1001111110\n1010100111\n1000100111\n1000001001\n1100110011",
"output": "18124952"
},
{
"input": "10001001011000100101010110011101011001110010000001010110000101000100101111101010\n0101100001\n1100001100\n1111101010\n1000100101\n0010000001\n0100010010\n0010110110\n0101100111\n0000001110\n1101001110",
"output": "33774052"
},
{
"input": "00110010000111001001001100100010010111101011011110001011111100000101000100000001\n0100000001\n1011011110\n0010111111\n0111100111\n0100111001\n0000010100\n1001011110\n0111001001\n0100010011\n0011001000",
"output": "97961250"
},
{
"input": "01101100001000110101101100101111101110010011010111100011010100010001101000110101\n1001101001\n1000110101\n0110110000\n0111100100\n0011010111\n1110111001\n0001000110\n0000000100\n0001101001\n1011001011",
"output": "21954161"
},
{
"input": "10101110000011010110101011100000101101000110100000101101101101110101000011110010\n0110100000\n1011011011\n0011110010\n0001110110\n0010110100\n1100010010\n0001101011\n1010111000\n0011010110\n0111010100",
"output": "78740192"
},
{
"input": "11000101011100100111010000010001000001001100101100000011000000001100000101011010\n1100010101\n1111101011\n0101011010\n0100000100\n1000110111\n1100100111\n1100101100\n0111001000\n0000110000\n0110011111",
"output": "05336882"
},
{
"input": "11110100010000101110010110001000001011100101100010110011011011111110001100110110\n0101100010\n0100010001\n0000101110\n1100110110\n0101000101\n0011001011\n1111010001\n1000110010\n1111111000\n1010011111",
"output": "62020383"
},
{
"input": "00011001111110000011101011010001010111100110100101000110011111011001100000001100\n0111001101\n0101011110\n0001100111\n1101011111\n1110000011\n0000001100\n0111010001\n1101100110\n1010110100\n0110100101",
"output": "24819275"
},
{
"input": "10111110010011111001001111100101010111010011111001001110101000111110011001111101\n0011111001\n0101011101\n0100001010\n0001110010\n1001111101\n0011101010\n1111001001\n1100100001\n1001101000\n1011111001",
"output": "90010504"
},
{
"input": "01111101111100101010001001011110111001110111110111011111011110110111111011011111\n1111110111\n0010000101\n0110000100\n0111111011\n1011100111\n1100101010\n1011011111\n1100010001\n0111110111\n0010010111",
"output": "85948866"
},
{
"input": "01111100000111110000110010111001111100001001101010110010111010001000101001101010\n0100010101\n1011110101\n1010100100\n1010000001\n1001101010\n0101100110\n1000100010\n0111110000\n1100101110\n0110010110",
"output": "77874864"
},
{
"input": "11100011010000000010011110010111001011111001000111000000001000000000100111100101\n0000000010\n1110001101\n0011010101\n0111100101\n1001000111\n1101001111\n0111010110\n1100101111\n0110000000\n1101101011",
"output": "10374003"
},
{
"input": "01111011100111101110011001000110001111101000111110100100100001011111001011100010\n0110010100\n1100010001\n0111101110\n1001001000\n1010011011\n1000111110\n0010110101\n1011100010\n0101111100\n0110010001",
"output": "22955387"
},
{
"input": "11011010001100000011000100110011010101000110011110110000001100111100001000011111\n0000100010\n1000011111\n1101101000\n0110011110\n0011110000\n1100000011\n0010001100\n0101101000\n0001001100\n1101010100",
"output": "25893541"
},
{
"input": "01011001011111010010101111011001000011001100011101101111011011010011101011110110\n0100001100\n0101100101\n1111111011\n1111010010\n1111101100\n1100011101\n1011000011\n1101001110\n1011110110\n0110001010",
"output": "13805878"
},
{
"input": "11110011011000111111001100111110001111111100000010111100110100110011111111001101\n1111001101\n1001101010\n1100110010\n0011001111\n0001011110\n1000110011\n1000111111\n0110001010\n1001011101\n1100000010",
"output": "06369030"
},
{
"input": "01110011110010000011011001011000001000010110010110011001100001100110001100101000\n0000100001\n0110011000\n1010000010\n1110011101\n0111001111\n1100101000\n0010000011\n0110010000\n1100100101\n0110010110",
"output": "46909115"
},
{
"input": "00001011001111110111111111011111111101110101110100010111010010100101100001010110\n1111110111\n0001010110\n0111011011\n0111000001\n1010010110\n0101110100\n0001000101\n0000111000\n0110100001\n0000101100",
"output": "90005541"
}
] | 1,411,963,199
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 156
| 0
|
s = input()
a = []
for i in range(10):
a.append(input())
p = 0
while(p < 80):
for i in range(10):
if a[i] == s[p:p+10]:
print(i, end='')
p += 10
break
|
Title: Restoring Password
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" β thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
Input Specification:
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
Output Specification:
Print one line containing 8 characters β The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
Demo Input:
['01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n', '10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n']
Demo Output:
['12345678\n', '30234919\n']
Note:
none
|
```python
s = input()
a = []
for i in range(10):
a.append(input())
p = 0
while(p < 80):
for i in range(10):
if a[i] == s[p:p+10]:
print(i, end='')
p += 10
break
```
| 3.961
|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s*Β (1<=β€<=|*s*|<=β€<=103).
The second line contains a single integer *k*Β (0<=β€<=*k*<=β€<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer β the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value*β=β1Β·1β+β2Β·2β+β3Β·2β+β4Β·2β+β5Β·2β+β6Β·2β=β41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,621,844,619
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 24
| 109
| 0
|
s = input()
k = int(input())
w = list(map(int, input().split()))
n = len(s)
dlt = ord('a')
ans = 0
for i in range(n):
#print((i + 1) * w[ord(s[i]) - dlt])
ans += (i + 1) * w[ord(s[i]) - dlt]
m = max(w)
for i in range(n + 1, n + k + 1):
#print(m * i)
ans += m * i
print(ans)
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s*Β (1<=β€<=|*s*|<=β€<=103).
The second line contains a single integer *k*Β (0<=β€<=*k*<=β€<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer β the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value*β=β1Β·1β+β2Β·2β+β3Β·2β+β4Β·2β+β5Β·2β+β6Β·2β=β41.
|
```python
s = input()
k = int(input())
w = list(map(int, input().split()))
n = len(s)
dlt = ord('a')
ans = 0
for i in range(n):
#print((i + 1) * w[ord(s[i]) - dlt])
ans += (i + 1) * w[ord(s[i]) - dlt]
m = max(w)
for i in range(n + 1, n + k + 1):
#print(m * i)
ans += m * i
print(ans)
```
| 3
|
|
818
|
A
|
Diplomas and Certificates
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
There are *n* students who have taken part in an olympiad. Now it's time to award the students.
Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners.
You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners.
|
The first (and the only) line of input contains two integers *n* and *k* (1<=β€<=*n*,<=*k*<=β€<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas.
|
Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible.
It's possible that there are no winners.
|
[
"18 2\n",
"9 10\n",
"1000000000000 5\n",
"1000000000000 499999999999\n"
] |
[
"3 6 9\n",
"0 0 9\n",
"83333333333 416666666665 500000000002\n",
"1 499999999999 500000000000\n"
] |
none
| 0
|
[
{
"input": "18 2",
"output": "3 6 9"
},
{
"input": "9 10",
"output": "0 0 9"
},
{
"input": "1000000000000 5",
"output": "83333333333 416666666665 500000000002"
},
{
"input": "1000000000000 499999999999",
"output": "1 499999999999 500000000000"
},
{
"input": "1 1",
"output": "0 0 1"
},
{
"input": "5 3",
"output": "0 0 5"
},
{
"input": "42 6",
"output": "3 18 21"
},
{
"input": "1000000000000 1000",
"output": "499500499 499500499000 500000000501"
},
{
"input": "999999999999 999999",
"output": "499999 499998500001 500000999999"
},
{
"input": "732577309725 132613",
"output": "2762066 366285858458 366288689201"
},
{
"input": "152326362626 15",
"output": "4760198832 71402982480 76163181314"
},
{
"input": "2 1",
"output": "0 0 2"
},
{
"input": "1000000000000 500000000000",
"output": "0 0 1000000000000"
},
{
"input": "100000000000 50000000011",
"output": "0 0 100000000000"
},
{
"input": "1000000000000 32416187567",
"output": "15 486242813505 513757186480"
},
{
"input": "1000000000000 7777777777",
"output": "64 497777777728 502222222208"
},
{
"input": "1000000000000 77777777777",
"output": "6 466666666662 533333333332"
},
{
"input": "100000000000 578485652",
"output": "86 49749766072 50250233842"
},
{
"input": "999999999999 10000000000",
"output": "49 490000000000 509999999950"
},
{
"input": "7 2",
"output": "1 2 4"
},
{
"input": "420506530901 752346673804",
"output": "0 0 420506530901"
},
{
"input": "960375521135 321688347872",
"output": "1 321688347872 638687173262"
},
{
"input": "1000000000000 1000000000000",
"output": "0 0 1000000000000"
},
{
"input": "99999999999 15253636363",
"output": "3 45760909089 54239090907"
},
{
"input": "19 2",
"output": "3 6 10"
},
{
"input": "999999999999 1000000000000",
"output": "0 0 999999999999"
},
{
"input": "1000000000000 5915587276",
"output": "84 496909331184 503090668732"
},
{
"input": "1000000000000 1000000006",
"output": "499 499000002994 500999996507"
},
{
"input": "549755813888 134217728",
"output": "2047 274743689216 275012122625"
},
{
"input": "99999999999 3333333",
"output": "14999 49996661667 50003323333"
},
{
"input": "9 1",
"output": "2 2 5"
},
{
"input": "1000000000000 250000000001",
"output": "1 250000000001 749999999998"
},
{
"input": "5 1",
"output": "1 1 3"
},
{
"input": "3107038133 596040207",
"output": "2 1192080414 1914957717"
},
{
"input": "1000000000000 73786977",
"output": "6776 499980556152 500019437072"
},
{
"input": "1000000000000 73786976",
"output": "6776 499980549376 500019443848"
},
{
"input": "1000000000000 25000000000",
"output": "19 475000000000 524999999981"
},
{
"input": "216929598879 768233755932",
"output": "0 0 216929598879"
},
{
"input": "1000000000000 250000000000",
"output": "1 250000000000 749999999999"
},
{
"input": "1000000000000 100000000001",
"output": "4 400000000004 599999999992"
},
{
"input": "100000000000 100000000001",
"output": "0 0 100000000000"
},
{
"input": "900000000000 100281800001",
"output": "4 401127200004 498872799992"
},
{
"input": "906028900004 109123020071",
"output": "4 436492080284 469536819716"
},
{
"input": "1000000000000 1",
"output": "250000000000 250000000000 500000000000"
}
] | 1,500,491,733
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 77
| 4,608,000
|
s=input()
l=s.split()
n=int(l[0])
k=int(l[1])
a=n//2
p1=a//(k+1)
p2=k*p1
p3=n-p2-p1
if p3>=n/2 :
print(int(p1),int(p2),int(p3))
else :
print(0,0,n)
|
Title: Diplomas and Certificates
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* students who have taken part in an olympiad. Now it's time to award the students.
Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners.
You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners.
Input Specification:
The first (and the only) line of input contains two integers *n* and *k* (1<=β€<=*n*,<=*k*<=β€<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas.
Output Specification:
Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible.
It's possible that there are no winners.
Demo Input:
['18 2\n', '9 10\n', '1000000000000 5\n', '1000000000000 499999999999\n']
Demo Output:
['3 6 9\n', '0 0 9\n', '83333333333 416666666665 500000000002\n', '1 499999999999 500000000000\n']
Note:
none
|
```python
s=input()
l=s.split()
n=int(l[0])
k=int(l[1])
a=n//2
p1=a//(k+1)
p2=k*p1
p3=n-p2-p1
if p3>=n/2 :
print(int(p1),int(p2),int(p3))
else :
print(0,0,n)
```
| 3
|
|
919
|
B
|
Perfect Number
|
PROGRAMMING
| 1,100
|
[
"binary search",
"brute force",
"dp",
"implementation",
"number theory"
] | null | null |
We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer.
|
A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$).
|
A single number, denoting the $k$-th smallest perfect integer.
|
[
"1\n",
"2\n"
] |
[
"19\n",
"28\n"
] |
The first perfect integer is $19$ and the second one is $28$.
| 750
|
[
{
"input": "1",
"output": "19"
},
{
"input": "2",
"output": "28"
},
{
"input": "13",
"output": "136"
},
{
"input": "101",
"output": "1432"
},
{
"input": "1023",
"output": "100270"
},
{
"input": "9999",
"output": "10800010"
},
{
"input": "10000",
"output": "10800100"
},
{
"input": "2333",
"output": "310060"
},
{
"input": "9139",
"output": "10134010"
},
{
"input": "9859",
"output": "10422001"
},
{
"input": "5987",
"output": "2221201"
},
{
"input": "3",
"output": "37"
},
{
"input": "4",
"output": "46"
},
{
"input": "5",
"output": "55"
},
{
"input": "7",
"output": "73"
},
{
"input": "9",
"output": "91"
},
{
"input": "10",
"output": "109"
},
{
"input": "15",
"output": "154"
},
{
"input": "51",
"output": "613"
},
{
"input": "99",
"output": "1414"
},
{
"input": "138",
"output": "2224"
},
{
"input": "233",
"output": "5050"
},
{
"input": "666",
"output": "27100"
},
{
"input": "1234",
"output": "110206"
},
{
"input": "3567",
"output": "1033003"
},
{
"input": "4445",
"output": "1221301"
},
{
"input": "5689",
"output": "2114002"
},
{
"input": "6666",
"output": "3102004"
},
{
"input": "7777",
"output": "5300200"
},
{
"input": "8888",
"output": "10110061"
},
{
"input": "9411",
"output": "10214200"
},
{
"input": "5539",
"output": "2101114"
},
{
"input": "6259",
"output": "2511100"
},
{
"input": "2387",
"output": "312220"
},
{
"input": "8515",
"output": "10030114"
}
] | 1,694,594,253
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 1,606
| 0
|
k=int(input())
a=10
while k!=0:
a+=9
s=sum(list(map(int,str(a))))
# print(s)
if s==10:
k=k-1
print(a)
|
Title: Perfect Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer.
Input Specification:
A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$).
Output Specification:
A single number, denoting the $k$-th smallest perfect integer.
Demo Input:
['1\n', '2\n']
Demo Output:
['19\n', '28\n']
Note:
The first perfect integer is $19$ and the second one is $28$.
|
```python
k=int(input())
a=10
while k!=0:
a+=9
s=sum(list(map(int,str(a))))
# print(s)
if s==10:
k=k-1
print(a)
```
| 3
|
|
281
|
A
|
Word Capitalization
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500
|
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,695,062,353
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
n = input()
k = n[0].upper()
print(k+n[1:])
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
n = input()
k = n[0].upper()
print(k+n[1:])
```
| 3
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=100) β the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,475,694,466
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 0
|
n = int(input())
arr = sum(list(map(int,input().split())))
cnt=0
for i in range(1,6):
if ((arr+i)%(n+1) )!=1:
cnt+=1
print(cnt)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=100) β the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
n = int(input())
arr = sum(list(map(int,input().split())))
cnt=0
for i in range(1,6):
if ((arr+i)%(n+1) )!=1:
cnt+=1
print(cnt)
```
| 3
|
|
322
|
B
|
Ciel and Flowers
|
PROGRAMMING
| 1,600
|
[
"combinatorics",
"math"
] | null | null |
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make.
|
The first line contains three integers *r*, *g* and *b* (0<=β€<=*r*,<=*g*,<=*b*<=β€<=109) β the number of red, green and blue flowers.
|
Print the maximal number of bouquets Fox Ciel can make.
|
[
"3 6 9\n",
"4 4 4\n",
"0 0 0\n"
] |
[
"6\n",
"4\n",
"0\n"
] |
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
| 1,000
|
[
{
"input": "3 6 9",
"output": "6"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "0 3 6",
"output": "3"
},
{
"input": "7 8 9",
"output": "7"
},
{
"input": "8 8 9",
"output": "8"
},
{
"input": "15 3 999",
"output": "339"
},
{
"input": "32 62 92",
"output": "62"
},
{
"input": "123456789 123456789 123456789",
"output": "123456789"
},
{
"input": "3 5 5",
"output": "4"
},
{
"input": "666806767 385540591 357848286",
"output": "470065214"
},
{
"input": "80010646 727118126 817880463",
"output": "541669744"
},
{
"input": "829651016 732259171 572879931",
"output": "711596705"
},
{
"input": "242854896 442432924 180395753",
"output": "288561190"
},
{
"input": "139978911 5123031 935395222",
"output": "360165721"
},
{
"input": "553182792 10264076 395427398",
"output": "319624755"
},
{
"input": "597790453 720437830 855459575",
"output": "724562619"
},
{
"input": "494914467 356982656 757942689",
"output": "536613270"
},
{
"input": "908118348 67156409 217974865",
"output": "397749873"
},
{
"input": "952726009 629846517 972974334",
"output": "851848953"
},
{
"input": "775140200 616574841 630329230",
"output": "674014756"
},
{
"input": "524780569 326748594 90361407",
"output": "313963523"
},
{
"input": "937984449 184405994 992844522",
"output": "705078321"
},
{
"input": "835108464 525983528 452876698",
"output": "604656229"
},
{
"input": "879716125 531124573 207876166",
"output": "539572288"
},
{
"input": "292920005 241298326 667908343",
"output": "400708891"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 999999999 999999998",
"output": "999999998"
},
{
"input": "999999998 999999998 999999999",
"output": "999999998"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "0 1000000000 0",
"output": "333333333"
},
{
"input": "0 1 0",
"output": "0"
},
{
"input": "1 0 0",
"output": "0"
},
{
"input": "0 2 2",
"output": "0"
},
{
"input": "3 3 5",
"output": "3"
},
{
"input": "2 2 0",
"output": "0"
},
{
"input": "0 5 5",
"output": "2"
},
{
"input": "2 0 11",
"output": "3"
},
{
"input": "9 9 7",
"output": "8"
},
{
"input": "65 30 74",
"output": "56"
}
] | 1,560,863,478
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 248
| 0
|
r,g,b = map(int, input().split(" "))
res = 0
res += r//3
res += g//3
res += b//3
if r > 0 and b > 0 and g > 0:
r -= 1
g -= 1
b -= 1
res = max(res,r//3+b//3+g//3+1)
if r > 0 and b > 0 and g > 0:
r -= 1
g -= 1
b -= 1
res = max(res, r//3+b//3+g//3+2)
print(res)
|
Title: Ciel and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=β€<=*r*,<=*g*,<=*b*<=β€<=109) β the number of red, green and blue flowers.
Output Specification:
Print the maximal number of bouquets Fox Ciel can make.
Demo Input:
['3 6 9\n', '4 4 4\n', '0 0 0\n']
Demo Output:
['6\n', '4\n', '0\n']
Note:
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
|
```python
r,g,b = map(int, input().split(" "))
res = 0
res += r//3
res += g//3
res += b//3
if r > 0 and b > 0 and g > 0:
r -= 1
g -= 1
b -= 1
res = max(res,r//3+b//3+g//3+1)
if r > 0 and b > 0 and g > 0:
r -= 1
g -= 1
b -= 1
res = max(res, r//3+b//3+g//3+2)
print(res)
```
| 3
|
|
478
|
B
|
Random Teams
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null |
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
|
The only line of input contains two integers *n* and *m*, separated by a single space (1<=β€<=*m*<=β€<=*n*<=β€<=109) β the number of participants and the number of teams respectively.
|
The only line of the output should contain two integers *k**min* and *k**max* β the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
|
[
"5 1\n",
"3 2\n",
"6 3\n"
] |
[
"10 10\n",
"1 1\n",
"3 6\n"
] |
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
| 1,000
|
[
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,648,578,853
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 61
| 0
|
n,m = map(int,input().split())
temp = n-(m-1)
kmax = (temp*(temp-1))//2
a = n//m
temp1 = m*(a*(a-1))//2 + a*(n%m)
print(temp1,kmax)
|
Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=β€<=*m*<=β€<=*n*<=β€<=109) β the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* β the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
|
```python
n,m = map(int,input().split())
temp = n-(m-1)
kmax = (temp*(temp-1))//2
a = n//m
temp1 = m*(a*(a-1))//2 + a*(n%m)
print(temp1,kmax)
```
| 3
|
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=Γ<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=Γ<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=β€<=*n*<=β€<=10) β the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* β the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,688,803,721
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 10
| 46
| 0
|
n = int(input())
s = []
x = [[0] * n for _ in range(n)]
for i in range(n):
x[i][0] = 1
x[0][i] = 1
for i in range(1, n):
for j in range(1, n):
x[i][j] = x[i - 1][j] + x[i][j - 1]
for row in x:
s.append(max(row))
m = max(s)
print(m)
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=Γ<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=Γ<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=β€<=*n*<=β€<=10) β the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* β the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
n = int(input())
s = []
x = [[0] * n for _ in range(n)]
for i in range(n):
x[i][0] = 1
x[0][i] = 1
for i in range(1, n):
for j in range(1, n):
x[i][j] = x[i - 1][j] + x[i][j - 1]
for row in x:
s.append(max(row))
m = max(s)
print(m)
```
| 3
|
|
468
|
A
|
24 Game
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"greedy",
"math"
] | null | null |
Little X used to play a card game called "24 Game", but recently he has found it too easy. So he invented a new game.
Initially you have a sequence of *n* integers: 1,<=2,<=...,<=*n*. In a single step, you can pick two of them, let's denote them *a* and *b*, erase them from the sequence, and append to the sequence either *a*<=+<=*b*, or *a*<=-<=*b*, or *a*<=Γ<=*b*.
After *n*<=-<=1 steps there is only one number left. Can you make this number equal to 24?
|
The first line contains a single integer *n* (1<=β€<=*n*<=β€<=105).
|
If it's possible, print "YES" in the first line. Otherwise, print "NO" (without the quotes).
If there is a way to obtain 24 as the result number, in the following *n*<=-<=1 lines print the required operations an operation per line. Each operation should be in form: "*a* *op* *b* = *c*". Where *a* and *b* are the numbers you've picked at this operation; *op* is either "+", or "-", or "*"; *c* is the result of corresponding operation. Note, that the absolute value of *c* mustn't be greater than 1018. The result of the last operation must be equal to 24. Separate operator sign and equality sign from numbers with spaces.
If there are multiple valid answers, you may print any of them.
|
[
"1\n",
"8\n"
] |
[
"NO\n",
"YES\n8 * 7 = 56\n6 * 5 = 30\n3 - 4 = -1\n1 - 2 = -1\n30 - -1 = 31\n56 - 31 = 25\n25 + -1 = 24\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "NO"
},
{
"input": "8",
"output": "YES\n8 * 7 = 56\n6 * 5 = 30\n3 - 4 = -1\n1 - 2 = -1\n30 - -1 = 31\n56 - 31 = 25\n25 + -1 = 24"
},
{
"input": "12",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24"
},
{
"input": "100",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "1000",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "987",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..."
},
{
"input": "2",
"output": "NO"
},
{
"input": "3",
"output": "NO"
},
{
"input": "4",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24"
},
{
"input": "5",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24"
},
{
"input": "6",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24"
},
{
"input": "7",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24"
},
{
"input": "100000",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "99999",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..."
},
{
"input": "99998",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "99997",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..."
},
{
"input": "580",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "422",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "116",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "447",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..."
},
{
"input": "62052",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "25770",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "56118",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "86351",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..."
},
{
"input": "48108",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "33373",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24\n9 - 8 = 1\n24 * 1 = 24\n11 - 10 = 1\n24 * 1 = 24\n13 - 12 = 1\n24 * 1 = 24\n15 - 14 = 1\n24 * 1 = 24\n17 - 16 = 1\n24 * 1 = 24\n19 - 18 = 1\n24 * 1 = 24\n21 - 20 = 1\n24 * 1 = 24\n23 - 22 = 1\n24 * 1 = 24\n25 - 24 = 1\n24 * 1 = 24\n27 - 26 = 1\n24 * 1 = 24\n29 - 28 = 1\n24 * 1 = 24\n31 - 30 = 1\n24 * 1 = 24\n33 - 32 = 1\n24 * 1 = 24\n35 - 34 = 1\n24 * 1 = 24\n37 - 36 = 1\n24 * 1 = 24\n39 - 38 = 1\n24 * 1 = 24\n41 - 40 = 1\n24 * 1 = 2..."
},
{
"input": "9782",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "19082",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24\n6 - 5 = 1\n24 * 1 = 24\n8 - 7 = 1\n24 * 1 = 24\n10 - 9 = 1\n24 * 1 = 24\n12 - 11 = 1\n24 * 1 = 24\n14 - 13 = 1\n24 * 1 = 24\n16 - 15 = 1\n24 * 1 = 24\n18 - 17 = 1\n24 * 1 = 24\n20 - 19 = 1\n24 * 1 = 24\n22 - 21 = 1\n24 * 1 = 24\n24 - 23 = 1\n24 * 1 = 24\n26 - 25 = 1\n24 * 1 = 24\n28 - 27 = 1\n24 * 1 = 24\n30 - 29 = 1\n24 * 1 = 24\n32 - 31 = 1\n24 * 1 = 24\n34 - 33 = 1\n24 * 1 = 24\n36 - 35 = 1\n24 * 1 = 24\n38 - 37 = 1\n24 * 1 = 24\n40 - 39 = 1\n24 * 1 = 24\n42 - 41..."
},
{
"input": "4",
"output": "YES\n3 * 4 = 12\n2 * 1 = 2\n12 * 2 = 24"
},
{
"input": "7",
"output": "YES\n5 - 3 = 2\n2 * 4 = 8\n1 + 2 = 3\n8 * 3 = 24\n7 - 6 = 1\n24 * 1 = 24"
},
{
"input": "3",
"output": "NO"
}
] | 1,626,961,482
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 31
| 249
| 26,828,800
|
n=int(input())
if n>=4:
print("YES")
if n==4:
print("4 * 3 = 12")
print("12 * 2 = 24")
print("24 * 1 = 24")
elif n==5:
print("5 * 4 = 20")
print("20 + 3 = 23")
print("23 + 2 = 25")
print("25 - 1 = 24")
else:
print("4 * 3 = 12")
print("12 * 2 = 24")
print(str(n)+" - "+str(n-1)+" = 1")
print("1 - 1 = 0")
for i in range(5,n-1):
print(str(i)+" * 0 = 0")
print("24 + 0 = 24")
else:
print("NO")
|
Title: 24 Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little X used to play a card game called "24 Game", but recently he has found it too easy. So he invented a new game.
Initially you have a sequence of *n* integers: 1,<=2,<=...,<=*n*. In a single step, you can pick two of them, let's denote them *a* and *b*, erase them from the sequence, and append to the sequence either *a*<=+<=*b*, or *a*<=-<=*b*, or *a*<=Γ<=*b*.
After *n*<=-<=1 steps there is only one number left. Can you make this number equal to 24?
Input Specification:
The first line contains a single integer *n* (1<=β€<=*n*<=β€<=105).
Output Specification:
If it's possible, print "YES" in the first line. Otherwise, print "NO" (without the quotes).
If there is a way to obtain 24 as the result number, in the following *n*<=-<=1 lines print the required operations an operation per line. Each operation should be in form: "*a* *op* *b* = *c*". Where *a* and *b* are the numbers you've picked at this operation; *op* is either "+", or "-", or "*"; *c* is the result of corresponding operation. Note, that the absolute value of *c* mustn't be greater than 1018. The result of the last operation must be equal to 24. Separate operator sign and equality sign from numbers with spaces.
If there are multiple valid answers, you may print any of them.
Demo Input:
['1\n', '8\n']
Demo Output:
['NO\n', 'YES\n8 * 7 = 56\n6 * 5 = 30\n3 - 4 = -1\n1 - 2 = -1\n30 - -1 = 31\n56 - 31 = 25\n25 + -1 = 24\n']
Note:
none
|
```python
n=int(input())
if n>=4:
print("YES")
if n==4:
print("4 * 3 = 12")
print("12 * 2 = 24")
print("24 * 1 = 24")
elif n==5:
print("5 * 4 = 20")
print("20 + 3 = 23")
print("23 + 2 = 25")
print("25 - 1 = 24")
else:
print("4 * 3 = 12")
print("12 * 2 = 24")
print(str(n)+" - "+str(n-1)+" = 1")
print("1 - 1 = 0")
for i in range(5,n-1):
print(str(i)+" * 0 = 0")
print("24 + 0 = 24")
else:
print("NO")
```
| 3
|
|
897
|
B
|
Chtholly's request
|
PROGRAMMING
| 1,300
|
[
"brute force"
] | null | null |
β I experienced so many great things.
β You gave me memories like dreams... But I have to leave now...
β One last request, can you...
β Help me solve a Codeforces problem?
β ......
β What?
Chtholly has been thinking about a problem for days:
If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not.
Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*.
Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help!
|
The first line contains two integers *k* and *p* (1<=β€<=*k*<=β€<=105,<=1<=β€<=*p*<=β€<=109).
|
Output single integerΒ β answer to the problem.
|
[
"2 100\n",
"5 30\n"
] |
[
"33\n",
"15\n"
] |
In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22.
In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 1,000
|
[
{
"input": "2 100",
"output": "33"
},
{
"input": "5 30",
"output": "15"
},
{
"input": "42147 412393322",
"output": "251637727"
},
{
"input": "77809 868097296",
"output": "440411873"
},
{
"input": "5105 443422097",
"output": "363192634"
},
{
"input": "75615 376679484",
"output": "373089399"
},
{
"input": "22951 23793302",
"output": "1898631"
},
{
"input": "12785 993582106",
"output": "286204743"
},
{
"input": "60276 428978808",
"output": "376477293"
},
{
"input": "84776 104860385",
"output": "10209596"
},
{
"input": "41984 653766991",
"output": "17823101"
},
{
"input": "100000 1000000000",
"output": "495495496"
},
{
"input": "41163 472310076",
"output": "207304047"
},
{
"input": "6983 765352180",
"output": "586866999"
},
{
"input": "33493 967727004",
"output": "305705165"
},
{
"input": "90898 94010922",
"output": "65928728"
},
{
"input": "67298 349286579",
"output": "156435206"
},
{
"input": "92452 296773064",
"output": "229486976"
},
{
"input": "58832 563860457",
"output": "16775206"
},
{
"input": "90234 156145441",
"output": "44023160"
},
{
"input": "91454 977186148",
"output": "681779748"
},
{
"input": "11108 444095250",
"output": "188075844"
},
{
"input": "46304 584475527",
"output": "275627129"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 1000000000",
"output": "11"
},
{
"input": "100000 1",
"output": "0"
}
] | 1,645,098,773
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 93
| 2,150,400
|
a, k = map(int, input().split())
sm = 0
for i in range(1, a + 1):
r = str(i)
sm += int(r + r[::-1])
sm %= k
print(sm % k)
|
Title: Chtholly's request
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
β I experienced so many great things.
β You gave me memories like dreams... But I have to leave now...
β One last request, can you...
β Help me solve a Codeforces problem?
β ......
β What?
Chtholly has been thinking about a problem for days:
If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not.
Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*.
Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help!
Input Specification:
The first line contains two integers *k* and *p* (1<=β€<=*k*<=β€<=105,<=1<=β€<=*p*<=β€<=109).
Output Specification:
Output single integerΒ β answer to the problem.
Demo Input:
['2 100\n', '5 30\n']
Demo Output:
['33\n', '15\n']
Note:
In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22.
In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
a, k = map(int, input().split())
sm = 0
for i in range(1, a + 1):
r = str(i)
sm += int(r + r[::-1])
sm %= k
print(sm % k)
```
| 3
|
|
46
|
A
|
Ball Game
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] |
A. Ball Game
|
2
|
256
|
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
|
The first line contains integer *n* (2<=β€<=*n*<=β€<=100) which indicates the number of kids in the circle.
|
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
|
[
"10\n",
"3\n"
] |
[
"2 4 7 1 6 2 9 7 6\n",
"2 1\n"
] |
none
| 0
|
[
{
"input": "10",
"output": "2 4 7 1 6 2 9 7 6"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "4",
"output": "2 4 3"
},
{
"input": "5",
"output": "2 4 2 1"
},
{
"input": "6",
"output": "2 4 1 5 4"
},
{
"input": "7",
"output": "2 4 7 4 2 1"
},
{
"input": "8",
"output": "2 4 7 3 8 6 5"
},
{
"input": "9",
"output": "2 4 7 2 7 4 2 1"
},
{
"input": "2",
"output": "2"
},
{
"input": "11",
"output": "2 4 7 11 5 11 7 4 2 1"
},
{
"input": "12",
"output": "2 4 7 11 4 10 5 1 10 8 7"
},
{
"input": "13",
"output": "2 4 7 11 3 9 3 11 7 4 2 1"
},
{
"input": "20",
"output": "2 4 7 11 16 2 9 17 6 16 7 19 12 6 1 17 14 12 11"
},
{
"input": "25",
"output": "2 4 7 11 16 22 4 12 21 6 17 4 17 6 21 12 4 22 16 11 7 4 2 1"
},
{
"input": "30",
"output": "2 4 7 11 16 22 29 7 16 26 7 19 2 16 1 17 4 22 11 1 22 14 7 1 26 22 19 17 16"
},
{
"input": "35",
"output": "2 4 7 11 16 22 29 2 11 21 32 9 22 1 16 32 14 32 16 1 22 9 32 21 11 2 29 22 16 11 7 4 2 1"
},
{
"input": "40",
"output": "2 4 7 11 16 22 29 37 6 16 27 39 12 26 1 17 34 12 31 11 32 14 37 21 6 32 19 7 36 26 17 9 2 36 31 27 24 22 21"
},
{
"input": "45",
"output": "2 4 7 11 16 22 29 37 1 11 22 34 2 16 31 2 19 37 11 31 7 29 7 31 11 37 19 2 31 16 2 34 22 11 1 37 29 22 16 11 7 4 2 1"
},
{
"input": "50",
"output": "2 4 7 11 16 22 29 37 46 6 17 29 42 6 21 37 4 22 41 11 32 4 27 1 26 2 29 7 36 16 47 29 12 46 31 17 4 42 31 21 12 4 47 41 36 32 29 27 26"
},
{
"input": "55",
"output": "2 4 7 11 16 22 29 37 46 1 12 24 37 51 11 27 44 7 26 46 12 34 2 26 51 22 49 22 51 26 2 34 12 46 26 7 44 27 11 51 37 24 12 1 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "60",
"output": "2 4 7 11 16 22 29 37 46 56 7 19 32 46 1 17 34 52 11 31 52 14 37 1 26 52 19 47 16 46 17 49 22 56 31 7 44 22 1 41 22 4 47 31 16 2 49 37 26 16 7 59 52 46 41 37 34 32 31"
},
{
"input": "65",
"output": "2 4 7 11 16 22 29 37 46 56 2 14 27 41 56 7 24 42 61 16 37 59 17 41 1 27 54 17 46 11 42 9 42 11 46 17 54 27 1 41 17 59 37 16 61 42 24 7 56 41 27 14 2 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "70",
"output": "2 4 7 11 16 22 29 37 46 56 67 9 22 36 51 67 14 32 51 1 22 44 67 21 46 2 29 57 16 46 7 39 2 36 1 37 4 42 11 51 22 64 37 11 56 32 9 57 36 16 67 49 32 16 1 57 44 32 21 11 2 64 57 51 46 42 39 37 36"
},
{
"input": "75",
"output": "2 4 7 11 16 22 29 37 46 56 67 4 17 31 46 62 4 22 41 61 7 29 52 1 26 52 4 32 61 16 47 4 37 71 31 67 29 67 31 71 37 4 47 16 61 32 4 52 26 1 52 29 7 61 41 22 4 62 46 31 17 4 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "80",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 12 26 41 57 74 12 31 51 72 14 37 61 6 32 59 7 36 66 17 49 2 36 71 27 64 22 61 21 62 24 67 31 76 42 9 57 26 76 47 19 72 46 21 77 54 32 11 71 52 34 17 1 66 52 39 27 16 6 77 69 62 56 51 47 44 42 41"
},
{
"input": "85",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 7 21 36 52 69 2 21 41 62 84 22 46 71 12 39 67 11 41 72 19 52 1 36 72 24 62 16 56 12 54 12 56 16 62 24 72 36 1 52 19 72 41 11 67 39 12 71 46 22 84 62 41 21 2 69 52 36 21 7 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "90",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 2 16 31 47 64 82 11 31 52 74 7 31 56 82 19 47 76 16 47 79 22 56 1 37 74 22 61 11 52 4 47 1 46 2 49 7 56 16 67 29 82 46 11 67 34 2 61 31 2 64 37 11 76 52 29 7 76 56 37 19 2 76 61 47 34 22 11 1 82 74 67 61 56 52 49 47 46"
},
{
"input": "95",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 11 26 42 59 77 1 21 42 64 87 16 41 67 94 27 56 86 22 54 87 26 61 2 39 77 21 61 7 49 92 41 86 37 84 37 86 41 92 49 7 61 21 77 39 2 61 26 87 54 22 86 56 27 94 67 41 16 87 64 42 21 1 77 59 42 26 11 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "96",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 10 25 41 58 76 95 19 40 62 85 13 38 64 91 23 52 82 17 49 82 20 55 91 32 70 13 53 94 40 83 31 76 26 73 25 74 28 79 35 88 46 5 61 22 80 43 7 68 34 1 65 34 4 71 43 16 86 61 37 14 88 67 47 28 10 89 73 58 44 31 19 8 94 85 77 70 64 59 55 52 50 49"
},
{
"input": "97",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 9 24 40 57 75 94 17 38 60 83 10 35 61 88 19 48 78 12 44 77 14 49 85 25 63 5 45 86 31 74 21 66 15 62 13 62 15 66 21 74 31 86 45 5 63 25 85 49 14 77 44 12 78 48 19 88 61 35 10 83 60 38 17 94 75 57 40 24 9 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "98",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 8 23 39 56 74 93 15 36 58 81 7 32 58 85 15 44 74 7 39 72 8 43 79 18 56 95 37 78 22 65 11 56 4 51 1 50 2 53 7 60 16 71 29 86 46 7 67 30 92 57 23 88 56 25 93 64 36 9 81 56 32 9 85 64 44 25 7 88 72 57 43 30 18 7 95 86 78 71 65 60 56 53 51 50"
},
{
"input": "99",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 7 22 38 55 73 92 13 34 56 79 4 29 55 82 11 40 70 2 34 67 2 37 73 11 49 88 29 70 13 56 1 46 92 40 88 38 88 40 92 46 1 56 13 70 29 88 49 11 73 37 2 67 34 2 70 40 11 82 55 29 4 79 56 34 13 92 73 55 38 22 7 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "100",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 6 21 37 54 72 91 11 32 54 77 1 26 52 79 7 36 66 97 29 62 96 31 67 4 42 81 21 62 4 47 91 36 82 29 77 26 76 27 79 32 86 41 97 54 12 71 31 92 54 17 81 46 12 79 47 16 86 57 29 2 76 51 27 4 82 61 41 22 4 87 71 56 42 29 17 6 96 87 79 72 66 61 57 54 52 51"
}
] | 1,670,394,381
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 92
| 0
|
aruncari = int(input(''))
def nr_ce_primesc_mingea(aruncari):
numar = 1
for i in range(1, aruncari):
numar = numar + i
if numar > aruncari:
numar = numar - aruncari
print(numar, end=' ')
nr_ce_primesc_mingea(aruncari)
|
Title: Ball Game
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
Input Specification:
The first line contains integer *n* (2<=β€<=*n*<=β€<=100) which indicates the number of kids in the circle.
Output Specification:
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
Demo Input:
['10\n', '3\n']
Demo Output:
['2 4 7 1 6 2 9 7 6\n', '2 1\n']
Note:
none
|
```python
aruncari = int(input(''))
def nr_ce_primesc_mingea(aruncari):
numar = 1
for i in range(1, aruncari):
numar = numar + i
if numar > aruncari:
numar = numar - aruncari
print(numar, end=' ')
nr_ce_primesc_mingea(aruncari)
```
| 3.977
|
498
|
A
|
Crazy Town
|
PROGRAMMING
| 1,700
|
[
"geometry"
] | null | null |
Crazy Town is a plane on which there are *n* infinite line roads. Each road is defined by the equation *a**i**x*<=+<=*b**i**y*<=+<=*c**i*<==<=0, where *a**i* and *b**i* are not both equal to the zero. The roads divide the plane into connected regions, possibly of infinite space. Let's call each such region a block. We define an intersection as the point where at least two different roads intersect.
Your home is located in one of the blocks. Today you need to get to the University, also located in some block. In one step you can move from one block to another, if the length of their common border is nonzero (in particular, this means that if the blocks are adjacent to one intersection, but have no shared nonzero boundary segment, then it are not allowed to move from one to another one in one step).
Determine what is the minimum number of steps you have to perform to get to the block containing the university. It is guaranteed that neither your home nor the university is located on the road.
|
The first line contains two space-separated integers *x*1, *y*1 (<=-<=106<=β€<=*x*1,<=*y*1<=β€<=106) β the coordinates of your home.
The second line contains two integers separated by a space *x*2, *y*2 (<=-<=106<=β€<=*x*2,<=*y*2<=β€<=106) β the coordinates of the university you are studying at.
The third line contains an integer *n* (1<=β€<=*n*<=β€<=300) β the number of roads in the city. The following *n* lines contain 3 space-separated integers (<=-<=106<=β€<=*a**i*,<=*b**i*,<=*c**i*<=β€<=106; |*a**i*|<=+<=|*b**i*|<=><=0) β the coefficients of the line *a**i**x*<=+<=*b**i**y*<=+<=*c**i*<==<=0, defining the *i*-th road. It is guaranteed that no two roads are the same. In addition, neither your home nor the university lie on the road (i.e. they do not belong to any one of the lines).
|
Output the answer to the problem.
|
[
"1 1\n-1 -1\n2\n0 1 0\n1 0 0\n",
"1 1\n-1 -1\n3\n1 0 0\n0 1 0\n1 1 -3\n"
] |
[
"2\n",
"2\n"
] |
Pictures to the samples are presented below (A is the point representing the house; B is the point representing the university, different blocks are filled with different colors):
| 500
|
[
{
"input": "1 1\n-1 -1\n2\n0 1 0\n1 0 0",
"output": "2"
},
{
"input": "1 1\n-1 -1\n3\n1 0 0\n0 1 0\n1 1 -3",
"output": "2"
},
{
"input": "841746 527518\n595261 331297\n10\n-946901 129987 670374\n-140388 -684770 309555\n-302589 415564 -387435\n-565799 -72069 -395358\n-523453 -511446 854898\n-846967 -749453 -341866\n-622388 434663 264157\n-638453 625357 344195\n-255265 -676356 -772398\n-824723 -319141 33585",
"output": "0"
},
{
"input": "454379 373644\n-665078 -385892\n2\n-530 -468 -379786\n-173 -275 -100376",
"output": "2"
},
{
"input": "841746 527518\n595261 331297\n10\n936 -209 -790797\n898 1240 -36994\n759 285 -413562\n174 323 34281\n662 400 -284846\n298 520 42086\n-36 -27 12861\n462 631 -22515\n-499 1105 919372\n582 1490 319884",
"output": "0"
},
{
"input": "-537 648838\n227 -51454\n1\n678 0 235266",
"output": "1"
},
{
"input": "-940 -984641\n403 -942522\n2\n530 0 -63600\n-439 0 95263",
"output": "2"
},
{
"input": "-867 -465880\n793 -581568\n5\n73 0 57743\n-818 0 -635586\n-804 0 -415668\n-383 0 -52854\n1258 0 155992",
"output": "5"
},
{
"input": "-632 -387435\n942 798117\n10\n249 0 135705\n536 0 271752\n750 0 375750\n799 0 -206142\n1102 0 -437494\n-453 0 197055\n-581 0 260288\n-322 0 161322\n1317 0 -878439\n-811 0 594463",
"output": "10"
},
{
"input": "527189 -306471\n-998939 648838\n1\n-950717 -549267 -820616",
"output": "1"
},
{
"input": "454379 373644\n-665078 -385892\n2\n-984641 503905 -909460\n-767954 -468772 -942522",
"output": "2"
},
{
"input": "-589794 344286\n532652 -230711\n5\n-2919 -179425 -546698\n-465880 342737 794428\n-230739 -687865 713836\n-932054 513357 -97639\n-559361 -75096 -581568",
"output": "5"
},
{
"input": "0 1\n2 2\n1\n1 1 2",
"output": "0"
},
{
"input": "0 2\n-2 0\n2\n2 3 -1\n4 0 3",
"output": "2"
},
{
"input": "1 -4\n1 5\n1\n0 1 0",
"output": "1"
},
{
"input": "1 0\n2 0\n1\n1 0 0",
"output": "0"
},
{
"input": "0 0\n0 2\n4\n1 0 1\n1 0 -1\n-2 0 1\n0 1 -1",
"output": "1"
},
{
"input": "100000 100000\n-100000 100000\n1\n10000 0 7",
"output": "1"
},
{
"input": "1 1\n-1 -1\n1\n1 1 0",
"output": "1"
},
{
"input": "1 1\n3 3\n1\n1 0 2",
"output": "0"
},
{
"input": "1 3\n1 1\n1\n1 1 3",
"output": "0"
},
{
"input": "5 0\n15 0\n1\n10 0 -100",
"output": "1"
},
{
"input": "3 4\n2 6\n1\n0 -2 5",
"output": "0"
},
{
"input": "1 0\n1 2\n1\n0 1 -1",
"output": "1"
},
{
"input": "0 0\n0 2\n1\n0 1 -1",
"output": "1"
},
{
"input": "0 0\n0 1\n1\n1 0 10000",
"output": "0"
},
{
"input": "0 0\n0 1\n1\n0 2 2",
"output": "0"
},
{
"input": "10 18\n10 0\n2\n1 -1 0\n0 1 -5",
"output": "2"
},
{
"input": "10 10\n8 8\n1\n1 1 19",
"output": "0"
},
{
"input": "0 1\n1000000 1\n1\n1000000 1 0",
"output": "0"
}
] | 1,556,901,076
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 51
| 109
| 0
|
x1,y1=map(int,input().split())
x2,y2=map(int,input().split())
a1=y1-y2
b1=x2-x1
c1=x2*(y2-y1)-y2*(x2-x1)
def intersect(a2,b2,c2):
global a1,b1,c1,x1,y1,x2,y2
if(a1*b2==a2*b1):
return False
x=(b1*c2-b2*c1)/(a1*b2-b1*a2)
y=(a1*c2-c1*a2)/(b1*a2-a1*b2)
if(min(x1,x2)<=x<=max(x1,x2) and min(y1,y2)<=y<=max(y1,y2)):
return True
return False
m=int(input())
ans=0
for i in range(m):
a2,b2,c2=map(int,input().split())
if(intersect(a2,b2,c2)):
ans+=1
print(ans)
|
Title: Crazy Town
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Crazy Town is a plane on which there are *n* infinite line roads. Each road is defined by the equation *a**i**x*<=+<=*b**i**y*<=+<=*c**i*<==<=0, where *a**i* and *b**i* are not both equal to the zero. The roads divide the plane into connected regions, possibly of infinite space. Let's call each such region a block. We define an intersection as the point where at least two different roads intersect.
Your home is located in one of the blocks. Today you need to get to the University, also located in some block. In one step you can move from one block to another, if the length of their common border is nonzero (in particular, this means that if the blocks are adjacent to one intersection, but have no shared nonzero boundary segment, then it are not allowed to move from one to another one in one step).
Determine what is the minimum number of steps you have to perform to get to the block containing the university. It is guaranteed that neither your home nor the university is located on the road.
Input Specification:
The first line contains two space-separated integers *x*1, *y*1 (<=-<=106<=β€<=*x*1,<=*y*1<=β€<=106) β the coordinates of your home.
The second line contains two integers separated by a space *x*2, *y*2 (<=-<=106<=β€<=*x*2,<=*y*2<=β€<=106) β the coordinates of the university you are studying at.
The third line contains an integer *n* (1<=β€<=*n*<=β€<=300) β the number of roads in the city. The following *n* lines contain 3 space-separated integers (<=-<=106<=β€<=*a**i*,<=*b**i*,<=*c**i*<=β€<=106; |*a**i*|<=+<=|*b**i*|<=><=0) β the coefficients of the line *a**i**x*<=+<=*b**i**y*<=+<=*c**i*<==<=0, defining the *i*-th road. It is guaranteed that no two roads are the same. In addition, neither your home nor the university lie on the road (i.e. they do not belong to any one of the lines).
Output Specification:
Output the answer to the problem.
Demo Input:
['1 1\n-1 -1\n2\n0 1 0\n1 0 0\n', '1 1\n-1 -1\n3\n1 0 0\n0 1 0\n1 1 -3\n']
Demo Output:
['2\n', '2\n']
Note:
Pictures to the samples are presented below (A is the point representing the house; B is the point representing the university, different blocks are filled with different colors):
|
```python
x1,y1=map(int,input().split())
x2,y2=map(int,input().split())
a1=y1-y2
b1=x2-x1
c1=x2*(y2-y1)-y2*(x2-x1)
def intersect(a2,b2,c2):
global a1,b1,c1,x1,y1,x2,y2
if(a1*b2==a2*b1):
return False
x=(b1*c2-b2*c1)/(a1*b2-b1*a2)
y=(a1*c2-c1*a2)/(b1*a2-a1*b2)
if(min(x1,x2)<=x<=max(x1,x2) and min(y1,y2)<=y<=max(y1,y2)):
return True
return False
m=int(input())
ans=0
for i in range(m):
a2,b2,c2=map(int,input().split())
if(intersect(a2,b2,c2)):
ans+=1
print(ans)
```
| 3
|
|
672
|
A
|
Summer Camp
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
|
The only line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=1000)Β β the position of the digit you need to print.
|
Print the *n*-th digit of the line.
|
[
"3\n",
"11\n"
] |
[
"3\n",
"0\n"
] |
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
| 500
|
[
{
"input": "3",
"output": "3"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "29",
"output": "9"
},
{
"input": "30",
"output": "2"
},
{
"input": "1000",
"output": "3"
},
{
"input": "999",
"output": "9"
},
{
"input": "100",
"output": "5"
},
{
"input": "123",
"output": "6"
},
{
"input": "8",
"output": "8"
},
{
"input": "157",
"output": "3"
},
{
"input": "289",
"output": "1"
},
{
"input": "179",
"output": "4"
},
{
"input": "942",
"output": "0"
},
{
"input": "879",
"output": "9"
},
{
"input": "394",
"output": "1"
},
{
"input": "423",
"output": "7"
},
{
"input": "952",
"output": "3"
},
{
"input": "121",
"output": "5"
},
{
"input": "613",
"output": "2"
},
{
"input": "945",
"output": "1"
},
{
"input": "270",
"output": "6"
},
{
"input": "781",
"output": "2"
},
{
"input": "453",
"output": "7"
},
{
"input": "171",
"output": "0"
},
{
"input": "643",
"output": "2"
},
{
"input": "570",
"output": "6"
},
{
"input": "750",
"output": "6"
},
{
"input": "500",
"output": "0"
},
{
"input": "2",
"output": "2"
},
{
"input": "1",
"output": "1"
},
{
"input": "108",
"output": "5"
},
{
"input": "500",
"output": "0"
},
{
"input": "189",
"output": "9"
},
{
"input": "491",
"output": "0"
},
{
"input": "191",
"output": "0"
}
] | 1,590,842,682
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 140
| 0
|
s=""
for i in range(1,1000):
f=str(i)
s=s+f
n=int(input())
print(s[n-1])
|
Title: Summer Camp
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
Input Specification:
The only line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=1000)Β β the position of the digit you need to print.
Output Specification:
Print the *n*-th digit of the line.
Demo Input:
['3\n', '11\n']
Demo Output:
['3\n', '0\n']
Note:
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
|
```python
s=""
for i in range(1,1000):
f=str(i)
s=s+f
n=int(input())
print(s[n-1])
```
| 3
|
|
369
|
A
|
Valera and Plates
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Valera is a lazy student. He has *m* clean bowls and *k* clean plates.
Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates.
When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
|
The first line of the input contains three integers *n*, *m*, *k* (1<=β€<=*n*,<=*m*,<=*k*<=β€<=1000)Β β the number of the planned days, the number of clean bowls and the number of clean plates.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
|
Print a single integer β the minimum number of times Valera will need to wash a plate/bowl.
|
[
"3 1 1\n1 2 1\n",
"4 3 1\n1 1 1 1\n",
"3 1 2\n2 2 2\n",
"8 2 2\n1 2 1 2 1 2 1 2\n"
] |
[
"1\n",
"1\n",
"0\n",
"4\n"
] |
In the first sample Valera will wash a bowl only on the third day, so the answer is one.
In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once.
In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
| 500
|
[
{
"input": "3 1 1\n1 2 1",
"output": "1"
},
{
"input": "4 3 1\n1 1 1 1",
"output": "1"
},
{
"input": "3 1 2\n2 2 2",
"output": "0"
},
{
"input": "8 2 2\n1 2 1 2 1 2 1 2",
"output": "4"
},
{
"input": "2 100 100\n2 2",
"output": "0"
},
{
"input": "1 1 1\n2",
"output": "0"
},
{
"input": "233 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 1 2 1 2 2 2 2 2 2 2 2 1 1 2 1 2 1 2 2",
"output": "132"
},
{
"input": "123 100 1\n2 2 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 2 1 2 2 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 2 2 2 1 1 1 1 1 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 1 1",
"output": "22"
},
{
"input": "188 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1",
"output": "87"
},
{
"input": "3 1 2\n1 1 1",
"output": "2"
},
{
"input": "3 2 2\n1 1 1",
"output": "1"
},
{
"input": "3 2 1\n1 1 1",
"output": "1"
},
{
"input": "3 1 1\n1 1 1",
"output": "2"
},
{
"input": "5 1 2\n2 2 2 2 2",
"output": "2"
},
{
"input": "5 2 2\n2 2 2 2 2",
"output": "1"
},
{
"input": "5 2 1\n2 2 2 2 2",
"output": "2"
},
{
"input": "5 1 1\n2 2 2 2 2",
"output": "3"
},
{
"input": "1 1 2\n2",
"output": "0"
},
{
"input": "1 2 2\n2",
"output": "0"
},
{
"input": "1 2 1\n2",
"output": "0"
},
{
"input": "1 1 1\n2",
"output": "0"
},
{
"input": "6 3 1\n1 1 2 2 2 2",
"output": "2"
},
{
"input": "100 40 20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "40"
},
{
"input": "7 5 2\n2 2 1 1 1 1 1",
"output": "0"
},
{
"input": "10 4 4\n2 2 2 2 2 2 1 1 1 1",
"output": "2"
},
{
"input": "3 2 1\n2 1 1",
"output": "0"
},
{
"input": "7 6 1\n2 1 1 1 1 1 1",
"output": "0"
},
{
"input": "7 5 1\n1 1 1 2 2 2 2",
"output": "1"
},
{
"input": "5 3 1\n1 1 2 2 2",
"output": "1"
},
{
"input": "3 1 1\n2 2 2",
"output": "1"
},
{
"input": "5 2 2\n2 2 2 2 2",
"output": "1"
},
{
"input": "3 1 3\n1 1 1",
"output": "2"
},
{
"input": "5 2 1\n1 1 2 2 2",
"output": "2"
},
{
"input": "4 3 2\n2 1 1 1",
"output": "0"
},
{
"input": "4 2 1\n1 2 2 2",
"output": "1"
},
{
"input": "14 4 7\n1 1 1 2 2 2 2 2 2 2 2 2 2 2",
"output": "3"
},
{
"input": "12 10 4\n2 2 2 2 2 2 1 1 1 1 1 1",
"output": "0"
},
{
"input": "5 3 2\n2 2 1 1 1",
"output": "0"
}
] | 1,620,705,832
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 63
| 108
| 20,172,800
|
n, m, k = map(int, input().split())
daf = list(map(int, input().split()))
c = 0
total = 0
while (m>0 or k>0) and c < n:
f = daf[c]
if f == 1:
if m > 0:
m -= 1
else:
total += 1
else:
if k > 0:
k -= 1
elif m > 0:
m -= 1
else:
total += 1
c += 1
print(total + n - c)
|
Title: Valera and Plates
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a lazy student. He has *m* clean bowls and *k* clean plates.
Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates.
When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
Input Specification:
The first line of the input contains three integers *n*, *m*, *k* (1<=β€<=*n*,<=*m*,<=*k*<=β€<=1000)Β β the number of the planned days, the number of clean bowls and the number of clean plates.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=β€<=*a**i*<=β€<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
Output Specification:
Print a single integer β the minimum number of times Valera will need to wash a plate/bowl.
Demo Input:
['3 1 1\n1 2 1\n', '4 3 1\n1 1 1 1\n', '3 1 2\n2 2 2\n', '8 2 2\n1 2 1 2 1 2 1 2\n']
Demo Output:
['1\n', '1\n', '0\n', '4\n']
Note:
In the first sample Valera will wash a bowl only on the third day, so the answer is one.
In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once.
In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
|
```python
n, m, k = map(int, input().split())
daf = list(map(int, input().split()))
c = 0
total = 0
while (m>0 or k>0) and c < n:
f = daf[c]
if f == 1:
if m > 0:
m -= 1
else:
total += 1
else:
if k > 0:
k -= 1
elif m > 0:
m -= 1
else:
total += 1
c += 1
print(total + n - c)
```
| 3
|
|
721
|
A
|
One-dimensional Japanese Crossword
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=Γ<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=Γ<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
|
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=100)Β β the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W'Β β to white square in the row that Adaltik drew).
|
The first line should contain a single integer *k*Β β the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
|
[
"3\nBBW\n",
"5\nBWBWB\n",
"4\nWWWW\n",
"4\nBBBB\n",
"13\nWBBBBWWBWBBBW\n"
] |
[
"1\n2 ",
"3\n1 1 1 ",
"0\n",
"1\n4 ",
"3\n4 1 3 "
] |
The last sample case correspond to the picture in the statement.
| 500
|
[
{
"input": "3\nBBW",
"output": "1\n2 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "4\nWWWW",
"output": "0"
},
{
"input": "4\nBBBB",
"output": "1\n4 "
},
{
"input": "13\nWBBBBWWBWBBBW",
"output": "3\n4 1 3 "
},
{
"input": "1\nB",
"output": "1\n1 "
},
{
"input": "2\nBB",
"output": "1\n2 "
},
{
"input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB",
"output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "1\nW",
"output": "0"
},
{
"input": "2\nWW",
"output": "0"
},
{
"input": "2\nWB",
"output": "1\n1 "
},
{
"input": "2\nBW",
"output": "1\n1 "
},
{
"input": "3\nBBB",
"output": "1\n3 "
},
{
"input": "3\nBWB",
"output": "2\n1 1 "
},
{
"input": "3\nWBB",
"output": "1\n2 "
},
{
"input": "3\nWWB",
"output": "1\n1 "
},
{
"input": "3\nWBW",
"output": "1\n1 "
},
{
"input": "3\nBWW",
"output": "1\n1 "
},
{
"input": "3\nWWW",
"output": "0"
},
{
"input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB",
"output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 "
},
{
"input": "5\nBBBWB",
"output": "2\n3 1 "
},
{
"input": "5\nBWWWB",
"output": "2\n1 1 "
},
{
"input": "5\nWWWWB",
"output": "1\n1 "
},
{
"input": "5\nBWWWW",
"output": "1\n1 "
},
{
"input": "5\nBBBWW",
"output": "1\n3 "
},
{
"input": "5\nWWBBB",
"output": "1\n3 "
},
{
"input": "10\nBBBBBWWBBB",
"output": "2\n5 3 "
},
{
"input": "10\nBBBBWBBWBB",
"output": "3\n4 2 2 "
},
{
"input": "20\nBBBBBWWBWBBWBWWBWBBB",
"output": "6\n5 1 2 1 1 3 "
},
{
"input": "20\nBBBWWWWBBWWWBWBWWBBB",
"output": "5\n3 2 1 1 3 "
},
{
"input": "20\nBBBBBBBBWBBBWBWBWBBB",
"output": "5\n8 3 1 1 3 "
},
{
"input": "20\nBBBWBWBWWWBBWWWWBWBB",
"output": "6\n3 1 1 2 1 2 "
},
{
"input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB",
"output": "5\n6 1 1 1 12 "
},
{
"input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB",
"output": "9\n5 1 2 1 1 4 1 1 8 "
},
{
"input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB",
"output": "7\n11 1 1 8 1 1 6 "
},
{
"input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW",
"output": "9\n5 1 1 1 1 2 2 1 1 "
},
{
"input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB",
"output": "6\n1 1 1 1 1 5 "
},
{
"input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB",
"output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB",
"output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n100 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB",
"output": "11\n20 1 1 1 2 1 1 1 1 1 20 "
},
{
"input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB",
"output": "11\n4 1 1 1 1 2 1 1 1 1 6 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "10\nWWBWWWBWBB",
"output": "3\n1 1 2 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n17 31 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n24 42 "
},
{
"input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB",
"output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 "
},
{
"input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB",
"output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 "
},
{
"input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB",
"output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 "
},
{
"input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB",
"output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 "
},
{
"input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB",
"output": "11\n1 5 3 4 3 1 1 2 1 2 4 "
}
] | 1,618,969,100
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 62
| 0
|
n = int(input())
row = input()
row_arr = row.split("W")
row_arr = [i for i in row_arr if i != '']
print(len(row_arr))
#print(row_arr) # debugging
for i in row_arr:
print(len(i),end=" ")
|
Title: One-dimensional Japanese Crossword
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=Γ<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=Γ<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
Input Specification:
The first line of the input contains a single integer *n* (1<=β€<=*n*<=β€<=100)Β β the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W'Β β to white square in the row that Adaltik drew).
Output Specification:
The first line should contain a single integer *k*Β β the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
Demo Input:
['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n']
Demo Output:
['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 ']
Note:
The last sample case correspond to the picture in the statement.
|
```python
n = int(input())
row = input()
row_arr = row.split("W")
row_arr = [i for i in row_arr if i != '']
print(len(row_arr))
#print(row_arr) # debugging
for i in row_arr:
print(len(i),end=" ")
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
|
Output one number β the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,614,517,340
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 124
| 0
|
m, n = map(int, input().split())
if ((int(m) * int(n)) % 2) == 0:
y = ((int(m) * int(n) * 0.5))
print(int(y))
elif((int(m) * int(n)) % 2) == 1:
y = (((int(m) * int(n)) - 1) * 0.5)
print(int(y))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=Γ<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* β board sizes in squares (1<=β€<=*M*<=β€<=*N*<=β€<=16).
Output Specification:
Output one number β the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
m, n = map(int, input().split())
if ((int(m) * int(n)) % 2) == 0:
y = ((int(m) * int(n) * 0.5))
print(int(y))
elif((int(m) * int(n)) % 2) == 1:
y = (((int(m) * int(n)) - 1) * 0.5)
print(int(y))
```
| 3.969
|
228
|
A
|
Is your horseshoe on the other hoof?
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
|
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=β€<=*s*1,<=*s*2,<=*s*3,<=*s*4<=β€<=109) β the colors of horseshoes Valera has.
Consider all possible colors indexed with integers.
|
Print a single integer β the minimum number of horseshoes Valera needs to buy.
|
[
"1 7 3 3\n",
"7 7 7 7\n"
] |
[
"1\n",
"3\n"
] |
none
| 500
|
[
{
"input": "1 7 3 3",
"output": "1"
},
{
"input": "7 7 7 7",
"output": "3"
},
{
"input": "81170865 673572653 756938629 995577259",
"output": "0"
},
{
"input": "3491663 217797045 522540872 715355328",
"output": "0"
},
{
"input": "251590420 586975278 916631563 586975278",
"output": "1"
},
{
"input": "259504825 377489979 588153796 377489979",
"output": "1"
},
{
"input": "652588203 931100304 931100304 652588203",
"output": "2"
},
{
"input": "391958720 651507265 391958720 651507265",
"output": "2"
},
{
"input": "90793237 90793237 90793237 90793237",
"output": "3"
},
{
"input": "551651653 551651653 551651653 551651653",
"output": "3"
},
{
"input": "156630260 609654355 668943582 973622757",
"output": "0"
},
{
"input": "17061017 110313588 434481173 796661222",
"output": "0"
},
{
"input": "24975422 256716298 337790533 690960249",
"output": "0"
},
{
"input": "255635360 732742923 798648949 883146723",
"output": "0"
},
{
"input": "133315691 265159773 734556507 265159773",
"output": "1"
},
{
"input": "28442865 741657755 978106882 978106882",
"output": "1"
},
{
"input": "131245479 174845575 497483467 131245479",
"output": "1"
},
{
"input": "139159884 616215581 958341883 616215581",
"output": "1"
},
{
"input": "147784432 947653080 947653080 947653080",
"output": "2"
},
{
"input": "94055790 756126496 756126496 94055790",
"output": "2"
},
{
"input": "240458500 511952208 240458500 511952208",
"output": "2"
},
{
"input": "681828506 972810624 972810624 681828506",
"output": "2"
},
{
"input": "454961014 454961014 454961014 454961014",
"output": "3"
},
{
"input": "915819430 915819430 915819430 915819430",
"output": "3"
},
{
"input": "671645142 671645142 671645142 671645142",
"output": "3"
},
{
"input": "132503558 132503558 132503558 132503558",
"output": "3"
},
{
"input": "5 5 999999 6",
"output": "1"
},
{
"input": "1 1 2 5",
"output": "1"
},
{
"input": "2 1 2 3",
"output": "1"
},
{
"input": "1 1 3 5",
"output": "1"
},
{
"input": "1 1 3 3",
"output": "2"
},
{
"input": "2 2 2 1",
"output": "2"
},
{
"input": "3 1 1 1",
"output": "2"
},
{
"input": "1 2 2 2",
"output": "2"
}
] | 1,698,323,129
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 34
| 122
| 0
|
shoes = list(input().split())
shoes = list(map(int, shoes))
colours = []
count = 0
for i in range(len(shoes)):
if shoes[i] in colours:
count += 1
else:
colours.append(shoes[i])
print(count)
|
Title: Is your horseshoe on the other hoof?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
Input Specification:
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=β€<=*s*1,<=*s*2,<=*s*3,<=*s*4<=β€<=109) β the colors of horseshoes Valera has.
Consider all possible colors indexed with integers.
Output Specification:
Print a single integer β the minimum number of horseshoes Valera needs to buy.
Demo Input:
['1 7 3 3\n', '7 7 7 7\n']
Demo Output:
['1\n', '3\n']
Note:
none
|
```python
shoes = list(input().split())
shoes = list(map(int, shoes))
colours = []
count = 0
for i in range(len(shoes)):
if shoes[i] in colours:
count += 1
else:
colours.append(shoes[i])
print(count)
```
| 3
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=β€<=*n*<=β€<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integerΒ β the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,607,593,338
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 109
| 0
|
t = list(input())
q_inds = [i for i, x in enumerate(t) if x == "Q"]
a_inds = [i for i, x in enumerate(t) if x == "A"]
ans = 0
for i, qi in enumerate(q_inds):
for ai in a_inds:
if qi < ai:
for qi_2 in q_inds[i+1:]:
if ai < qi_2:
ans += 1
print(ans)
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=β€<=*n*<=β€<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integerΒ β the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
t = list(input())
q_inds = [i for i, x in enumerate(t) if x == "Q"]
a_inds = [i for i, x in enumerate(t) if x == "A"]
ans = 0
for i, qi in enumerate(q_inds):
for ai in a_inds:
if qi < ai:
for qi_2 in q_inds[i+1:]:
if ai < qi_2:
ans += 1
print(ans)
```
| 3
|
|
534
|
A
|
Exam
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
An exam for *n* students will take place in a long and narrow room, so the students will sit in a line in some order. The teacher suspects that students with adjacent numbers (*i* and *i*<=+<=1) always studied side by side and became friends and if they take an exam sitting next to each other, they will help each other for sure.
Your task is to choose the maximum number of students and make such an arrangement of students in the room that no two students with adjacent numbers sit side by side.
|
A single line contains integer *n* (1<=β€<=*n*<=β€<=5000) β the number of students at an exam.
|
In the first line print integer *k* β the maximum number of students who can be seated so that no two students with adjacent numbers sit next to each other.
In the second line print *k* distinct integers *a*1,<=*a*2,<=...,<=*a**k* (1<=β€<=*a**i*<=β€<=*n*), where *a**i* is the number of the student on the *i*-th position. The students on adjacent positions mustn't have adjacent numbers. Formally, the following should be true: |*a**i*<=-<=*a**i*<=+<=1|<=β <=1 for all *i* from 1 to *k*<=-<=1.
If there are several possible answers, output any of them.
|
[
"6",
"3\n"
] |
[
"6\n1 5 3 6 2 4",
"2\n1 3"
] |
none
| 500
|
[
{
"input": "6",
"output": "6\n5 3 1 6 4 2 "
},
{
"input": "3",
"output": "2\n1 3"
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "2",
"output": "1\n1"
},
{
"input": "4",
"output": "4\n3 1 4 2 "
},
{
"input": "5",
"output": "5\n5 3 1 4 2 "
},
{
"input": "7",
"output": "7\n7 5 3 1 6 4 2 "
},
{
"input": "8",
"output": "8\n7 5 3 1 8 6 4 2 "
},
{
"input": "9",
"output": "9\n9 7 5 3 1 8 6 4 2 "
},
{
"input": "10",
"output": "10\n9 7 5 3 1 10 8 6 4 2 "
},
{
"input": "13",
"output": "13\n13 11 9 7 5 3 1 12 10 8 6 4 2 "
},
{
"input": "16",
"output": "16\n15 13 11 9 7 5 3 1 16 14 12 10 8 6 4 2 "
},
{
"input": "25",
"output": "25\n25 23 21 19 17 15 13 11 9 7 5 3 1 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "29",
"output": "29\n29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 28 26 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "120",
"output": "120\n119 117 115 113 111 109 107 105 103 101 99 97 95 93 91 89 87 85 83 81 79 77 75 73 71 69 67 65 63 61 59 57 55 53 51 49 47 45 43 41 39 37 35 33 31 29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 120 118 116 114 112 110 108 106 104 102 100 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "128",
"output": "128\n127 125 123 121 119 117 115 113 111 109 107 105 103 101 99 97 95 93 91 89 87 85 83 81 79 77 75 73 71 69 67 65 63 61 59 57 55 53 51 49 47 45 43 41 39 37 35 33 31 29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 128 126 124 122 120 118 116 114 112 110 108 106 104 102 100 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 "
},
{
"input": "216",
"output": "216\n215 213 211 209 207 205 203 201 199 197 195 193 191 189 187 185 183 181 179 177 175 173 171 169 167 165 163 161 159 157 155 153 151 149 147 145 143 141 139 137 135 133 131 129 127 125 123 121 119 117 115 113 111 109 107 105 103 101 99 97 95 93 91 89 87 85 83 81 79 77 75 73 71 69 67 65 63 61 59 57 55 53 51 49 47 45 43 41 39 37 35 33 31 29 27 25 23 21 19 17 15 13 11 9 7 5 3 1 216 214 212 210 208 206 204 202 200 198 196 194 192 190 188 186 184 182 180 178 176 174 172 170 168 166 164 162 160 158 156 154 1..."
},
{
"input": "729",
"output": "729\n729 727 725 723 721 719 717 715 713 711 709 707 705 703 701 699 697 695 693 691 689 687 685 683 681 679 677 675 673 671 669 667 665 663 661 659 657 655 653 651 649 647 645 643 641 639 637 635 633 631 629 627 625 623 621 619 617 615 613 611 609 607 605 603 601 599 597 595 593 591 589 587 585 583 581 579 577 575 573 571 569 567 565 563 561 559 557 555 553 551 549 547 545 543 541 539 537 535 533 531 529 527 525 523 521 519 517 515 513 511 509 507 505 503 501 499 497 495 493 491 489 487 485 483 481 479 47..."
},
{
"input": "1111",
"output": "1111\n1111 1109 1107 1105 1103 1101 1099 1097 1095 1093 1091 1089 1087 1085 1083 1081 1079 1077 1075 1073 1071 1069 1067 1065 1063 1061 1059 1057 1055 1053 1051 1049 1047 1045 1043 1041 1039 1037 1035 1033 1031 1029 1027 1025 1023 1021 1019 1017 1015 1013 1011 1009 1007 1005 1003 1001 999 997 995 993 991 989 987 985 983 981 979 977 975 973 971 969 967 965 963 961 959 957 955 953 951 949 947 945 943 941 939 937 935 933 931 929 927 925 923 921 919 917 915 913 911 909 907 905 903 901 899 897 895 893 891 889 8..."
},
{
"input": "1597",
"output": "1597\n1597 1595 1593 1591 1589 1587 1585 1583 1581 1579 1577 1575 1573 1571 1569 1567 1565 1563 1561 1559 1557 1555 1553 1551 1549 1547 1545 1543 1541 1539 1537 1535 1533 1531 1529 1527 1525 1523 1521 1519 1517 1515 1513 1511 1509 1507 1505 1503 1501 1499 1497 1495 1493 1491 1489 1487 1485 1483 1481 1479 1477 1475 1473 1471 1469 1467 1465 1463 1461 1459 1457 1455 1453 1451 1449 1447 1445 1443 1441 1439 1437 1435 1433 1431 1429 1427 1425 1423 1421 1419 1417 1415 1413 1411 1409 1407 1405 1403 1401 1399 1397 ..."
},
{
"input": "1777",
"output": "1777\n1777 1775 1773 1771 1769 1767 1765 1763 1761 1759 1757 1755 1753 1751 1749 1747 1745 1743 1741 1739 1737 1735 1733 1731 1729 1727 1725 1723 1721 1719 1717 1715 1713 1711 1709 1707 1705 1703 1701 1699 1697 1695 1693 1691 1689 1687 1685 1683 1681 1679 1677 1675 1673 1671 1669 1667 1665 1663 1661 1659 1657 1655 1653 1651 1649 1647 1645 1643 1641 1639 1637 1635 1633 1631 1629 1627 1625 1623 1621 1619 1617 1615 1613 1611 1609 1607 1605 1603 1601 1599 1597 1595 1593 1591 1589 1587 1585 1583 1581 1579 1577 ..."
},
{
"input": "2048",
"output": "2048\n2047 2045 2043 2041 2039 2037 2035 2033 2031 2029 2027 2025 2023 2021 2019 2017 2015 2013 2011 2009 2007 2005 2003 2001 1999 1997 1995 1993 1991 1989 1987 1985 1983 1981 1979 1977 1975 1973 1971 1969 1967 1965 1963 1961 1959 1957 1955 1953 1951 1949 1947 1945 1943 1941 1939 1937 1935 1933 1931 1929 1927 1925 1923 1921 1919 1917 1915 1913 1911 1909 1907 1905 1903 1901 1899 1897 1895 1893 1891 1889 1887 1885 1883 1881 1879 1877 1875 1873 1871 1869 1867 1865 1863 1861 1859 1857 1855 1853 1851 1849 1847 ..."
},
{
"input": "2999",
"output": "2999\n2999 2997 2995 2993 2991 2989 2987 2985 2983 2981 2979 2977 2975 2973 2971 2969 2967 2965 2963 2961 2959 2957 2955 2953 2951 2949 2947 2945 2943 2941 2939 2937 2935 2933 2931 2929 2927 2925 2923 2921 2919 2917 2915 2913 2911 2909 2907 2905 2903 2901 2899 2897 2895 2893 2891 2889 2887 2885 2883 2881 2879 2877 2875 2873 2871 2869 2867 2865 2863 2861 2859 2857 2855 2853 2851 2849 2847 2845 2843 2841 2839 2837 2835 2833 2831 2829 2827 2825 2823 2821 2819 2817 2815 2813 2811 2809 2807 2805 2803 2801 2799 ..."
},
{
"input": "3001",
"output": "3001\n3001 2999 2997 2995 2993 2991 2989 2987 2985 2983 2981 2979 2977 2975 2973 2971 2969 2967 2965 2963 2961 2959 2957 2955 2953 2951 2949 2947 2945 2943 2941 2939 2937 2935 2933 2931 2929 2927 2925 2923 2921 2919 2917 2915 2913 2911 2909 2907 2905 2903 2901 2899 2897 2895 2893 2891 2889 2887 2885 2883 2881 2879 2877 2875 2873 2871 2869 2867 2865 2863 2861 2859 2857 2855 2853 2851 2849 2847 2845 2843 2841 2839 2837 2835 2833 2831 2829 2827 2825 2823 2821 2819 2817 2815 2813 2811 2809 2807 2805 2803 2801 ..."
},
{
"input": "4181",
"output": "4181\n4181 4179 4177 4175 4173 4171 4169 4167 4165 4163 4161 4159 4157 4155 4153 4151 4149 4147 4145 4143 4141 4139 4137 4135 4133 4131 4129 4127 4125 4123 4121 4119 4117 4115 4113 4111 4109 4107 4105 4103 4101 4099 4097 4095 4093 4091 4089 4087 4085 4083 4081 4079 4077 4075 4073 4071 4069 4067 4065 4063 4061 4059 4057 4055 4053 4051 4049 4047 4045 4043 4041 4039 4037 4035 4033 4031 4029 4027 4025 4023 4021 4019 4017 4015 4013 4011 4009 4007 4005 4003 4001 3999 3997 3995 3993 3991 3989 3987 3985 3983 3981 ..."
},
{
"input": "4990",
"output": "4990\n4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 4791 4789 ..."
},
{
"input": "4991",
"output": "4991\n4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 4791 ..."
},
{
"input": "4992",
"output": "4992\n4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 4791 ..."
},
{
"input": "4993",
"output": "4993\n4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 ..."
},
{
"input": "4994",
"output": "4994\n4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 4793 ..."
},
{
"input": "4995",
"output": "4995\n4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 ..."
},
{
"input": "4996",
"output": "4996\n4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 4795 ..."
},
{
"input": "4997",
"output": "4997\n4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 ..."
},
{
"input": "4998",
"output": "4998\n4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 4797 ..."
},
{
"input": "4999",
"output": "4999\n4999 4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 ..."
},
{
"input": "5000",
"output": "5000\n4999 4997 4995 4993 4991 4989 4987 4985 4983 4981 4979 4977 4975 4973 4971 4969 4967 4965 4963 4961 4959 4957 4955 4953 4951 4949 4947 4945 4943 4941 4939 4937 4935 4933 4931 4929 4927 4925 4923 4921 4919 4917 4915 4913 4911 4909 4907 4905 4903 4901 4899 4897 4895 4893 4891 4889 4887 4885 4883 4881 4879 4877 4875 4873 4871 4869 4867 4865 4863 4861 4859 4857 4855 4853 4851 4849 4847 4845 4843 4841 4839 4837 4835 4833 4831 4829 4827 4825 4823 4821 4819 4817 4815 4813 4811 4809 4807 4805 4803 4801 4799 ..."
}
] | 1,617,611,086
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 62
| 204,800
|
def odd(lst,n):
for i in range(1,n+1,2):
lst.append(i)
def even(lst,n):
start=2
if len(lst)==1 or n==3:
start=4
for j in range(start,n+1,2):
lst.append(j)
n=int(input())
lst=[]
if n%2==0 and n>2:
even(lst, n)
odd(lst, n)
else:
odd(lst, n)
even(lst, n)
print(len(lst))
print(*lst)
|
Title: Exam
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An exam for *n* students will take place in a long and narrow room, so the students will sit in a line in some order. The teacher suspects that students with adjacent numbers (*i* and *i*<=+<=1) always studied side by side and became friends and if they take an exam sitting next to each other, they will help each other for sure.
Your task is to choose the maximum number of students and make such an arrangement of students in the room that no two students with adjacent numbers sit side by side.
Input Specification:
A single line contains integer *n* (1<=β€<=*n*<=β€<=5000) β the number of students at an exam.
Output Specification:
In the first line print integer *k* β the maximum number of students who can be seated so that no two students with adjacent numbers sit next to each other.
In the second line print *k* distinct integers *a*1,<=*a*2,<=...,<=*a**k* (1<=β€<=*a**i*<=β€<=*n*), where *a**i* is the number of the student on the *i*-th position. The students on adjacent positions mustn't have adjacent numbers. Formally, the following should be true: |*a**i*<=-<=*a**i*<=+<=1|<=β <=1 for all *i* from 1 to *k*<=-<=1.
If there are several possible answers, output any of them.
Demo Input:
['6', '3\n']
Demo Output:
['6\n1 5 3 6 2 4', '2\n1 3']
Note:
none
|
```python
def odd(lst,n):
for i in range(1,n+1,2):
lst.append(i)
def even(lst,n):
start=2
if len(lst)==1 or n==3:
start=4
for j in range(start,n+1,2):
lst.append(j)
n=int(input())
lst=[]
if n%2==0 and n>2:
even(lst, n)
odd(lst, n)
else:
odd(lst, n)
even(lst, n)
print(len(lst))
print(*lst)
```
| 3
|
|
409
|
D
|
Big Data
|
PROGRAMMING
| 1,700
|
[
"*special"
] | null | null |
Little Petya wanted to give an April Fools Day present to some scientists. After some hesitation he decided to give them the array that he got as a present in Codeforces Round #153 (Div.2). The scientists rejoiced at the gift and decided to put some important facts to this array. Here are the first few of the facts:
- The highest mountain above sea level in the world is Mount Everest. Its peak rises to 8848 m. - The largest board game tournament consisted of 958 participants playing chapaev.- The largest online maths competition consisted of 12766 participants.- The Nile is credited as the longest river in the world. From its farthest stream in Burundi, it extends 6695 km in length.- While not in flood, the main stretches of the Amazon river in South America can reach widths of up to 1100 km at its widest points.- Angel Falls is the highest waterfall. Its greatest single drop measures 807 m.- The Hotel Everest View above Namche, Nepal β the village closest to Everest base camp β is at a record height of 31962 m- Uranium is the heaviest of all the naturally occurring elements. Its most common isotope has a nucleus containing 146 neutrons.- The coldest permanently inhabited place is the Siberian village of Oymyakon, where the temperature of -68Β°C was registered in the twentieth century.- The longest snake held in captivity is over 25 feet long. Its name is Medusa.- Colonel Meow holds the world record for longest fur on a cat β almost 134 centimeters.- Sea otters can have up to 10000 hairs per square inch. This is the most dense fur in the animal kingdom.- The largest state of USA is Alaska; its area is 663268 square miles- Alaska has a longer coastline than all of the other 49 U.S. States put together: it is 154103 miles long.- Lake Baikal is the largest freshwater lake in the world. It reaches 1642Β meters in depth and contains around one-fifth of the worldβs unfrozen fresh water.- The most colorful national flag is the one of Turkmenistan, with 106 colors.
|
The input will contain a single integer between 1 and 16.
|
Output a single integer.
|
[
"1\n",
"7\n"
] |
[
"1\n",
"0\n"
] |
none
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "7",
"output": "0"
},
{
"input": "13",
"output": "1"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "16",
"output": "0"
},
{
"input": "11",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "15",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "12",
"output": "0"
},
{
"input": "6",
"output": "1"
},
{
"input": "14",
"output": "0"
}
] | 1,643,029,745
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 16
| 77
| 0
|
s="01001010111001010"
print(s[int(input())])
|
Title: Big Data
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya wanted to give an April Fools Day present to some scientists. After some hesitation he decided to give them the array that he got as a present in Codeforces Round #153 (Div.2). The scientists rejoiced at the gift and decided to put some important facts to this array. Here are the first few of the facts:
- The highest mountain above sea level in the world is Mount Everest. Its peak rises to 8848 m. - The largest board game tournament consisted of 958 participants playing chapaev.- The largest online maths competition consisted of 12766 participants.- The Nile is credited as the longest river in the world. From its farthest stream in Burundi, it extends 6695 km in length.- While not in flood, the main stretches of the Amazon river in South America can reach widths of up to 1100 km at its widest points.- Angel Falls is the highest waterfall. Its greatest single drop measures 807 m.- The Hotel Everest View above Namche, Nepal β the village closest to Everest base camp β is at a record height of 31962 m- Uranium is the heaviest of all the naturally occurring elements. Its most common isotope has a nucleus containing 146 neutrons.- The coldest permanently inhabited place is the Siberian village of Oymyakon, where the temperature of -68Β°C was registered in the twentieth century.- The longest snake held in captivity is over 25 feet long. Its name is Medusa.- Colonel Meow holds the world record for longest fur on a cat β almost 134 centimeters.- Sea otters can have up to 10000 hairs per square inch. This is the most dense fur in the animal kingdom.- The largest state of USA is Alaska; its area is 663268 square miles- Alaska has a longer coastline than all of the other 49 U.S. States put together: it is 154103 miles long.- Lake Baikal is the largest freshwater lake in the world. It reaches 1642Β meters in depth and contains around one-fifth of the worldβs unfrozen fresh water.- The most colorful national flag is the one of Turkmenistan, with 106 colors.
Input Specification:
The input will contain a single integer between 1 and 16.
Output Specification:
Output a single integer.
Demo Input:
['1\n', '7\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
s="01001010111001010"
print(s[int(input())])
```
| 3
|
|
408
|
A
|
Line to Cashier
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=β€<=*k**i*<=β€<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=β€<=*m**i*,<=*j*<=β€<=100)Β β the number of products the *j*-th person in the queue for the *i*-th cash has.
|
Print a single integer β the minimum number of seconds Vasya needs to get to the cashier.
|
[
"1\n1\n1\n",
"4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n"
] |
[
"20\n",
"100\n"
] |
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100Β·5β+β15β=β515 seconds. But if he chooses the second queue, he will need 1Β·5β+β2Β·5β+β2Β·5β+β3Β·5β+β4Β·15β=β100 seconds. He will need 1Β·5β+β9Β·5β+β1Β·5β+β3Β·15β=β100 seconds for the third one and 7Β·5β+β8Β·5β+β2Β·15β=β105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
| 500
|
[
{
"input": "1\n1\n1",
"output": "20"
},
{
"input": "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8",
"output": "100"
},
{
"input": "4\n5 4 5 5\n3 1 3 1 2\n3 1 1 3\n1 1 1 2 2\n2 2 1 1 3",
"output": "100"
},
{
"input": "5\n5 3 6 6 4\n7 5 3 3 9\n6 8 2\n1 10 8 5 9 2\n9 7 8 5 9 10\n9 8 3 3",
"output": "125"
},
{
"input": "5\n10 10 10 10 10\n6 7 8 6 8 5 9 8 10 5\n9 6 9 8 7 8 8 10 8 5\n8 7 7 8 7 5 6 8 9 5\n6 5 10 5 5 10 7 8 5 5\n10 9 8 7 6 9 7 9 6 5",
"output": "480"
},
{
"input": "10\n9 10 10 10 9 5 9 7 8 7\n11 6 10 4 4 15 7 15 5\n3 9 11 12 11 1 13 13 1 5\n6 15 9 12 3 2 8 12 11 10\n7 1 1 6 10 2 6 1 14 2\n8 14 2 3 6 1 14 1 12\n6 10 9 3 5\n13 12 12 7 13 4 4 8 10\n5 6 4 3 14 9 13\n8 12 1 5 7 4 13 1\n1 9 5 3 5 1 4",
"output": "240"
},
{
"input": "10\n5 5 5 5 5 5 5 5 5 5\n5 5 4 5 4\n6 5 7 7 6\n5 4 4 5 5\n4 4 5 5 5\n7 6 4 5 7\n4 6 5 4 5\n6 6 7 6 6\n4 5 4 4 7\n7 5 4 4 5\n6 6 7 4 4",
"output": "190"
},
{
"input": "1\n1\n100",
"output": "515"
},
{
"input": "1\n90\n90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90",
"output": "41850"
}
] | 1,563,261,273
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 140
| 1,536,000
|
class CodeforcesTask408ASolution:
def __init__(self):
self.result = ''
self.cash_count = 0
self.client_cashwise = []
self.baskets = []
def read_input(self):
self.cash_count = int(input())
self.client_cashwise = [int(x) for x in input().split(" ")]
for x in range(self.cash_count):
self.baskets.append([int(x) for x in input().split(" ")])
def process_task(self):
times = [len(x) * 15 + 5 * sum(x) for x in self.baskets]
self.result = str(min(times))
def get_result(self):
return self.result
if __name__ == "__main__":
Solution = CodeforcesTask408ASolution()
Solution.read_input()
Solution.process_task()
print(Solution.get_result())
|
Title: Line to Cashier
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products.
There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that:
- the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change.
Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=100)Β β the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=β€<=*k**i*<=β€<=100), where *k**i* is the number of people in the queue to the *i*-th cashier.
The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=β€<=*m**i*,<=*j*<=β€<=100)Β β the number of products the *j*-th person in the queue for the *i*-th cash has.
Output Specification:
Print a single integer β the minimum number of seconds Vasya needs to get to the cashier.
Demo Input:
['1\n1\n1\n', '4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n']
Demo Output:
['20\n', '100\n']
Note:
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100Β·5β+β15β=β515 seconds. But if he chooses the second queue, he will need 1Β·5β+β2Β·5β+β2Β·5β+β3Β·5β+β4Β·15β=β100 seconds. He will need 1Β·5β+β9Β·5β+β1Β·5β+β3Β·15β=β100 seconds for the third one and 7Β·5β+β8Β·5β+β2Β·15β=β105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
|
```python
class CodeforcesTask408ASolution:
def __init__(self):
self.result = ''
self.cash_count = 0
self.client_cashwise = []
self.baskets = []
def read_input(self):
self.cash_count = int(input())
self.client_cashwise = [int(x) for x in input().split(" ")]
for x in range(self.cash_count):
self.baskets.append([int(x) for x in input().split(" ")])
def process_task(self):
times = [len(x) * 15 + 5 * sum(x) for x in self.baskets]
self.result = str(min(times))
def get_result(self):
return self.result
if __name__ == "__main__":
Solution = CodeforcesTask408ASolution()
Solution.read_input()
Solution.process_task()
print(Solution.get_result())
```
| 3
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=β€<=*n*<=β€<=100) β the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,647,143,270
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
"""
sumOfFinger=sum(fingerShownByFriends)
Dima can show 1 to 5 fingers..
so
k = [sumOfFingers+i for i in range(1,6)]
now we've to check if k[i] prsenet in arithmetic progression whose firstVal=1 and diff=numOfFriens+1
if k[i] is present==
=>>then it means if Dima shows i+1 fingers then..
=>>then counting will end on Dima & hence he'll have to clean the place
"""
def willCountingEndOnDima(n,d):
#check if n is part of arithmetic progression with firstElement=a=1 and diff=d
a=1
return (n-a)%d==0
noOfFriends=int(input())
frndsFingers=list(map(int,input().split(" ")))
sumOfFinger=sum(frndsFingers)
noOfWays=5
for fingerShownByDima in range(1,6):
if willCountingEndOnDima(sumOfFinger+fingerShownByDima, noOfFriends+1):
noOfWays-=1
print(noOfWays)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=β€<=*n*<=β€<=100) β the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
"""
sumOfFinger=sum(fingerShownByFriends)
Dima can show 1 to 5 fingers..
so
k = [sumOfFingers+i for i in range(1,6)]
now we've to check if k[i] prsenet in arithmetic progression whose firstVal=1 and diff=numOfFriens+1
if k[i] is present==
=>>then it means if Dima shows i+1 fingers then..
=>>then counting will end on Dima & hence he'll have to clean the place
"""
def willCountingEndOnDima(n,d):
#check if n is part of arithmetic progression with firstElement=a=1 and diff=d
a=1
return (n-a)%d==0
noOfFriends=int(input())
frndsFingers=list(map(int,input().split(" ")))
sumOfFinger=sum(frndsFingers)
noOfWays=5
for fingerShownByDima in range(1,6):
if willCountingEndOnDima(sumOfFinger+fingerShownByDima, noOfFriends+1):
noOfWays-=1
print(noOfWays)
```
| 3
|
|
701
|
B
|
Cells Not Under Attack
|
PROGRAMMING
| 1,200
|
[
"data structures",
"math"
] | null | null |
Vasya has the square chessboard of size *n*<=Γ<=*n* and *m* rooks. Initially the chessboard is empty. Vasya will consequently put the rooks on the board one after another.
The cell of the field is under rook's attack, if there is at least one rook located in the same row or in the same column with this cell. If there is a rook located in the cell, this cell is also under attack.
You are given the positions of the board where Vasya will put rooks. For each rook you have to determine the number of cells which are not under attack after Vasya puts it on the board.
|
The first line of the input contains two integers *n* and *m* (1<=β€<=*n*<=β€<=100<=000, 1<=β€<=*m*<=β€<=*min*(100<=000,<=*n*2))Β β the size of the board and the number of rooks.
Each of the next *m* lines contains integers *x**i* and *y**i* (1<=β€<=*x**i*,<=*y**i*<=β€<=*n*)Β β the number of the row and the number of the column where Vasya will put the *i*-th rook. Vasya puts rooks on the board in the order they appear in the input. It is guaranteed that any cell will contain no more than one rook.
|
Print *m* integer, the *i*-th of them should be equal to the number of cells that are not under attack after first *i* rooks are put.
|
[
"3 3\n1 1\n3 1\n2 2\n",
"5 2\n1 5\n5 1\n",
"100000 1\n300 400\n"
] |
[
"4 2 0 \n",
"16 9 \n",
"9999800001 \n"
] |
On the picture below show the state of the board after put each of the three rooks. The cells which painted with grey color is not under the attack.
| 750
|
[
{
"input": "3 3\n1 1\n3 1\n2 2",
"output": "4 2 0 "
},
{
"input": "5 2\n1 5\n5 1",
"output": "16 9 "
},
{
"input": "100000 1\n300 400",
"output": "9999800001 "
},
{
"input": "10 4\n2 8\n1 8\n9 8\n6 9",
"output": "81 72 63 48 "
},
{
"input": "30 30\n3 13\n27 23\n18 24\n18 19\n14 20\n7 10\n27 13\n20 27\n11 1\n21 10\n2 9\n28 12\n29 19\n28 27\n27 29\n30 12\n27 2\n4 5\n8 19\n21 2\n24 27\n14 22\n20 3\n18 3\n23 9\n28 6\n15 12\n2 2\n16 27\n1 14",
"output": "841 784 729 702 650 600 600 552 506 484 441 400 380 380 361 342 324 289 272 272 255 240 225 225 210 196 182 182 168 143 "
},
{
"input": "70 31\n22 39\n33 43\n50 27\n70 9\n20 67\n61 24\n60 4\n60 28\n4 25\n30 29\n46 47\n51 48\n37 5\n14 29\n45 44\n68 35\n52 21\n7 37\n18 43\n44 22\n26 12\n39 37\n51 55\n50 23\n51 16\n16 49\n22 62\n35 45\n56 2\n20 51\n3 37",
"output": "4761 4624 4489 4356 4225 4096 3969 3906 3782 3660 3540 3422 3306 3249 3136 3025 2916 2809 2756 2652 2550 2499 2450 2401 2352 2256 2208 2115 2024 1978 1935 "
},
{
"input": "330 17\n259 262\n146 20\n235 69\n84 74\n131 267\n153 101\n32 232\n214 212\n239 157\n121 156\n10 45\n266 78\n52 258\n109 279\n193 276\n239 142\n321 89",
"output": "108241 107584 106929 106276 105625 104976 104329 103684 103041 102400 101761 101124 100489 99856 99225 98910 98282 "
},
{
"input": "500 43\n176 85\n460 171\n233 260\n73 397\n474 35\n290 422\n309 318\n280 415\n485 169\n106 22\n355 129\n180 301\n205 347\n197 93\n263 318\n336 382\n314 350\n476 214\n367 277\n333 166\n500 376\n236 17\n94 73\n116 204\n166 50\n168 218\n144 369\n340 91\n274 360\n171 360\n41 251\n262 478\n27 163\n151 491\n208 415\n448 386\n293 486\n371 479\n330 435\n220 374\n163 316\n155 158\n26 126",
"output": "249001 248004 247009 246016 245025 244036 243049 242064 241081 240100 239121 238144 237169 236196 235710 234740 233772 232806 231842 230880 229920 228962 228006 227052 226100 225150 224202 223256 222312 221840 220899 219960 219023 218088 217620 216688 215758 214830 213904 212980 212058 211138 210220 "
},
{
"input": "99999 1\n54016 16192",
"output": "9999600004 "
},
{
"input": "99991 9\n80814 65974\n12100 98787\n9390 76191\n5628 47659\n80075 25361\n75330 1630\n38758 99962\n33848 40352\n43732 52281",
"output": "9998000100 9997800121 9997600144 9997400169 9997200196 9997000225 9996800256 9996600289 9996400324 "
},
{
"input": "1 1\n1 1",
"output": "0 "
}
] | 1,626,838,620
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 405
| 15,052,800
|
import sys
input = lambda:sys.stdin.readline()
int_arr = lambda: list(map(int,input().split()))
str_arr = lambda: list(map(str,input().split()))
get_str = lambda: map(str,input().split())
get_int = lambda: map(int,input().split())
get_flo = lambda: map(float,input().split())
mod = 1000000007
# def solve():
# pass
# while 1:
# print(100000)
n,r = get_int()
c = 0
a,b = set(),set()
for _ in range(r):
x,y = get_int()
a.add(x);b.add(y)
print((n-len(a))*(n-len(b)))
|
Title: Cells Not Under Attack
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has the square chessboard of size *n*<=Γ<=*n* and *m* rooks. Initially the chessboard is empty. Vasya will consequently put the rooks on the board one after another.
The cell of the field is under rook's attack, if there is at least one rook located in the same row or in the same column with this cell. If there is a rook located in the cell, this cell is also under attack.
You are given the positions of the board where Vasya will put rooks. For each rook you have to determine the number of cells which are not under attack after Vasya puts it on the board.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=β€<=*n*<=β€<=100<=000, 1<=β€<=*m*<=β€<=*min*(100<=000,<=*n*2))Β β the size of the board and the number of rooks.
Each of the next *m* lines contains integers *x**i* and *y**i* (1<=β€<=*x**i*,<=*y**i*<=β€<=*n*)Β β the number of the row and the number of the column where Vasya will put the *i*-th rook. Vasya puts rooks on the board in the order they appear in the input. It is guaranteed that any cell will contain no more than one rook.
Output Specification:
Print *m* integer, the *i*-th of them should be equal to the number of cells that are not under attack after first *i* rooks are put.
Demo Input:
['3 3\n1 1\n3 1\n2 2\n', '5 2\n1 5\n5 1\n', '100000 1\n300 400\n']
Demo Output:
['4 2 0 \n', '16 9 \n', '9999800001 \n']
Note:
On the picture below show the state of the board after put each of the three rooks. The cells which painted with grey color is not under the attack.
|
```python
import sys
input = lambda:sys.stdin.readline()
int_arr = lambda: list(map(int,input().split()))
str_arr = lambda: list(map(str,input().split()))
get_str = lambda: map(str,input().split())
get_int = lambda: map(int,input().split())
get_flo = lambda: map(float,input().split())
mod = 1000000007
# def solve():
# pass
# while 1:
# print(100000)
n,r = get_int()
c = 0
a,b = set(),set()
for _ in range(r):
x,y = get_int()
a.add(x);b.add(y)
print((n-len(a))*(n-len(b)))
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,481,130,423
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 124
| 4,608,000
|
n=int(input())
m=input().split()
jishu=0
oushu=0
for i in range(3):
k=int(m[i])/2-int(m[i])//2
if k==0:
oushu+=1
else:
jishu+=1
if jishu>oushu:
for i in range(n):
kt=int(m[i])/2-int(m[i])//2
if kt==0:
print(i+1)
break
else:
for i in range(n):
kt=int(m[i])/2-int(m[i])//2
if kt!=0:
print(i+1)
break
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=β€<=*n*<=β€<=100) β amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n=int(input())
m=input().split()
jishu=0
oushu=0
for i in range(3):
k=int(m[i])/2-int(m[i])//2
if k==0:
oushu+=1
else:
jishu+=1
if jishu>oushu:
for i in range(n):
kt=int(m[i])/2-int(m[i])//2
if kt==0:
print(i+1)
break
else:
for i in range(n):
kt=int(m[i])/2-int(m[i])//2
if kt!=0:
print(i+1)
break
```
| 3.960417
|
483
|
A
|
Counterexample
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math",
"number theory"
] | null | null |
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=β€<=*a*<=<<=*b*<=<<=*c*<=β€<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=β€<=*a*<=<<=*b*<=<<=*c*<=β€<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
|
The single line contains two positive space-separated integers *l*, *r* (1<=β€<=*l*<=β€<=*r*<=β€<=1018; *r*<=-<=*l*<=β€<=50).
|
Print three positive space-separated integers *a*, *b*, *c*Β β three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
|
[
"2 4\n",
"10 11\n",
"900000000000000009 900000000000000029\n"
] |
[
"2 3 4\n",
"-1\n",
"900000000000000009 900000000000000010 900000000000000021\n"
] |
In the first sample pair (2,β4) is not coprime and pairs (2,β3) and (3,β4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
| 500
|
[
{
"input": "2 4",
"output": "2 3 4"
},
{
"input": "10 11",
"output": "-1"
},
{
"input": "900000000000000009 900000000000000029",
"output": "900000000000000009 900000000000000010 900000000000000021"
},
{
"input": "640097987171091791 640097987171091835",
"output": "640097987171091792 640097987171091793 640097987171091794"
},
{
"input": "19534350415104721 19534350415104725",
"output": "19534350415104722 19534350415104723 19534350415104724"
},
{
"input": "933700505788726243 933700505788726280",
"output": "933700505788726244 933700505788726245 933700505788726246"
},
{
"input": "1 3",
"output": "-1"
},
{
"input": "1 4",
"output": "2 3 4"
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "266540997167959130 266540997167959164",
"output": "266540997167959130 266540997167959131 266540997167959132"
},
{
"input": "267367244641009850 267367244641009899",
"output": "267367244641009850 267367244641009851 267367244641009852"
},
{
"input": "268193483524125978 268193483524125993",
"output": "268193483524125978 268193483524125979 268193483524125980"
},
{
"input": "269019726702209402 269019726702209432",
"output": "269019726702209402 269019726702209403 269019726702209404"
},
{
"input": "269845965585325530 269845965585325576",
"output": "269845965585325530 269845965585325531 269845965585325532"
},
{
"input": "270672213058376250 270672213058376260",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492378",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608523",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691962",
"output": "273150934002691930 273150934002691931 273150934002691932"
},
{
"input": "996517375802030516 996517375802030524",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146694",
"output": "997343614685146644 997343614685146645 997343614685146646"
},
{
"input": "998169857863230068 998169857863230083",
"output": "998169857863230068 998169857863230069 998169857863230070"
},
{
"input": "998996101041313492 998996101041313522",
"output": "998996101041313492 998996101041313493 998996101041313494"
},
{
"input": "999822344219396916 999822344219396961",
"output": "999822344219396916 999822344219396917 999822344219396918"
},
{
"input": "648583102513043 648583102513053",
"output": "648583102513044 648583102513045 648583102513046"
},
{
"input": "266540997167959130 266540997167959131",
"output": "-1"
},
{
"input": "267367244641009850 267367244641009850",
"output": "-1"
},
{
"input": "268193483524125978 268193483524125979",
"output": "-1"
},
{
"input": "269019726702209402 269019726702209402",
"output": "-1"
},
{
"input": "269845965585325530 269845965585325530",
"output": "-1"
},
{
"input": "270672213058376250 270672213058376254",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492379",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608508",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691931",
"output": "-1"
},
{
"input": "996517375802030516 996517375802030518",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146644",
"output": "-1"
},
{
"input": "2147483647 2147483649",
"output": "-1"
},
{
"input": "3 5",
"output": "-1"
},
{
"input": "1 7",
"output": "2 3 4"
},
{
"input": "9 12",
"output": "9 11 12"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "11 13",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
}
] | 1,589,206,044
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 109
| 6,656,000
|
l,r = map(int,input().split())
range = r - l + 1
if (range < 3) or (l % 2 == 1 and range < 4):
print(-1)
else:
if (l % 2 == 0):
print(l,l+1,l+2)
else:
print(l+1,l+2,l+3)
|
Title: Counterexample
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=β€<=*a*<=<<=*b*<=<<=*c*<=β€<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=β€<=*a*<=<<=*b*<=<<=*c*<=β€<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
Input Specification:
The single line contains two positive space-separated integers *l*, *r* (1<=β€<=*l*<=β€<=*r*<=β€<=1018; *r*<=-<=*l*<=β€<=50).
Output Specification:
Print three positive space-separated integers *a*, *b*, *c*Β β three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
Demo Input:
['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n']
Demo Output:
['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n']
Note:
In the first sample pair (2,β4) is not coprime and pairs (2,β3) and (3,β4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
|
```python
l,r = map(int,input().split())
range = r - l + 1
if (range < 3) or (l % 2 == 1 and range < 4):
print(-1)
else:
if (l % 2 == 0):
print(l,l+1,l+2)
else:
print(l+1,l+2,l+3)
```
| 3
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.