description stringlengths 2.98k 3.35M | abstract stringlengths 94 10.6k | cpc int64 0 8 |
|---|---|---|
This application claims benefit of 60/309,226 filed Jul. 31, 2001.
BACKGROUND OF THE INVENTION
The present invention relates generally to the field of protecting people from the negative effects of ultra-violate rays, and specifically to methods and apparatus for applying sunscreen lotion to the body of a use... | An automatic sunscreen application vending apparatus which accepts payment from a user, stores a plurality of grades of sunscreen lotion, allows the user to select a grade of suntan lotion such as by SPF factor, and sprays the user with the selected grade of stored sunscreen lotion after acceptance of payment. | 6 |
This application claims the priority under 35 U.S.C. §119 of European patent application no. 10196871.7, filed on Dec. 23, 2010, the contents of which are incorporated by reference herein.
FIELD OF THE INVENTION
This invention relates to a power management device and method, and more particularly to a devic... | A power management device comprises: an input for receiving a transient energy pulse; a first storage section and a second storage section for storing energy from the input; an output; a switching section for selectively connecting the input, first storage section, second storage section and output in at least first an... | 7 |
[0001] This Application claims the benefit of U.S. Application Ser. No. 60/547,442 of RICHARD COPPOLA filed Feb. 26, 2004 for TELESCOPING UNDERWATER GUIDE, the contents of which are herein incorporated by reference.
[0002] This application is a continuation-in-part of U.S. application Ser. No. 11/050... | Disclosed are systems and methods for drilling in an environment having a fluid and a bed. The method includes positioning a platform such that the fluid is between the platform and the bed; and assembling a guide, the assembled guide being straight. The method subsequently acts to place the guide such that the guide i... | 4 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
The present invention relates to an X-ray examination apparatus which includes: an X-ray image means for providing an X-ray image composed of pixels, each having a grey value, and a brightness control system which is coupled to the X-ray image means in o... | An X-ray examination apparatus is provided including: an X-ray image means for providing an X-ray image composed of pixels each having a grey value, and a brightness control system which is coupled to the X-ray image means in order to apply a brightness control signal of the image to the X-ray image means. The brightne... | 6 |
CONTINUITY DATA
This application is a continuation application of U.S. patent application Ser. No. 14/595,644 filed Jan. 13, 2015, now allowed, which is a continuation of U.S. patent application Ser. No. 14/478,615 filed Sep. 5, 2014, now U.S. Pat. No. 9,015,766, which is a continuation of U.S. patent application... | An apparatus, method and data structure for generating at least one table in a broadcast environment, are provided. The apparatus includes a generator to generate an event information table (EIT) and an extended text table (ETT). The ETT has program guide information for an n-hour span and has a transmission interval. ... | 7 |
This is a division of our copending application Ser. No. 453,911, filed Mar. 22, 1974.
DESCRIPTION OF THE INVENTION
The invention relates to and has among its objects the provision of novel plastic compositions capable of photodegradation. Further objects of the invention will be evident from the ... | Polyolefins capable of photodegradation are prepared by incorporating in the polyolefin an additive which contains chlorine, bromine, or iodine directly linked to the nitrogen atom of an amide or imide group. | 2 |
BACKGROUND OF THE INVENTION
The invention relates to an arrangement for the electrothermal treatment of the human or animal body, in particular for the electrocoagulation or electrotomy.
The use of high-frequency alternating currents in the frequency range of 300 kHz to 2 MHZ for tissue coagulation and tiss... | An arrangement ( 1 ) for electrothermally treating the human body or an animal body, in particular for tissue coagulation or electrotomy, includes two electrodes ( 3, 4 ) for insertion into the body to be treated. The two electrodes ( 3, 4 ) are electrically insulated from each other and are disposed at a distance from... | 0 |
BACKGROUND OF THE INVENTION
[0001] This is a continuation-in-part of application Ser. No. 09/457,454 which is a continuation of Ser. No. 09/222,049. application Ser. No. 09/457,454 is pending.
FIELD OF THE INVENTION
[0002] This invention relates to devices used to clip... | The disposable cutting head is basically a four element clip together assembly with a base, lower and upper cutting blades, and spring. The base serves as the support for the entire assembly and incorporates the attachment elements for retention to a clipper. The spring holds the elements together, forces the cutting b... | 5 |
FIELD OF THE INVENTION
The present invention relates to a method and apparatus for tensioning fabric and particularly, but not exclusively, to a method and apparatus for tensioning a fabric supported by a frame in a marquee.
DESCRIPTION OF RELATED ART
It is well understood in the art that the fabric of a ma... | The present invention relates to a method and apparatus for tensioning fabric and particularly, but not exclusively, to a method and apparatus for tensioning a fabric support by a frame in a marquee. A tensioner ( 2 ) is provided with a mounting device ( 4 ) for mounting the tensioner to a frame ( 100 ) of a marquee an... | 4 |
FIELD OF THE INVENTION
This invention relates in general to devices for injecting medicines into animals and, more particularly, to devices which mark the animal concurrently upon injecting the animal.
BACKGROUND OF THE INVENTION
The days of farmers independently operating small family farms profitabl... | A marking syringe which allows an individual using the syringe to inject a fluid such as a vaccine into an animal and, at the same time, mark the location of the injection on the animal. More specifically, the marking syringe includes a vaccine syringe and an ink syringe connected to a handle. Activation of the handle ... | 0 |
TECHNICAL FIELD
[0001] This invention relates to a polyester resin container made of a polyester resin composition containing a specific ultraviolet absorber. More particularly, it relates to a polyester resin container excellent in heat resistance, colorlessness, and weatherability which is obtained from ... | A polyester resin container with improved weatherability as well as colorlessness and heat resistance, made of a polyester resin composition comprising (A) 100 parts by weight of a polyester resin and (B) 0.01 to 10 parts by weight of a triazine ultraviolet absorber represented by formula (I):
... | 8 |
FIELD OF THE INVENTION
The invention relates to a resonator and more particularly to a multi-chamber resonator box for a vehicle air intake system, the resonator including serially arranged Helmholtz, expansion chamber, annular, and perforated type resonators.
BACKGROUND OF THE INVENTION
In an interna... | A multi-chamber resonator box for a vehicle air intake system, wherein the resonator includes a Helmholtz, an expansion chamber, an annular, and a perforated style resonator to militate against the emission of noise energy caused by intake air. | 5 |
BACKGROUND OF THE INVENTION
[0001] 1. Field of the Invention
[0002] The present invention relates to a chain configured by alternately arranging in a shifted position by a half pitch in a chain longitudinal direction first plate rows and second plate rows including a plurality of plates arranged... | The invention provides a chain and a chain guide plate that suppress occurrence of noise during chain traveling while attaining a reduction in costs and also attaining space saving. A chain includes first plate rows and second late rows. Each of the first plate rows includes a guide plate including a guide slide contac... | 5 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
This invention relates to a table capable of tilting motion, more particularly, to a tilting rotary table device for subjecting a workpiece secured thereon to machining or scribing.
2. Description of the Prior Art
A conventional tilting rotar... | A tilting table for machining works is of the worm and worm wheel type incorporating a hydraulic servomechanism. A displacement of a stylus operating lever effected by the drive worm shaft moves the servocontrol valve out of its neutral position, thereby causing a tilting motion of the table in a desired direction via ... | 5 |
CROSS REFERENCE TO RELATED APPLICATIONS
This application is a 371 of WO 97/45449.
FIELD OF THE INVENTION
This invention relates to dendritic cell receptors. In particular, it relates to human DEC-205, to the production and use thereof, and to ligands which bind to it. Human DEC-205 and its ligands are... | An isolated human dendritic cell receptor comprising amino acid sequences selected from: TVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYN FIITKNRHMATTQDEVQSTCEKLHPKSHILSIRDEKENNFVLEQLLYFNYMA SWVMLGITYRNNSL amino acid at position 1208-1323 of SEQ ID NO:1 and SQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAML amino acid at position ... | 0 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
This invention relates to a process and apparatus for recovery of solvents.
2. Description of the Prior Art
In the known processes and apparatus, which are described, for example, in Ullmann's Encyclopedia of Technical Chemistry, Vol. 1 (... | A process for the recovery of solvents is disclosed. A hot carrier gas stream laden with solvent vapors from an evaporation space is compressed, cooled, and expanded with production of work for condensing and separating the solvent. The carrier gas stream lean in solvent vapors is conducted back into the evaporation sp... | 5 |
CROSS REFERENCE TO RELATED APPLICATION
This application is a continuation of U.S. patent application Ser. No. 10/196,330 filed Jul. 15, 2002 now U.S. Pat. No. 6,601,712 which application is a divisional application of U.S. patent application Ser. No. 09/910,649 filed Jul. 20, 2001 now U.S. Pat. No. 6,460,708 titled... | A rack for carrying a bicycle on a vehicle. The rack includes forward and rear crossbars extending across a top surface of the vehicle and a pair of tower bodies associated with each crossbar to secure the crossbars to the vehicle. A wheel mount is attached to a first one of the crossbars. The wheel mount is adapted to... | 8 |
INCORPORATION BY REFERENCE TO ANY PRIORITY APPLICATIONS
[0001] Any and all applications for which a foreign or domestic priority claim is identified in the Application Data Sheet as filed with the present application are hereby incorporated by reference under 37 CFR 1.57.
[0002] This application... | A non-invasive endometrial sample collector has an outer body of absorbent material configured for insertion into a vaginal cavity of a patient such that a distal end of the body is positioned proximate a uterine cervix of the patient. The collector has an internal collection assembly disposed within the outer body of ... | 0 |
CROSS-REFERENCE TO RELATED PATENTS
The present invention relates to a punch and die unitary tool set for operation by a powder compacting press as disclosed in U.S. Pat. Nos. 3,328,840, 3,561,054, 3,561,056, 3,574,892, 3,645,658, 3,715,796, 3,730,659, 3,741,697 and 3,826,599, all assigned to the same assignee as ... | A punch and die set for operation by the ram of a powder compacting press, comprising at least three concentrically disposed telescopic punches independently reciprocable within a single die cavity. Each punch is separately supported by a punch holder plate, one of which is directly reciprocable from the press ram, ano... | 1 |
BACKGROUND OF THE INVENTION
[0001] The present invention relates to an amphibious vehicle.
[0002] The amphibious vehicle contemplated by the present invention is lightweight in nature. Nevertheless, it requires a power plant with a certain amount of power output in order that the vehicle on ... | Amphibious vehicle needs less power on land than on water. A control system is provided to limit power and/or speed on land, using: restriction of flow of fuel, air, or exhaust gases; heated intake air; exhaust gas recirculation; declutching of a supercharger; bypassing of a turbocharger; a variable throttle stop, dual... | 1 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
The present invention relates to methods and apparatus for circulating and dispensing fluids; more particularly, to methods and apparatus for circulating and dispensing fluids having magnetorheological properties; and most particularly, to methods and ap... | A magnetorheological fluid delivery system includes a mixing and tempering vessel. Fluid is admitted to the vessel via a plurality of tangential ports, creating a mixing of the fluid in the vessel and promoting homogeneity. Fluid may be reconstituted in the vessel by metered addition of carrier fluid. A fixed-speed cen... | 8 |
FIELD OF THE INVENTION
This invention relates to archery and more particularly to apparatus for stabilizing a drawn bow string against inadvertent lateral deflection by the archer's hand.
BACKGROUND OF THE INVENTION
When an archer draws a bow string with a notched arrow he tries to anchor the stri... | A bow string stabilizer bar is telescopically carried by a bracket attached to a bow. The bar carries at its end remote from the bow a bow string clamp and handle assembly and a flexible element, whose length is adjustable, limits the extent to suit an individual archer to which the bar can be telescopically extended a... | 5 |
FIELD OF THE INVENTION
[0001] One exemplary aspect of the present invention is directed toward non-verbal communications. More specifically, one exemplary aspect is directed toward providing information about visually presented information in audio form to either a speaker or a listener such that they can be... | Descriptions of visually presented material are provided to one or more conference participants that do not have video capabilities. This presented material could be any one or more of a document, PowerPoint® presentation, spreadsheet, Webex® presentation, whiteboard, chalkboard, interactive whiteboard, description of ... | 7 |
CROSS REFERENCE TO RELATED APPLICATIONS
This application is a continuation of U.S. application Ser. No. 12/221,516, filed Aug. 4, 2008 and scheduled to issue as U.S. Pat. No. 8,215,251, on Jul. 10, 2012, which is a continuation of U.S. application Ser. No. 11/799,849, filed May 3, 2007, now U.S. Pat. No. 8,176,86... | An undergarment includes at least one piece of fabric that forms the undergarment. The undergarment has leg openings. The fabric includes edges that surround the leg openings, whereby at least one of the edges surrounding the leg openings has a plurality of fibers and at least some of the fibers have free ends terminat... | 8 |
This application claims the priority benefit under 35 U.S.C. section 119 of U.S. Provisional Patent Application No. 60/935,402 entitled “Styrenated Phenol Ethoxylates In Emulsion Polymerization”, filed Aug. 10, 2007, which is in its entirety herein incorporated by reference.
FIELD OF THE INVENTION
... | The present invention relates to the use of Styrenated Phenol Ethoxylates as surfactants in emulsion polymerization. The present invention further relates to the use of both anionic and nonionic Styrenated Phenol Ethoxylates in emulsion polymerization. Latexes with small average particle and narrow particle size distri... | 2 |
This is a divisional of application Ser. No. 07/911,599 filed on Jul. 10, 1992, now U.S. Pat. No. 5,380,301.
BACKGROUND OF THE INVENTION
1. Field of the Invention
This invention relates generally to catheters. More specifically, the present invention relates to a method of attaching a cathet... | A catheter is disclosed which includes a mechanical connection between the strain relief thereof and the hub. The strain relief operates both to secure the catheter tube to the hub and to provide strain relief for the catheter tube. The strain relief connection is assisted in gripping the catheter tube by intentional o... | 1 |
BACKGROUND OF THE INVENTION
This invention relates to the removal of soil from fabric, and, more particularly, to a process for improving the dislodging of soil from the fabric and preventing its redeposition onto the fabric.
Garment dry cleaning is currently performed commercially using organic solvents su... | A piece of soiled fabric is cleaned by contacting it with a jet of an ionized soil-dislodging gas to dislodge the soil therefrom. The ionized gas and the use of an oppositely charged electrostatic filter aid in preventing redeposition of the soil onto the fabric. The fabric may be agitated while it is contacted with th... | 3 |
This application claims priority from Canadian Patent Application No. 2,411,955, filed Nov. 15, 2002, the disclosure of which is incorporated herein by reference.
FIELD OF THE INVENTION
The invention relates to the field of embroidery machines, and more specifically, to a system and method for reducing thread b... | A method for minimizing contact between a needle point and a needle thread in a computer controlled embroidery machine, to prevent breakage of the needle thread by the needle point upon penetration of a workpiece during stitching. The method includes the steps of: determining a first straight path between a current nee... | 3 |
This application claims benefit of provisional application No. 60/062,708 filed Oct. 22,1997.
FIELD OF THE INVENTION
The present invention relates to read channels and more particularly to a Digital Video Disk (DVD) read channel.
BACKGROUND OF THE INVENTION
Currently, DVD read channels... | The present invention implements a maximum likelihood detector for optical disk drive without using a Viterbi detector. The detection algorithm that includes y 0+ y 1 detection is very simple by requiring only one adder and one comparator, and not survival path memories. | 6 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
This invention relates broadly to gas-operated automatic and semi-automatic guns, especially rifles. More particularly, it concerns the improvement of such guns by addition of unique exterior surface configurations on their barrels.
2. Description of the... | Gas-operated automatic and semi-automatic guns are improved by providing their barrels with unique exterior surface configurations to reduce the weight of their barrels while retaining the barrels' original stiffness and to cause the barrels to dissipate heat faster. | 5 |
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This is a Continuation of U.S. application Ser. No. 14/695,089 filed on Apr. 24, 2015, which is a Continuation of U.S. application Ser. No. 12/964,299 filed Dec. 9, 2010 now U.S. Pat. No. 9,022,409 issued May 5, 2015, which is a Continuation of U.S. application ... | A steerable caddy trailer is provided that has an improved structure including a main frame assembly, spindle assemblies attached to each end of the main frame for attachment of a wheel, a pair of swinging arms forwardly extending from the main frame and pivotally attached to the main frame, and tie rods connecting the... | 1 |
This application claims the benefit of U.S. provisional application Ser. No. 60/004,400, filed Sep. 27, 1995.
FIELD OF THE INVENTION
The invention relates to an apparatus for separating vapor from fuel and more particularly to an apparatus for separating vapor from diesel fuel for use in a diesel engine.
... | A fuel/vapor separator apparatus for de-vaporizing fuel entrained with vapor has a hollow canister defining a separation chamber. The canister has an input port for receiving the fuel entrained with vapor, an output port in communication with the engine for removal of the de-vapored fuel from the chamber, and a vapor p... | 5 |
FIELD OF THE INVENTION
The field of this invention is tools run downhole preferably on cable and which operate with on board power to perform a downhole function and more particularly wellbore debris cleanup.
BACKGROUND OF THE INVENTION
It is a common practice to plug wells and to have encroachment of... | A wellbore cleanup tool is run on slickline. It has an onboard power supply and circulation pump. Inlet flow is at the lower end into an inlet pipe that keeps up fluid velocity. The inlet pipe opens to a surrounding annular volume for sand containment and the fluid continues through a screen and into the pump for event... | 4 |
This is a continuation of application Ser. No. 06/735,149 filed May 17 1985, now abandoned which was a continuation-in-part of application Ser. No. 06/619,583 filed 11 June 1984, also now abandoned.
BACKGROUND OF THE INVENTION
1. Field of the Invention
Citrate esters are useful as plasticize... | Citrate esters are formed utilizing organic titanates as a catalyst allowing excess alcohol to be removed. Four citrate esters have been found which provide advantageous plasticizing properties to PVC compositions which include superior toxicity test results and superior soapy water extraction test results. The four ci... | 2 |
CROSS-REFERENCES TO RELATED APPLICATIONS
[0001] This application is a continuation of co-pending U.S. patent application Ser. No. 12/572,558, filed on Oct. 2, 2009, which claims the benefit of U.S. Provisional Patent Application No. 61/102,338 filed Oct. 2, 2008 whose contents are incorporated herein for all... | A multipurpose lighting device comprising a flashlight end, a lantern end including a barrel through which light may pass, and a module mounted between the flashlight end and lantern end. The module includes a first light source configured to direct light out the flashlight end, and a second light source configured to ... | 5 |
RELATED APPLICATIONS
[0001] This application is a continuation of U.S. Ser. No. 11/444,837, filed Jun. 1, 2006, which application is a continuation of U.S. Ser. No. 10/948,827, filed Sep. 23, 2004, which application is a continuation of U.S. Ser. No. 10/731,825, filed Dec. 9, 2003, which application is a c... | 4-[4-(2-pyrrolylcarbonyl)-1-piperazinyl]-3-trifluoromethylbenzoylguanidine hydrochloride and its hydrates, processes for preparing this benzoylguanidine salt and its hydrates, pharmaceutical compositions containing this benzoylguanidine salt and its hydrates, and its use in treating diseases, particularly those in whic... | 2 |
This is a division of copending application Ser. No. 07/634,905 filed on Dec. 27, 1990.
TECHNICAL FIELD
The invention relates to high temperature gas turbines and in particular to cooling of the first to second stage turbine seal area.
BACKGROUND OF THE INVENTION
The turbines of gas tu... | Cooling air to the 1-2 turbine stage seal is supplied in parallel with air to the second vane from a plenum. A modulatable valve in the supply line to the plenum regulates air flow in response to a sensed temperature in the 1-2 seal area at high sensed speeds. Valve and thermocouples are checked for proper operation. I... | 8 |
CROSS REFERENCE TO RELATED APPLICATION
[0001] This application is based upon and claims the benefit of priority from Japanese Patent Application No. 2007-250423, filed on Sep. 27, 2007, the entire contents of which are incorporated herein by reference.
BACKGROUND
[0002] A general color ima... | In one aspect of the present invention, a color filter capable of controlling wavelengths of light to be transmitted therethrough may include a pair of interferometric films which are substantially parallel to each other and which transmit the light; and a drive member which drives at least one film of the pair of the ... | 7 |
This is a continuation of application Ser. No. 08/098,444 filed on Jul. 23, 1993, now abandoned.
BACKGROUND OF THE INVENTION
The present invention relates to a cordless telephone.
In the ETSI Committee in Europe, specifications called CT-2 are under investigation as standards for digital cor... | A method for facilitating communication between parent telephones and child telephones in a cordless telephone system. The method includes steps of dividing a plurality of channels into groups and assigning each parent telephone to one of the groups. When a child telephone is registered with one of the parent telephone... | 7 |
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent Application Ser. No. 61/593,368 filed Feb. 1, 2012, entitled “Exercise Adapter System,” the contents of which are incorporated herein by reference in their entirety.
BACKGROUND
... | A multi-purpose, adjustable fitness apparatus is provided for performing exercises; in particular, sliding pull-ups and push-ups. Two in-line metal bars are interposed by a T-connector. A sliding handle grip may be disposed on each bar between a pair of retaining collars. A radius elbow including a foot is attached to ... | 0 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
The present invention relates to engine control devices, and particularly relates to mechanisms designed to remotely control the throttle, shift and emergency stop functions of marine engines.
2. Description of the Prior Art
A number of remot... | A safety stop switch for a marine engine includes a control unit housing, and a normally closed, single throw toggle switch mounted on the housing and including a switch arm extending away from the housing to permit operation of the switch between closed and open positions. The switch is electrically connected to the e... | 7 |
BACKGROUND OF THE INVENTION
[0001] The present invention relates to method for producing a garland or decorative arrangement using Spanish moss and, more particularly, for making a decorative arrangement using such moss to create a spooky appearance for Halloween.
[0002] Spanish moss ( Tillandsi... | A method is disclosed for treating Spanish moss and for creating a decorative arrangement of the moss. Spanish moss is collected, treated with a pesticide, if necessary, and dried to remove substantially all moisture. The dried moss is separated into strands and draped over a cord that has been pre-treated with an adhe... | 8 |
BACKGROUND OF THE INVENTION
The invention relates to a cabinet hinge having a wall-related part in the form of an elongated arm of substantially channel-like cross section which is coupled pivotingly by a linkage to the door-related part. The door is mounted for adjustment in at least two coordinate directions on... | Cabinet hinge whose cabinet-wall-related part in the form of a cantilever arm can be slipped onto a mounting plate installed on the wall of a cabinet and can then be fixed at selected positions on the mounting plate by tightening a screw. The mounting plate bears a resilient catch which, at the beginning of the install... | 4 |
BACKGROUND OF THE INVENTION
This invention relates to hammocks and, in particular, to a design that compensates for hammock sag without manual readjustment. My criteria were that the hammock had to be light and simple to install, easy to cover, and a better alternative to current hammock models, air mattresses, a... | This disclosure describes a HAMMOCK design which compensates for sag. The lower part of the HAMMOCK becomes level when occupied and allows the user to lie flat on the back or the side as in a bed. The HAMMOCK is equally suited for recreation and camping and is simple to make and easy to install. | 0 |
BACKGROUND
[0001] Spacecraft that are in space are subject to a number of processes that result in a significant electrostatic charging. In the case of rendezvous and proximity operations of one or more spacecraft with one or more other bodies in space, a potential difference can exist between objects, which... | A charge neutralization system is provided. The charge neutralization system includes a reservoir, a plasma generator and a flow restricting transfer line. The reservoir is configured to hold matter to be ionized under pressure. The plasma generator is configured and arranged to create a neutral energy plasma on a vehi... | 1 |
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application is a continuation-in-part of pending international application PCT/EP99/06514, filed on Aug. 21, 1999.
BACKGROUND OF THE INVENTION
[0002] The present invention concerns a new method for in vivo labeling of ... | The invention relates to a novel method for the in-vivo labeling of biopolymers such as proteins, nucleic acids, lipids, carbohydrates and biodegradable plastic using isotopes, especially stabile isotopes. The invention also relates to the use of chemolithotrophic bacteria for the in-vivo isotopic labeling of biopolyme... | 8 |
FIELD OF THE INVENTION
This invention relates to the catalytic polymerization of ethylene using an aluminum-phosphinimine catalyst component.
BACKGROUND OF THE INVENTION
The use of transition metals, especially chromium or Group 4/5 metals such as titanium, zirconium and hafnium as catalysts in the po... | Aluminum-phosphinimine complexes function as a component in a catalyst system for the (co)polymerization of ethylene. The inventive catalyst components form a highly productive polymerization system when activated with so-called “ionic activators”. The need for conventional transition metal catalyst metals (such as tit... | 2 |
FIELD OF THE INVENTION
The invention relates to a power steering apparatus which utilizes an electric motor, and more particularly, to such apparatus which is designed to prevent sounds of percussion from occurring which may be caused by a backlash of a gear which provides a power transmission from an electric mo... | An improvement to an electrically driven power steering apparatus which utilizes an electric motor is disclosed. A bevel gear of a greater diameter is mounted on a steering shaft so as to be axially displaceable thereon, and an urging mechanism is connected between the bevel gear and the steering shaft. The urging mech... | 5 |
BACKGROUND OF THE INVENTION
[0001] 1. Field of the Invention
[0002] The present invention relates to a pattern recognition system for handling an image of a DNA microarray and particularly relates to an image analysis system for a Stanford type microarray having a plurality of blocked spot... | In a microarray image analysis system, when one of a plurality of statuses is set for a spot of a microarray by the user, the status of a similar spot is automatically determined.
In a microarray image, the user determines a status of a spot, the pixel value matrix of an image in a spot region is learned by a ne... | 6 |
This application is a continuation-in-part of application Ser. No. 09/033,819, filed on Mar. 3, 1998, now abandoned.
BACKGROUND AND SUMMARY OF INVENTION
The present invention is directed to pumps and shut off valves and, more particularly, to pumps and shut off valves for use in reverse osmosis wa... | In one embodiment a reverse osmosis permeate pump with shut off valve and reverse osmosis system employs bypassed feed water from the reverse osmosis membrane to drive a water wheel and gear set to reciprocate a piston back and forth between two chambers in the pump. Permeate from the membrane is introduced to the resp... | 1 |
BACKGROUNG OF THE INVENTION
[0001] 1. Field of the Invention
[0002] The present invention relates to a coated paper used in printing and, particularly, to a new coated paper for use in printing which hardly generates any fluting in web-offset printing (in the Japanese printing industry, th... | A coated paper used for printing and manufacturing method thereof. The coated paper comprises a coated layer mainly compose of a pigment and an adhesive on a base paper or paper web. The coated paper also comprises the thermal shrinkage force (R) which satisfies following formula when measured pursuant to the measuring... | 8 |
RELATED APPLICATION
[0001] The present application is a continuation of the Applicants' co-pending U.S. patent application Ser. No. 11/221,634, entitled “Propellant For Fracturing Wells,” filed on Sep. 8, 2005, which claimed priority to U.S. Provisional Patent Application 60/607,929, filed on Sep. 8, 200... | An apparatus for fracturing wells employs a propellant charge and an ignition cord wrapped around the outer surface of the propellant charge to rapidly ignite the outer surface of the propellant charge. | 4 |
This is a divisional of copending application Ser. No. 344,780, filed on Apr. 28, 1989.
BACKGROUND OF THE INVENTION
This invention relates to a reaction vessel or tank structure for use in a suspension polymerization for the manufacture of polyvinyl chloride or vinyl chloride.
In the polymer... | A pressure proof reactor vessel and the method of making such vessel wherein the vessel has a cylindrical one-piece outer wall and a cylindrical one-piece cylindrical inner liner, which liner has a smooth continuous interior surface spaced radially inwardly from the outer wall and concentric thereto. The inner cylindri... | 1 |
FIELD OF THE INVENTION
This invention relates generally to the use of non-naturally occurring specific gold-binding proteins or peptides for use in analytic, exploration or recovery methods in the gold mining industry.
BACKGROUND OF THE INVENTION
Gold is one of the rarest precious metals on earth. It ... | Methods for detecting gold and quantitating gold in ore samples utilizing a gold-specific protein are provided, including methods for multiple sample handling. Also provided are methods for extracting gold from mineral suspensions utilizing a magnetic mineral binding reagent and gold-specific protein, or hydrophobic re... | 2 |
BACKGROUND OF THE INVENTION
The purpose of this invention is to construct a unique combination of elements in a gas turbine engine in order to maximize fuel economy, part power performance, and ease of maintenance. Gas turbine engines are most economical when they are run at full power and, therefore, maximum inl... | A gas turbine engine is constructed having a forward differentially geared power output with an adjacent inlet for the introduction of airflow to the engine. After the airflow is compressed, it is discharged into an annular regenerator which is heated by exhaust gases. A reverse flow can-type combustor is located withi... | 5 |
BACKGROUND OF THE INVENTION
[0001] 1. Field of the Invention
[0002] The present invention relates to semiconductor integrated circuit (IC) chips which can be tailored to include a fuse. The invention further relates to a method of making the improved circuit.
[0003] 2. Rela... | A structure and method of fabricating a metallization fuse line is disclosed. The structure can be formed on a semiconductor substrate, including an insulator structure formed on the substrate, the insulator structure having an upper layer and a lower layer, the upper being thinner than the lower, the insulator structu... | 7 |
FIELD OF THE INVENTION
[0001] The present invention relates to the field of analog-to-digital converters and more particularly to low-voltage drop reference generation circuit for A/D converters basically utilizing a resistor string, two transistors, and two amplifiers.
BACKGROUND ART
[0002] ... | Two cost-effective low-voltage drop reference generation circuits for A/D converter of the present invention generates a plurality of reference voltages characterized by voltage increments between two fixed reference voltages, which are able to be close to positive rail and negative rail (or ground). These low-voltage ... | 7 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
This invention relates to endoscopes which are widely used in the field of medicine and in particular to a compact endoscope having a fine diameter probe for use in hospitals and doctors' offices for outpatient procedures.
2. Description of the... | A micro-endoscopic system employs a pulsed xenon light source and image collection optics with a fine diameter optical probe for an endoscope. Very bright pulses of light emitted by a xenon flash tube increase the intensity of light incident on the light transmitting optics, allowing a reduction in size of the optical ... | 0 |
BACKGROUND
[0001] The present invention relates to a method of laminating an adherend which rarely causes air bubbles to occur between the adherend and an adhesive layer.
[0002] In recent years, a flexible printed circuit (FPC) which is thin and flexible and has excellent flexural characteristic... | There is provided a means for laminating and bonding a flexible printed circuit and a stiffener film with an adhesive layer therebetween by using a laminator without creating air bubbles at the lamination surface and without using large-scale manufacturing equipment. A method comprising: providing a laminate in which l... | 2 |
This invention relates to a process for preparing certain biscyclopentadienyl Group 4 transition metal complexes possessing diene ligands. The complexes are valuable commercial polymerization catalysts for use in preparing polyolefins, especially crystalline polypropylene.
The preparation and characterization of ... | Biscyclopentadienyl, Group 4 transition metal complexes containing a conjugated diene ligand group wherein the diene is bound to the transition metal either in the form of σ-complex or a π-complex are readily prepared by reacting in any order:
a) a Group 4 metal salt corresponding to the formula M'X 3 or M&#... | 2 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
This invention relates to piperazine derivatives, vasodilators containing the same and a vasodilating method for vascular disorders. The piperazine derivatives provided by the present invention are novel compounds which have potent vasodilating activitie... | There are disclosed novel piperazine derivatives and vasodilators containing the same. The compounds are useful for controlling or preventing vascular disorders such as cerebral embolism, myocardial infarction and limb arterial obstruction. As typical compounds are mentioned 1-[5-(3,4,5-trimethoxyphenyl)-2,4-pentadieno... | 2 |
BACKGROUND OF THE INVENTION
[0001] The invention relates to an exhaust gas turbocharger for an internal combustion engine including an exhaust gas turbine and a compressor driven by the exhaust gas turbine, wherein the turbine comprises a turbine housing with a turbine wheel rotatably supported in the tur... | In an exhaust gas turbocharger for an internal combustion engine including an exhaust gas turbine and a compressor connected to the turbine so as to be operated thereby, the turbine includes a housing consisting of an inner and an outer shell formed from steel sheets and being arranged in spaced relationship so as to f... | 8 |
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority based on Japanese Patent Application No. 2002-379970, filed Dec. 27, 2002, the entirety of which is incorporated herein by reference.
BACKGROUND OF THE INVENTION
[0002] The present invention relates to... | In order to provide durable shock absorbers, a bearing to bear a piston rod is enhanced in wear resistance and made low in friction. A cylindrical-shaped bearing for reciprocatory sliding, to bear a piston rod comprises lengthy inclined portions and a short parallel portion on an inner-peripheral surface of the bearing... | 5 |
TECHNICAL FIELD
This invention is in the field of power operated tools used during surgery for cutting, drilling, and similar functions, as applied to muscle, bone, or other types of tissue.
BACKGROUND OF THE INVENTION
During the performance of endoscopic or arthroscopic surgery, it is often necessary... | A portable power cutting tool is disclosed, having a plurality of replaceable tool assemblies for connection to the power cutting tool, with each tool assembly having a different cutting blade and a mode of motion selected for optimum operation of the cutting blade. Each tool assembly has a mode of motion selected from... | 0 |
FIELD OF THE INVENTION
The present invention relates to a method for the treatment/prophylaxis and control of a viral infection in a mammal. The invention also relates to compositions comprising galactofucan sulfate from the marine algae Undaria . This invention has particular application for use in the treatmen... | Methods and compositions for the treatment, control or prophylaxis of a viral infection in a mammal, the method including administering to the mammal an effective amount of galactofucan sulfate from Undaria. | 0 |
ORIGIN OF THE INVENTION
The invention described herein was made by employees of the United States Government and may be manufactured and used by or for the government for government purposes without payment of any royalties thereon or therefore.
FIELD OF THE INVENTION
This invention relates ... | The design of a compact low-loss Magic-T is described. The planar Magic-T incorporates a compact microstrip-slotline tee junction and small microstrip-slotline transition area to reduce slotline radiation. The Magic-T produces broadband in-phase and out-of-phase power combiner/divider responses, has low in-band inserti... | 7 |
BACKGROUND OF THE INVENTION
This invention relates to data acquisition and, in particular, to analog to digital conversion of an electrical signal.
As known in the art, transducers are used in a host of applications to convert the effect of some phenomenon into an electrical signal. The pervasiveness of the... | Analog data is collected by conversion to a digital representation thereof via an analog to digital converter. Reference voltages for the converter are provided by digital to analog converters. The reference voltages are varied under the control of a central processing unit to establish a range of interest in the analo... | 7 |
FIELD OF THE INVENTION
[0001] The present invention relates to a simply-constructed paint-spraying platform, and more particularly to a foldable and expandable paint-spraying platform to provide the advantages including easy carriage, good ventilation, low cost, and enhanced steadiness.
BACKGROUND OF... | A simply-constructed paint-spraying platform comprises: a platform body comprising a top wall, a ventilation part, a bottom wall, two support plates, and a backing plate. When in use, the paint-spraying platform is expanded, and the article to be painted is hung on the first and second hooking holes or placed on the ba... | 1 |
This application is a division of copending U.S. patent application Ser. No. 884,678 filed July 17, 1986 now U.S. Pat. No. 4,737,392, which in turn is a continuation of therewith copending U.S. patent application Ser. No. 678,477 filed Dec. 5, 1984, now abandoned.
BACKGROUND OF THE INVENTION
The p... | A method of manufacturing a steel wire with high tensile strength having improved bending and torsional ductility properties useful as a reinforcement wire or cord, especially for rubber products such as tires, comprising providing steel comprising less than 0.015%, preferably less than 0.010%, and most preferably less... | 8 |
CROSS-REFERENCE TO RELATED APPLICATION
This application is based on a U.S. provisional application filed Jan. 14, 1997, having Ser. No. 60/035,495 now abandoned and priority in that application is claimed for this application.
BACKGROUND OF THE INVENTION
This invention relates to launchers f... | A canister for launching a missile having a cylindrical outer tube with a hemispherical head releaseably secured to its lower end connected through stiffeners to an inner tubular member to form a passage for the gases generated when the missile is fired. A restraint mechanism secures the missile to a base plate, which ... | 5 |
CROSS-REFERENCE TO RELATED APPLICATION
This is a division of application Ser. No. 464,410, filed Feb. 7, 1983 now U.S. Pat. No. 4,483,261.
BACKGROUND OF INVENTION
This invention relates to a multiple needle tufting machine, and more particularly to a needle bar assembly for a multiple needle... | A needle bar assembly for a multiple needle tufting machine including an elongated continuous mounting bar connected to the push rod of the needle drive mechanism for reciprocal movement, and a plurality of elongated, but substantially shorter, needle bar segments having needle holes for receiving the needles and secur... | 3 |
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority from and the benefit of PCT Application No. PCT/EP2007/009368, filed on Oct. 29, 2007; German Patent No. DE 10 2006 051 377.0, filed on Oct. 27, 2006; and German Patent DE 10 2007 016 690.9, filed on Apr. 4, 2007; all entitled “S... | A motor vehicle seat has a structural element that includes a plurality of components, at least some of which are connected to one another. At least one of the components is available in a plurality of materials, such as steel or a lightweight construction. The shape of the components, however, is configured so that it... | 8 |
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of U.S. Provisional Application No. 60/112,510, filed Dec. 14, 1998.
FIELD OF THE INVENTION
The invention is in the field of optical telecommunications, and more particularly, pertains to upgrading an in-service wave... | A wavelength division multiplexed optical communication system includes a plurality of optical line terminals which may be part of separate in service networks, each having a line interface and an all-optical pass-through interface including a plurality of pass-through optical ports, and each also including a plurality... | 7 |
CROSS REFERENCE TO RELATED APPLICATIONS
This application is based upon and claims priority to U.S. Provisional Patent Application No. 60/304,058 filed on Jul. 9, 2001.
BACKGROUND OF INVENTION
1. Field of the Invention
This invention relates to polycrystalline diamond compacts (PDC) used primarily in t... | A superhard compact having an improved superabrasive-substrate interface region design for use in drilling bits, cutting tools and wire dies and the like. This compact is designed to provide an interface design to manipulate residual stresses to enhance the working the strength of the compact. The compact is provided w... | 8 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
This invention relates to a suction recovery apparatus for an ink jet recording apparatus, and in particular to a suction recovery apparatus for easily and reliably recovering from unsatisfactory ink discharge, for example, unsatisfactory discharge durin... | A suction recovery apparatus comprises a capping unit for hermetically sealing the end of a recording head for discharging ink, a unit for mounting the capping unit movement toward the recording head, a negative pressure generating unit for generating a negative pressure, and a lever rotatable about an axis for moving ... | 1 |
This application is a Continuation of Application Ser. No. 07/933,432, Aug. 8, 1992, now abandoned.
BACKGROUND OF THE INVENTION
1. Technical Field
The present invention relates to highly sensitive positive photoresist compositions which are mixtures of certain partially substituted polymeric... | Positive resists sensitive to UV, electron beam, and x-ray radiation which are alkaline developable are formulated from a polymer material comprising recurrent structures having alkaline soluble groups pendent to the polymer backbone, a portion of which groups are substituted with acid labile groups. | 2 |
This is a National Phase Application in the United States of International Patent Application No. PCT/JP2012/004559 filed Jul. 17, 2012, which claims priority on Japanese Patent Application No. 2011-194285, filed Sep. 6, 2011. The entire disclosures of the above patent applications are hereby incorporated by reference.... | An apparatus able to regulate a raw material concentration, in a mixed gas of carrier gas and raw material gas, accurately and stably to supply the mixed gas to a process chamber, with a flow rate controlled highly accurately, thereby detecting a vapor concentration of the raw material gas in the mixed gas easily and h... | 5 |
BACKGROUND OF THE INVENTION
The present invention relates to improved method and device for carrying out loggings in an activated nonflowing production well which provides improved measurements.
Various embodiments of a production log method and device for a nonflowing well requiring, for its bringing in, t... | The method involves introducing a pumping and measuring set into a production well fitted with a pipe or liner perforated in a part extending through a producing zone. This set is fastened to the end of a flow string and comprises an activation pump and at least one set for measuring the produced effluents. The improve... | 4 |
BACKGROUND OF THE INVENTION
The present invention relates to a fluid heater system, and particularly to a single tank fluid heater system with an exterior temperature sensor.
Instantaneous water heating systems have long been used in applications including, for example, dishwashing in commercial food establ... | An instantaneous fluid heating system includes a fluid source, a use point for intermittently demanding fluid from the fluid source, an instantaneous IR gas heater, and a temperature sensor positioned external to the heater. The instantaneous IR gas heater is interposed operatively between the fluid source and the use ... | 5 |
FIELD
The present disclosure relates to a method for balancing a propshaft assembly.
BACKGROUND
This section provides background information related to the present disclosure which is not necessarily prior art.
Various techniques are known for balancing propshaft assemblies, including the weldin... | Methods for correcting a rotational imbalance of a shaft are disclosed. The methods include determining a rotational imbalance of an unbalanced shaft, determining an imbalance correction and mapping the imbalance correction to predetermined points on the shaft. The imbalance correction can be implemented through the ad... | 6 |
BACKGROUND OF THE INVENTION
1. Field of the Invention
The present invention generally relates to light bulb assemblies for vehicles, and in particular, concerns taillight assembly for an automobile wherein a light emitting diode assembly is mounted within a durable water-resistant structure that is used in ... | A light emitting diode (LED) assembly designed to be used in a light bulb mounting assembly in a vehicle, such as taillight or turn indicator assembly. The LED assembly having a plurality of LEDs mounted upon a single circuit board that may be arranged in numerous colors, patterns and shapes to give a distinctive look ... | 5 |
FIELD OF THE INVENTION
[0001] The present invention regards a system of components for the diffusion of sound, which is particularly suitable for permanent or semi-permanent installations in venues dedicated to the production or reproduction of music, speech, sounds or vibrations, outdoors, in cinemas, au... | A system for sound diffusion, particularly at low and infra-low frequencies in rooms used for the reproduction of music and speech including at least one large horn enclosure and an architectural structure with a continuous or intermittent “multi-hemicylindrical” surface. The surface covers the walls of the room, for t... | 4 |
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Application No. 62/240,380, filed Oct. 12, 2015, which is herein incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0002] The present invention relates to aircraf... | A method of making a panel assembly that includes forming a thermoplastic panel, placing a thermoset portion into a pocket in a mold, placing an attachment member into the pocket in the mold, positioning the thermoplastic panel in the mold, cooling the thermoplastic panel while heating the thermoset portion to flow at ... | 1 |
BACKGROUND OF THE INVENTION
[0001] 1. Field of the Invention
[0002] The present invention relates to a twin wire former for the production of a fiber web, specifically a paper, cardboard or tissue web, from a fiber suspension. This type of twin wire former is generally referred to as “Roll... | The invention relates to a twin wire former for the production of a fiber web specifically a paper, cardboard or tissue web, from a fiber suspension. The invention is characterized in that
the rotating forming roll has an open volume and is a non-suction type;
the rotating forming roll has a forming roll ... | 3 |
This application is a divisional part of application Ser. No. 09/957,184, filed on Sep. 21, 2001, now U.S. Pat. No. 6,576,085 B2, which is a divisional of application Ser. No. 09/224,804 filed on Dec. 31, 1998, now U.S. Pat. No. 6,346,169 B1, for which priority is claimed under 35 U.S.C. § 120. This application also cl... | This invention is to provide a paper bulking promoter with which a highly bulky sheet can be obtained without impairing paper strength. Namely, this invention provides a process for producing a bulky paper, comprising the step of making paper from pulp in the presence of a bulking promoter comprising a cationic compoun... | 3 |
TECHNICAL FIELD OF THE INVENTION
[0001] The present invention relates an improved method of detecting microbiological growth and, more particularly, to a method of filtering background noise of chemical redox reactions to prevent or minimize false positives in analyzing a sample using the technique of meas... | According to the present invention, there is disclosed a method of stabilizing the output signal of a system that detects microbiological growth in a sealed sample container that contains a sample which may contain an unknown microorganism. One embodiment relates to a method of providing a sealed sample container which... | 2 |
RELATED U.S. APPLICATION DATA
[0001] This patent application claims priority to U.S. Provisional Patent Application No. 60/451,897 (Attorney Docket No. 15958ROUS01P) filed Mar. 4, 2003; the contents of which are hereby incorporated by reference.
[0002] This patent application is related to the... | A multi-facetted antenna array is disclosed for omnidirectional signalling. The multi-facetted antenna array includes a plurality of abutting facets having a planar region under the patch antenna structures, and curving regions between the planar regions and across the abutting edges of the facets. The planar regions u... | 7 |
FIELD OF THE INVENTION
[0001] The present invention relates to a phase locked loop (PLL) circuit, and more particularly to a wide-locking range phase locked loop circuit using the adaptive post division technique.
BACKGROUND OF THE INVENTION
[0002] Please refer to FIG. 1 , which illustrat... | A wide-locking range phase locked loop circuit includes a decision unit and a closed loop connection comprising a phase frequency detector, a charge pump, a loop filter, a voltage controlled oscillator, and a multi-modulus divider. The decision unit receives a phase difference signal outputted from phase frequency dete... | 7 |
CROSS-REFERENCE TO RELATED APPLICATIONS
This application is a continuation application of U.S. patent application Ser. No. 12/033,120, filed Feb. 19, 2008 now U.S. Pat. No. 7,812,122, which claims the benefit of U.S. provisional patent application 60/918,203 filed Mar. 15, 2007.
STATEMENT REGARDIN... | Disclosed herein are sweet proteins that are variants of Brazzein, and nucleotide sequences capable of expressing them. Through a replacement of a tyrosine residue at the C terminus in the naturally occurring Brazzein sequence, or the insertion of two residues (at least one being isoleucine, glycine or proline) before ... | 2 |
BACKGROUND OF THE INVENTION
[0001] 1. Field of the Invention
[0002] This application relates to both radio frequency as well as free space optical data communication, particularly E-band millimeter wave Radio Frequency data communication.
[0003] 2. Description of the Related Arts
... | A stabilized ultra-high bandwidth capacity transceiver system that combines an E-band (71-76 GHz, 81-86 GHz) millimeter wave RF transceiver with an eye-safe adaptive optics Free Space Optical (FSO) transceiver as a combined apparatus for simultaneous point-to-point commercial communications. The apparatus has a high de... | 7 |
This application claims benefit of Provisional Appln. 60/129,908 filed Apr. 19, 1999.
FIELD OF THE INVENTION
The invention relates to surgical stapler assemblies, and more particularly to surgical stapler assemblies with interchangeable heads for connecting tubular prostheses of different sizes wi... | A surgical stapler assembly for joining a tubular prosthesis to an organic duct such as a blood vessel or artery is disclosed. The assembly has a handle and a set of interchangeable heads attachable to a distal end of the handle. Each head has a staple holder housing a plurality of radially arrayed staples, a plurality... | 0 |
FIELD OF THE INVENTION
[0001] The present invention relates to a method of demand management and control for limited pressure head or gravity fed fluid closed conduit networks, and relates particularly, though not exclusively, to a method of demand management and control for limited pressure head or gravity ... | A method of demand management and control of fluid pipe networks including providing a computer controlled fluid network for delivery of fluid through a plurality of valves, maintaining a real time database of predetermined parameters including flow schedules and valve capabilities, requesting a flow rate and time of d... | 6 |
RELATED APPLICATIONS
This is a continuation of application Ser. No. 08/644,422, filed May 10, 1996 and now U.S. Pat. No. 5,602,741 issued Feb. 11, 1997, which is a continuation of application Ser. No. 08/199,387, filed Feb. 18, 1994, and now U.S. Pat. No. 5,519,620, issued May 21, 1996.
A copending U.S. pat... | A system embodiment of the present invention comprises a fixed and a roving pair of four-observable GPS receivers and a communication link between them for double differencing code and carrier measurements. Carrier phase integer ambiguities are resolved efficiently by searching the simultaneous narrow-lane intersection... | 6 |
CROSS-REFERENCE TO RELATED APPLICATIONS
This application is a continuation of International application PCT/GB01/02919, entitled “Keyless Access Sensor System” filed Jun. 29, 2001 and published as International Publication No. WO 02/02893 A1, the entire content of which is expressly incorporated herein by reference... | A keyless access sensor system for use with a keyless access control mechanism (KACM) is described for controlling the operation of a locking device. The KACM receives a signal from a sensor device for keyless access to create a first output signal before the user has begun any action on the handle in order to open the... | 4 |
CROSS-REFERENCE TO RELATED APPLICATIONS
This application is a continuation of International Application No. PCT/US2014/035042 filed Apr. 22, 2014 which claims the benefit of U.S. Provisional Patent Application No. 61/814,653 filed Apr. 22, 2013.
BACKGROUND OF THE INVENTION
1. Field of the In... | A method has been developed to overcome deficiencies in the prior art in the properties and fabrication of semi-polar group III-nitride templates, films, and materials. A novel variant of hydride vapor phase epitaxy has been developed that provides for controlled growth of nanometer-scale periodic structures. The growt... | 7 |
FIELD OF THE INVENTION
[0001] The present invention generally relates to the fields of pharmaceutical chemistry. More particularly, the present invention relates to a novel method for preparing and purifying 4-(6-Amino-purin-9-yl)-2(S)-hydroxy-butyric acid methyl ester (hereinafter, referred to as DZ2002).
... | The present invention discloses a novel method for preparing and purifying 4-(6-Amino-purin-9-yl)-2(S)-hydroxy-butyric acid methyl ester. The preparation started from cheap and easily available L-malic acid, which was transformed to intermediate I after simultaneous protection of the groups of 1-carboxyl and 2-hydroxyl... | 8 |
FIELD OF THE INVENTION
This invention generally relates to duplicating machines and, more particularly, to ink fountain assemblies for use in duplicating machines.
BACKGROUND OF THE INVENTION
Printing machines, such as rotary offset lithographic duplicating machines, rotary printing presses, or the li... | An ink fountain assembly for use in duplicating machines, such as rotary offset lithographic machines. A fountain trough is defined by an elongated blade extending along one side of the trough and an ink fountain roller extending along the other side of the trough defining a gap therebetween. A plurality of independent... | 1 |
BACKGROUND
[0001] The invention is related to the field of remotely hosted computing, commonly referred to in the information technology industry as “cloud computing”.
SUMMARY
[0002] A primary cloud computing system (CCS) provides a cloud-hosted desktop, in some embodiments employing softw... | Application programs delivered from one or more cloud computing systems (“clouds” or “CCSs”) are integrated into a desktop being delivered/hosted by another cloud (“primary” CCS). In one respect, the integration includes integration of controls for directly launching a separately hosted application program from a deskt... | 6 |
CROSS REFERENCE TO RELATED APPLICATION
[0001] This application is a continuation of Ser. No. 13/507,985, which was filed on Aug. 10, 2012, which was a continuation-in-part patent application which claimed priority to the continuation patent application having Ser. No. 12/806,916, filed on Aug. 24, 2010, whic... | A cosmetic applicator construction that includes a distributable sampling packet that is affixable to a carrier substrate, such as a mailing card or printed publication, to permit distribution of the sampling packet to an end location for use thereat by an individual user. The cosmetic applicator construction is suitab... | 0 |
REFERENCE TO RELATED APPLICATION
[0001] Cross reference is made to copending U.S. patent applications Ser. No. ______ entitled “Adjustable Ground Anchor” (Attorney Docket No. 445-4555-U; 60137-630 PUS1); Ser. No. ______ entitled “Support Arm Positioning Tab” (Attorney Docket No. 445-3448-U; 60137-631 PUS1) a... | An adjustable support for a mailbox includes an arm, a first bracket for attaching to the arm and having a first projection, a second bracket for attaching to the arm and having a second projection, wherein the first projection and the second projection cooperate to achieve a desired dimension upon the arm to support a... | 0 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.