text stringlengths 21 4k | label stringclasses 2 values |
|---|---|
CIENTOMETRIA DAS TESES E DISSERTAÇÕES BRASILEIRAS SOBRE QUESTÃO RACIAL: apontamentos iniciais SCIENTOMETRY OF BRAZILIAN THESES AND DISSERTATIONS ON RACIAL ISSUE: initial notes DOI: https://doi.org/10.5281/zenodo.11235893 1 INTRODUÇÃO Esta comunicação científica tem como temática central a questão racial, sendo o campo de aplicação à produção acadêmica das Instituições de Ensino Superior (IES) administradas pelo Governo Federal em âmbito nacional, com recorte nos cursos de mestrado e doutorado em educação. Utilizou-se a metodologia bibliométrica para trazer à tona informações métricas relacionadas a questão racial e a luta antirracista no período a partir do ano 1988 até 2023, disponibilizados através do Catálogo de Teses e Dissertações (CTD) da CAPES. O problema busca saber quantas são as comunicações científicas que estão representadas na produção de teses e dissertações sobre a questão racial no Brasil. Nesse sentido, nosso objetivo é conhecer a quantidade de comunicações científicas desenvolvidas sobre a temática racial no Brasil de 1988 até o ano de 2023. Os temas que envolvem a questão racial têm ampliado a discussão na sociedade, seja pela denúncia de práticas racistas, seja pelo fortalecimento da luta antirracial. Nesse contexto, a universidade demonstra sintonia com a sociedade em que ela está inserida. Por isso, essa instituição também vai manifestar as contradições, pensamentos e lutas presentes em tais sociedades (Coêlho,1980). | non_poster |
Colección de ESMOS 1 ADN Polimerasa Camila Ojeda-Fernández* iD Licenciatura en Biotecnología, Facultad de Ciencias Biológicas, Benemérita Universidad Autónoma de Puebla, Puebla, México. *Email: camila.ojeda@alumno.buap.mx 25 de Octubre de 2022 DOI: http://doi.org/10.5281/zenodo.7247865 Editado por: Jesús Muñoz-Rojas (Instituto de Ciencias, Benemérita Universidad Autónoma de Puebla). Revisado por: Verónica Quintero-Hernández (Profesora Investigadora de Cátedras CONACYT-Instituto de Ciencias, Benemérita Universidad Autónoma de Puebla). Colección de ESMOS Resumen La ADN Polimerasa es una enzima de suma importancia en el proceso de replicación de ADN. Es la encargada de agregar los nucleótidos correspondientes para crear una nueva hebra de ADN a partir de una prexistente. Los nucleótidos agregados suelen ser referidos como desoxinucleósidos trifosfatos (dNTP). Al agregar nucleótidos se forman enlaces fosfodiester y, las bases nitrogenadas se unen por puentes de hidrógeno. La enzima sintetiza en un sentido 5’-3’ [3, 4]. | non_poster |
2/1/2021 OHBM https://ww4.aievolution.com/hbm2101/index.cfm?do=abs.viewAbs&subView=1&abs=2494 1/6 NeuroHub - Advanced Data and Computational Infrastructure for Collaborative, Reproducible Research Poster No: 2615 Submission Type: Abstract Submission Authors: Bryan Caron , Verena Schuster , Rida Abou-Haider , Natacha Beck , Serge Boroday , Samir Das , Alexandre Hutton , Diana Le , Xavier Lecours-Boucher , Melanie Legault , Emmet O'Brien , Liam O'Callaghan , Darcy Quesnel , Pierre Rioux , Adam Trefonides , Shen Wang , Ksenia Zaytseva , Shawn Brown , Alan Evans , Jean-Baptiste Poline Institutions: McGill University, Montreal, Quebec, McGill Centre for Integrative Neuroscience (MCIN), Ludmer Centre for Neuroinformatics and Mental Health, Montreal Neurological Institute (MNI), McGill University, Montreal, Canada, Montreal Neurological Institute, McGill University, Montreal, Canada, NeuroDataScience-ORIGAMI Lab, Faculty of Medicine and Health Sciences, McGill University, Montreal, Canada, McGill Centre for Integrative Neurosciences MCIN, McGill, McGill, Pittsburg Supercomputing Center, Pittsburg, PA, Montreal Neurological Institute, McGill University, Montreal, Quebec, McGill University, Montreal, Canada First Author: Bryan Caron McGill University|McGill Centre for Integrative Neuroscience (MCIN), Ludmer Centre for Neuroinformatics and Mental Health, Montreal Neurological Institute (MNI), McGill University|Montreal Neurological Institute, McGill University Montreal, Quebec|Montreal, Canada|Montreal, Canada Co-Author(s): Verena Schuster McGill University|NeuroDataScience-ORIGAMI Lab, Faculty of Medicine and Health Sciences, McGill University|Montreal Neurological Institute, McGill University Montreal, Quebec|Montreal, Canada|Montreal, Canada Rida Abou-Haider McGill University|McGill Centre for Integrative Neuroscience (MCIN), Ludmer Centre for Neuroinformatics and Mental Health, Montreal Neurological Institute (MNI), McGill University|Montreal Neurological Institute, McGill University Montreal, Quebec|Montreal, Canada|Montreal, Canada Natacha Beck McGill University|McGill Centre for Integrative Neuroscience (MCIN), Ludmer Centre for Neuroinformatics and Mental Health, Montreal Neurological Institute (MNI), McGill University|Montreal Neurological Institute, McGill 1,2,3 1,4,3 1,2,3 1,2,3 1,2,3 5,2,3 1,4,3 1,2,3 1,2,3 1,2,3 1,2,3 1,2,3 1,2,3 1,2,3 1,3,4 1,2,3 1,2,3 6 7,2,8 1,4,3 1 2 3 4 5 6 7 8 | non_poster |
Building a compendium of expert driven read-across (EDRA) cases to investigate the utility of New Approach Methodology (NAM) data in Generalized Read-Across (GenRA) W Jenkins1,2, T Tate1, I Shah1, G Patlewicz1 1Center for Computational Toxicology and Exposure, US Environmental Protection Agency, RTP, NC 27711, USA ; 2ORISE, Oak Ridge, TN, USA OBJECTIVES • Create a compendium of established and accepted expert driven read-across (EDRA) examples that have been published in the literature. • Extract the data and justification supporting the EDRA examples e.g., identity of source analogues, toxicity data • Compare and contrast case studies of EDRA with those derived objectively with NAM data using GenRA • As a proof of concept, identify structural and biologically based source analogues for 2 substances that were assessed as part of the Provisional Peer Review Toxicity Values (PPRTVs) and estimate their points of departure (PODs) using GenRA APPROACH MAIN RESULTS FUTURE DIRECTIONS • Expand dataset to include all EDRA cases presented in published PPRTVs and modify inclusion criteria. • Repeat structural and biological fingerprint comparison using pairwise and Nearest Neighbor analyses. • Evaluate similarity and dissimilarity in analogue selection for new dataset. • Use GenRA to compute PODs and compare them to published PODs for all PPRTV chemicals. • For more information, contact: Willysha Jenkins | Jenkins.Willysha@epa.gov #P231 Extract and compile relevant information from EDRA cases Select target chemicals for comparative case study Identify and review sources of EDRA cases Create source analogue inventory using ToxVal DB Generate EDRA and GenRA structural and biological chemical fingerprints Identify GenRA source analogues and derive POD estimates GenRA POD estimates for sec-Butylbenzene based on Chemical and Bioactivity based analogues EDRA POD Estimate (mg/kg-day) GenRA Estimate Chemical Fingerprints (mg/kg-day) GenRA Estimate Biological Fingerprints (mg/kg-day) 110 76.14 188.08 | non_poster |
4/1/24, 4:26 PM An Analysis of Iranian University Library Websites from Standpoint Five Effective Factors on Google SEO : Iranian University Librar… https://ieeexplore.ieee.org/document/9443112 1/4 IEEE.org IEEE Xplore IEEE SA IEEE Spectrum More Sites Subscribe Conferences > 2021 7th International Confer... An Analysis of Iranian University Library Websites from Standpoint Five Effective Factors on Google SEO : Iranian University Library Websites and Google SEO Publisher: IEEE Cite This PDF Maryam Tavosi ; Nader Naghshineh All Authors 2 Cites in Papers 263 Full Text Views Donate Cart Create Account << Results Alerts Manage Content Alerts Add to Citation Alerts Abstract Document Sections I. Introduction II. Literature Review III. Materials and Methods IV. Findings V. Conclusion Show Full Outline Authors Figures References Citations Keywords Metrics Downl PDF Abstract:The main purpose of this study was, analysis of library websites of Iranian governmental universities affiliated with the ministry of science from Standpoint, five effect... View more Metadata Abstract: The main purpose of this study was, analysis of library websites of Iranian governmental universities affiliated with the ministry of science from Standpoint, five effective factors on Google Search Engine Optimization (SEO). First, the five factors that impact Google SEO, by the Google Help Center and some previously published articles, Identified. Then 42 library websites of governmental universities affiliated with the ministry of science exception for Payam Noor and Farhangian located in Tehran and other metropolitan cities of Iran with descriptive survey methods were comparison analyses. Data collection tools were analytical databases W3C, Similarweb, Ahrefs. The data analysis tool was "LibreOfficeCalc" software. All stages of the evaluation of library websites from standpoints, SEO factors, approved by eight Google SEO experts. In the four factors impacting Google SEO, the top 11 websites of the research community (42 websites) were identified. Also, Just, 33% of the research community, used "Digital Security Certificate" or HTTPS Protocol for their university library websites (fifth effective factor). It’s worthy, the university library managers in Iran, have high pay attention to improve Google SEO and effective factors on this. Previous studies have noted the role of search engine optimization in libraries or academic libraries, but accurate measurement of five effective factors on Google SEO, in Iranian university library websites, is the innovation of this study. ADVANCED SEARCH All Browse My Settings Help Institutional Sign In Institutional Sign In Personal Sign In | non_poster |
10th Annual Meeting of the Organization for Human Brain Mapping Abstract Number: 2562.1106001 Submitted By: Thomas Nichols Last Modified: 16 Jan 04 Conjunction Inference Using the Bayesian Interpretation of the Positive False Discovery Rate (pFDR) Thomas E. Nichols1 , Tor D. Wager,2 1Department of Biostatistics, University Michigan, Ann Arbor, MI 48109, 2Department of Psychology, Columbia University, New York, NY 10027 Introduction Functional neuroimaging often requires a test for the conjunction of several effects. For example, task A and B may each involve working memory but use different modalities; it is of interest to find brain regions where both task A and B are significantly activated. In separate work (see poster by Brett etal), we show that conjunction inference based on the minimum statistic test (Worsley & Friston, 2000; SPM99; SPM2) does not control the relevant false positive rate. That is, a significant P-value for a minimum statistic only means that one or more of the effects are significant, not that all effects are significant. In this work we propose an approach to conjunction inference which overcomes this fundamental limitations of the minimum statistic test. We use the Bayesian interpretation of the Positive False Discovery Rate (pFDR) (Storey, 2003). A pFDR "q-value" is also the posterior probability of the (random) null hypothesis given the extremity of the data. It is precisely the Bayesian complement of the P-value (a P-value is the probability of the extremity of the data given the null hypothesis). Using posterior probabilities, it is easy to control the relevant conjunction false positive rate, the probability of "not all effects true". We introduce pFDR, describe our method, and apply it to a real dataset. Gentle Methods 1. Create images of pFDR q-values. 2. Sum the q-value images to be conjoined. 3. Reject the conjunction null where sum image is less than 0.05. Statistical Methods pFDR. For one statistic image and a given threshold u, the FDR is the expected proportion of false positives among suprathreshold voxels. The pFDR is same except that it conditions on there being at least one suprathreshold voxel. pFDR has been described as "the rate at which discoveries are false". Bayes & pFDR. Let Ti be the statistic value at voxel i and let Hi be the null hypothesis; Hi = 0 if the null is true or 1 otherwise. Let Hi be random. Then for a threshold u, pFDR(u) = P(Hi = 0 | Ti ! u) (Storey 2003). This is the posterior probability of the null given that voxel i is as or more extreme than u. Conjunction. Now consider conjoining K statistic images. The conjunction null is Uk{Hik=0}, the state of one or more nulls being true. We control the posterior conjunction null probability: P(Uk{Hik=0}|"k{Tik>ti}) # $P(Hik=0|"k{Tik>ti}) | non_poster |
Unabhängige Ausführung computerbasierter Berechnungen im Peer Review mit CODECHECK Daniel Nüst, Opening Reproducible Research (o2r, https://o2r.info) | d.n@wwu.de | doi:10.5281/zenodo.4247655 go.wwu.de/dh2020 This work is licensed under a Creative Commons Attribution 4.0 International License. https://giphy.com/gifs/usnationalarchives-nasa-scientist-scientists-1F1JGyGZhiSAA8Vuhn https://theconversation.com/how-computers-broke-science- and-what-we-can-do-to-fix-it-49938 https://giphy.com/gifs/with-computers-fascination-PxSFAnuubLkSA https://giphy.com/gifs/david-hasselhoff-M3o3fL9nnxG4o CC-BY 3.0, Sebastian Bertalan, Wikimedia Commons Ein Artikel über rechentechnische Wissenschaft ist nicht das Wissen selbst, es ist nur die Werbung. Die tatsächliche Wissenschaft umfasst die komplette Softwareentwicklungsumgebung und die gesamten Handlungsanweisungen welche die Darstellungen erzeugten. https://doi.org/10.1190/1.1822162 https://doi.org/10.1007/978-1-4612-2544-7_5 Claerbouts Anspruch: Ich möchte ihr Interesse für die unabhängige Ausführung computerbasierter Berechnungen im Begutachtungsprozess wecken. WAS IST DAS PROBLEM? Wissenschaftler benutzen Computer. Und zwar immer mehr, weil Computer uns helfen können ansonsten unlösbare Fragen zu beantworten, wie bereits im Grußwort heute morgen festgestellt wurde. ABER die Zusammenarbeit mit unseren digitalen Werkzeugen ist oft nicht reibungslos! Das ist kein Fehler der Wissenschaftler allein, denn unsere virtuellen Labore sind komplizierter als man denkt. Der Archäologe Ben Marwick stellte folgendes fest: moderne Wissenschaft ist so kompliziert und Publikation in Zeitschriften so eingeschränkt, dass Artikel gar nicht alle Details beinhalten können um die genutzten Methoden und die getroffenen Entscheidungen nachhaltig zu dokumentieren. Diese Bruchstelle in der Wissenschaftskommunikation wird immer relevanter. Zu lange haben wir nur gesagt: guckt mal, so sieht das bei mir auf dem Bildschirm am Ende aus. Jedoch kann in den wenigsten Fällen wirklich hingeschaut oder gar hineingeschaut werden! Gutachter evaluieren selten Daten und Code weil Zeit, passende Expertise und Richtlinien fehlen. [Unter den ersten, die diese Bruchstelle auf den Punkt brachten, waren Buckheit und Donoho im Jahr 1995 (in meiner Übersetzung): “Ein Artikel über rechentechnische Wissenschaft ist nicht das Wissen selbst, es ist nur die | non_poster |
Poster STI 2022 Conference Proceedings Proceedings of the 26th International Conference on Science and Technology Indicators All papers published in this conference proceedings have been peer reviewed through a peer review process administered by the proceedings Editors. Reviews were conducted by expert referees to the professional and scientific standards expected of a conference proceedings. Proceeding Editors Nicolas Robinson-Garcia Daniel Torres-Salinas Wenceslao Arroyo-Machado Citation: Boman, J., Sanchez-Barrioluengo, M., & van der Weijden, I. (2022). Determinants of career pathways of PhD graduates. In N. Robinson- Garcia, D. Torres-Salinas, & W. Arroyo-Machado (Eds.), 26th International Conference on Science and Technology Indicators, STI 2022 (sti22154). https://doi.org/10.5281/zenodo.6962284 Copyright: © 2022 the authors, © 2022 Faculty of Communication and Documentation, University of Granada, Spain. This is an open access article distributed under the terms of the Creative Commons Attribution License. Collection: https://zenodo.org/communities/sti2022grx/ | non_poster |
CLINICAL CHEMISTRY, Vol. 61, No. 10, Supplement, 2015 S183 Pediatric/Fetal Clinical Chemistry Wednesday, July 29, 9:30 am – 5:00 pm Wednesday, July 29, 2015 Poster Session: 9:30 AM - 5:00 PM Pediatric/Fetal Clinical Chemistry B-208 Effect of Multiple Transfusions on Lipid Peroxidation in Preterm Infants Z. A. Unkar, H. Bilgen, A. Yaman, A. Memisoglu, H. Ozdemir, O. Sirikci, G. Haklar, E. Ozer. Marmara University, Istanbul, Turkey Multiple blood transfusions are commonly used in the course of neonatal intensive care unit (NICU) stay in very low birth weight (VLBW) infants. The number of transfusions received has been associated with the development of prematurity complications (retinopathy, necrotizing enterocolitis, bronchopulmonary dysplasia, intraventricular hemorrhage, and periventricular leukomalacia). The severity of the illness can increase the number of transfusions required, resulting in iron overload which may increase the release of reactive oxygen species. The aim of this study was to determine the relationship between blood transfusions, ferritin levels and oxidative stress in preterm infants. Preterm infants (n=23, gestational age 28.43±3.50 weeks; birth weight 1180±471g) admitted to the NICU were enrolled. Five of them (21.7%) were never transfused, while 10 cases (43.5%) were transfused less than 5 times, 2 cases (8.7%) 6-10 times, and 6 cases (26.1%) were transfused more than 10 times. Venous blood samples were taken when they were at least 20 days of age in a period free of infection according to clinical signs and laboratory test results. Serum malondialdehyde (MDA) levels were measured by HPLC (Ultimate 3000, Thermo Dionex, USA) with a flourescence detector. Within-run precision values were 1.8-5.5% and between-run precision values were 6.5-9% for 0.40-1.55 µmol/L MDA, according to manufacturer’s claim. The lower detection limit was 0.02 μmol/L. Serum iron and iron binding capacity were measured colorimetrically (Cobas 8000 Modular Analytics, Roche Diagnostics, Germany). Ferritin levels were measured with an immunometric test with electrochemiluminescence detection (Modular Analytics E170, Roche Diagnostics, Germany). There was a significant difference in serum ferritin levels between transfused (median: 457ng/mL, range:108-2717) and non-transfused (median: 203ng/mL, range:102-268) infants (P=0.017). There was a statistically significant correlation between serum ferritin and MDA levels (P<0.001; r=0.693). Also, the correlation between the number of transfusions and serum ferritin levels was statistically significant (P=0.016; r=0.558). Serum MDA levels were significantly higher in infants with serum ferritin levels >450 ng/mL (P<0.001). When the infants were grouped according to prematurity related complications; transfusion numbers, serum ferritin, and MDA levels of those with two or more complications were significantly higher when compared to cases without complications (P<0.001, P=0.001, and P=0.019, respectively). In conclusion, iron status of VLBW infants has to be monitored to detect iron deficiency and also transfusion-related iron overload. Ferritin can be used to assess the iron status of preterms. Ferritin levels can also reflect lipid peroxidation as we have shown its correlation with MDA, the levels of which were higher in infants with two or more prematurity-related complications. It is important to use restrictive transfusion guidelines in order to protect preterms from iron overload and oxidative stress. Further research is necessary to determine a cut-off level for ferritin to decide when to start iron prophylaxis. B-209 An Evaluation of the HemoCue Assay for the Rapid Assessment of Plasma Free Hemoglobin in Pediatric Patients Undergoing Extracorporeal Membrane Oxygenation (ECMO) F. Gowani, C. Deel, P. Lowery, L. Barton, N. Tran, F. Yin, P. Akl, K. E. Blick. Un of OK Health Sci Ctr, Oklahoma City, OK Background: Extracorporeal membrane oxygenation (ECMO) therapy on newborns is associated wi | non_poster |
Introduction to Sustainable Development Sustainable development is a holistic approach that aims to meet our present needs without compromising the ability of future generations to meet their own needs. It encompasses environmental, economic, and social considerations to create a more equitable and resilient world. by Shashikant Nishant Sharma | non_poster |
25th International Symposium on Electronic Theses and Dissertations – ETD 2022, Novi Sad, Serbia September 7 - 9, 2022 Harvesting ETD Metadata from ‘Shodhganga’ to National Digital Library of India: present scenario and implementations Abstract. By using ICT, there has been a dramatic change in the world of e-learning and learning resource materials. Through the OAI-PMH, the records data about information sources allows an initial assessment of compatibility. It provides an avenue for merging information or for exchanging information between systems. Integration of Indian ETDs based on metadata has received wide attention for better management and utilization. This study explores the current state of metadata harvesting of Shodhganga or Indian ETD repository to NDL platform. One of the fundamental aims of NDL (National Digital Library of India) is to share the e-resources of multiple academic institutions and other resources across a common platform. One of the major objectives realized through this activity include increased visibility and enhanced discoverability of resources. Based on the variation in contents, metadata schema in NDL platform has been categorized into three basic classes, they are Generic Metadata, Educational Metadata and Thesis Metadata. Thesis Metadata fields like researcher, advisor, degree, etc. This Thesis Metadata standard has been used Qualified DC to harvesting the national ETDs to NDL repository. Some popular metadata schema of national and global ETDs repositories, such as ETD-MS (NDLTD) and UK-ETD (EThOS) also compared in the paper. 1 Purpose of the paper A digital library system can allow end-users to tag a resource with terminology meaningful to that user. Understanding user expectations is most important step in designing the discovery functionality for every effective digital library system, it enables retrieval of information and knowledge by making digital materials available to a large audience by removing barriers of language and culture. In order to avoid duplication of efforts and to increase accessibility, merging information or for exchanging information between systems metadata holds the key of success in digital library system. Integration of Indian ETDs based on metadata has received wide attention for better management and utilization. So, ETD metadata, as structured data about ETDs, enables user and system interactions with the resources themselves. 2 Objectives The major objectives of the study are – • To explore the need of metadata harvesting; | non_poster |
Sensory-Equipped Robots with Reactive Behavior Gina Murphy Dept. of Computer Systems Tech. North Carolina A&T State University Greensboro, NC 27411 ggmm0118@live.com 1-336-334-7717 Sasha Cheek Dept. of Computer Systems Tech. North Carolina A&T State University Greensboro, NC 27411 sbcheek@aggies.ncat.edu 1-336-334-7717 Gina Bullock Dept. of Computational Sci & Eng. North Carolina A&T State University Greensboro, NC 27411 glbulloc@ncat.edu 1-336-334-7717 ABSTRACT This student paper reports on the current work on sensory-equipped robots with reactive behavior done for research purposes at North Carolina A&T State University. We are performing computer programming that enables a scorpion animal robot can produce reactive behavior while it is equipped with motor sensors to behave like a normal organism. Robotic sensors have been created to help the machine adapt to the environment around it. It would eventually be completely developed to where it would eventually rely on visual, proximity, and auditory sensors to control its movements. The sensors will also be programmed to give the scorpion robot human-like behavior when faced with scenarios of human error. The robot will also be capable of doing basic problem solving when it comes to figuring out how to complete a single task such as finding its way through a maze. Over time, the computer programming used to enhance the actions of the robot should make it capable of performing even more difficult tasks to test its reaction in different scenarios. The faculty advisor for the work reported here is Dr. Gina Bullock, Dept. of Computational Science and Engineering, North Carolina A&T State University, glbulloc@ncat.edu. Categories and Subject Descriptors I.2.11 [Robotics]: Distributed Robotics – sensory motors, reactive behavior. General Terms Design, Experimentation Keywords Reactive behavior; Sensors; Robotics; Control 1. INTRODUCTION Animals use their senses to receive information from the outside world to better navigate their environment. Just like animals, robots equipped with sensors can detect useful information about the world around it. Sensors used in robotics are devices that, to a degree, imitate properties of animal senses [2]. 2. TYPES OF SENSORS USED IN ROBOTIC PROJECT Some common types of sensors used in robotics position sensing, which involves the use of a potentiometer, are used in mobile robots. The distance can be estimated by counting the wheel revolutions. Another alternative is that you can use an electromagnetic device in wheel robotics to count the position of the wheel. Another type of sensor is a battery charge sensor. Battery charge sensors can signal to the user how low the power source is. Autonomous robots in a structured environment, like a home environment, can locate and plug themselves into a charging station. Autonomous robots give off various types of signals such as a noise or flicker of light before the battery dies. For example, the Rumba is an autonomous robot that is capable of performing this action as well. There are also vision sensors, which are usually cameras. These vision sensors are virtually cameras that can be programmed to sense depth around them. For example, a vision sensor can be equipped with facial recognition of a certain object or person to help identify them or perform certain tasks. Cameras can also have software downloaded into their program that detects edges and corners. Another type of sensor is found in autonomous robots is known as a proximity sensor. Proximity sensors send and receive ultrasonic signals. The time interval given from the ultrasonic signals provides the distance from the robot. These signals bounce off of objects and are received by the sensor. One type of a less commonly used proximity sensor are lasers. Since they tend to be more expensive, they are not utilized as much as ultrasonic proximity sensors. One of the primary uses for sensors is to recognize and avoid danger. Another common use is to a | non_poster |
Book of Abstracts of the 73rd Annual Meeting of the European Federation of Animal Science Book of abstracts No. 28 (2022) Porto, Portugal 5 – 9 September, 2022 | non_poster |
Degrees With a Difference Ontario Agricultural College Graduate Studies Viewbook 2023 | non_poster |
The spread of Xylella fastidiosa in the south-eastern Iberian Peninsula: combining spatial and regional geographical approaches 1* Oliver Gutiérrez-Hernández & 2 Luis V. García 1 Department of Geography, University of Málaga *Corresponding author: olivergh@uma.es 2 Institute of Natural Resources and Agrobiology of Seville (IRNAS), Spanish National Research Council (CSIC) | non_poster |
December 12-16, 2021 Jeju Island UNESCO Global Geopark, Republic of Korea 2021.12.12.-16, 제주도 유네스코 세계지질공원 " # 4 5 3 " $ 5 # 0 0 , 제9차 유네스코 세계지질공원 제주 총회 | non_poster |
1 Emotional labeling and attribute framing on pro- environmental product decision making Leandro Miletto Tonetto Escola Superior de Propaganda e Marketing and Zooma Porto Alegre, Brazil, ltonetto@yahoo.com Abstract: Attribute framing effect refers to the fact that different descriptions of the same element can cause different reactions in people. This paper describes an experiment that was aimed at investigating attribute framing on pro-environmental product decision-making, having the consumer´s socially responsible behavior as a moderating effect. Framing effect was detected, but not as a universal response, since the type of evaluated product and the consumer´s level of socially responsible behavior can interfere in people´s judgements, by not producing the effect. Key words: Consumption, Emotion, Attribute framing effect, Pro-environmental product, Decision making. 1. Introduction The term ´framing´ is used to refer to the various ways that decision situations are presented leading decision makers to construct different representations of given situations [1, 2]. ´Attribute framing effect´ refers to the fact that positively-framed attribute presentations (e.g., a fridge that saves 25% of electric in comparison to average equipment) are usually more sucessfull, or attractive to subjects than the negatively-framed descriptions (e.g., a fridge that spends 75% of electric compared to average equipment) [3]. Since the message content in the previous example is supposed to be identical, findings related to the framing effect suggest that people would be more sensitive to the message frame than to its content. The explanation for the higher persuasion level of the positive frame, compared to the negative frame, could be found on intuitive reactions (definded as System 11), which are emotion-based. When facing negative-framed attributes, an adaptive system would act by producing negative emotion labels, drawing persuasion levels down. Facing a gain frame, this adaptive system could produce a positive label and it could draw the persuasion level of the content upwards. This mechanism, which can draw persuasion levels up and down, according to positive and negative labeling, is called affect heuristic [4, 5]. This is not a universal rule, as specific kinds of messages tend to be more persuasive in the negative frame. Common health communications about cancer are examples of messages that are more persuasive in negative forms, since the loss of a life seems to be a stronger message than its maintenance. 1 System 1 (intuition) operations tend to be fast, automatic, associative, effortless, implicit, emotionally charged, governed by habit and difficult to control and modify. System 2 (reasoning) operations tend to be slower, serial, effortful, consciously monitored, deliberately controlled, relatively flexible and rule governed [6]. | non_poster |
- 1 - Measuring the Trait Component of Speech Disfluency Using Computerized Language Measures Presented at the Society for Computers in Psychology (SCiP) November 14, 2013 – Toronto, ON, Canada Sean Murphy; Bernard Maskit & Wilma Bucci www.thereferentialprocess.org smurphy1@gmail.com Abstract Disfluency is a characteristic feature of spontaneous spoken language that is associated with speech production functions and problems. Variation in disfluency has been investigated in relation to mechanical speech planning difficulty [1], management of listeners' expectations [2], deceptive speech [3], and in various other contexts [4] [5]. This study used measures of disfluency computed by the Discourse Attributes Analysis Program (DAAP) [6] to investigate the trait variance of disfluent speech in monologue and dialogue samples. The subcomponents of the measure are also explored. Background Definitions of disfluency vary in the literature with some studies focused on a single type, e.g., 'um' [3] and others considering various combinations of fillers, word prolongations, repairs, whole or part-word repetitions and false starts [4] [7]. It is unclear whether certain of these features have different purposes, with some researchers arguing, for example, that 'um' should be treated as a lexical type [3] vs. a filled pause [8]. Several studies have shown that disfluency is increased when a person engages in more difficult speech tasks [5], demonstrating situational variation. Other studies have suggested that disfluency may be a marker of expressive language problems [9] [10], suggesting it exhibits trait variance. This study examined disfluency as measured by DAAP [6], which counts incomplete words, repeated single words and repeated two word phrases (indicated as 'Non-Lexical- Disfluency' or 'NLDF') and the lexical types: 'um', 'uh', 'like', 'I mean'(IMN), 'you know' (YKNW), 'well', 'kind', 'hm', 'mm', 'eh', 'ehm', and 'ah'. DAAP employs disambiguation | non_poster |
Colección de ESMOS 1 Infografía Glucosa-isomerasa (EC 5.3.1.5) Mariana Mendoza Badillo* iD Licenciatura en Biotecnología, Facultad de Ciencias Biológicas, Benemérita Universidad Autónoma de Puebla, Puebla, México. *Email: mariana.mendozaba@alumno.buap.mx 02 de marzo de 2023 DOI: http://doi.org/10.5281/zenodo.7690700 Editado por: Jesús Muñoz-Rojas (Instituto de Ciencias, Benemérita Universidad Autónoma de Puebla). Revisado por: Dalia Molina-Romero (Facultad de Ciencias Biológicas, Benemérita Universidad Autónoma de Puebla). Colección de ESMOS Resumen Las enzimas son proteínas catalizadoras, tienden a cumplir funciones únicas al acelerar las reacciones químicas y haciendo posibles varios procesos biológicos [1]. La clasificación de enzimas se rige por el tipo de función que desempeña, siendo las enzimas isomerasas las capaces de isomerizar un compuesto, transformándolo a través de catalizar la reacción de reordenamiento de sus átomos, su nomenclatura inicia con EC [2]. | non_poster |
Emotion through Product Motion Behavior Chia-Cheng, Liu, Institute of Applied Art, National Chiao Tung University - Taiwan Hua-Min, Chang, Institute of Applied Art, National Chiao Tung University - Taiwan Yi-Shin Deng, Department of Industrial Design, National Taipei University of Technology - Taiwan Abstract Although the general interest of the emotional arousal in human-product interaction gradually grows, we have few understandings of how it can be addressed by products. In this paper we propound an argument that the feedback style caused by user’s action will give rise to emotional responses. Taking the action of CD player cover for example, we propose an approach to investigating how the different rhythm of the cover’s open and close influences emotion. This result of the research shows the relationship between emotional responses and product motion behavior and facilitates designer’s intention to arouse emotional responses by deciding the product motion behavior in interactive product design. Key words: product motion behavior, emotional responses, interactive product design Relevance of problem It has been argued that emotion has become more and more important in the field of product design. Products effect user’s emotion apparently in different aspects, e.g. a user may feel pleasure or disgusting because of product’s appearance, or impose past images pertaining to similar experiences on new product. There have been many researchers addressing the issue of emotion aroused from product appearances (Nagamachi 1995; Desmet 2003). However, little attention has been given to the point that emotion is aroused from interactive conditions. The traditional research issues in the interactive relationship between user and product are ergonomics or usability engineering borrowed from software interface design or some other ethical concerns. Namely, performance has been considered as the most important value while user-product interaction happens, yet the potential for enhancing pleasure has been often ignored. Although the evidence is not compelling that emotion is probably aroused from user-product interaction, it is possible to argue that emotional appraisals indeed exist so as to evaluate partial or whole interactive quality, e.g. given the opening conditions between a poor electric door or a elegant CD player manufactured by Bang & Olufsen, they certainty give us different feelings. | non_poster |
ANAIS 2017 VI CEFIVASF VI CONGRESSO DE EDUCAÇÃO FÍSICA DO VALE DO SÃO FRANCISCO 24 a 26 de Agosto de 2017, Petrolina-PE / Juazeiro-BA Educação Física no Brasil: Aplicações na Escola, Saúde e Desempenho GEPEGENE CEFIS Colegiado de Educação Física Prefeitura de Juazeiro O trabalho segue em frente para mudar ainda mais Ministério da Saúde Ministério do Esporte Realização Patrocínio Apoio Sec. Executiva TREINAMENTOS E EVENTOS FACULDADE INSPIRAR ® WZ PETROLINA | non_poster |
George’s Education Day: 15 November 2017 Transformational Education: learning for life Hilary Wason, Cheryl Whiting, Fran Arrigoni and Colin Clarke Abstract: Our contribution focuses on the innovations in learning and teaching that have arisen from the outcomes of an interdisciplinary international research collaboration on critical thinking, aiming to enhance curricula and improve students’ development as required by employers. This has culminated in the development of a critical thinking skills framework and toolkit designed to inform learning, teaching and assessment practice. Our transformative educational endeavours are illustrated in three posters. Collectively these highlight our approach to developing student’s self-efficacy to master critical thinking and explore the challenges faced in leading students through ‘conceptual gateways’ to a more accessible way of thinking about information (Meyer and Land, 2005). Our key message is that to overcome such challenges we must as educators firstly transform ourselves by revising our own personal assumptions about learning and embrace a reflective and evidence-based exploration of our own methods of practice, l expectations of ourselves and of our students. Keywords: Critical Thinking; Learning and Teaching; Student Engagement; Curriculum Development Reflection Transformation is a process of change, in the context of developing ourselves and our students as independent autonomous and critical thinkers. Prior knowledge and experiences constrain our perceptions of the world around us and our ability to avert the ideas and opinions of others. This can deny us the opportunity to make the most of our learning experiences. Overt teaching of critical thinking (CT) skills builds self-efficacy, improves learning and enhances students’ academic performance (Putwain et al.,2013). Kingston and St George’s University has been at forefront of developing interventions to embed CT skills within undergraduate curriculum to equip students for academic success, and future employment. The outcomes of an interdisciplinary international research collaboration have informed the development of a CT skills framework and toolkit designed to inform learning, teaching and assessment practice. The toolkit, which is underpinned by the work of Abrahmi et al. (2015), operationalises our institutional adaptation of Facione's CT skills framework (Facione,1990). Containing 10 branded teaching tools, it offers a flexible framework of instructional guides and worksheets are tailored to a variety of learner levels and assignment tasks. With the aid of a small HEFCE Catalyst project fund the toolkit has been piloted within the first year of 5 undergraduate degree programmes across two diverse employment sectors (Business and Healthcare). Our series of 3 posters builds a picture of our approach to the development and evaluation of CT skills. Our quest to enhance student’s ability to independently and systematically analyse problems and make decisions, has uncovered the challenges faced by students and how they make sense of the concept of critical thinking. This has encouraged us to review personal assumptions and transform our approaches to learning and teaching. It is evident that there is | non_poster |
An Optical/NIR Exploration of Forming Cluster Environments at High Redshift with VLT, Keck, and HST z=1100 z=2-8 z=1.5-2 z~0.8-1.5 z<0.8 ? ? Brian C. Lemaux, Olga Cucciati, Lori Lubin, Roy Gal, Olivier Le Fèvre, Ben Forrest, Ekta Shah, Priti Staab, Denise Hung, Lu Shen and the ORELSE, VUDS, and C3VO Teams A Journey Through Galactic Environments, Porto Ercole, Italy, 2023 Sept. 25 | non_poster |
ANAIS 2017 VI CEFIVASF VI CONGRESSO DE EDUCAÇÃO FÍSICA DO VALE DO SÃO FRANCISCO 24 a 26 de Agosto de 2017, Petrolina-PE / Juazeiro-BA Educação Física no Brasil: Aplicações na Escola, Saúde e Desempenho GEPEGENE CEFIS Colegiado de Educação Física Prefeitura de Juazeiro O trabalho segue em frente para mudar ainda mais Ministério da Saúde Ministério do Esporte Realização Patrocínio Apoio Sec. Executiva TREINAMENTOS E EVENTOS FACULDADE INSPIRAR ® WZ PETROLINA | non_poster |
14/05/2020 BPS Survey - https://bildungsportal.sachsen.de/umfragen/limesurvey/index.php/admin/printablesurvey/sa/index/surveyid/684654/lang/sq 1/66 There are 28 questions in this survey. | non_poster |
Colección de ESMOS 1 Infografía Taq polimerasa: historia, características y aplicaciones Francisco Germán Tapia Clemente* iD Licenciatura en Biotecnología, Facultad de Ciencias Biológicas, Benemérita Universidad Autónoma de Puebla, Puebla, México. *Email: tapiaclementefranciscogerman@gmail.com 01 de marzo de 2023 DOI: http://doi.org/10.5281/zenodo.7689901 Editado por: Jesús Muñoz-Rojas (Instituto de Ciencias, Benemérita Universidad Autónoma de Puebla). Revisado por: Francisco David Moreno Valencia (Instituto de Ciencias, Benemérita Universidad Autónoma de Puebla). Colección de ESMOS Resumen La definición general de las enzimas es que son un tipo de proteínas que catalizan, es decir, aceleran o retrasan procesos o reacciones químicas dentro de los seres vivos, sin embargo, a pesar de que hay clasificación para cada tipo de enzimas, hay algunas que son diferentes debido a los organismos que las sintetizan, esto posiblemente por el hábitat hostil que provocó una adaptación. | non_poster |
Slovak Society of Chemical Engineering Institute of Chemical and Environmental Engineering Slovak University of Technology in Bratislava PROCEEDINGS 50th International Conference of the Slovak Society of Chemical Engineering SSCHE 2024 hotel SOREA HUTNIK I Tatranské Matliare, High Tatras, Slovakia May 20 - 24, 2024 Editors: Assoc. Prof. Mário Mihaľ ISBN: 978-80-8208-118-6, EAN: 9788082081186 Published by the Faculty of Chemical and Food Technology Slovak Technical University in Bratislava in Slovak Chemistry Library for the Institute of Chemical and Environmental Engineering; Radlinského 9, 812 37 Bratislava, 2024 Ruzicka, M., Paulen, R., Helgeland, I.: Modelling and Optimal Operation of a Forward Osmosis Process, Editors: Mihaľ, M., In 50th International Conference of the Slovak Society of Chemical Engineering SSCHE 2024, Tatranské Matliare, Slovakia, 2024. | non_poster |
10-12.05.2022 Izola, Slovenia Nežka Sajinčič Learning about NDSS through video – Evidence-based guidelines for eff ective instructional videos for a smooth transition into industry Nežka Sajinčič1*, Andreja Istenič², Anna Sandak¹,³ 1 InnoRenew CoE, Livade 6a, 6310 Izola, Slovenia, nezka.sajincic@innorenew.eu, anna.sandak@innorenew.eu 2 Faculty of Education, University of Primorska, Cankarjeva 5, 6000 Koper, Slovenia, andreja.istenic7@gmail.com 3 Faculty of Mathematics, Natural Sciences and Information Technologies, University of Primorska, Glagoljaška 8, 6000 Koper, Slovenia *Corresponding author Non-destructive spectroscopic sensors (NDSS) are an innovative and highly useful group of tools that have a potential to considerably improve the food industry. Research and development are reaching the point where these laboratory-bound technologies can be implemented directly in the fi eld, allowing the industry to apply them and put them into practice. However, widespread adoption of new technologies requires eff ective knowledge transfer, which means that people must fi rst learn what these innovations can do and how to use them properly. The COVID-19 pandemic brought many face-to-face meetings and training sessions to a standstill and highlighted the possibilities of online learning that will outlast the period of constraints. Although more sophisticated learning technologies now exist, recorded instructional videos remain one of the most popular and consistently used mediums for both formal and informal learning because of their ease of use, convenience, fl exibility, and eff ectiveness (Islam et al., 2020). However, not all instructional videos are created equally, so it is important to know how to design educational videos that promote learning by knowing which features contribute positively to knowledge transfer and which do not (Fiorella and Mayer, 2018; Mayer et al., 2020). Drawing on theories of learning with multimedia such as Cognitive Load Theory (Sweller et al., 2011), Cognitive Multimedia Learning Theory (Mayer, 2014), and the Cognitive-Aff ective Theory of Learning with Media (Moreno, 2006), we will present evidence-based guidelines for making eff ective educational videos. Using the topic of non-destructive spectral sensor applications for in situ analysis as an example, we will demonstrate some ways to improve instructional videos with the goal of accelerating the transfer of knowledge from academia and facilitating the implementation of NDSS in the food industry. Keywords: instructional video, multimedia learning, instructional design, video demonstrations, knowledge transfer Acknowledgements: The authors gratefully acknowledge the European Commission for funding the InnoRenew CoE project (Grant Agreement #739574) under the Horizon2020 Widespread- | non_poster |
1 Designers as Storytellers: the weaving of narratives in the work of bernabeifreeman Rina Bernabei – Senior Lecturer, Faculty of the Built Environment, The University of New South Wales, Sydney, Australia, (+61) 0418 616 071, r.bernabei@unsw.edu.au Kelly Freeman –Part-time Lecturer, Faculty of the Built Environment, The University of New South Wales, Sydney Australia, (+61) 02 9716 4401, kelly@bernabeifreeman.com.au Jacqueline Power – PhD Candidate/Casual Staff Member/ Research Assistant, Faculty of the Built Environment, The University of New South Wales, Sydney, Australia, 61 401 283 663, jacqueline.power@student.unsw.edu.au Abstract Products may communicate a premeditated story, one that has been planned and designed from the products’ conception. This story may be communicated through designed ‘triggers’ or ‘cues’ that are all part of the product’s form, material, intractability and manufacture. How and if designed objects achieve their goal of communicating with responders and establishing an emotional connection, will be explored through a series of interviews with end-users in relation to the work of award winning practice bernabeifreeman. The bernabeifreeman designers have identified four key storytelling methods in their work as: Narrative, Manufacture, History and Interaction. Conference theme: Usage & Interaction Keywords: Product design, Storytelling, bernabeifreeman | non_poster |
© Agnès Eyhéramendy <<8 | non_poster |
CAST: Interim Report to the ASTB, May 19th 1999 Ben Whitaker University of Leeds | non_poster |
INTRODUCTION • The intermediate disturbance hypothesis states that diversity levels will be highest in moderately disturbed sites due to impacts on competition and available niches. • We surveyed biodiversity on three land use types in an urban setting in the central interior of British Columbia. METHODS • We used pitfall traps to monitor ground- dwelling invertebrates in industrial, residential, and greenbelt sites in Prince George, British Columbia. • N=4 sites for each land use type. • We sorted specimens from four one- week sampling periods (summer 2015) using keys and DNA barcodes. DISCUSSION • Different land use types in Prince George, BC, are reasonably well differentiated by their invertebrate assemblages. • Industrial sites, followed closely by residential lawns, exhibit the highest species diversity. Both land use types are characterized by historical disturbance and moderate levels of continuous low-level disturbance. • Our work also provides a baseline checklist of ground-dwelling invertebrate fauna in an under-surveyed ecosystem and region. Invertebrate biodiversity levels in an urban ecosystem are higher in industrial and residential areas than in parks. Ground-dwelling invertebrate biodiversity patterns in a small, central British Columbia city support the intermediate disturbance hypothesis Dezene P. W. Huber, Lisa M. Poirier, and Alicja M. Muir – University of Northern British Columbia, Faculty of Environment ACKNOWLEDGEMENTS: We thank the City of Prince George, Rolling Mix Concrete Ltd., the Salvation Army, Brandt Tractor Ltd, Coast Powertrain Ltd., and several residential landowners and tenants for access to sites. Funding was provided by the University of Northern British Columbia and NSERC. Species accumulation curve for all traps at all sites at all collection dates (R, vegan, specaccum). Our analysis is based on 137 unique identifications, most to the level of genus or species, and none higher than family other than Annelida and Mollusca. Non-metric multidimensional scaling of species presence-absence in the three urban land use types (R, vegan, vegdist “bray”, ordiplot). Industrial areas exhibited a distinct community, while residential areas were intermediate compared to the other areas. α-Diversity levels for the three land use types (R, vegan, specnumber). Both greenbelt and residential areas tended towards lower α-diversity than industrial sites. Shannon’s H for the three land use types (R, vegan, diversity “shannon”). Industrial sites showed the highest richness, followed closely by residential sites. An analysis using Simpson’s index returned a similar result. @docdez @lisapoir @alicjamuir More details & citations here | non_poster |
Detection of Philaenus sp. (Hemiptera: Aphrophoridae) DNA in the gut of spiders, using PCR-based gut-content analysis Rodrigues I. a,b, Ramos V. a, Benhadi-Marín J. a, Pereira J.A. a, Baptista P. a aCentro de Investigação de Montanha (CIMO), Instituto Politécnico de Bragança. Campus de Santa Apolónia, 5300-253 Bragança, Portugal bUniversidad de Léon, Departamento de Ingeniería Agraria, Av. Portugal, n° 41, 24071 Léon, Spain | non_poster |
how to write a (good) data description Developing Best Practice Michael Smit Dan Phillips DOI: 10.5281/zenodo.4709835 | non_poster |
Comparative metadata for popular theater in Alsatian, German and French Pablo Ruiz Fabo, Fanny Boisnard, Alexia Schneider - Université de Strasbourg, France Project goals and methods We describe ongoing work to create metadata for popular theater subgenres in Alsatian, German and French.1 Alsatian theater (written in Germanic varieties spoken in Alsace, Eastern France) has been influenced by both German and French theater, and large-scale metadata will help compare the traditions. As we work with lesser-studied subgenres, the data adds variety to Computational Literary Studies (CLS).2 We transcribe and annotate the following: ● Bibliographic metadata based on the frontmatter (title, author, publisher and its location, publication year for our source), also searching for the first edition and premiere year ● Plays’ genre based on their subtitle; if absent, secondary literature is consulted ● The dramatis personæ, annotating variables to describe characters (gender, social class, socioprofessional group, etc.) besides character relations ● The plays’ setting, including time and place information, retrieving coordinates from OpenStreetMap when possible ● Number of acts and scenes ● We retrieve Wikidata IDs for plays, authors and publishers; adding missing ones to Wikidata is a project goal For French, we work on vaudeville, a comedic subgenre; corpus selection is based on Gidel (1986) and Matthes (1983). For German, we work on two popular comedy subgenres called Posse and Schwank (Wilms, 1969; Klotz, 2007). These three subgenres have been identified as the main influences of Alsatian theater (Hülsen, 2003). For Alsatian, our corpus includes Schwank and more refined comedy types, besides about 25 popular dramas (Volksstück), ca. 25 Christmas tales (Weihnachtsstück), and a handful of serious dramas. Data includes 6,834 characters from 589 plays by 200 authors, between 1800 and 1929. Rationale and related work Alsatian theater is at the crossroads of French and German drama (Hülsen, 2003), but no systematic comparison has been performed between Alsatian and these traditions. We recently created a prosopography for Alsatian characters (Ruiz & Bermúdez, 2022), obtaining findings (Ruiz et al., 2024) that complement earlier knowledge of Alsatian theater, based on smaller samples (Cerf, 1972; Gall, 1974; Huck, 2005; Hülsen, 2003). Since the corpus overview afforded by such annotations proved useful, here we extend the methodology to German and French popular subgenres, to explore subgenre evolution across traditions. One of our inspirations is Wiedmer et al. (2020), who insist on the value of the dramatis personæ as an indicator of possible plots and conflicts. DraCor Einakter (Çakir & Fischer, 2020) also develops similar annotations to ours, covering one-act plays in German (1740-1850). More generally, the literary polysystems approach (Even Zohar, 1990), which 2 Data for this submission is at https://git.unistra.fr/thealtres/dh2024-data 1 The work is carried out within the Thealtres project: https://thealtres.pages.unistra.fr/ 1 | non_poster |
Warning! Cyberattack! Cyberpandemic! A global cyberpandemic is more likely to happen than you think. Preface. It has been more than 6 months and even more, even like November/December 2020 that I had the intention of writing this text that is (in my opinion) important. With procrastination, projects and other occupations, I had so much delayed that the time that I was writing this preface was July 9th 2021. This day is symbolic because it meets the day of the CyberPolygon 2021 conference. This day has passed and I still didn’t see or read the results of their report, so the prospection is more legitimate without cheating, but to be honest, in some time, I will maybe read the report to clarify some arguments. It is also important to note that I am no prophet, no big expert, but I will confess that I make frequently links between things that other people don’t see and it is important to not hide something we know for a long time. There is millions of things to say, but we should start by a small synthesis of the general arguments and the key points to facilitate and shorten your reading, and this is needed in these times of sanitary crises and socio-economic crises. Let’s begin Statement: A cyber-pandemic has a significant probability to happen and it should not be ignored. It could be false, planned, and accidental or even the three at the same time in progression, with causes and consequences, direct and indirect. It would still be a problem that someone should take in consideration and leave it in his head in case of prevention, who knows. The most probable time is whether in the nearest times, like some months, or either a decade. Something to know is that the more we approach to 2030 and over, the more big the probability. More details will come after. This global cyberattack will effect internet, electricity, communications and other electronic and non-electronic elements like supply-chains. Just to say that because there is too much to say, I resumed the biggest parts in the next page. Because there would be too much sources, too much references and links to know before understanding, I will try to put a part. But because explaining these big points could take eternity, I resumed and said to myself that I will publish a part today and will try to develop it more gradually. Because the event could happen any minute, I ask you to save this pdf wherever you are. Thank you. And to translate and facilitate its accessibility and reading wherever you are. Thank you. -Diluvio Ghamari, August 4 2021. With the help of Yan Rashid Dadelda. Page 1/4 | non_poster |
1 Can yesterday’s data fulfil today's researchers' needs? Crafting additional ways to improve the fitness for use Sitthida Samath, CNRS, Persée (UAR 3602), Lyon, France Persée (UAR 3602), École Normale Supérieure de Lyon, 15 parvis René Descartes, 69342 Lyon Cedex 07, France Email: sitthida.samath@persee.fr Persée, a digital library and a research data supplier For 20 years, Persée1 has been the French operator for scientific literature heritage digitization and online dissemination. Persée currently has a 30 people team, involved in publishing, technical and scientific projects, and working over a fully-fledged paper-to-digital document processing chain. So far Persée has produced: • a web portal2 (standard digital library); • a triplestore3 (linked open metadata outlet); • 5 ‘perséides’4 (project-specific online corpora). Assessing the fitness for use in the light of the (yet-to-come) latest standards: a challenge for all Alongside the perseides which are the result of a co-design process, Persée has been providing legacy (meta)data to digital humanists for whom data science and computational methods, not to mention AI/ML, have become standard practice. Since ‘Collections as data designed for everyone serve no one’ (The Santa Barbara Statement on Collections as Data, 2017), Persée has implemented various methods to ensure the fitness for use, including quality checks, user feedback analysis, co-design. Yet, the same questions eventually arise again: 'Can yesterday’s data fulfil today’s researchers’ needs? What are these needs? How can we ascertain quality?’. 3 down-to-earth ways of addressing the problem Taking our part in the collaboration of library science, computer science and humanities working together with digital cultural heritage (Oberbichler et al., 2022), we saw fit to extend customer study. Drawing up explicitly the Persée FAIR Implementation Profile (Schultes et al., 2020), mapping visually user types and data dissemination channels, then applying graph analysis, makes it possible to highlight critical nodes, popular use cases and intensive use areas. Moreover, modelling a typical data reuse process (fig. 1) makes it possible to (re)locate occurrences of data friction (Edwards et al., 2011). 1 https://info.persee.fr/?lang=en 2 https://www.persee.fr/ 3 https://data.persee.fr/?lang=en 4 https://info.persee.fr/perseides/?lang=en | non_poster |
Piernik MHD code extension: modelling energy dependent transport of cosmic ray electrons with energy spectrum evolution Mateusz Ogrodnik CRISM 2018 Conference 27 June 2018 Piernik MHD code extension: CRESP algorithm | non_poster |
DD.MM.YYYY Influence of KI flux purity on the properties of CZTS powders and monograin layer solar cells K. Muska, H.-L. Ots, K. Timmo, M. Pilvet, R. Kaupmees, V. Mikli, M. Grossberg, M. Kauk-Kuusik 10.11.2022 Introduction Some unintentional impurities in CZTS are detrimental on the performances of solar cells. Laboratory of Photovoltaic Materials Department of Materials and Environmental Technology Tallinn University of Technology Aim of the study Investigate the influence of purity of Potassium iodide (KI) on the properties of CZTS absorber materials and monograin layer solar cells performance. 99.999 % purity ZnS; S; SnS; CuS 99 - 99.998 % purity KI salt as flux Monograin powder technology Experimental Sample name by KI Purity, % Company Price, €/100g 99% Alfa 99 Alfa Aesar 45 99.5% Fluka 99.5 Honeywell/Fluka 44 99.8% Merck 99.8 Merck 38 99.995% Supelco 99.995 Supelco 333 99.998% Alfa 99.998 Alfa Aesar 1008 99.995% Acros 99.995 Acros organics 121 Test six different KI salts with up to 22x different in price and up to 500x different in some impurity levels CZTS monograins are synthesized from high purity precursors in the liquid phase of KI Acknowledgements European Regional Development Fund Project TK141, Estonian Research Council grant PRG1023. European Union’s H2020 research andinnovation programme under Grant Agreement nº 952982 (CUSTOM-ART). | non_poster |
This project has received funding from the European Union’s Horizon 2020 research and innovation programme under the Grant Agreement No 101000794. Newsletter EXELISIS COPYRIGHT© 2nd Issue June 2022 In this Issue 1. Executive Management Board of SECRETed 2. Overview of SECRETed 3. Methodological steps 4. News and achievements 5. Dissemination activities To gain access to our forthcoming Newsletters subscribe through our website https://www.secreted.eu/ Check the previous 1st issue of the SECRETed Newsletter HERE | non_poster |
Version 1 (September 2020) M.bovis2022 poster 1 D-PhD06-6.19 Responsible Partner: ANSES | non_poster |
Margot MacMahon NuPhys Reconstruction of Neutral Final-State Particles in Neutrino-Argon Interactions J. Kopp, P. Machado, M. MacMahon and I. Martinez-Soler 1 18-20th December 2023 | non_poster |
Thai Home Falls Hazards Assessment Tool (Thai-HFHAT) 44 items Steps for using the assessment form Step 1: Go to each room and the area of your home using this quiz look for the hazards listed below the image on each page. (Some items may not be relevant to your home.) Step 2: If hazard is found in the room mark ✓ at the box in front. Step 3: After checking all the hazards, write down the total score for each room. After that, write your total score in the big box on the last page. Living room 1. The lighting is not suitable for activities 2. The steps in the room 3. Not enough space for movement 4. Cluttered objects or wires block the path Total score | non_poster |
“A SAÚDE É PARA TODOS” RESUMO SIMPLES ANAIS | non_poster |
Poster STI 2022 Conference Proceedings Proceedings of the 26th International Conference on Science and Technology Indicators All papers published in this conference proceedings have been peer reviewed through a peer review process administered by the proceedings Editors. Reviews were conducted by expert referees to the professional and scientific standards expected of a conference proceedings. Proceeding Editors Nicolas Robinson-Garcia Daniel Torres-Salinas Wenceslao Arroyo-Machado Citation: Yu, C. (2022). Technological paradigm of convergence technologies: An empirical analysis on the technological trajectories of cultured meat. In N. Robinson-Garcia, D. Torres- Salinas, & W. Arroyo-Machado (Eds.), 26th International Conference on Science and Technology Indicators, STI 2022 (sti2270). https://doi.org/10.5281/zenodo.6960305 Copyright: © 2022 the authors, © 2022 Faculty of Communication and Documentation, University of Granada, Spain. This is an open access article distributed under the terms of the Creative Commons Attribution License. Collection: https://zenodo.org/communities/sti2022grx/ | non_poster |
© Agnès Eyhéramendy !""#$!"$#$%&'()&% | non_poster |
Painéis expositivos Carolina Michaëlis e María Goyri Filólogas europeias em paralelo | non_poster |
Open Schools Journal for Open Science Vol. 3, 2020 Toxicity of azo-dyes combined with TiO2 nanoparticles Kroath M. BG/BRG Schloss Wagrain Punz E. BG/BRG Schloss Wagrain Joubert I.A. Dept. Biosciences, University of Salzburg Himly M. Dept. Biosciences, University of Salzburg Geppert M. Dept. Biosciences, University of Salzburg https://doi.org/10.12681/osj.22590 Copyright © 2020 M. Kroath, E. Punz, I.A. Joubert, M. Himly, M. Geppert To cite this article: Kroath, M., Punz, E., Joubert, I., Himly, M., & Geppert, M. (2020). Toxicity of azo-dyes combined with TiO2 nanoparticles. Open Schools Journal for Open Science, 3(2). doi:https://doi.org/10.12681/osj.22590 http://epublishing.ekt.gr | e-Publisher: EKT | Downloaded at 02/03/2021 01:48:43 | | non_poster |
PRAZOS IMPORTANTES Submissão do texto completo: até 15 de julho de 2024. Conclusão do processo de avaliação: até 15 de outubro de 2024. Publicação da edição especial (expectativa): novembro/dezembro de 2024. EDITORES CONVIDADOS Mário Vasconcellos Sobrinho – Universidade Federal do Pará, Brasil (mariovasc25@gmail.com) Mariluce Paes-de-Souza – Universidade Federal de Rondônia, Brasil (mariluce@unir.br) Ana Maria de Albuquerque Vasconcellos – Universidade da Amazônia, Brasil (anamaria.vasconcellos@unama.br) Irma Garcia-Serrano – Universidad Central Del Ecuador, Equador (iggarcia@uce.edu.ec) Emilio F. Moran – Michigan State University, Estados Unidos; Universidade de Campinas, Brasil (moranef@msu.edu) Revista de Administração Contemporânea Journal of Contemporary Administration e-ISSN: 1982-7849 CALL FOR PAPERS TEMÁTICA DA CHAMADA Desde a década de 1990, o debate sobre a necessidade de gestão de recursos naturais para o desenvolvimento regional sustentável na e da Amazônia se apresenta proeminente. No contexto desse debate pelo menos quatro grandes vertentes teóricas se apresentaram como alternativas econômicas para alicerçar o desenvolvimento regional (Vasconcellos, 2013). A primeira defende a verticalização produtiva de recursos (até então proeminentes exportadores), tais como ferro, manganês, madeira e produtos vinculados ao agronegócio. A geração de commodities está no centro dessa proposição. A segunda vertente fundamenta-se na pequena agricultura familiar, uma vez que a maior parte dos negócios e população rural e regional está a ela vinculada e, portanto, seria o caminho para geração de trabalho e renda para o desenvolvimento regional. A inclusão de pequenas propriedades rurais amazônicas a partir de políticas públicas envolve a garantia de preços mínimos para produtos da biodiversidade. Bioeconomia e Negócios Inovadores e Sustentáveis no Contexto da Gestão de Recursos Naturais e Enfrentamento às Mudanças Climáticas na Amazônia Revista de Administração Contemporânea - RAC | Call for Papers: Bioeconomia e Negócios | doi.org/10.5281/zenodo.10048489 | e-ISSN 1982-7849 | rac.anpad.org.br | non_poster |
THE LIFEPLAN® TRAINING and EQUIPPING PROGRAMME AUTHeR (Africa Unit for Transdisciplinary Health Research) takes pleasure to present LIFEPLAN®. AUTHeR, a research entity of the Faculty of Health Sciences of the North-West University, strives to provide research across disciplinary boundaries that offer realistic solutions to address community challenges. Communities need to be empowered through continuous social impact because health is an extremely valuable necessity for everyday life. Before one can improve health or even refer to health, seven fundamental resources for health come to play (Ottawa Charter of the WHO, 1986), namely shelter, food, peace, income, education, sustainable eco-systems and equity; all intertwined into the socio-economic and ecological determinants of health. This opens the essential need for health to mediate across boundaries into the public and private sectors. LIFEPLAN® represents therefore a holistic and transdisciplinary approach to enable any responsible citizen, grappled in the realities of low literacy but in need of basic life skills. LIFEPLAN® version 2 presents the upgraded, current and relevant curriculum, based on rigorous original research output. The original LIFEPLAN® was written for a specific target audience that of farm workers stuck within structural poverty. LIFEPLAN® version 2 however, broadened the scope to include any person. LIFEPLAN® is based on the interdependent relations from intrapersonal to interpersonal to household, communities and societies. From a holistic approach to health complexities, this life skills training encapsulates all the dimensions of physical health, psychosocial and economic wellbeing within cultural diversity, environmental health, consumer health, ethics and food systems, to list a few. The facilitator becomes the central figure to enable learning through interactive participatory pedagogy. | non_poster |
AMERICAN JOURNAL OF EDUCATION AND LEARNING ISSN: 2996-5128 (online) | ResearchBib (IF) = 9.918 IMPACT FACTOR Volume-2| Issue-4| 2024 Published: |30-11-2024| 589 UCH O‘LCHOVLI LAPLAS TENGLAMASI UCHUN YARIMCHEKSIZ PARALLELEPIPEDDA CHEGARAVIY MASALA https://doi.org/10.5281/zenodo.14224001 K.T. Karimov, D.A. Mutalipova, Farg‘ona davlat universiteti, karimovk80@mail.ru, dilshodaxonmutalipova@gmail.com Annotatsiya Mazkur ishda uch o‘lchovli Laplas tenglamasi uchun yarimcheksiz parallelepipedda Dirixle-Neyman tipidagi masala o‘rganilgan. Masala yechimiming mavjudligi va yagonaligi spektral analiz usuli yordamida isbotlangan. Tayanch so‘z va iboralar Uch o‘chovli Laplas tenglamasi, Dirixle-Neyman masalasi, spektral analiz usuli. I. Kirish. Masalaning qo‘yilishi Quyidagi uch o‘lchovli 0 xx yy zz U U U (1) Laplas tenglamasini , , : 0, , 0, , 0, x y z x a y z c yarimcheksiz paralellepipedda qaraymiz, bu yerda ,a c R ; , , U U x y z - noma’lum funksiya. Ikki va ko‘p o‘lchovli Laplas tenglamasi uchun chegaraviy masalalarni chegaralangan sohalarda [1], [2] ishlarda uchratish mumkin. sohada (1) tenglama uchun quyidagi masalani tadqiq qilamiz. DN masala. sohada (1) tenglamani va quyidagi 2,2,2 , , , , , , , ( ) x y z x y z U x y z C C U U U C , (2) 0, , 0 x U y z , , , 0 U a y z , 0 y , 0 z c , (3) ,0, , y U x z g x z , 0 x a , 0 z c , (4) lim , , 0 y U x y z , 0 x a , 0 z c , (5) , ,0 0 z U x y , , , 0 U x y c , 0 x a , 0 y (6) | non_poster |
Poster: Privacy-Preserving Billing for Local Energy Markets Eman Alqahtani∗and Mustafa A. Mustafa∗† ∗Department of Computer Science, The University of Manchester, Manchester, M13 9PL, UK ‡COSIC, KU Leuven, Leuven, 3001, Belgium Email: eman.alqahtani@postgrad.manchester.ac.uk, mustafa.mustafa@manchester.ac.uk Abstract—We propose a privacy-preserving billing protocol for local energy markets (PBP-LEMs) that takes into account market participants’ energy volume deviations from their bids. It enables a group of market entities to jointly compute partic- ipants’ bills in a decentralized and privacy-preserving manner. It also mitigates risks on individuals’ privacy arising from any potential internal collusion. We first propose a novel, efficient, and privacy-preserving individual billing scheme, achieving information-theoretic security, which serves as a building block. PBP-LEMs utilises this scheme, along with other techniques such as multiparty computation, Pedersen commitments and inner product functional encryption, to ensure data confidentiality and accuracy. We present three approaches, resulting in different levels of privacy and performance. We also show that PBP-LEMs is feasible for deployment in real LEMs. Index Terms—Security, Privacy, LEM, MPC I. INTRODUCTION Local energy markets (LEMs) enable prosumers – individ- uals who consume and produce – to actively participate in open markets, supporting direct trading of surplus energy with others. This contrasts with the traditional practice of selling to suppliers at feed-in-tariff (FiT), which is lower than retail market price (RP). LEMs typically require participants to submit bids before the actual trading period (e.g., 1 hour in advance). There- fore, market participants need to forecast their bid volumes, indicating the amount of energy they intend to trade. This prediction relies on historical data and estimated consumption, making it inherently prone to errors. As a result, participants may commit to trade specific energy volumes but subsequently fail to fulfill these commitments. As this failure can disrupt grid stability and increase costs, market participants should be accounted for their deviations from their committed bid volumes during the billing process. Furthermore, a market participant’s deviation may cause a different level of effect on the grid depending on what part of the grid the participant resides in. As a result, some might bear higher costs than others, not only due to their deviation amounts but also because of their specific locations on the grid. The computation and settlement of bills/rewards for partic- ipants in LEMs, while considering their deviations, requires critical private information, including individual bid volumes and meter readings per trading period. These are closely associated with individuals’ consumption patterns, posing risks to their privacy. This work was supported by EPSRC through EnnCore [EP/T026995/1] and by the Flemish Government through FWO-SBO SNIPPET [S007619]. Previous studies have addressed the privacy concerns dur- ing billing and settlement, employing techniques such as anonymization, perturbation , and homomorphic encryption. Nevertheless, only a few have considered establishing a billing mechanism based on the actual amount of energy pro- duced/consumed by LEM participants [1, 2] or to additionally account for deviations [3–5]. However, the billing process is coordinated or executed by a single honest party [1, 2, 4], disclosing some or all of the individuals private data to the party and potentially imposing a high computational cost on a single party. This raise questions about the applicability or scalability of their solutions in realistic scenarios. In contrast, solutions [3, 5] rely on a group of entities working together to compute individual bills/rewards privately. However, they are vulnerable to the risk of internal collusion, potentially leading to the disclosure of highly sensitive data. To address th | non_poster |
What we learned from preparing for a Linked Open Data hackathon Experiences from a first timer team of the KB, national library of the Netherlands Olaf Janssen – olaf.janssen@kb.nl – @ookgezellig – 0000-0002-9058-9941, Mirjam Cuper - Mirjam.Cuper@kb.nl – @CuperMirjam – 0000-0003-0187-9873, Thomas Haighton –Thomas.Haighton@KB.nl – @ThomasHaighton, Martijn Pluim – Martijn.Pluim@KB.nl, Roosmarijn de Groot – Roosmarijn.deGroot@KB.nl – @RoosmarijndeG, Daniëlle Jansen - Danielle.Jansen@KB.nl – @ecritures, Koninklijke Bibliotheek, national library of the Netherlands Lotte van den Eertwegh - lotte.van.den.eertwegh@outlook.com, Dutch Ministry of Internal Affairs The HackaLOD1 is an annual one day hackathon of the heritage field in the Netherlands focusing on linked open data (LOD). Teams of programmers, historians, designers, and other heritage and data experts are challenged to create new, creative applications with collection data from heritage institutions, resulting in new insights into Dutch heritage by connecting collections. For the 2020 edition we formed a KB2 team to participate for the first time, bringing together colleagues from various departments, whose knowledge about SPARQL3, Wikidata4 and other LOD technologies ranged from basic to intermediate. As we never participated in a hackathon before and we are no LOD gurus who could hack together an application within a single day, we needed to make the necessary preparations well in advance. Due to COVID19 regulations the 2020 HackaLOD was repeatedly postponed, now to November 2022, but that did not discourage us from continuing our preparations, as team based learning from these preparations was a goal in itself. First, we discussed the boundary conditions for our project. With the KB collection as our natural starting point, a requirement for the HackaLOD was to reuse LOD from other institutions as well. Furthermore, we wanted to link the past to the present, bringing heritage into a 21st century context. Finally, inspired by the success of KB’s Medieval Meme Generator5, we wanted to build a fun and not-too-serious application. We aimed for collection objects that allowed us to build our own rich LOD cloud, not only by interlinking entities (people, locations, datetimes, events etc.) within our own datasets, but especially by connecting to entities in LOD endpoints of other parties as well. We found the Album amicorum of Jacob Heyblocq6 [abbrev. AAJH] to be an excellent starting point. This 17th century book of friendship7 was created by Jacob Heyblocq (1623-1690), poet and headmaster of the Amsterdam Grammar School8. It holds contributions by Rembrandt9, Vondel10, Huygens11, Cats12 and 137 other persons from the Dutch Golden Age13. This allowed us to make semantic links between Heyblocq and all album contributors. As many of these contributors are described in LOD databases of other parties, it allowed us to retrieve additional information from those sources. Furthermore, most contributions are signed with both a placename (city) and a date, allowing us to make connections between persons, locations and dates. Finally, as some contributors maintained alba themselves, it should theoretically be possible to make connections to those alba and their contributors, contributions, locations and dates, adding even more nodes to our AAJH-LOD- cloud. To build this cloud, we used Wikidata as our storage and created Wikidata items for the album itself14, for all contributions15 and for all contributors16. We did this by manual input via the Wikidata web interface and by semi-automated input via OpenRefine17, adding batches of data from local Excel sheets. We made sure all the entities were properly interconnected. This way, we were able to request data directly linked to the contributors, such as their genders, places and dates of birth and | non_poster |
6th Design & Emotion Conference 2008 — Poster Brief Game Design for Personal Health Management: An Emotional and Educational Perspective Peter Kwok Chan, Ph.D. – Department of Industrial, Interior, and Visual Communication Design, The Ohio State University, Columbus, Ohio, USA, (1) 614-247-4271, chan.179@osu.edu Elizabeth B.-N. Sanders, Ph.D. – Department of Industrial, Interior, and Visual Communication Design, The Ohio State University, Columbus, Ohio, USA, (1) 614-975-9437, sanders.82@osu.edu Erik A. Evensen – Department of Industrial, Interior, and Visual Communication Design, The Ohio State University, Columbus, Ohio, USA, (1) 603-661-9660, evensen.1@osu.edu Research Team – Erik A. Evensen, Erwin Lian, Erin Lucarelli, Louis Miller, Paul Scudieri Abstract This poster presents the efforts of a graduate student team that developed a board game design to engage children living with diabetes, as well as their friends and parents, in personal health management. Diabetes has multi-leveled health and life style management requirements, and employing a game format can simplify complex concepts in appealing ways and motivate appropriate behavior. The students applied participatory design research methodologies to co- design with subject matter experts, educators, care providers, and end-users. The students utilized game design strategy, character design, and storytelling to develop an emotionally connected and fun activity where game players interact with each other while learning about personal health management. The authors summarized this collaborative design process and shared the learning experiences of the students. Conference Theme: Toy and Game Design Keywords: Game Design, Design Research, Design Education, Participatory Design Research, Diabetes, Fun 1 | non_poster |
ANAIS 2017 VI CEFIVASF VI CONGRESSO DE EDUCAÇÃO FÍSICA DO VALE DO SÃO FRANCISCO 24 a 26 de Agosto de 2017, Petrolina-PE / Juazeiro-BA Educação Física no Brasil: Aplicações na Escola, Saúde e Desempenho GEPEGENE CEFIS Colegiado de Educação Física Prefeitura de Juazeiro O trabalho segue em frente para mudar ainda mais Ministério da Saúde Ministério do Esporte Realização Patrocínio Apoio Sec. Executiva TREINAMENTOS E EVENTOS FACULDADE INSPIRAR ® WZ PETROLINA | non_poster |
Optical light curves of the FUor and FUor-like objects Evgeni Semkov1, Stoyanka Peneva1, Sunay Ibryamov2, Ulisse Munari3, Hiroyuki Mito4 1) Institute of Astronomy and NAO, Bulgarian Academy of Sciences, Sofia, Bulgaria 2) Department of Physics and Astronomy, Faculty of Natural Sciences, University of Shumen, Shumen, Bulgaria 3) INAF Osservatorio Astronomico di Padova, Sede di Asiago, Asiago, Italy 4) Kiso Observatory, Institute of Astronomy, University of Tokyo, Japan | non_poster |
A Study on the Relationship between the Form Features and Image Perceptions of Signboards in Taiwan Ching-li Lin - Department of Visual Communication Design, The Transworld Institute of Technology, Yun Lin, Taiwan, (886) -5-5370988#8204, ap@tit.edu.tw Shing-Sheng Guan - Professor/Department of Visual Communication Design, National Yunlin University of Science and Technology, Yun Lin, Taiwan, (886) -5-5342601#6000, ssguan@yuntech.edu.tw Abstract This study uses Taiwan’s business districts as samples, which already carried out renovation program of signboard form and had assisted by the Department of Commerce, Ministry of Economic Affairs (DOC, MOEA) of Taiwan since 1996. we adopt some methods, which are multi-stage picking-out method, focus group, method of semantic differential, and questionnaire survey to establish a database on the relationship between the form feature and image perceptions of signboards. The results of this study were as follows: First, the analysis of Quantitative Theory Type I shows that the “frame”, “top shape”, “left side shape” and “right side shape” of signboard form features have more effects on image perceptions of “modern-traditional” and “friendly-cold”, which their partial correlation coefficient (PCC) of design elements are higher than 85%. Second, the “direction” variable is the least significant one on the 2 image expressions of the signboard form. Third, according the result of this paper, which can offer a reference for someone are engaging in signboard form design in the future. Conference theme: Values and Culture Keywords: signboard, form features, image perceptions, Taiwan | non_poster |
Colección de ESMOS 1 Infografía Nanopartículas de TiO2, ¿Aliadas o enemigas de la vida? Hannia Josselín Hernándes-Biviano iD, Sofía López González iD, Diana Belen Marcial-Reyes iD, Daniel Emmanuel Perez Figueroa iD, José Arturo Pantoja Cruz iD Licenciatura en Biotecnología, Facultad de Ciencias Biológicas, Benemérita Universidad Autónoma de Puebla *Email: sofia_lpg@outlook.com 07 de mayo de 2024 DOI: http://doi.org/10.5281/zenodo.11134301 Editado por: Jesús Muñoz-Rojas (Instituto de Ciencias, Benemérita Universidad Autónoma de Puebla, Puebla, México). Revisado por: Luis Ramiro Caso Vargas (Biotecnología, Facultad de Ciencias Biológicas, Benemérita Universidad Autónoma de Puebla, Puebla, México). Apoyo en la maquetación: Luz del Carmen Cortés Reyes (Estudiante de Bioquímica Clínica, Universidad de las Américas Puebla, Puebla, México). Colección de ESMOS Resumen El dióxido de titanio es un mineral y compuesto inorgánico formado por la unión de un átomo de titanio y dos de oxígeno con fórmula química: TiO2, se comporta como semiconductor normalmente en la fase anatasa y rutilo [1]. Es poliforme y existe de forma natural en tres diferentes tipos cristalinos: anatasa, rutilo y brookita. Todas presentan distintas | non_poster |
O PROCESSO DE MUNDIALIZAÇÃO FINANCEIRA E O CASO DA ECONOMIA BRASILEIRA Dyeggo Rocha Guedes1; Rosembergue Valverde de Jesus2 1. Bolsista PET/MEC-SESU Graduando em Ciências Econômicas, Universidade Estadual de Feira de Santana, e-mail: dyeggoguedes@gmail.com 2. Tutor PET/MEC-SESU Departamento de Ciências Sociais Aplicadas, Universidade Estadual de Feira de Santana, e-mail: r-valverde@uol.com.br PALAVRAS-CHAVE: Financeirização; finanças globais e economia brasileira. INTRODUÇÃO O atual estágio/grau de financeirização que vive a economia mundial faz parte dum processo de construção e reconstrução interna do sistema capitalista. Para além das análises teóricas e abordagens que dizem respeito à temática, é de suma importância que se compreenda em que contexto as finanças globais assumem o movimento sui generis de valorização do capital e da geração de lucros dentro da esfera financeira. A ênfase particular dada a este processo conhecido como de mundialização financeira, é encontrado no papel desempenhado pelo regime de câmbio flexível após o colapso de Bretton Woods, na securitização da dívida pública pelos países mais desenvolvidos do ponto de vista da industrialização – a exemplo dos EUA –, e no processo de desmantelamento dos mecanismos de supervisão da esfera financeira, efetivado pelas políticas de desregulamentação e de liberalização, CHESNAIS (1998). Deveras importante salientar que o processo de abertura, tanto interno quanto externo dos sistemas nacionais entre as décadas de 70 e 80, viabilizou e tornou emergente a necessidade de um espaço financeiro mundial. Segundo a abordagem de CHESNAIS (1998), os demais sistemas financeiros dos países periféricos não foram eliminados deste espaço durante este processo, eles foram integrados de maneira “imperfeita” ou “incompleta”, dentro de um ambiente com três peculiaridades: 1) hierarquizado – onde o sistema financeiro norte- americano domina todos os outros, por conta da posição do dólar e da grande dimensão de seus mercados de bônus e ações; 2) falta de instâncias de supervisão e com poder de controle e, 3) unidade dos mercados financeiros sendo assegurada pelos seus operadores. Com o intuito de destacar as etapas deste processo, ressaltam-se três importantes fases de periodização do surgimento da finança mundializada - regime de finanças de mercado1. A partir da abordagem sobre a periodização do processo de mundialização financeira de Chesnais feita por Scherer, tais acontecimentos podem ser sintetizados abaixo: a) A derrubada do Sistema de Bretton Woods – Gold Exchange Standard – em 1971 pelos EUA, a constituição do mercado de eurodólares e o endividamento dos países subdesenvolvidos encontram-se na etapa inicial e previamente indispensável para o crescimento da esfera financeira pós-80. b) A segunda etapa deste processo pode ser destacada no período 1980-85, a partir da adoção de uma política monetária restritiva por parte dos EUA e Inglaterra, pela expansão da securitização das dívidas públicas, liberalização dos movimentos de capitais e taxas de juros além do crescimento dos ativos pertencentes aos fundos de pensão e fundos coletivos de investimento. c) Com a intensificação da etapa anterior, a explosão das atividades nos mercados de câmbio e com a introdução dos mercados emergentes ao processo de mundialização 1 Segundo Chesnais (1998, p. 14 e 15), o forte crescimento da esfera financeira foi acompanhado de perto pela liberalização e desregulamentação dos sistemas nacionais financeiros permitindo a transição de um regime de finanças administradas para um regime de finanças de mercado. 1328 | non_poster |
Are Auditory Evoked Potentials (AEPs) altered in patients with chronic subjective tinnitus? B-ORL Spring Meeting March 6th, 2021 L. Jacxsens 1, K. Bens 1, E. Cardon 1,2, L. Jacquemin 1,2, S. Michiels 3, A. Van der Wal 1,2, W. De Hertogh 1 1. University of Antwerp 2. Antwerp University Hospital 3. Hasselt University | non_poster |
Poster: Testability-driven security and privacy testing for Web Applications Luca Compagna SAP Security Research Giancarlo Pellegrino CISPA Helmholtz Center for Information Security Davide Balzarotti Eurecom Martin Johns Technical University Braunschweig Angel Cuevas Universidad Carlos III de Madrid Battista Biggio Pluribus One Leyla Bilge Norton Lifelock Fabian Yamaguchi ShiftLeft Inc Matteo Meucci IMQ Minded Security Abstract—Modern web applications play a pivotal role in our digital society. Motivated by the many security vulnerabilities and data breaches routinely reported on those applications, we initiated the EU TESTABLE research project to address the main challenges of building and maintaining web applica- tions secure and privacy-friendly. The ultimate goal is to lay the foundations for a new integration of security and privacy into the software development lifecycle (SDLC), by proposing the novel idea of combining two metrics to quantify the security and privacy risks of a program, i.e., the testability of the codebase (via the novel concept of ”testability patterns”) and the indicators for vulnerable behaviors. We have already achieved promising results by applying our research proposal in the area of static analysis security testing (SAST) [2]. Hundreds of tarpits—code instructions challenging for SAST tools—have been identified and cap- tured in testability patterns that we used to measure SAST tools effectiveness as well as to improve the ”SAST testabil- ity” of open source applications via code refactoring routines removing the tarpits. More than 180 new vulnerabilities have been uncovered after refactoring and confirmed by open source applications’ owners. We believe similar promising results can also be achieved in other areas such as dynamic analysis, privacy, and machine learning. Index Terms—web, testability, risk, measurement, metrics, security, privacy, ML 1. Introduction Web applications are ubiquitous, and they are used in a multitude of different domains. According to the 2020 Edgescan Security Report, “Web application security is where the majority of risk still resides” [1]. This is confirmed by the fact that most of the recent data breaches took advantage of the poor security of web applications. Software security testing plays a fundamental role to mitigate this problem. In particular, developers regularly use static code analysis and automated testing tools to verify their application and identify vulnerabilities. But existing solutions are often limited in their ability to automatically discover security problems. When problems are not detected is always challenging to know for sure what the testing tools left uncovered. While threat modeling and risk assessment method- ologies are often adopted by industry at early phases of the software development lifecycle, they are too far from the implementation details and therefore they can only set high-level recommendations for later phases, such as testing. Computing risk measures that are closer to the application code itself can be used to complement early risk assessment phases, and could help to prioritize the testing effort. However, this area has so far mainly focused on determining the likelihood that an application contains a vulnerability (what we call vulnerability indicators). Therefore, even when these indicators exist, they provide little guidance to the developers on how the corresponding risk could be mitigated. For instance, knowing that a web application has a high risk of containing vulnerabilities (even when none have been detected during development and testing) is a piece of information that can be difficult to translate into actionable insights. The poor state of web security is further exacerbated by two rapidly emerging aspects. First, more and more web applications integrate machine learning (ML) components at the code or at the service level to im- plement business functions or to protect web applications from abuse1. Unfortu | non_poster |
FACTS TO EQUATIONS & WHAT! / WOW! TO HOW? Abstract: While planning to educate astronomy outside the classroom, we must first distinguish with whom we teach, in what environment, etc. If the age group is at an education level, they can use it for a career path, and others can take it as a hobby and awareness. Besides regular talks and models, etc., we can make them work with maths, physics and problem-solving related to astronomy and space education in a fun way. We have to differentiate between facts learning and analytical thinking. All about explanation through models and related helps to know the truth and facts, but working with the problem induces their analytical thinking with enthusiasm. Hence, this allows either way of raising the interest in astronomy and also good at analytical thinking. In this I discuss what are such examples. CHRISPHIN KARTHICK, INDIAN INSTITUTE OF ASTROPHYSICS, INDIA 5th Shaw-IAU Workshop on Astronomy for Education | non_poster |
3D modeling of a superconducting dynamo- type flux pump Asef Ghabeli 1, Enric Pardo 1, Milan Kapolka 2 1. Institute of Electrical Engineering, Slovak Academy of Sciences, Bratislava, Slovakia. 2. Aerospace & Computational Engineering, University of Leicester, Leicester, United Kingdom. PRESENTED AT: centennial (iPosterSessions - an aMuze! Interactive sy... https://asc2020.ipostersessions.com/Default.aspx?s=1... 1 of 14 09/11/2020, 16:26 | non_poster |
The Survey Quality Predictor 3.0 What is SQP? • A software to predict the quality of continuous latent survey questions • A searchable open-access database of survey questions and estimates of their measurement quality in many different languages • Freely available at How does SQP work? Almost like the weather forecast... Lydia Repke1, Cornelia Neuert1, & Wiebke Weber2 1 GESIS – Leibniz Institute for the Social Sciences, Germany 2 Ludwig-Maximilians-Universität München, Germany Facts Quality prediction available for • 28 languages • 33 countries • continuous latent variables Prediction algorithm is based on • >600 MTMM experiments Database contains • >75.000 survey questions Coding of the formal question characteristics e. g., number of scale points, polarity Based on a meta-analysis of Multitrait-Multimethod (MTMM) experiments with attitudinal questions Quality estimates = reliability x validity SQP Estimation algorithm i. e., random forest model or https://sqp.gesis.org/ What can SQP be used for? 1 3 Questionnaire Development Search for already existing items in the database Add new survey questions, code their characteristics, and get a qua- lity estimate Compare different versions of sur- vey items and their quality estimates Download information from the database Translation Checks Compare the formal and linguistic codes between different language versions of the same question (e.g., between source and translated ver- sion) Uncover translations that might be problematic Correction for Measurement Error Use the quality estimates in your substantive analyses Discover the true correlations bet- ween items by correcting the ob- served correlations 2 • • • • • • • • | non_poster |
Newsletter Issue 6 August 2021 The overall objective of the MASTRO project is to develop intelligent bulk materials for the transport sector incorporating self-responsive properties In this issue: 1. The MASTRO Workshop on “Developing Intelligent bulk Materials for Smart Transport Industries” 2. The final results of MASTRO 3. MASTRO´s Exploitation Plan 4. MASTRO Dissemination Activities 5. MASTRO Publications 2021 6. MASTRO Videos 7. Who we are From nanomaterials and manufacturing know-how to building self-responsive materials for the aerospace, automotive, and transport sectors This project has received funding from the European Union’s Horizon 2020 research and innovation programme under the Grant Agreement no 760940.The material presented and views expressed here are the responsibility of the author(s) only. The EUCommission takes no responsibility for any use made of the information set out. COPYRIGHT © AXIA INNOVATION | non_poster |
Open Science data without curation. Is it useful? An American Astronomical Society Publishing perspective Greg Schwarz AAS Journals Data Editor | non_poster |
Improvements in mycoremediation technology for the recovery of contaminated soils DEMONSTRATION SITE What are the expected results? The LIFE MySOIL project develops a competitive and innovative technology to demonstrate the feasibility of mycoremediation to remediate all petroleum-derived organic pollutants from aged contaminated soils MySOIL project includes the design, construction, and operation of different pilots for TPH mycoremediation testing in 3 different sites (Spain, France, and Italy) and one additional small pilot to study the technology’s transferability for the remediation of HTF (Heat Transfer Fluid) polluted soil 90% Removal of total petroleum hydrocabons >75% Reduction of soil toxicity 100m3 Valorisation of of agro-industrial waste as fungal inoculum amendment Reduction of environmental impacts compared to the thermal desorption baseline scenario: 90% energy 55-70% in toxicity 55% global warming What are the environmental objectives? Remove all petroleum-derived organic pollutants from aged industrial contaminated soils Promote and demonstrate mycoremediation as a key bioremediation technology Reduce the environmental impacts of mycoremediation processes in comparison with conventional technologies Promote the principle of a circular economy remediation & waste into development This project has received funding from the LIFE Programme of the European Commission under contract number LIFE20 ENV/ES/000416. More information: www.lifemysoil.eu @MySOIL_EU @mysoil-life-project MySOIL – LIFE project contact@lifemysoil.eu Site characterization Biotreatability testS SMALL PILOTS PILOT MYCOPILES The soil texture is sandy clay loam. Soils of an already strongly biodegraded middle distillate, with a TPH concentration of 5,7 g/kg. 30 strains tested for growth and survival on the soil. Five saprotrophic strains were selected for the biotreatability tests. Mixtures of coarse and fine material were trialed as soil bulking agent. Four conditions are tested using a Pleurotus sp.: + a biopile (periodically mixed) + 3 static systems: • 1 thick layer with 100 kg of inoculum • 4 thin layers with 25 kg each • full mixing of inoculum and soil. Small pilots and pilot mycopiles installed and operated sequentially for 6 months, respectively, at former refinery in Rouen managed by VALGO 1 active and 1 control biopile of 50 m3 will be designed and settled from the small pilot results. | non_poster |
IDCS - Projet Eosine L’Eosine est une solution antiseptique et assechante de couleur rouge qu’il est possible de trouver dans n’importe quelle pharmacie. L’éosine Y(yellow) qui la constitue est indiquée comme étant présente à 2 % en masse. L’objectif est donc de savoir s’il est possible de retrouver cette valeur par des méthodes de dosages par absorption ou par émission. I. Dosage par étalonnage But : obtenir la concentration molaire puis massique A. Protocole expérimental Au préalable il est nécessaire de préparer une dilution de l’éosine commerciale dont on cherche la concentration, pour cela une goutte de ce produit est introduite dans une fiole jaugée de 100 mL, fiole ensuite complétée avec de la soude (NaOH, 0,01M) jusqu’au trait de jauge. Avant de réaliser toutes les dilutions afin d’obtenir une courbe d’étalonnage, il est préférable de réaliser seulement trois solutions afin de s’assurer que l’absorbance de la solution que l’on souhaite doser se trouve bien dans l’intervalle des absorbances des solutions préparées. Il s’agit de s’assurer de ne pas préparer des solutions superflues. Il a donc été décidé de réaliser trois solutions de concentrations , et . Ces 𝐶1 = 5 * 10 −5𝑚𝑜𝑙. 𝐿 −1 𝐶2 = 10 −5𝑚𝑜𝑙. 𝐿 −1 𝐶3 = 5 * 10 −6𝑚𝑜𝑙. 𝐿 −1 concentrations ont été choisies arbitrairement sachant qu’il est primordial que ces concentrations soient suffisamment faibles pour respecter le critère imposé par la loi de Beer-Lambert. Pour cela, une solution mère d’éosine Y de concentration égale à est faite, c’est 10 −3𝑚𝑜𝑙. 𝐿 −1 à partir de celle-ci que les trois solutions seront réalisées. Ainsi, une masse de 64,3 mg d’éosine Y pure est prélevée et transvasée dans une fiole de 100 mL, celle-ci est ensuite complétée avec la solution de soude utilisée précédemment. A partir des concentrations C1, C2 et C3 les volumes de la solution mère à prélever ont été calculés, ils sont respectivement de , et . Les solutions 1, 2 et 3 𝑉1 = 1 𝑚𝐿𝑉2 = 200 µ𝐿 𝑉3 = 100 µ𝐿 sont donc préparées à partir de ces volumes. Après avoir effectué le blanc de spectromètre avec la solution de soude utilisée pour les dilutions, les trois solutions d’éosine Y ainsi que la première solution réalisée à partir de l’éosine commerciale sont analysées. Des résultats obtenus (cf graphe 1) il a été conclu que les dix dilutions à partir desquelles la courbe d’étalonnage sera réalisée auront des concentrations comprises dans l’intervalle . Il a également été décidé de refaire une solution à partir d’éosine commerciale, [10 −6; 10 −5] 𝑚𝑜𝑙. 𝐿 −1 cependant cette fois un volume précis est prélevé. Sachant qu’une goutte équivaut environ à et 40 µ𝐿 d’après nos précédents résultats, afin d’être dans l’intervalle d’absorbance déterminé postérieurement, un volume de est prélevé pour préparer 100 mL de solution. L’ensemble des dilutions sont 15 µ𝐿 réalisées et on obtient les solutions et les données suivantes (cf figure 2 et tableau 1) : | non_poster |
510 Anais do V Simpósio Internacional de Inovação em Mídias Interativas Goiânia: Media Lab / UFG, 2018 Desenvolvimento de objeto educacional baseado em Realidade Virtual Aumentada para aplicação nos processos de ensino da sinapse de neurônios na disciplina de biologia Hailton David Lemos1 Gustavo Gomes de Oliveira2 Raimundo Ferreira da Silva2 Introdução O ensino da Sinapse na disciplina Biológica é um desafio, por ser um tópico abstrato, o que geralmente causa desmotivação, desinteresse e dificuldade de assimilação por parte dos alunos. Nesse contexto, a Realidade Virtual Aumentada, pode se tornar um instrumento capaz de auxiliar no ensino deste conteúdo abstrato, melhorando a comunicação e a interação aluno-professor durante o período letivo. Como hoje é está se tornando comum o aluno fazer uso de aparatos tecnológicos em sala de aula, o professor deve aproveitar essa tecnologia disponível elaborar metodologias, e trabalhar conteúdos utilizando-os, e assim, os aparatos tecnológicos poderão deixar de ser simples entretenimento, com intervenções pedagógicas por parte dos pro- fessores. Portanto, permitir o aluno levar tabletes e celulares pra sala irá resinificar o processo ensino aprendizado em sala de aula. O objetivo deste trabalho é apresentar uma proposta utilizando a Realidade Virtual Aumentada como ferramenta aplicada no ensino de Biologia, mais precisamente, no ensino de Sinapses de Neurônios, Figura 1, e fenda sináptica. Figura 1: Sinapse de um Neurônio. Fonte: O Autor. 1 Professor da FANAP. http://lattes.cnpq.br/0527593633350229 2 Alunos do curso de Graduação de Análise e Desenvolvimento de Sistemas – FANAP. | non_poster |
Perlara PBC, Confidential, March 2017, Pg. 1 6000 Shoreline Court, South San Francisco CA, 94080 MSD PerlQuest Research Plan Perlara is the first biotech public benefit corporation partnering with families and BioPharma to discover definitive treatments and ultimately cures for rare genetic diseases. Our automated and fully integrated drug discovery platform involves rapid, in vivo phenotypic screens using CRISPR- programmable disease models in multiple species, followed by lead validation in patient-derived cells and mice. We propose the first natural history study of Multiple Sulfatase Deficiency (MSD) in the fruit fly Drosophila melanogaster, with the objective of discovering and validating phenotypes amenable for high- throughput drug screening, or screenotypes. The gene responsible for MSD is SUMF1, which has a single ortholog in flies. While a MSD mouse model has been generated and characterized (1), a fly MSD model has not yet been studied. In fact, the SUMF1 fly ortholog (“dSUMF1”), or CG7049, is as the gene name suggests completely uncharacterized. As shown in the protein sequence alignment below, a comparison of human SUMF1 and CG7049 reveals that 53% of amino acids are conserved, especially in the C-terminal domain where many mutations are found. In fact, 23 of 54 mutations observed in MSD patients to date (2, 4) affect amino acids that are identical between humans and flies (red): Human 46 LAGSCGC-----GTPQRPGAHGS-----SAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFT 100 ::..*** ..*..*...*. :..**.:.*: ..**.:...:.*..:*.*... Fly 18 VSSDCGCQKLDRKAPDMPSISGQVCQQRAQGAHSHYRD------YYGELEPNIADMSLLPGGTVY 76 Human 101 MGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQ 165 ****.*....*.***.*:*.::.**:*.*****..*.***..*.*.****::****:*:.:**.. Fly 77 MGTDKPHFPADREAPERQVKLNDFYIDKYEVSNEAFAKFVLHTNYTTEAERYGDSFLFKSLLSPL 141 Human 166 VKTNIQQ-AVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEA 229 .:.*::. .**:*.**..*.*.*****.*.**.*.*...***:****.***.**.*******:** Fly 142 EQKNLEDFRVASAVWWYKVAGVNWRHPNGVDSDIDHLGRHPVVHVSWRDAVEYCKWAGKRLPSEA 206 Human 230 EWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNI 294 ***.:****...:********.*:.:*:.*****:**..*..****:.*:*****..*.*.*:*: Fly 207 EWEAACRGGKERKLFPWGNKLMPRNEHWLNIWQGDFPDGNLAEDGFEYTSPVDAFRQNIYDLHNM 271 Human 295 VGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSAS 359 ***.****:*.*.*: :.:.** :********:**:***************.****. Fly 272 VGNVWEWTADLWDVN---DVSDNP-------NRVKKGGSYLCHKSYCYRYRCAARSQNTEDSSAG 326 Human 360 NLGFRCA 366 ******* Fly 327 NLGFRCA 333 | non_poster |
University Politehnica of Bucharest Title: Resilient DC LV communities – UPB demonstrator Authors: Irina Ciornei, Mihaela Albu, Mihai Sanduleac, Lucian Toma Published in: Conference Proceedings of Microgrids Symposium, Bucharest, Romania DOI link to publication: to be determined Publication date: 09/2018 Link to publication from www.openenergyprojects.ro Citation for published version: I. Ciornei, M. Albu, M. Sanduleac, L. Toma, “Resilient DC LV communities – UPB demonstrator,” presented at the Microgrids Symposium 2018, Bucharest, Romania, 3-7 Sept. 2018, poster. General rights: Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. Personal use of this material is permitted. Permission from the copyright owner of the published version of this document must be obtained (e.g., IEEE) for all other uses, in current or future media, including distribution of the material or use for any profit-making activity or for advertising/promotional purposes, creating new collective works, or reuse of any copyrighted component of this work in other works. You may freely distribute the URL/DOI identifying the publication in the public portal. Policy for disabling free access: If you believe that this document breaches copyright lease contact us at info@openenergyprojects.ro providing details, and we will remove access to the work immediately and investigate your claim. | non_poster |
Dear {{ contact.NOME | default : "reader" }}, Welcome to the latest edition of our newsletter, where we are thrilled to present the culmination of months of groundbreaking research and innovation within the SiC Nano for PicoGeo consortium! In this edition, delve into the advancements of SiC technology showcased at the final conference in Brussels, including innovative applications in geophysical monitoring. Explore the successful development of an all-optical strain sensor prototype and gain insights from advanced strain-meter signal analysis. Learn about pioneering work presented at international conferences, focusing on volcanic activity monitoring using new sensor technologies. Finally, discover future frontiers in electronics and sensing technologies discussed in the latest webinar. Enjoy the read! The SiC Nano for PicoGeo Team Final Conference – Innovation and business potential of SIC optical and mechanical materials: the experience of SiComb & SIC Nano for PicoGeo frontier projects On March 20th, Brussels hosted the final conference marking the culmination of the SiComb and SiC Nano for PicoGeo projects, both of which represent significant strides in silicon carbide (SiC) research. Supported by the Horizon 2020 FET-Open Programme, these projects have set new benchmarks in developing compact, high-efficiency devices and advanced geophysical monitoring systems. The conference provided a platform for discussing the impressive outcomes of these initiatives and contemplating the future of SiC technology. Led by Dr. Francesco La Via from the CNR-IMM Catania, the SiC Nano for PicoGeo project focuses on harnessing SiC’s unique properties to revolutionize geophysical monitoring systems. The project demonstrated SiC’s wide application potential, especially in creating devices that operate across an ultra- wideband, offering a versatile solution for integrating and surpassing the capabilities of traditional materials. | non_poster |
R ES OLVIN G THE MOST LUM INOUS LYM AN-ALPHA EMI TT ERS IN THE EPO CH OF RE IONISATION Jorryt Matthee Zwicky Fellow @ collaborators include David Sobral, Max Gronke, Ana Afonso, Huub Röttgering, Bahram Mobasher, Sergio Santos, Gabriele Pezzulli, Behnam Darvish, Sebastiano Cantalupo, Haruka Kusakabe, Floriane Leclercq and others in the MUSE GTO | non_poster |
GMRT HCT 1.3 DFOT ❏ Archival data Proper motion data NIR MIR FIR Radio Gaia eDR3 2MASS WISE AKARI, Planck NVSS, HIPASS Sh 2-301 :A blistered H II region undergoing star formation Rakesh Pandey*, Saurabh Sharma**, Lokesh Dewangan* Physical Research Laboratory, Ahmedabad*, Aryabhatta Research Institute of Observational Sciences, Nainital** , Email: pandey.rakesh405@gmail.com ❏ Observed data | non_poster |
By University of Coimbra Urban smart manufacturing RES4CITY CASE STUDY #8 with carbon sequestration | non_poster |
At CD ComputaBio, we specialize in providing comprehensive drug design services that leverage the latest advancements in computational biology and chemistry. Our integrated approach combines the precision of computational methods with the creativity of human expertise to deliver tailor-made solutions for our clients in the pharmaceutical and biotechnology industries. Drug design is a multifaceted process that involves the identification and optimization of biologically active compounds to create pharmaceutical drugs. Traditionally, drug discovery relied heavily on experimental approaches, which were time-consuming, expensive, and often led to a high rate of failure. With the advent of CADD, researchers can now expedite the drug design process by utilizing computational tools to predict how a molecule will interact with its target and optimize its properties for enhanced efficacy and safety. Drug Design Services Introduction of Drug Design Services Virtual Screening Service Our virtual screening service utilizes advanced computational algorithms to screen vast libraries of compounds and identify potential drug candidates with high binding affinity to specific biological targets. By employing sophisticated molecular docking simulations and innovative scoring methods, we can efficiently sift through millions of compounds to pinpoint those with the greatest potential for further optimization. CADD Services Our CADD services encompass a wide range of computational techniques, including molecular modeling, QSAR (Quantitative Structure-Activity Relationship) analysis, and molecular dynamics simulations. By integrating these approaches, we can elucidate the Our Service | non_poster |
Study of the complementation of Xylella fastidiosa causing CVC with a functional polygalacturonase enzyme and its impact on bacterial physiology Marcella Rosa Leão da Costa¹; Natália Sousa Teixeira Silva²; Alessandra Alves de Souza² 1 Universidade Federal de São Carlos, Araras, SP, Brazil 2 Instituto Agronômico de Campinas, Centro de Citricultura Sylvio Moreira, Cordeirópolis, SP, Brazil | non_poster |
Final conference, Rome October 11, 2016 Facies and stratigraphic architecture of high-frequency shelf sequences in high- latitude settings Massimo Zecchin1, Octavian Catuneanu2, Michele Rebesco1 1 OGS (National Institute of Oceanography and Experimental Geophysics), Trieste, Italy 2 Department of Earth and Atmospheric Sciences, University of Alberta, Edmonton, Canada Abstract High-frequency clastic shelf sequences deposited in high-latitude settings display marked differences, in term of facies and stratigraphic architecture, with respect to their lower latitude counterparts. This is due to the presence of ice which (1) leads to the accumulation of glacigenic and glacimarine deposits; (2) provides an additional control on accommodation; and (3) determines the position of the shoreline. Transgressions and regressions in glaciated settings are controlled respectively by the retreat and advance of the ‘ice’ shoreline (i.e., the water/ice contact) irrespective of relative sea-level changes; once the ice retreats across the land, the traditional ‘land’ shoreline is exposed and the control on sequence architecture is exerted by the interplay between relative sea-level changes and sediment supply as in low- and middle-latitude settings. Figure 1: The concepts of ‘ice’ and ‘land’ shorelines. (A) The ‘ice’ shoreline is represented by the water/ice contact, when ice sheets occupy the shelf. (B) The ‘land’ shoreline, represented by the water/land contact, is found when ice retreats across the land area. | non_poster |
etaicossA UAI ,rataQ-CON-ecneics ecapS & ymonortsA rof noinU barAeelaD inaHykS eht nI semaN cibarA riehT toG sratS woHykS naibarA eht ni selaT sratSبسم الله الرحمن الرحيم Looking at any sky chart, one can find many stars with Arabic names. Two third of the stars in the modern sky chart have Arabic names. | non_poster |
Sociedad EDUCACIÓN · MEDIO AMBIENTE · IGUALDAD · SANIDAD · CONSUMO · LAICISMO · COMUNICACIÓN · ÚLTIMAS NOTICIAS El Ministerio de Sanidad ha decidido suavizar los criterios de exclusión para donar sangre de quienes han pasado la infección por coronavirus y sus contactos estrechos ante la escasez registrada en las últimas fechas, que amenazaba con poner en riesgo la actividad de los hospitales y que ha llevado a la mayoría de comunidades a hacer un llamamiento a los ciudadanos para incrementar las reservas.... LA CRISIS DEL CORONAVIRUS > La escasez de sangre en los hospitales obliga a Sanidad a relajar los criterios para donar tras pasar la covid El Comite Científico del ministerio rebaja de 14 a 7 días la espera tras la infección y los centros podrán aceptar a los contactos estrechos 14 ENE 2022 - 22:30 CST ORIOL GÜELL SUSCRÍBETE 30/5/24, 22:19 La escasez de sangre en los hospitales obliga a Sanidad a relajar los criterios para donar tras pasar la covid | Sociedad | EL PAÍS https://elpais.com/sociedad/2022-01-15/la-escasez-de-sangre-en-los-hospitales-obliga-a-sanidad-a-relajar-los-criterios-para-donar-tras-pasar-la-covid… 1/6 | non_poster |
Aile ve Toplum Desteğinin Önemi Down Sendromu Farkındalık Hareketi, Selim Keçeli | non_poster |
Embedding Intangible Rewards of a Brand Using Transvaluation How embedding the intangible rewards of the Oprah brand changed the function of O Magazine Paula Chenchar Hänus, MFA Paula Chenchar Hänus, Clear Lake, Iowa, USA, paulahanus@gmail.com 1. Introduction In his book Beyond the Brillo Box, Danto looks at works of art that began as simple objects from the real world and were transformed into artwork. He establishes that, in the end, it is the function of the work of art that determines its value. When the function changes, so does the value. Danto calls this concept of the changing value of art ‘transvaluation’. Danto uses Warhol’s Brillo Box and Duchamp’s Fountain to illustrate how artifacts from the real world, such as a Brillo box or a urinal, can transform into works of art. He says that by reappropriating the meanings of the artifacts, the artists were able to transform the artifacts into objects that embodied thought and content, which increased the value of these objects. The objects no longer existed as objects of use, rather as the material embodiment of Warhol’s and Duchamp’s thoughts and values [1]. Another important concept that Danto offers is that simply putting objects from the real world on display in an art type setting does not change the value of the object. He uses the example of a museum director hanging an African net at the entrance of an African art exhibit as a way to connect the audience with the exhibit. The function of the net was to help link the viewer with the exhibit. Danto says making the audience aesthetically responsive to an object does not transform the object into a work of art. There is a difference between art and artifact and the circumstance of display itself does not affect the value. By adding the net to the exhibit, the value of the net did not change. Its value only existed in that system, at that time, and in that space. In industry, one might say the net was a value add proposition. Whereas, the value of Warhol’s Brillo Box and Duchamp’s Fountain is in the broader social context in which the objects exist. The value of their artwork is in their ability to embody thought and content. It is in the social value. When the function of the object changed to an object that exists for the greater good of society (and the viewer/audience believes this), then the value changes. Abstract: In Beyond the Brillo Box, Danto looks at works of art that began as objects and were transformed into works of art. He establishes that it is the function of the work that determines the value. When the function changes, so does the value. Danto calls this Transvaluation [1]. With regards to changing the value of a brand, the belief is that consideration should be given to the function of the designed affordances. Is the function of these brand experiences to link the viewer/audience with the product/organization; or is the function of the product/organization to express the values behind the brand? An analysis of the launch of O, the Oprah Magazine discovers that within the first few months of publication, the function of the designed affordances in the magazine changed from objects that link the reader to the brand to embodiments of the emotional rewards of the brand. Keywords: Transvaluation, intangible rewards, Hearst/Harpo-driven, double identities | non_poster |
h"ps://doi.org/10.25392/leicester.data.c.6630017 Summary • The landscape where modern slavery and sexual exploitation takes place has changed with the onset of digital technologies dominating the organisation of the commercial sex industry. • Adult Service Websites (ASWs), where most sexual services are advertised, negotiated and facilitated in the UK, is a relatively new space where exploiters can manipulate, entrap, coerce and force individuals into selling sexual services. • The role of ASWs in facilitating offending behaviour is complicated and unregulated as national intelligence services try to understand routes to trafficking, the police work to identify victims and target offenders, and first responders deliver interventions to victims of sexual exploitation. • Researchers from the University of Leicester, (in partnership with the National Crime Agency, National Police Chief's Council, and the NGO Unseen) investigated what role ASWs can play in preventing human trafficking and sexual exploitation in the UK, and their role in wider policies and laws. Introduction This study explored the ways Adult Service Websites (ASWs) have facilitated and responded to modern slavery human trafficking (MSHT) and sexual exploitation online. The findings demonstrate the varied ways the internet is a tool for exploiters. Technology, then, is essential to disrupting sex trafficking online (Kjellgren, 2022). The multi-methods study comprised of semi-structured qualitative interviews with police (n=30) across 23 forces in England & Wales, practitioners (n=13) and ASW operators (n=5) and a survey with sex buyers (n=142). Central to the research process was a participatory action research approach with survivors of modern slavery, in partnership with Unseen. This briefing reports on the findings from the survey with sex buyers, exploring how they perceive their role in identifying crimes, barriers to reporting and how prospective further criminalisation will affect their purchasing practices. Background The survey yielded 142 responses from people who purchase sex on ASWs in the UK. Most respondents were aged 55-64 (31%), or 45-54 (24%), whilst 14% of individuals were 35-44 or 65 years and older and 12% and 5% were 25-34 or 18-24 respectively. The vast majority were male (92%) who purchased sexual services from cisgender women (98%) and many had been purchasing sexual services for more than 10 years (37%). Before being asked regarding their knowledge of sexual exploitation on ASWs, respondents were asked when purchasing sexual services, where they thought the majority of the money went. • 78.1% believe the money goes directly to the sex worker • 3.5% to a third party • 14.1% were not sure • 4.2% cited that the money gets split between the sex worker and their agency Prevention of Modern Slavery within Sex Work: the role of Adult Services Websites Sex buyers briefing Professor Teela Sanders and Dr Rachel Keighley https://doi.org/10.25392/leicester. data.c.6630017 Key messages 1 2 3 4 5 6 Sex buyers who utilise ASWs have oversight of adverts and have knowledge of potential indicators of exploitation. Most sex buyers understand themselves to have a level of responsibility, and if they suspected exploitation, would cancel their booking and in some cases, report to the police or ASW platform. However, most sex buyers say they are not aware of reporting routes on their chosen ASW platform and there remains significant barriers to reporting including: - Wishing to remain anonymous; - Lack of trust; - And believing no action will be taken. Nearly half of respondents trusted ASW platforms to give them information regarding sexual exploitation, suggesting that ASWs can play an important role in MSHT education and the promotion of whistleblowing. Sex buyers were concerned regarding the increased regulation of ASWs, but ultimately the majority believed there is a greater duty of care required to make online platforms safer for consensual sex work. Curren | non_poster |
Marco Danilo Claudio Torri Università degli Studi di Milano Istituto Nazionale di Fisica Nucleare – sezione di Milano Via Celoria 16 – 20133 – Milano - Italy Neutrinos as possible probes for quantum gravity COST Action 18108 King’s College – London – UK – 18-20 December 2023 | non_poster |
A new era of neutrino physics at LHC: the SND @LHC experiment Riddhi Biswas 1 NuPhys2023, 18th – 20th December, 2023 King’s College London | non_poster |
SC-FLARE: Cooperative DDoS Signaling based on Smart Contracts Bruno Rodrigues, Spasen Trendafilov, Eder Scheid, Burkhard Stiller Communication Systems Group CSG, Department of Informatics IfI, University of Zurich UZH Binzm¨uhlestrasse 14, CH-8050 Z¨urich E-mail: [rodrigues,scheid,stiller]@ifi.uzh.ch spasen.trendafilov@uzh.ch Abstract—Distributed Denial-of-Service (DDoS) attacks re- mains as one of the major causes of concerns for service providers around the world. This paper introduces SC-FLARE, a Smart Contract (SC) based cooperative signaling protocol built on top of a Ethereum Proof-of-Authority Blockchain (BC) for the sharing of attack information, the exchange of incentives, and the tracking of reputation in a fully distributed and automated fashion. By making use of BC and SC, SC-FLARE provide the required collaborative platform without the burden to maintain, design, and develop special registries and gossip protocols for a cooperative defense. I. INTRODUCTION The growing number of insecure devices inflated Distributed Denial-of-Service (DDoS) statistics to unprecedented levels. Recent attacks demonstrated their power with new records in the volume of traffic and greater attack frequency [1]. While 2018 registered the largest ever DDoS attack in terms of traffic volume, the frequency of DDoS attacks also increased more than 2.5 times between 2014 and 2017 [2]. Botnets (e.g., Mirai [3]) taking advantage of insecure devices ranging from small sensors to baby cameras and home gateways connected to the Internet are the main reason behind the escalation. The distributed nature of DDoS attacks suggests that an ideal defense would be equally distributed. Advantages of cooperative defenses have been widely recognized in literature [4], [5]. It expands the detection and mitigation capabilities over the network, it also enables to block malicious traffic near its source. While our previous work [6] presented the initial structure of a collaborative defense based on Blockchain (BC) and Smart Contracts (SC), the SC design had no mechanisms to ensure the provision of incentives for mitigation services, nor assess the reputations of the actors involved. SC-FLARE proposes a cooperative defense providing in- centives and reputation tracking capabilities based on a per- missioned Proof-of-Authority (PoA) Ethereum Blockchain. The main advantages are the deployment of existing public and distributed infrastructure to flare white or blacklisted IP addresses and to distribute incentives related to the requested mitigation activities. This work is structured as follows. Sec- tion II present related work. Section III presents the design and implementation. Evaluation is presented in Section IV and considerations and future work, in Section V. II. RELATED WORK The literature contains a number of industry and academia proposals to detect and mitigate DDoS attacks, being cate- gorized as in-house or off-house approaches [4]. While in- house defenses are based on resources available locally (e.g., firewall, load balancer, intrusion detection/prevention systems) to protect a single target or network, an off-house defense involves a third-party to detect and/or mitigate the attack. In this regard, an off-house defense can be cloud-based or cooperative [5]. While the former serves as a proxy receiving, analyzing and redirecting traffic to the target, which delegate detection and mitigation tasks to the protection provider (e.g., Akamai [1] or CloudFlare [7]), the latter is a decentralized approach typically implemented as an overlay network. Secure Overlay Services (SOS) [8], COSSACK [9], and DefCOM [10] paved the way for cooperative defenses in the early 2000s. While SOS’s approach focused on identifying legitimate sources for time-sensitive networks (i.e., requiring peers to authenticate to the overlay network), COSSACK and DefCOM based their approach on detection and enforcement points in access networks. However, despite pioneering the decentralization | non_poster |
The 19th Cambridge Workshop on Cool Stars, Stellar Systems, and the Sun Edited by G. A. Feiden The Sun Like Star : HT Vir Mehmet TANRIVER1, Ferhat Fikri ÖZEREN1 1 Erciyes University, Astronomy and Space Sciences Department, 38039, Kayseri, Turkey Abstract This study is focused on the photometric (light curve) analysis of the Sun like star HT Vir which is a binary star located in the ASAS catalogue, shows variation in W UMa (EW/KW) type. The solution of light curve was executed using the PHOBE code. We conducted an unspotted solution for the HT Vir binary system. The positions in the HR diagram of the components are also discussed. 1 INTRODUCTION HT Vir is the sun like a photometric binary star. The gen- eral information belongs to this star are given the follow- ing Table2. HT Vir is an eclipsing variable with ESD (Eclips- ing Semi-Detached) type according to data of ASAS catalog. The U, B, V, R, I, J, H and K bands magnitudes of the Sun were taken from (Tanrıver, 2012), Tanrıver (2014a), Tanrıver (2014b) and Tanrıver & Özeren (2016) as shown in Table??. As seen, it is in compliance the colour indices of the Sun with the colour indexes of HT Vir (see Table3). Table 1: The informations of HT Vir ASAS ID 134607+0506.9 J 6.11 RA (2000) 13:46:06.9 H 5.85 DEC (2000) 05:06:54.0 K 5.79 Period (day) 0.407672 V-J 1.10 T0 (2450000+) 2490.0 V-H 1.36 V 7.1 V-K 1.42 VAmp 0.45 J-H 0.26 Class EC/ESD H-K 0.06 J-K 0.32 Table 2: The colour indexes of the Sun ( Tanrıver (2012), Tan- rıver (2014a), Tanrıver (2014b) ). B-V 0.6457 ± 0.0421 V-J 1.1413 ± 0.1063 H-K 0.0572 ± 0.0351 U-B 0.1463 ± 0.0596 V-H 1.4613 ± 0.1183 J-K 0.3777 ± 0.0494 R-I 0.3403 ± 0.0356 V-K 1.5210 ± 0.1149 J-L 0.4187 ± 0.0558 U-V 0.7926 ± 0.1032 V-L 1.5167 ± 0.0959 J-M 0.3711 ± 0.0529 V-R 0.4674 ± 0.0639 V-M 1.4621 ± 0.0759 K-L 0.0403 ± 0.0517 V-I 0.7053 ± 0.0872 J-H 0.3196 ± 0.0432 K-M 0.0063 ± 0.0546 Table 3: Comparison the colour indexes of the Sun and star. V-J V-K J-K The Sun 1.14 1.52 0.37 134607+1506.9 (HT Vir) 1.10 1.42 0.32 2 OBSERVATION AND PHOTOMETRIC SO- LUTION The light curves and data in the V band of HT Vir vari- able in the ASAS catalog have been taken into account (Po- jmanski, 1997). The graphics according to the time (HJD) of the magnitudes (Vmag) is given in Figure1. The light curve according to phase of the stars is given in Figure2. The light curve created according to the average (averaged ev- ery each third point ) is given in Figure3. The photometric solution was carried out using the PHOEBE interface with based Wilson-Devinney, photometric solution methods (see Figure4). While the photometric solution, hot component of the binary system is taken as a Sun like star. Physical param- eters of hot component (temperature: 5800K, mass: 1Msun and radius: 1Rsun) which is compatible with the Sun are firstly kept constant during solution. The parameters ob- tained from the photometric solution results are given in Table4. The positions in the HR diagram of the component stars are given in Figure5. 3 CONCLUSION HT Vir shows variation like W UMa (EW/KW) type. The component stars belong to a contact binary which filled Roche lobes and main sequence stars. The positions in the HR diagram of components are shown figure 5. Both compo- nents are Sun like stars. Acknowledgments This work was supported by Scientific Research Projects Coordination Unit of Erciyes University with project num- ber FBA-09-788, FBY-10-2924 and FBA-11-3283 . This study makes use of data products from the All Sky Autometed Sur- vey (ASAS). The use of the SIMBAD and ADS databases is 1 | non_poster |
Poster STI 2022 Conference Proceedings Proceedings of the 26th International Conference on Science and Technology Indicators All papers published in this conference proceedings have been peer reviewed through a peer review process administered by the proceedings Editors. Reviews were conducted by expert referees to the professional and scientific standards expected of a conference proceedings. Proceeding Editors Nicolas Robinson-Garcia Daniel Torres-Salinas Wenceslao Arroyo-Machado Citation: Weimer, V., Kullmann, S., Heck, T., & Rittberger, M. (2022). Teaching as Part of Open Scholarship – Open Educational Resources as a Scientometric Indicator for Academic Performance Measurement. In N. Robinson-Garcia, D. Torres- Salinas, & W. Arroyo-Machado (Eds.), 26th International Conference on Science and Technology Indicators, STI 2022 (sti2297). https://doi.org/10.5281/zenodo.6948364 Copyright: © 2022 the authors, © 2022 Faculty of Communication and Documentation, University of Granada, Spain. This is an open access article distributed under the terms of the Creative Commons Attribution License. Collection: https://zenodo.org/communities/sti2022grx/ | non_poster |
Towards Improving Mental Models of Personal Firewall Users !"# # $ % # &' () *+,-. % . $ &# / 01234 5 (67 8 ,9:"33:; )8 .8 85):<1&2&-3!!1&",-&<(3:(3, ; 5 ;55 = ; 5 ;55 = ; 5 ;55 >= | non_poster |
Poster STI 2022 Conference Proceedings Proceedings of the 26th International Conference on Science and Technology Indicators All papers published in this conference proceedings have been peer reviewed through a peer review process administered by the proceedings Editors. Reviews were conducted by expert referees to the professional and scientific standards expected of a conference proceedings. Proceeding Editors Nicolas Robinson-Garcia Daniel Torres-Salinas Wenceslao Arroyo-Machado Citation: Oancea, A., Robson, J., Derrick, G.E., & Xu, X. (2022). The role of research in higher education and research assessment: an international comparative study. In N. Robinson- Garcia, D. Torres-Salinas, & W. Arroyo-Machado (Eds.), 26th International Conference on Science and Technology Indicators, STI 2022 (sti2259). https://doi.org/10.5281/zenodo.6912775 Copyright: © 2022 the authors, © 2022 Faculty of Communication and Documentation, University of Granada, Spain. This is an open access article distributed under the terms of the Creative Commons Attribution License. Collection: https://zenodo.org/communities/sti2022grx/ | non_poster |
Міжнародний науково-практичний семінар «Цифрові інновації для наукових досліджень» ПРОГРАМА СЕМІНАРУ Організатори: Науково-технічна бібліотека ім. Г. І. Денисенка Національного технічного університету України «Київський політехнічний інститут імені Ігоря Сікорського» Видавнича служба УРАН Компанія Clarivate Analytics 26 ВЕРЕСНЯ, СЕРЕДА 12.30 – 13.00 Реєстрація учасників семінару 13.00 – 13.10 Відкриття семінару Вітання директора Науково-технічної бібліотеки ім. Г. І. Денисенка Національного технічного університету України «Київський політехнічний інститут імені Ігоря Сікорського» Оксани Бруй | non_poster |
FACULTY OF EDUCATION THEME TOPIC - AI, ENGINEERING AND CREATIVITY CAN A ROBOT OWN ITS OWN IDEAS? | non_poster |
a b c d e g h Flag-CDK5 GAPDH f Flag-CDK5 GAPDH Flag-CDK5 GAPDH Flag-CDK5 EV CDK5 b-actin p-IRF3 p-TBK1 MDA5 RIG-I IRF3 TBK1 p-P65 P65 P35/25 Mock 1 2 4 6 8 VSV(hours) p-STAT2 STAT1 STAT2 Flag-CDK5 GAPDH p-STAT1 VSV (hours) Mock 2 4 6 Mock 2 4 6 EV Flag-CDK5 Flag-CDK5 β-actin p-IRF3 p-TBK1 IRF3 TBK1 p-P65 P65 VSV (hours) Mock 2 4 6 Mock 2 4 6 EV Flag-CDK5 Figure 1 | non_poster |
To begin, could you explain the core objectives of the EURO-BASIN project? The multidisciplinary EURO-BASIN team’s core objectives are resolving the impacts of climate and fi sheries on the structure of North Atlantic marine ecosystems. Changes in ecosystem structure can lead to important consequences for the sequestration of greenhouse gases in the deep ocean, the production of fi sh stocks and ultimately feedback to global climate. The North Atlantic is one of the key areas infl uencing global climate and our understanding of its importance for climate is still in its infancy. The project’s activities will contribute to this understanding. What are the key challenges faced in understanding the dynamics of North Atlantic ecosystems and how does the EURO-BASIN project aim to respond to such challenges? There are many challenges facing us but probably the biggest is the vastness of the region, the complexity of the interactions and, with the spatial limitations of existing sampling techniques, our ability to examine only a small area at any one time. Think of it as the story of the blind men and the elephant. As they touch different parts of the elephant these men come to different conclusions about the animal. Similarly, we are looking at a vast area through a keyhole and trying to understand how the whole system is functioning. Add to that the fact that the whole system is in motion, while the biological and biogeochemical components in it are evolving in space and time. How do you intend to use modelling techniques to further our understanding of climate variability on marine ecosystems and the feedbacks to the Earth system? Coupled climate-physical oceanographic, single species and ecosystem models serve as the glue for developing our understanding of how these ecosystems will evolve as well as helping us overcome our problem of scale. For example, models use relationships derived from experiments and observations on the effects of temperature and food availability on an organism’s feeding and growth. The models allow us to extrapolate process mechanisms so we can better understand how our key species control the fl ow of carbon through an ecosystem and ultimately infl uence the storage of carbon in the deep ocean. They also allow us to simulate how ecosystems and their key species will fare under different future scenarios. Models serve as the state of our predictive art; without them, our understanding of the evolution of the system and its feedbacks to climate would be little more than a guess. Can you highlight how the project aims to develop understanding and strategies that will improve and advance ocean management? To manage our oceans we must understand how populations of key species, some of which we harvest, will change as their habitats evolve due to climate. Our laboratory and fi eld activities defi ne the habitats critical for their survival, while our coupled climate-physical oceanography-ecosystem models allow us to simulate the occurrence of these habitats and, as a result, the success of these species in the future. This information will empower managers to modify harvesting practices to preserve these key species and the services they provide. Furthermore, by identifying these key habitats, fi sh spawning grounds, for instance, we can provide environmentally-based advice for shipping and the placement of offshore energy facilities, as well as understanding the consequences of mineral extraction. Finally, our understanding of the effects of marine ecosystem structure on greenhouse gas storage is rather rudimentary. The project supplements and extends our knowledge in this area with the potential to better understand the role of marine ecosystems in climate regulation, thereby developing better management strategies to enhance the role of marine ecosystems in climate. How is the EURO-BASIN project linked with other similar projects internationally? EURO-BASIN was originally planned to form part of a transatlantic co | non_poster |
Tasmin Boam Department of Materials REFERENCES 1. Pelvic organ prolapse: You're not alone. [online]. Harvard Health Publishing, 2015. [14/08/2019]. Available from:https://www.health.harvard.edu/womens-health/pelvic- organ-prolapse-youre-not-alone. 2. JELOVSEK, J.E. and MAHER, C. and BARBER, M.D., ‘Pelvic organ prolapse’, The Lancet, 2007, 369(9566), pp. 1027-1038. 3. Treatment: Pelvic Organ Prolapse. [online]. NHS, 2019. [10/08/2019]. Available from: https://www.nhs.uk/conditions/pelvic-organ-prolapse/treatment/. 4. Urogynecologic Surgical Mesh: Update on the Safety and Effectiveness of Transvaginal Placement for Pelvic Organ Prolapse. [online]. FDA Center for Devices and Radiological Health, 2011. [10/08/2019]. Available from: https://www.fda.gov/media/81123/download. 5. Vaginal Pessaries. [online]. Urogynaecological Society of Australasia. [07/08/2019]. Available from:https://www.ugsa.com.au/wp- content/uploads/2019/01/Vaginal-Pessary.pdf ACKNOWLEDGEMENTS With thanks to Dr Sara Ronca and Dr Elisa Mele for their advice and supervision, and to Michael Graysmark, Callum Crane and Dr Giuseppe Forte for their help in the laboratory. CONTACT INFORMATION Tasmin Boam Department of Materials Loughborough University Leicestershire LE11 3TU UK t.l.boam-15@student.lboro.ac.uk www.lboro.ac.uk/materials Design and fabrication of novel vaginal ring pessaries with improved performances Introduction to Project Pelvic organ prolapse (POP) is a severe gynaecological condition affecting around 50% of women over the age of 50 [1]. POP can occur due to weakening of the pelvic floor and vaginal tissue, leading to prolapse of the uterus, bladder or rectum. Pessaries are devices inserted into the vagina for treatment of POP by provision of mechanical support to the prolapsed organ. A variety of pessaries exist, with each being suited to a particular type and stage of prolapse, one of the most common is the ring pessary [2]. Pessaries provide an alternative treatment to vaginal mesh, which has now been banned [3] following its link to multiple deaths [4]. Scenario: A GP has reported patients complaining of discomfort during insertion and removal with currently used pPVC ring pessaries. As well as the material being too rigid, there is also the risk of toxic plasticiser being released into the body. Project Aim: Initial exploration of possible design and material solutions to produce a more comfortable pessary for the patient. Sample Development Alternative to pPVC: Silicone rubber pessary Problem: Insufficient mechanical properties to withstand the prolapse Potential solution: Reinforcement of silicone with a 3D printed PLA scaffold. A helical design (A), seen in Figure 1, along with 2 simple ring designs (B,C) were chosen. To improve the bonding between the silicone and PLA, holes were included in the ring designs to increase surface area. On one of the rings (C) the holes were made larger in the regions that would be highly compressed (Figure 2) to assess their effect on mechanical properties. Bigger holes Figure 3: Images showing progressive compression of sample A. Scan QR for video. Figure 2: An image of the PLA ring (C) scaffold showing sections with larger holes. Figure 1: An image showing the PLA helix (A) scaffold after 3D printing. A B Testing Compression testing (Figure 3) was completed to simulate the conditions of insertion and removal to help evaluate the most suitable design. Current practice requires immersion of the pPVC ring in warm water prior to insertion, making the material more pliable. Therefore, compression testing was carried out following immersion in warm water (53 ºC). Samples were also tested in ambient conditions to assess the effect of the increased temperature on compression performance. Results are shown in Figure 4. The silicone samples were compressed to failure, a force >500 N was required to induce failure at room temperature. Future Work Further work is required in both design (Figure 5) and material choices, a | non_poster |
An Insight Into the Interaction of Oxo-Vanadium (V) Complex with Nucleic acid Basel Life Science Week & MipTech Exhibition 2015 Mamta Tripathi and Rama Pande* School of Studies in Chemistry, Pt. Ravishankar Shukla University, Raipur, 492010, Chhattisgarh, INDIA E mail ID - mamtat320@gmail.com INTRODUCTION Nucleic acids are targeted as they are the central machinery for protein synthesis. DNA being the starting material in central dogma leads to the formation of RNA which in turns produces proteins in body. Molecule that can bind to DNA/RNA plays a key role in drug designing mechanism. Mode of interaction predict the potency and extent of binding molecule. FUTURE ASPECTS REFRENCES N-ARYLHYDROXAMIC ACID OBJECTIVE FLUORESCENCE METHOD MODES OF INTERACTION ACKNOWLEDGEMENT CONCLUSION Co-Researcher Yamini Thakur Bharati Verma Rubi Khilari Manish Pardhi Shakuntala Raj I am thankful to Prof.(Mrs.) Rama Pande, Supervisor for her ever available guidance and support . I am very grateful to DST and UGC for providing financial assistance. R. Khilari, Y. Thakur, M. Pardhi, R. Pande, Nucleosides, Nucleo- tides and Nucleic Acids, 34 (2015) 332-347. P. Singh, D. Khare, R.Pande, Chem. Pap. 68 (2014) 1298-1304. B. Verma, M. Pardhi, R Pande, Int J Pharm Pharm Sci. 61 (2014) 170-174. J.I.B. Janairo, G.C. Janairo, Analele Universităţii din Bucureşti – Chimie (serie nouă) 20 (2011) 25 – 30. P.J. Cox, E.J. Gibbs, C.A. Bolos, J. Bioorg. Med. Chem. 17 (2009) 6054–6062. Determination of following parameters: Nucleic acid interactional studies of different metal complex of Hydroxamic acid. Enzymatic Inhibitory Activity . Antioxidant property. UV absorption spectra shows hyperchromic Shift with slighter blue shift with Nucleic acid . Decrease in intensity of emission spectra (fluorescence quench- ing & enhancement) indicates the binding of molecule with nu- cleic acid. Ethidium bromide displacement shows decrease in intensity of emission spectra indicating intercalation mode of binding and in- crease in intensity of spectra interpreted as groove binding. The relative viscosities of complex shownhave increased value as compared to ct-DNA/t-RNA alone which further confirm the binding. Hydroxamic acids (RC(=O)N(OH)R′) used in the present investigation are drug like molecules and a very important class of bio-ligands . Possess both hydrogen bond donor and hydrogen bond acceptor sites and usually form stable five membered [O,O] chelating agents. with metal ions. To Investigate the interactional parameters of Oxo-chloro-bis-N- phenylbenzohydroxamato-vanadium(V) ,PBHA-V(V)- with Nucleic acid by Absorption Spectroscopy, Fluorescence Spectroscopy, Viscos- ity measurement and Molecular Docking Techniques. EXPERIMENTAL SECTION Molecular formulae : C26H20ClN2O5V Molecular weight : 526.84 Structure : Oxo-chloro-bis-N-phenylbenzohydroxamato-vanadium(V) ,PBHA-V(V)- N C O O N C O O V O Cl Solution Preparation The stock solutions of hydroxamic acid, (0.01M) were prepared in DMSO and used further of various concentrations as obtained by mass dilution technique. SOLUTION OF DNA/RNA The stock solution of RNA was prepared in citrate-phosphate buffer and used further of various concentration whereas DNA Solution was prepared in Tris-HCl buffer. 220 240 260 280 300 320 340 360 -0.1 0.0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 Absorbance (a.u.) Wavelength (nm) 200 220 240 260 280 300 320 -0.5 0.0 0.5 1.0 1.5 2.0 2.5 3.0 3.5 4.0 4.5 Absorbance (a.u) Wavelength (nm) Representative UV-Vis spectra recorded for (a) PBHA-V(V) -ct-DNA ,(b) PBHA- V (V)-t-RNA with increasing concentration of Ct-DNA and t-RNA at 298 K . Fluorescence quenching is decrease in fluorescence intensity of lumi- nescent species with interaction to other species. Binding constant Ksv were calculated by Stern—Volmer Equation. F0/F= 1+ KSV (Q) Where, F0 = the fluorescence intensities of the PBHA-V(V) with ct-DNA/t -RNA the absence of quencher. F = the fluorescence intensities of th | non_poster |
Final conference, Rome October 11, 2016 Modern sediment distribution and composition within the Kongsfjorden, Svalbard Islands Stefano Miserocchi1, Alessandra D’Angelo1,2, Fabrizio Del Bianco3, Federico Giglio1, Leonardo Langone1, Tommaso Tesi1 and Stefano Aliani1. 1 CNR-ISMAR, Italy (s.miserocchi@ismar.cnr.it). 2 Università degli Studi di Siena, Italy 3 Proambiente Scrl, Bologna, Italy Abstract The Kongsfjorden is 20 km long and 4-10 km wide glacially eroded fjord, elongated in SE-NW direction, located in western Spitsbergen, Svalbard. 12 sediment cores have been sampled using a lightweight SW104 corer during a cruise in 2011 with the purpose to describe modern sediment distribution and composition. Core locations were chosen after a high resolution seismic survey, performed during September 2010, when over 130 miles of sub-bottom profiles were acquired (Fig. 1), in order to delineate the morpho-bathymetric features and surficial seismo-stratigraphy. The depositional environments of Kongsfjorden is mainly influenced by sediment supply from the glaciers directly into the basins with sediment input decreasing away from the glacier termini (Howe et al., 2003). Soft sediment deposition over bedrock bottom occurred after the last full glacial re-advance, that would have the effect of removing the previously deposited sediments, transporting them out into the shelf, while the fjord was filled by the advancing ice sheet (Howe et al., 2003). The acoustically well-laminated sediment fill of the ice-proximal basins in Kongsfjorden must therefore be all post- Little Ice Age, younger than 1450–1800 AD (550 to 200 years ago) (Howe et al., 2003). Furthermore, sediments of the inner fjord may have also recorded small-scale fluctuations of the ice fronts related to younger glacial surges. The last glacial surge of Kronebreen glacier occurred in 1948 AD and coincide with recent maximum extent of the glacial complex from which the still- going glacial retreat phase started (Trusel et al., 2010). Figure 1. Morpho-bathymetric map of Kongsfjorden obtained from sub-bottom profiling. Map shows also coring stations and profiling routes. On the right panel n. 2 Chirp Sonar seismic profiles are shown (see map for location). | non_poster |
@NanoporeConf | #NanoporeConf Signal level RNA modifications detection in eukaryotic ncRNAs Tommaso Leonardi Center for Genomic Science Italian Institute of Technology | non_poster |
-1- Ana Macario Content Model for Biodiversity, 2006-05-04 Mastertitelformat bearbeiten Plankton*Net: Using Fedora to aggregate and disseminate biodiversity content Ana Macario Alfred Wegener Intitute for Polar and Marine Research Computer Center | non_poster |
Unveilling the Celestial Narratives: Empowering Human Resources through Literacy Exploration Muchammad Toyib Master Program of Human Resource Development, Postgraduate School of Universitas Airlangga; East Java Amateur Astronomer Communication Forum (FOKALIS JATIM); Surabaya Astronomy Club 5th Shaw-IAU Workshop Astronomy Beyond the Classroom | non_poster |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.