hexsha
stringlengths
40
40
size
int64
2
1.02M
ext
stringclasses
10 values
lang
stringclasses
1 value
max_stars_repo_path
stringlengths
4
245
max_stars_repo_name
stringlengths
6
130
max_stars_repo_head_hexsha
stringlengths
40
40
max_stars_repo_licenses
listlengths
1
10
max_stars_count
int64
1
191k
max_stars_repo_stars_event_min_datetime
stringlengths
24
24
max_stars_repo_stars_event_max_datetime
stringlengths
24
24
max_issues_repo_path
stringlengths
4
245
max_issues_repo_name
stringlengths
6
130
max_issues_repo_head_hexsha
stringlengths
40
40
max_issues_repo_licenses
listlengths
1
10
max_issues_count
int64
1
67k
max_issues_repo_issues_event_min_datetime
stringlengths
24
24
max_issues_repo_issues_event_max_datetime
stringlengths
24
24
max_forks_repo_path
stringlengths
4
245
max_forks_repo_name
stringlengths
6
130
max_forks_repo_head_hexsha
stringlengths
40
40
max_forks_repo_licenses
listlengths
1
10
max_forks_count
int64
1
105k
max_forks_repo_forks_event_min_datetime
stringlengths
24
24
max_forks_repo_forks_event_max_datetime
stringlengths
24
24
content
stringlengths
2
1.02M
avg_line_length
float64
1
417k
max_line_length
int64
1
987k
alphanum_fraction
float64
0
1
content_no_comment
stringlengths
0
1.01M
is_comment_constant_removed
bool
1 class
is_sharp_comment_removed
bool
1 class
1c452c8a6569b75610cdf1914eeb687f42106575
196
py
Python
ferminet_ecp/integral/__init__.py
bytedance/FermiNet_with_ECP
f86874513541866db6b89559698e2078d4e37f7c
[ "Apache-2.0" ]
3
2022-01-11T03:31:00.000Z
2022-01-18T07:28:24.000Z
ferminet_ecp/integral/__init__.py
bytedance/FermiNet_with_ECP
f86874513541866db6b89559698e2078d4e37f7c
[ "Apache-2.0" ]
null
null
null
ferminet_ecp/integral/__init__.py
bytedance/FermiNet_with_ECP
f86874513541866db6b89559698e2078d4e37f7c
[ "Apache-2.0" ]
1
2022-01-05T17:39:53.000Z
2022-01-05T17:39:53.000Z
# Copyright (c) ByteDance, Inc. and its affiliates. # All rights reserved. # # This source code is licensed under the license found in the # LICENSE file in the root directory of this source tree.
39.2
61
0.760204
true
true
1c452ced1d02e0be92216546022c19ebe1d5e3d7
5,219
py
Python
packages/python/plotly/plotly/graph_objs/scatterternary/unselected/_textfont.py
labaran1/plotly.py
7ec751e8fed4a570c11ea4bea2231806389d62eb
[ "MIT" ]
null
null
null
packages/python/plotly/plotly/graph_objs/scatterternary/unselected/_textfont.py
labaran1/plotly.py
7ec751e8fed4a570c11ea4bea2231806389d62eb
[ "MIT" ]
null
null
null
packages/python/plotly/plotly/graph_objs/scatterternary/unselected/_textfont.py
labaran1/plotly.py
7ec751e8fed4a570c11ea4bea2231806389d62eb
[ "MIT" ]
null
null
null
from plotly.basedatatypes import BaseTraceHierarchyType as _BaseTraceHierarchyType import copy as _copy class Textfont(_BaseTraceHierarchyType): # class properties # -------------------- _parent_path_str = "scatterternary.unselected" _path_str = "scatterternary.unselected.textfont" _valid_props = {"color"} # color # ----- @property def color(self): """ Sets the text font color of unselected points, applied only when a selection exists. The 'color' property is a color and may be specified as: - A hex string (e.g. '#ff0000') - An rgb/rgba string (e.g. 'rgb(255,0,0)') - An hsl/hsla string (e.g. 'hsl(0,100%,50%)') - An hsv/hsva string (e.g. 'hsv(0,100%,100%)') - A named CSS color: aliceblue, antiquewhite, aqua, aquamarine, azure, beige, bisque, black, blanchedalmond, blue, blueviolet, brown, burlywood, cadetblue, chartreuse, chocolate, coral, cornflowerblue, cornsilk, crimson, cyan, darkblue, darkcyan, darkgoldenrod, darkgray, darkgrey, darkgreen, darkkhaki, darkmagenta, darkolivegreen, darkorange, darkorchid, darkred, darksalmon, darkseagreen, darkslateblue, darkslategray, darkslategrey, darkturquoise, darkviolet, deeppink, deepskyblue, dimgray, dimgrey, dodgerblue, firebrick, floralwhite, forestgreen, fuchsia, gainsboro, ghostwhite, gold, goldenrod, gray, grey, green, greenyellow, honeydew, hotpink, indianred, indigo, ivory, khaki, lavender, lavenderblush, lawngreen, lemonchiffon, lightblue, lightcoral, lightcyan, lightgoldenrodyellow, lightgray, lightgrey, lightgreen, lightpink, lightsalmon, lightseagreen, lightskyblue, lightslategray, lightslategrey, lightsteelblue, lightyellow, lime, limegreen, linen, magenta, maroon, mediumaquamarine, mediumblue, mediumorchid, mediumpurple, mediumseagreen, mediumslateblue, mediumspringgreen, mediumturquoise, mediumvioletred, midnightblue, mintcream, mistyrose, moccasin, navajowhite, navy, oldlace, olive, olivedrab, orange, orangered, orchid, palegoldenrod, palegreen, paleturquoise, palevioletred, papayawhip, peachpuff, peru, pink, plum, powderblue, purple, red, rosybrown, royalblue, rebeccapurple, saddlebrown, salmon, sandybrown, seagreen, seashell, sienna, silver, skyblue, slateblue, slategray, slategrey, snow, springgreen, steelblue, tan, teal, thistle, tomato, turquoise, violet, wheat, white, whitesmoke, yellow, yellowgreen Returns ------- str """ return self["color"] @color.setter def color(self, val): self["color"] = val # Self properties description # --------------------------- @property def _prop_descriptions(self): return """\ color Sets the text font color of unselected points, applied only when a selection exists. """ def __init__(self, arg=None, color=None, **kwargs): """ Construct a new Textfont object Parameters ---------- arg dict of properties compatible with this constructor or an instance of :class:`plotly.graph_objs.scatterternary .unselected.Textfont` color Sets the text font color of unselected points, applied only when a selection exists. Returns ------- Textfont """ super(Textfont, self).__init__("textfont") if "_parent" in kwargs: self._parent = kwargs["_parent"] return # Validate arg # ------------ if arg is None: arg = {} elif isinstance(arg, self.__class__): arg = arg.to_plotly_json() elif isinstance(arg, dict): arg = _copy.copy(arg) else: raise ValueError( """\ The first argument to the plotly.graph_objs.scatterternary.unselected.Textfont constructor must be a dict or an instance of :class:`plotly.graph_objs.scatterternary.unselected.Textfont`""" ) # Handle skip_invalid # ------------------- self._skip_invalid = kwargs.pop("skip_invalid", False) self._validate = kwargs.pop("_validate", True) # Populate data dict with properties # ---------------------------------- _v = arg.pop("color", None) _v = color if color is not None else _v if _v is not None: self["color"] = _v # Process unknown kwargs # ---------------------- self._process_kwargs(**dict(arg, **kwargs)) # Reset skip_invalid # ------------------ self._skip_invalid = False
36.753521
82
0.564284
from plotly.basedatatypes import BaseTraceHierarchyType as _BaseTraceHierarchyType import copy as _copy class Textfont(_BaseTraceHierarchyType): _parent_path_str = "scatterternary.unselected" _path_str = "scatterternary.unselected.textfont" _valid_props = {"color"} @property def color(self): return self["color"] @color.setter def color(self, val): self["color"] = val @property def _prop_descriptions(self): return """\ color Sets the text font color of unselected points, applied only when a selection exists. """ def __init__(self, arg=None, color=None, **kwargs): super(Textfont, self).__init__("textfont") if "_parent" in kwargs: self._parent = kwargs["_parent"] return if arg is None: arg = {} elif isinstance(arg, self.__class__): arg = arg.to_plotly_json() elif isinstance(arg, dict): arg = _copy.copy(arg) else: raise ValueError( """\ The first argument to the plotly.graph_objs.scatterternary.unselected.Textfont constructor must be a dict or an instance of :class:`plotly.graph_objs.scatterternary.unselected.Textfont`""" ) self._skip_invalid = kwargs.pop("skip_invalid", False) self._validate = kwargs.pop("_validate", True) _v = arg.pop("color", None) _v = color if color is not None else _v if _v is not None: self["color"] = _v self._process_kwargs(**dict(arg, **kwargs)) self._skip_invalid = False
true
true
1c452d29c806e98640fff6394a519a69547d9461
21,953
py
Python
sdk/storage/azure-storage-queue/azure/storage/queue/_shared/utils.py
vchske/azure-sdk-for-python
6383ed3676b7355af7be394562b126209961ec13
[ "MIT" ]
null
null
null
sdk/storage/azure-storage-queue/azure/storage/queue/_shared/utils.py
vchske/azure-sdk-for-python
6383ed3676b7355af7be394562b126209961ec13
[ "MIT" ]
1
2019-06-04T18:12:16.000Z
2019-06-04T18:12:16.000Z
sdk/storage/azure-storage-queue/azure/storage/queue/_shared/utils.py
vchske/azure-sdk-for-python
6383ed3676b7355af7be394562b126209961ec13
[ "MIT" ]
1
2019-06-17T22:18:23.000Z
2019-06-17T22:18:23.000Z
# ------------------------------------------------------------------------- # Copyright (c) Microsoft Corporation. All rights reserved. # Licensed under the MIT License. See License.txt in the project root for # license information. # -------------------------------------------------------------------------- from typing import ( # pylint: disable=unused-import Union, Optional, Any, Iterable, Dict, List, Type, Tuple, TYPE_CHECKING ) import base64 import hashlib import hmac import logging from os import fstat from io import (SEEK_END, SEEK_SET, UnsupportedOperation) try: from urllib.parse import quote, unquote, parse_qs except ImportError: from urlparse import parse_qs # type: ignore from urllib2 import quote, unquote # type: ignore import six import isodate from azure.core import Configuration from azure.core.exceptions import raise_with_traceback from azure.core.pipeline import Pipeline from azure.core.pipeline.transport import RequestsTransport from azure.core.pipeline.policies import ( RedirectPolicy, ContentDecodePolicy, BearerTokenCredentialPolicy, ProxyPolicy) from azure.core.exceptions import ( HttpResponseError, ResourceNotFoundError, ResourceModifiedError, ResourceExistsError, ClientAuthenticationError, DecodeError) from .constants import STORAGE_OAUTH_SCOPE, SERVICE_HOST_BASE, DEFAULT_SOCKET_TIMEOUT from .models import LocationMode, StorageErrorCode from .authentication import SharedKeyCredentialPolicy from .policies import ( StorageBlobSettings, StorageHeadersPolicy, StorageUserAgentPolicy, StorageContentValidation, StorageRequestHook, StorageResponseHook, StorageLoggingPolicy, StorageHosts, QueueMessagePolicy, ExponentialRetry) if TYPE_CHECKING: from datetime import datetime from azure.core.pipeline.transport import HttpTransport from azure.core.pipeline.policies import HTTPPolicy from azure.core.exceptions import AzureError _LOGGER = logging.getLogger(__name__) class _QueryStringConstants(object): SIGNED_SIGNATURE = 'sig' SIGNED_PERMISSION = 'sp' SIGNED_START = 'st' SIGNED_EXPIRY = 'se' SIGNED_RESOURCE = 'sr' SIGNED_IDENTIFIER = 'si' SIGNED_IP = 'sip' SIGNED_PROTOCOL = 'spr' SIGNED_VERSION = 'sv' SIGNED_CACHE_CONTROL = 'rscc' SIGNED_CONTENT_DISPOSITION = 'rscd' SIGNED_CONTENT_ENCODING = 'rsce' SIGNED_CONTENT_LANGUAGE = 'rscl' SIGNED_CONTENT_TYPE = 'rsct' START_PK = 'spk' START_RK = 'srk' END_PK = 'epk' END_RK = 'erk' SIGNED_RESOURCE_TYPES = 'srt' SIGNED_SERVICES = 'ss' @staticmethod def to_list(): return [ _QueryStringConstants.SIGNED_SIGNATURE, _QueryStringConstants.SIGNED_PERMISSION, _QueryStringConstants.SIGNED_START, _QueryStringConstants.SIGNED_EXPIRY, _QueryStringConstants.SIGNED_RESOURCE, _QueryStringConstants.SIGNED_IDENTIFIER, _QueryStringConstants.SIGNED_IP, _QueryStringConstants.SIGNED_PROTOCOL, _QueryStringConstants.SIGNED_VERSION, _QueryStringConstants.SIGNED_CACHE_CONTROL, _QueryStringConstants.SIGNED_CONTENT_DISPOSITION, _QueryStringConstants.SIGNED_CONTENT_ENCODING, _QueryStringConstants.SIGNED_CONTENT_LANGUAGE, _QueryStringConstants.SIGNED_CONTENT_TYPE, _QueryStringConstants.START_PK, _QueryStringConstants.START_RK, _QueryStringConstants.END_PK, _QueryStringConstants.END_RK, _QueryStringConstants.SIGNED_RESOURCE_TYPES, _QueryStringConstants.SIGNED_SERVICES, ] class StorageAccountHostsMixin(object): def __init__( self, parsed_url, # type: Any service, # type: str credential=None, # type: Optional[Any] **kwargs # type: Any ): # type: (...) -> None self._location_mode = kwargs.get('_location_mode', LocationMode.PRIMARY) self._hosts = kwargs.get('_hosts') self.scheme = parsed_url.scheme if service not in ['blob', 'queue', 'file']: raise ValueError("Invalid service: {}".format(service)) account = parsed_url.netloc.split(".{}.core.".format(service)) secondary_hostname = None self.credential = format_shared_key_credential(account, credential) if self.scheme.lower() != 'https' and hasattr(self.credential, 'get_token'): raise ValueError("Token credential is only supported with HTTPS.") if hasattr(self.credential, 'account_name'): secondary_hostname = "{}-secondary.{}.{}".format( self.credential.account_name, service, SERVICE_HOST_BASE) if not self._hosts: if len(account) > 1: secondary_hostname = parsed_url.netloc.replace( account[0], account[0] + '-secondary') if kwargs.get('secondary_hostname'): secondary_hostname = kwargs['secondary_hostname'] self._hosts = { LocationMode.PRIMARY: parsed_url.netloc, LocationMode.SECONDARY: secondary_hostname} self.require_encryption = kwargs.get('require_encryption', False) self.key_encryption_key = kwargs.get('key_encryption_key') self.key_resolver_function = kwargs.get('key_resolver_function') self._config, self._pipeline = create_pipeline(self.credential, hosts=self._hosts, **kwargs) def __enter__(self): self._client.__enter__() return self def __exit__(self, *args): self._client.__exit__(*args) @property def url(self): return self._format_url(self._hosts[self._location_mode]) @property def primary_endpoint(self): return self._format_url(self._hosts[LocationMode.PRIMARY]) @property def primary_hostname(self): return self._hosts[LocationMode.PRIMARY] @property def secondary_endpoint(self): if not self._hosts[LocationMode.SECONDARY]: raise ValueError("No secondary host configured.") return self._format_url(self._hosts[LocationMode.SECONDARY]) @property def secondary_hostname(self): return self._hosts[LocationMode.SECONDARY] @property def location_mode(self): return self._location_mode @location_mode.setter def location_mode(self, value): if self._hosts.get(value): self._location_mode = value self._client._config.url = self.url # pylint: disable=protected-access else: raise ValueError("No host URL for location mode: {}".format(value)) def _format_query_string(self, sas_token, credential, snapshot=None): query_str = "?" if snapshot: query_str += 'snapshot={}&'.format(self.snapshot) if sas_token and not credential: query_str += sas_token elif is_credential_sastoken(credential): query_str += credential.lstrip('?') credential = None return query_str.rstrip('?&'), credential def format_shared_key_credential(account, credential): if isinstance(credential, six.string_types): if len(account) < 2: raise ValueError("Unable to determine account name for shared key credential.") credential = { 'account_name': account[0], 'account_key': credential } if isinstance(credential, dict): if 'account_name' not in credential: raise ValueError("Shared key credential missing 'account_name") if 'account_key' not in credential: raise ValueError("Shared key credential missing 'account_key") return SharedKeyCredentialPolicy(**credential) return credential service_connection_params = { 'blob': {'primary': 'BlobEndpoint', 'secondary': 'BlobSecondaryEndpoint'}, 'queue': {'primary': 'QueueEndpoint', 'secondary': 'QueueSecondaryEndpoint'}, 'file': {'primary': 'FileEndpoint', 'secondary': 'FileSecondaryEndpoint'}, } def parse_connection_str(conn_str, credential, service): conn_str = conn_str.rstrip(';') conn_settings = dict([s.split('=', 1) for s in conn_str.split(';')]) # pylint: disable=consider-using-dict-comprehension endpoints = service_connection_params[service] primary = None secondary = None if not credential: try: credential = { 'account_name': conn_settings['AccountName'], 'account_key': conn_settings['AccountKey'] } except KeyError: credential = conn_settings.get('SharedAccessSignature') if endpoints['primary'] in conn_settings: primary = conn_settings[endpoints['primary']] if endpoints['secondary'] in conn_settings: secondary = conn_settings[endpoints['secondary']] else: if endpoints['secondary'] in conn_settings: raise ValueError("Connection string specifies only secondary endpoint.") try: primary = "{}://{}.{}.{}".format( conn_settings['DefaultEndpointsProtocol'], conn_settings['AccountName'], service, conn_settings['EndpointSuffix'] ) secondary = "{}-secondary.{}.{}".format( conn_settings['AccountName'], service, conn_settings['EndpointSuffix'] ) except KeyError: pass if not primary: try: primary = "https://{}.{}.{}".format( conn_settings['AccountName'], service, conn_settings.get('EndpointSuffix', SERVICE_HOST_BASE) ) except KeyError: raise ValueError("Connection string missing required connection details.") return primary, secondary, credential def url_quote(url): return quote(url) def url_unquote(url): return unquote(url) def encode_base64(data): if isinstance(data, six.text_type): data = data.encode('utf-8') encoded = base64.b64encode(data) return encoded.decode('utf-8') def decode_base64(data): if isinstance(data, six.text_type): data = data.encode('utf-8') decoded = base64.b64decode(data) return decoded.decode('utf-8') def _decode_base64_to_bytes(data): if isinstance(data, six.text_type): data = data.encode('utf-8') return base64.b64decode(data) def _sign_string(key, string_to_sign, key_is_base64=True): if key_is_base64: key = _decode_base64_to_bytes(key) else: if isinstance(key, six.text_type): key = key.encode('utf-8') if isinstance(string_to_sign, six.text_type): string_to_sign = string_to_sign.encode('utf-8') signed_hmac_sha256 = hmac.HMAC(key, string_to_sign, hashlib.sha256) digest = signed_hmac_sha256.digest() encoded_digest = encode_base64(digest) return encoded_digest def serialize_iso(attr): """Serialize Datetime object into ISO-8601 formatted string. :param Datetime attr: Object to be serialized. :rtype: str :raises: ValueError if format invalid. """ if not attr: return None if isinstance(attr, str): attr = isodate.parse_datetime(attr) try: utc = attr.utctimetuple() if utc.tm_year > 9999 or utc.tm_year < 1: raise OverflowError("Hit max or min date") date = "{:04}-{:02}-{:02}T{:02}:{:02}:{:02}".format( utc.tm_year, utc.tm_mon, utc.tm_mday, utc.tm_hour, utc.tm_min, utc.tm_sec) return date + 'Z' except (ValueError, OverflowError) as err: msg = "Unable to serialize datetime object." raise_with_traceback(ValueError, msg, err) except AttributeError as err: msg = "ISO-8601 object must be valid Datetime object." raise_with_traceback(TypeError, msg, err) def get_length(data): length = None # Check if object implements the __len__ method, covers most input cases such as bytearray. try: length = len(data) except: # pylint: disable=bare-except pass if not length: # Check if the stream is a file-like stream object. # If so, calculate the size using the file descriptor. try: fileno = data.fileno() except (AttributeError, UnsupportedOperation): pass else: return fstat(fileno).st_size # If the stream is seekable and tell() is implemented, calculate the stream size. try: current_position = data.tell() data.seek(0, SEEK_END) length = data.tell() - current_position data.seek(current_position, SEEK_SET) except (AttributeError, UnsupportedOperation): pass return length def read_length(data): try: if hasattr(data, 'read'): read_data = b'' for chunk in iter(lambda: data.read(4096), b""): read_data += chunk return len(read_data), read_data if hasattr(data, '__iter__'): read_data = b'' for chunk in data: read_data += chunk return len(read_data), read_data except: # pylint: disable=bare-except pass raise ValueError("Unable to calculate content length, please specify.") def parse_length_from_content_range(content_range): ''' Parses the blob length from the content range header: bytes 1-3/65537 ''' if content_range is None: return None # First, split in space and take the second half: '1-3/65537' # Next, split on slash and take the second half: '65537' # Finally, convert to an int: 65537 return int(content_range.split(' ', 1)[1].split('/', 1)[1]) def validate_and_format_range_headers( start_range, end_range, start_range_required=True, end_range_required=True, check_content_md5=False, align_to_page=False): # If end range is provided, start range must be provided if (start_range_required or end_range is not None) and start_range is None: raise ValueError("start_range value cannot be None.") if end_range_required and end_range is None: raise ValueError("end_range value cannot be None.") # Page ranges must be 512 aligned if align_to_page: if start_range is not None and start_range % 512 != 0: raise ValueError("Invalid page blob start_range: {0}. " "The size must be aligned to a 512-byte boundary.".format(start_range)) if end_range is not None and end_range % 512 != 511: raise ValueError("Invalid page blob end_range: {0}. " "The size must be aligned to a 512-byte boundary.".format(end_range)) # Format based on whether end_range is present range_header = None if end_range is not None: range_header = 'bytes={0}-{1}'.format(start_range, end_range) elif start_range is not None: range_header = "bytes={0}-".format(start_range) # Content MD5 can only be provided for a complete range less than 4MB in size range_validation = None if check_content_md5: if start_range is None or end_range is None: raise ValueError("Both start and end range requied for MD5 content validation.") if end_range - start_range > 4 * 1024 * 1024: raise ValueError("Getting content MD5 for a range greater than 4MB is not supported.") range_validation = 'true' return range_header, range_validation def normalize_headers(headers): normalized = {} for key, value in headers.items(): if key.startswith('x-ms-'): key = key[5:] normalized[key.lower().replace('-', '_')] = value return normalized def return_response_headers(response, deserialized, response_headers): # pylint: disable=unused-argument return normalize_headers(response_headers) def return_headers_and_deserialized(response, deserialized, response_headers): # pylint: disable=unused-argument return normalize_headers(response_headers), deserialized def return_context_and_deserialized(response, deserialized, response_headers): # pylint: disable=unused-argument return response.location_mode, deserialized def create_configuration(**kwargs): # type: (**Any) -> Configuration config = Configuration(**kwargs) config.headers_policy = StorageHeadersPolicy(**kwargs) config.user_agent_policy = StorageUserAgentPolicy(**kwargs) config.retry_policy = kwargs.get('retry_policy') or ExponentialRetry(**kwargs) config.redirect_policy = RedirectPolicy(**kwargs) config.logging_policy = StorageLoggingPolicy(**kwargs) config.proxy_policy = ProxyPolicy(**kwargs) config.blob_settings = StorageBlobSettings(**kwargs) return config def create_pipeline(credential, **kwargs): # type: (Any, **Any) -> Tuple[Configuration, Pipeline] credential_policy = None if hasattr(credential, 'get_token'): credential_policy = BearerTokenCredentialPolicy(credential, STORAGE_OAUTH_SCOPE) elif isinstance(credential, SharedKeyCredentialPolicy): credential_policy = credential elif credential is not None: raise TypeError("Unsupported credential: {}".format(credential)) config = kwargs.get('_configuration') or create_configuration(**kwargs) if kwargs.get('_pipeline'): return config, kwargs['_pipeline'] transport = kwargs.get('transport') # type: HttpTransport if 'connection_timeout' not in kwargs: kwargs['connection_timeout'] = DEFAULT_SOCKET_TIMEOUT if not transport: transport = RequestsTransport(**kwargs) policies = [ QueueMessagePolicy(), config.headers_policy, config.user_agent_policy, StorageContentValidation(), StorageRequestHook(**kwargs), credential_policy, ContentDecodePolicy(), config.redirect_policy, StorageHosts(**kwargs), config.retry_policy, config.logging_policy, StorageResponseHook(**kwargs), ] return config, Pipeline(transport, policies=policies) def parse_query(query_str): sas_values = _QueryStringConstants.to_list() parsed_query = {k: v[0] for k, v in parse_qs(query_str).items()} sas_params = ["{}={}".format(k, v) for k, v in parsed_query.items() if k in sas_values] sas_token = None if sas_params: sas_token = '&'.join(sas_params) return parsed_query.get('snapshot'), sas_token def is_credential_sastoken(credential): if not credential or not isinstance(credential, six.string_types): return False sas_values = _QueryStringConstants.to_list() parsed_query = parse_qs(credential.lstrip('?')) if parsed_query and all([k in sas_values for k in parsed_query.keys()]): return True return False def add_metadata_headers(metadata): headers = {} if metadata: for key, value in metadata.items(): headers['x-ms-meta-{}'.format(key)] = value return headers def process_storage_error(storage_error): raise_error = HttpResponseError error_code = storage_error.response.headers.get('x-ms-error-code') error_message = storage_error.message additional_data = {} try: error_body = ContentDecodePolicy.deserialize_from_http_generics(storage_error.response) if error_body: for info in error_body.iter(): if info.tag.lower() == 'code': error_code = info.text elif info.tag.lower() == 'message': error_message = info.text else: additional_data[info.tag] = info.text except DecodeError: pass try: if error_code: error_code = StorageErrorCode(error_code) if error_code in [StorageErrorCode.condition_not_met, StorageErrorCode.blob_overwritten]: raise_error = ResourceModifiedError if error_code in [StorageErrorCode.invalid_authentication_info, StorageErrorCode.authentication_failed]: raise_error = ClientAuthenticationError if error_code in [StorageErrorCode.resource_not_found, StorageErrorCode.blob_not_found, StorageErrorCode.queue_not_found, StorageErrorCode.container_not_found]: raise_error = ResourceNotFoundError if error_code in [StorageErrorCode.account_already_exists, StorageErrorCode.account_being_created, StorageErrorCode.resource_already_exists, StorageErrorCode.resource_type_mismatch, StorageErrorCode.blob_already_exists, StorageErrorCode.queue_already_exists, StorageErrorCode.container_already_exists, StorageErrorCode.container_being_deleted, StorageErrorCode.queue_being_deleted]: raise_error = ResourceExistsError except ValueError: # Got an unknown error code pass try: error_message += "\nErrorCode:{}".format(error_code.value) except AttributeError: error_message += "\nErrorCode:{}".format(error_code) for name, info in additional_data.items(): error_message += "\n{}:{}".format(name, info) error = raise_error(message=error_message, response=storage_error.response) error.error_code = error_code error.additional_info = additional_data raise error
36.166392
125
0.651802
from typing import ( Union, Optional, Any, Iterable, Dict, List, Type, Tuple, TYPE_CHECKING ) import base64 import hashlib import hmac import logging from os import fstat from io import (SEEK_END, SEEK_SET, UnsupportedOperation) try: from urllib.parse import quote, unquote, parse_qs except ImportError: from urlparse import parse_qs from urllib2 import quote, unquote import six import isodate from azure.core import Configuration from azure.core.exceptions import raise_with_traceback from azure.core.pipeline import Pipeline from azure.core.pipeline.transport import RequestsTransport from azure.core.pipeline.policies import ( RedirectPolicy, ContentDecodePolicy, BearerTokenCredentialPolicy, ProxyPolicy) from azure.core.exceptions import ( HttpResponseError, ResourceNotFoundError, ResourceModifiedError, ResourceExistsError, ClientAuthenticationError, DecodeError) from .constants import STORAGE_OAUTH_SCOPE, SERVICE_HOST_BASE, DEFAULT_SOCKET_TIMEOUT from .models import LocationMode, StorageErrorCode from .authentication import SharedKeyCredentialPolicy from .policies import ( StorageBlobSettings, StorageHeadersPolicy, StorageUserAgentPolicy, StorageContentValidation, StorageRequestHook, StorageResponseHook, StorageLoggingPolicy, StorageHosts, QueueMessagePolicy, ExponentialRetry) if TYPE_CHECKING: from datetime import datetime from azure.core.pipeline.transport import HttpTransport from azure.core.pipeline.policies import HTTPPolicy from azure.core.exceptions import AzureError _LOGGER = logging.getLogger(__name__) class _QueryStringConstants(object): SIGNED_SIGNATURE = 'sig' SIGNED_PERMISSION = 'sp' SIGNED_START = 'st' SIGNED_EXPIRY = 'se' SIGNED_RESOURCE = 'sr' SIGNED_IDENTIFIER = 'si' SIGNED_IP = 'sip' SIGNED_PROTOCOL = 'spr' SIGNED_VERSION = 'sv' SIGNED_CACHE_CONTROL = 'rscc' SIGNED_CONTENT_DISPOSITION = 'rscd' SIGNED_CONTENT_ENCODING = 'rsce' SIGNED_CONTENT_LANGUAGE = 'rscl' SIGNED_CONTENT_TYPE = 'rsct' START_PK = 'spk' START_RK = 'srk' END_PK = 'epk' END_RK = 'erk' SIGNED_RESOURCE_TYPES = 'srt' SIGNED_SERVICES = 'ss' @staticmethod def to_list(): return [ _QueryStringConstants.SIGNED_SIGNATURE, _QueryStringConstants.SIGNED_PERMISSION, _QueryStringConstants.SIGNED_START, _QueryStringConstants.SIGNED_EXPIRY, _QueryStringConstants.SIGNED_RESOURCE, _QueryStringConstants.SIGNED_IDENTIFIER, _QueryStringConstants.SIGNED_IP, _QueryStringConstants.SIGNED_PROTOCOL, _QueryStringConstants.SIGNED_VERSION, _QueryStringConstants.SIGNED_CACHE_CONTROL, _QueryStringConstants.SIGNED_CONTENT_DISPOSITION, _QueryStringConstants.SIGNED_CONTENT_ENCODING, _QueryStringConstants.SIGNED_CONTENT_LANGUAGE, _QueryStringConstants.SIGNED_CONTENT_TYPE, _QueryStringConstants.START_PK, _QueryStringConstants.START_RK, _QueryStringConstants.END_PK, _QueryStringConstants.END_RK, _QueryStringConstants.SIGNED_RESOURCE_TYPES, _QueryStringConstants.SIGNED_SERVICES, ] class StorageAccountHostsMixin(object): def __init__( self, parsed_url, service, credential=None, **kwargs ): self._location_mode = kwargs.get('_location_mode', LocationMode.PRIMARY) self._hosts = kwargs.get('_hosts') self.scheme = parsed_url.scheme if service not in ['blob', 'queue', 'file']: raise ValueError("Invalid service: {}".format(service)) account = parsed_url.netloc.split(".{}.core.".format(service)) secondary_hostname = None self.credential = format_shared_key_credential(account, credential) if self.scheme.lower() != 'https' and hasattr(self.credential, 'get_token'): raise ValueError("Token credential is only supported with HTTPS.") if hasattr(self.credential, 'account_name'): secondary_hostname = "{}-secondary.{}.{}".format( self.credential.account_name, service, SERVICE_HOST_BASE) if not self._hosts: if len(account) > 1: secondary_hostname = parsed_url.netloc.replace( account[0], account[0] + '-secondary') if kwargs.get('secondary_hostname'): secondary_hostname = kwargs['secondary_hostname'] self._hosts = { LocationMode.PRIMARY: parsed_url.netloc, LocationMode.SECONDARY: secondary_hostname} self.require_encryption = kwargs.get('require_encryption', False) self.key_encryption_key = kwargs.get('key_encryption_key') self.key_resolver_function = kwargs.get('key_resolver_function') self._config, self._pipeline = create_pipeline(self.credential, hosts=self._hosts, **kwargs) def __enter__(self): self._client.__enter__() return self def __exit__(self, *args): self._client.__exit__(*args) @property def url(self): return self._format_url(self._hosts[self._location_mode]) @property def primary_endpoint(self): return self._format_url(self._hosts[LocationMode.PRIMARY]) @property def primary_hostname(self): return self._hosts[LocationMode.PRIMARY] @property def secondary_endpoint(self): if not self._hosts[LocationMode.SECONDARY]: raise ValueError("No secondary host configured.") return self._format_url(self._hosts[LocationMode.SECONDARY]) @property def secondary_hostname(self): return self._hosts[LocationMode.SECONDARY] @property def location_mode(self): return self._location_mode @location_mode.setter def location_mode(self, value): if self._hosts.get(value): self._location_mode = value self._client._config.url = self.url else: raise ValueError("No host URL for location mode: {}".format(value)) def _format_query_string(self, sas_token, credential, snapshot=None): query_str = "?" if snapshot: query_str += 'snapshot={}&'.format(self.snapshot) if sas_token and not credential: query_str += sas_token elif is_credential_sastoken(credential): query_str += credential.lstrip('?') credential = None return query_str.rstrip('?&'), credential def format_shared_key_credential(account, credential): if isinstance(credential, six.string_types): if len(account) < 2: raise ValueError("Unable to determine account name for shared key credential.") credential = { 'account_name': account[0], 'account_key': credential } if isinstance(credential, dict): if 'account_name' not in credential: raise ValueError("Shared key credential missing 'account_name") if 'account_key' not in credential: raise ValueError("Shared key credential missing 'account_key") return SharedKeyCredentialPolicy(**credential) return credential service_connection_params = { 'blob': {'primary': 'BlobEndpoint', 'secondary': 'BlobSecondaryEndpoint'}, 'queue': {'primary': 'QueueEndpoint', 'secondary': 'QueueSecondaryEndpoint'}, 'file': {'primary': 'FileEndpoint', 'secondary': 'FileSecondaryEndpoint'}, } def parse_connection_str(conn_str, credential, service): conn_str = conn_str.rstrip(';') conn_settings = dict([s.split('=', 1) for s in conn_str.split(';')]) endpoints = service_connection_params[service] primary = None secondary = None if not credential: try: credential = { 'account_name': conn_settings['AccountName'], 'account_key': conn_settings['AccountKey'] } except KeyError: credential = conn_settings.get('SharedAccessSignature') if endpoints['primary'] in conn_settings: primary = conn_settings[endpoints['primary']] if endpoints['secondary'] in conn_settings: secondary = conn_settings[endpoints['secondary']] else: if endpoints['secondary'] in conn_settings: raise ValueError("Connection string specifies only secondary endpoint.") try: primary = "{}://{}.{}.{}".format( conn_settings['DefaultEndpointsProtocol'], conn_settings['AccountName'], service, conn_settings['EndpointSuffix'] ) secondary = "{}-secondary.{}.{}".format( conn_settings['AccountName'], service, conn_settings['EndpointSuffix'] ) except KeyError: pass if not primary: try: primary = "https://{}.{}.{}".format( conn_settings['AccountName'], service, conn_settings.get('EndpointSuffix', SERVICE_HOST_BASE) ) except KeyError: raise ValueError("Connection string missing required connection details.") return primary, secondary, credential def url_quote(url): return quote(url) def url_unquote(url): return unquote(url) def encode_base64(data): if isinstance(data, six.text_type): data = data.encode('utf-8') encoded = base64.b64encode(data) return encoded.decode('utf-8') def decode_base64(data): if isinstance(data, six.text_type): data = data.encode('utf-8') decoded = base64.b64decode(data) return decoded.decode('utf-8') def _decode_base64_to_bytes(data): if isinstance(data, six.text_type): data = data.encode('utf-8') return base64.b64decode(data) def _sign_string(key, string_to_sign, key_is_base64=True): if key_is_base64: key = _decode_base64_to_bytes(key) else: if isinstance(key, six.text_type): key = key.encode('utf-8') if isinstance(string_to_sign, six.text_type): string_to_sign = string_to_sign.encode('utf-8') signed_hmac_sha256 = hmac.HMAC(key, string_to_sign, hashlib.sha256) digest = signed_hmac_sha256.digest() encoded_digest = encode_base64(digest) return encoded_digest def serialize_iso(attr): if not attr: return None if isinstance(attr, str): attr = isodate.parse_datetime(attr) try: utc = attr.utctimetuple() if utc.tm_year > 9999 or utc.tm_year < 1: raise OverflowError("Hit max or min date") date = "{:04}-{:02}-{:02}T{:02}:{:02}:{:02}".format( utc.tm_year, utc.tm_mon, utc.tm_mday, utc.tm_hour, utc.tm_min, utc.tm_sec) return date + 'Z' except (ValueError, OverflowError) as err: msg = "Unable to serialize datetime object." raise_with_traceback(ValueError, msg, err) except AttributeError as err: msg = "ISO-8601 object must be valid Datetime object." raise_with_traceback(TypeError, msg, err) def get_length(data): length = None try: length = len(data) except: pass if not length: try: fileno = data.fileno() except (AttributeError, UnsupportedOperation): pass else: return fstat(fileno).st_size try: current_position = data.tell() data.seek(0, SEEK_END) length = data.tell() - current_position data.seek(current_position, SEEK_SET) except (AttributeError, UnsupportedOperation): pass return length def read_length(data): try: if hasattr(data, 'read'): read_data = b'' for chunk in iter(lambda: data.read(4096), b""): read_data += chunk return len(read_data), read_data if hasattr(data, '__iter__'): read_data = b'' for chunk in data: read_data += chunk return len(read_data), read_data except: pass raise ValueError("Unable to calculate content length, please specify.") def parse_length_from_content_range(content_range): if content_range is None: return None return int(content_range.split(' ', 1)[1].split('/', 1)[1]) def validate_and_format_range_headers( start_range, end_range, start_range_required=True, end_range_required=True, check_content_md5=False, align_to_page=False): if (start_range_required or end_range is not None) and start_range is None: raise ValueError("start_range value cannot be None.") if end_range_required and end_range is None: raise ValueError("end_range value cannot be None.") if align_to_page: if start_range is not None and start_range % 512 != 0: raise ValueError("Invalid page blob start_range: {0}. " "The size must be aligned to a 512-byte boundary.".format(start_range)) if end_range is not None and end_range % 512 != 511: raise ValueError("Invalid page blob end_range: {0}. " "The size must be aligned to a 512-byte boundary.".format(end_range)) range_header = None if end_range is not None: range_header = 'bytes={0}-{1}'.format(start_range, end_range) elif start_range is not None: range_header = "bytes={0}-".format(start_range) range_validation = None if check_content_md5: if start_range is None or end_range is None: raise ValueError("Both start and end range requied for MD5 content validation.") if end_range - start_range > 4 * 1024 * 1024: raise ValueError("Getting content MD5 for a range greater than 4MB is not supported.") range_validation = 'true' return range_header, range_validation def normalize_headers(headers): normalized = {} for key, value in headers.items(): if key.startswith('x-ms-'): key = key[5:] normalized[key.lower().replace('-', '_')] = value return normalized def return_response_headers(response, deserialized, response_headers): return normalize_headers(response_headers) def return_headers_and_deserialized(response, deserialized, response_headers): return normalize_headers(response_headers), deserialized def return_context_and_deserialized(response, deserialized, response_headers): return response.location_mode, deserialized def create_configuration(**kwargs): config = Configuration(**kwargs) config.headers_policy = StorageHeadersPolicy(**kwargs) config.user_agent_policy = StorageUserAgentPolicy(**kwargs) config.retry_policy = kwargs.get('retry_policy') or ExponentialRetry(**kwargs) config.redirect_policy = RedirectPolicy(**kwargs) config.logging_policy = StorageLoggingPolicy(**kwargs) config.proxy_policy = ProxyPolicy(**kwargs) config.blob_settings = StorageBlobSettings(**kwargs) return config def create_pipeline(credential, **kwargs): credential_policy = None if hasattr(credential, 'get_token'): credential_policy = BearerTokenCredentialPolicy(credential, STORAGE_OAUTH_SCOPE) elif isinstance(credential, SharedKeyCredentialPolicy): credential_policy = credential elif credential is not None: raise TypeError("Unsupported credential: {}".format(credential)) config = kwargs.get('_configuration') or create_configuration(**kwargs) if kwargs.get('_pipeline'): return config, kwargs['_pipeline'] transport = kwargs.get('transport') if 'connection_timeout' not in kwargs: kwargs['connection_timeout'] = DEFAULT_SOCKET_TIMEOUT if not transport: transport = RequestsTransport(**kwargs) policies = [ QueueMessagePolicy(), config.headers_policy, config.user_agent_policy, StorageContentValidation(), StorageRequestHook(**kwargs), credential_policy, ContentDecodePolicy(), config.redirect_policy, StorageHosts(**kwargs), config.retry_policy, config.logging_policy, StorageResponseHook(**kwargs), ] return config, Pipeline(transport, policies=policies) def parse_query(query_str): sas_values = _QueryStringConstants.to_list() parsed_query = {k: v[0] for k, v in parse_qs(query_str).items()} sas_params = ["{}={}".format(k, v) for k, v in parsed_query.items() if k in sas_values] sas_token = None if sas_params: sas_token = '&'.join(sas_params) return parsed_query.get('snapshot'), sas_token def is_credential_sastoken(credential): if not credential or not isinstance(credential, six.string_types): return False sas_values = _QueryStringConstants.to_list() parsed_query = parse_qs(credential.lstrip('?')) if parsed_query and all([k in sas_values for k in parsed_query.keys()]): return True return False def add_metadata_headers(metadata): headers = {} if metadata: for key, value in metadata.items(): headers['x-ms-meta-{}'.format(key)] = value return headers def process_storage_error(storage_error): raise_error = HttpResponseError error_code = storage_error.response.headers.get('x-ms-error-code') error_message = storage_error.message additional_data = {} try: error_body = ContentDecodePolicy.deserialize_from_http_generics(storage_error.response) if error_body: for info in error_body.iter(): if info.tag.lower() == 'code': error_code = info.text elif info.tag.lower() == 'message': error_message = info.text else: additional_data[info.tag] = info.text except DecodeError: pass try: if error_code: error_code = StorageErrorCode(error_code) if error_code in [StorageErrorCode.condition_not_met, StorageErrorCode.blob_overwritten]: raise_error = ResourceModifiedError if error_code in [StorageErrorCode.invalid_authentication_info, StorageErrorCode.authentication_failed]: raise_error = ClientAuthenticationError if error_code in [StorageErrorCode.resource_not_found, StorageErrorCode.blob_not_found, StorageErrorCode.queue_not_found, StorageErrorCode.container_not_found]: raise_error = ResourceNotFoundError if error_code in [StorageErrorCode.account_already_exists, StorageErrorCode.account_being_created, StorageErrorCode.resource_already_exists, StorageErrorCode.resource_type_mismatch, StorageErrorCode.blob_already_exists, StorageErrorCode.queue_already_exists, StorageErrorCode.container_already_exists, StorageErrorCode.container_being_deleted, StorageErrorCode.queue_being_deleted]: raise_error = ResourceExistsError except ValueError: pass try: error_message += "\nErrorCode:{}".format(error_code.value) except AttributeError: error_message += "\nErrorCode:{}".format(error_code) for name, info in additional_data.items(): error_message += "\n{}:{}".format(name, info) error = raise_error(message=error_message, response=storage_error.response) error.error_code = error_code error.additional_info = additional_data raise error
true
true
1c4530276fcdb695658f172383b6ef0f338a039e
47
py
Python
deepclaw/utils/success_label/__init__.py
Nokkxz/ME336-Yellow-Team-Project
5b6d65ecb134049ba3c5d27c37f521ada79a913f
[ "MIT" ]
5
2020-06-24T03:47:00.000Z
2021-10-13T03:35:38.000Z
deepclaw/utils/success_label/__init__.py
Nokkxz/ME336-Yellow-Team-Project
5b6d65ecb134049ba3c5d27c37f521ada79a913f
[ "MIT" ]
null
null
null
deepclaw/utils/success_label/__init__.py
Nokkxz/ME336-Yellow-Team-Project
5b6d65ecb134049ba3c5d27c37f521ada79a913f
[ "MIT" ]
3
2020-06-18T09:25:39.000Z
2021-04-18T03:51:08.000Z
__all__ = ['DetectForeground', 'success_label']
47
47
0.765957
__all__ = ['DetectForeground', 'success_label']
true
true
1c453071197a502639b6057e02299e32868cc15f
392
py
Python
generate-schema.py
akhmetzaki/amplitude-bigquery
9c637198aa85518d72acb1184f06279497de3189
[ "MIT" ]
null
null
null
generate-schema.py
akhmetzaki/amplitude-bigquery
9c637198aa85518d72acb1184f06279497de3189
[ "MIT" ]
null
null
null
generate-schema.py
akhmetzaki/amplitude-bigquery
9c637198aa85518d72acb1184f06279497de3189
[ "MIT" ]
null
null
null
import pandas as pd import json def parse_json(): with open('bigquery-schema-events.json', 'r') as f: events_df = pd.DataFrame(json.loads(f.read())) with open('bigquery-schema-events-properties.json') as f: prop_df = pd.DataFrame(json.loads(f.read())) events_df.to_csv('events.csv') prop_df.to_csv('props.csv') if __name__ == '__main__': parse_json()
23.058824
61
0.660714
import pandas as pd import json def parse_json(): with open('bigquery-schema-events.json', 'r') as f: events_df = pd.DataFrame(json.loads(f.read())) with open('bigquery-schema-events-properties.json') as f: prop_df = pd.DataFrame(json.loads(f.read())) events_df.to_csv('events.csv') prop_df.to_csv('props.csv') if __name__ == '__main__': parse_json()
true
true
1c4530e1085d4b99291f8b076baa1a404e14de62
1,161
py
Python
openpmd_updater/transforms/v2_0_0/Version.py
openPMD/openPMD-updater
1f334c99093b7175af990d57879ea24ff5b4cb01
[ "ISC" ]
1
2019-03-28T13:29:44.000Z
2019-03-28T13:29:44.000Z
openpmd_updater/transforms/v2_0_0/Version.py
openPMD/openPMD-updater
1f334c99093b7175af990d57879ea24ff5b4cb01
[ "ISC" ]
3
2018-11-06T15:51:42.000Z
2020-02-03T16:38:29.000Z
openpmd_updater/transforms/v2_0_0/Version.py
openPMD/openPMD-updater
1f334c99093b7175af990d57879ea24ff5b4cb01
[ "ISC" ]
2
2018-11-07T18:10:21.000Z
2020-01-22T03:29:02.000Z
""" This file is part of the openPMD-updater. Copyright 2018 openPMD contributors Authors: Axel Huebl License: ISC """ from openpmd_updater.transforms.ITransform import ITransform import numpy as np class Version(ITransform): """ Transforms the openPMD version. openPMD standard: 1.*.* -> 2.0.0 Related openPMD-standard issues: https://github.com/openPMD/openPMD-standard/projects/3 """ """Name and description of the transformation""" name = "version", "replace openPMD version identifier with new version" """Minimum openPMD standard version that is supported by this transformation""" min_version = "1.0.0" """openPMD standard version is fulfulled by this transformation""" to_version = "2.0.0" def __init__(self, backend): """Open a file""" self.fb = backend def transform(self, in_place=True): """Perform transformation""" if not in_place: raise NotImplementedError("Only in-place transformation implemented!") self.fb.cd(None) self.fb.del_attr("openPMD") self.fb.add_attr("openPMD", np.string_(Version.to_version))
26.386364
83
0.676141
from openpmd_updater.transforms.ITransform import ITransform import numpy as np class Version(ITransform): name = "version", "replace openPMD version identifier with new version" min_version = "1.0.0" to_version = "2.0.0" def __init__(self, backend): self.fb = backend def transform(self, in_place=True): if not in_place: raise NotImplementedError("Only in-place transformation implemented!") self.fb.cd(None) self.fb.del_attr("openPMD") self.fb.add_attr("openPMD", np.string_(Version.to_version))
true
true
1c4530f68bcd141ac33d9dab2284d8d8685dbe9c
250
py
Python
nsd1903/devops/day01/mtprint4.py
MrWangwf/nsd2019
5e859b4b1926dc098d236be3720779c50d0a55fc
[ "Apache-2.0" ]
1
2019-09-19T04:53:22.000Z
2019-09-19T04:53:22.000Z
nsd1903/devops/day01/mtprint4.py
MrWangwf/nsd2019
5e859b4b1926dc098d236be3720779c50d0a55fc
[ "Apache-2.0" ]
null
null
null
nsd1903/devops/day01/mtprint4.py
MrWangwf/nsd2019
5e859b4b1926dc098d236be3720779c50d0a55fc
[ "Apache-2.0" ]
1
2021-12-28T04:26:02.000Z
2021-12-28T04:26:02.000Z
import threading class MyClass: def __call__(self, a, b, c): print('Hello', a, b, c) if __name__ == '__main__': for i in range(3): t = threading.Thread(target=MyClass(), args=(10, 20, 30)) t.start() # target(*args)
22.727273
65
0.572
import threading class MyClass: def __call__(self, a, b, c): print('Hello', a, b, c) if __name__ == '__main__': for i in range(3): t = threading.Thread(target=MyClass(), args=(10, 20, 30)) t.start()
true
true
1c4531039560c0133de2c7dd58e494b440bb52fe
3,438
py
Python
d2relay.py
seichter/d2relay
23e3e727b4de80e6e685964b7339ef0652d9ed8d
[ "MIT" ]
null
null
null
d2relay.py
seichter/d2relay
23e3e727b4de80e6e685964b7339ef0652d9ed8d
[ "MIT" ]
null
null
null
d2relay.py
seichter/d2relay
23e3e727b4de80e6e685964b7339ef0652d9ed8d
[ "MIT" ]
null
null
null
#!/usr/bin/env python """ D2 is a minimal relay tool to output Leica DISTO D2 data to the console Copyrights (c) 2021 Hartmut Seichter Distributed under the terms of the MIT License """ import gatt import struct debug_mode = False keepalive_hack = True class DISTOManager(gatt.DeviceManager): def __init__(self, adapter_name): super().__init__(adapter_name) def run(self): super().run() def on_idle(self): pass class DISTO(gatt.Device): def connect_succeeded(self): super().connect_succeeded() print("[%s] Connected" % (self.mac_address)) def connect_failed(self, error): super().connect_failed(error) print("[%s] Connection failed: %s" % (self.mac_address, str(error))) def disconnect_succeeded(self): super().disconnect_succeeded() print("[%s] Disconnected" % (self.mac_address)) # aweful hack to keep the DISTO from disconnecting # this will drain your distos battery! if keepalive_hack: self.connect() def services_resolved(self): super().services_resolved() if debug_mode: print("[%s] Resolved services" % (self.mac_address)) for service in self.services: if debug_mode: print("[%s] Service [%s]" % (self.mac_address, service.uuid)) for characteristic in service.characteristics: if debug_mode: print("[%s] Characteristic [%s]" % (self.mac_address, characteristic.uuid)) characteristic.read_value() characteristic.enable_notifications() def characteristic_value_updated(self, characteristic, value): if debug_mode: # this is here for debugging ... there many more things to implement # if characteristic.uuid == '3ab10102-f831-4395-b29d-570977d5bf94': print(characteristic.uuid,':',type(value),len(value)) # ,int.from_bytes(value,byteorder='big', signed=False)) # else: # print( characteristic.uuid, ":", value.decode("utf-8")) print('\traw :',value) if len(value) == 2: print("\tuint16 :",struct.unpack('>H',value)[0]) if len(value) == 4: print("\tfloat :",struct.unpack('f',value)[0]) elif len(value) == 8: print('\tdouble:',struct.unpack('d',value)[0]) elif characteristic.uuid == '3ab10101-f831-4395-b29d-570977d5bf94': self.report_measurement(value) # Vendor ID elif characteristic.uuid == '00002a29-0000-1000-8000-00805f9b34fb': # for whatever reasons the D2 reports itself as the BLE SoC # thats driving it - a Nordic Semi nRF51822 - a 16MhZ Cortex-M0 is_leica = value.decode('utf-8') == 'nRF51822' elif characteristic.uuid == '00002a1a-0000-1000-8000-00805f9b34fb': print('Battery level',value) def report_measurement(self,value): float_val = struct.unpack('f',value)[0] print(round(float_val,3),'m') # note: Make it configurable manager = DISTOManager(adapter_name='hci0') # well this is only for the D2 but other BLE devices by Leica should # work similar - usually they just have more functions device = DISTO(mac_address= 'FD:8B:B0:50:BA:A3', manager=manager) device.connect() manager.run()
33.705882
121
0.613729
import gatt import struct debug_mode = False keepalive_hack = True class DISTOManager(gatt.DeviceManager): def __init__(self, adapter_name): super().__init__(adapter_name) def run(self): super().run() def on_idle(self): pass class DISTO(gatt.Device): def connect_succeeded(self): super().connect_succeeded() print("[%s] Connected" % (self.mac_address)) def connect_failed(self, error): super().connect_failed(error) print("[%s] Connection failed: %s" % (self.mac_address, str(error))) def disconnect_succeeded(self): super().disconnect_succeeded() print("[%s] Disconnected" % (self.mac_address)) if keepalive_hack: self.connect() def services_resolved(self): super().services_resolved() if debug_mode: print("[%s] Resolved services" % (self.mac_address)) for service in self.services: if debug_mode: print("[%s] Service [%s]" % (self.mac_address, service.uuid)) for characteristic in service.characteristics: if debug_mode: print("[%s] Characteristic [%s]" % (self.mac_address, characteristic.uuid)) characteristic.read_value() characteristic.enable_notifications() def characteristic_value_updated(self, characteristic, value): if debug_mode: print(characteristic.uuid,':',type(value),len(value)) print('\traw :',value) if len(value) == 2: print("\tuint16 :",struct.unpack('>H',value)[0]) if len(value) == 4: print("\tfloat :",struct.unpack('f',value)[0]) elif len(value) == 8: print('\tdouble:',struct.unpack('d',value)[0]) elif characteristic.uuid == '3ab10101-f831-4395-b29d-570977d5bf94': self.report_measurement(value) elif characteristic.uuid == '00002a29-0000-1000-8000-00805f9b34fb': is_leica = value.decode('utf-8') == 'nRF51822' elif characteristic.uuid == '00002a1a-0000-1000-8000-00805f9b34fb': print('Battery level',value) def report_measurement(self,value): float_val = struct.unpack('f',value)[0] print(round(float_val,3),'m') manager = DISTOManager(adapter_name='hci0') device = DISTO(mac_address= 'FD:8B:B0:50:BA:A3', manager=manager) device.connect() manager.run()
true
true
1c4531cb438cfc0c8e48462c8037d07548cfe931
44,723
py
Python
nova/api/openstack/wsgi.py
nicholaskuechler/nova
ff412c3888b234eb123161cc4e6d0d0d69c0004e
[ "Apache-2.0" ]
null
null
null
nova/api/openstack/wsgi.py
nicholaskuechler/nova
ff412c3888b234eb123161cc4e6d0d0d69c0004e
[ "Apache-2.0" ]
1
2021-03-21T11:39:52.000Z
2021-03-21T11:39:52.000Z
nova/api/openstack/wsgi.py
nicholaskuechler/nova
ff412c3888b234eb123161cc4e6d0d0d69c0004e
[ "Apache-2.0" ]
1
2021-03-21T11:37:33.000Z
2021-03-21T11:37:33.000Z
# Copyright 2013 IBM Corp. # Copyright 2011 OpenStack Foundation # All Rights Reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); you may # not use this file except in compliance with the License. You may obtain # a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, WITHOUT # WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the # License for the specific language governing permissions and limitations # under the License. import functools import inspect import math import time from oslo_log import log as logging from oslo_serialization import jsonutils from oslo_utils import strutils import six import webob from nova.api.openstack import api_version_request as api_version from nova.api.openstack import versioned_method from nova import exception from nova import i18n from nova.i18n import _ from nova.i18n import _LE from nova.i18n import _LI from nova import utils from nova import wsgi LOG = logging.getLogger(__name__) _SUPPORTED_CONTENT_TYPES = ( 'application/json', 'application/vnd.openstack.compute+json', ) _MEDIA_TYPE_MAP = { 'application/vnd.openstack.compute+json': 'json', 'application/json': 'json', } # These are typically automatically created by routes as either defaults # collection or member methods. _ROUTES_METHODS = [ 'create', 'delete', 'show', 'update', ] _METHODS_WITH_BODY = [ 'POST', 'PUT', ] # The default api version request if none is requested in the headers # Note(cyeoh): This only applies for the v2.1 API once microversions # support is fully merged. It does not affect the V2 API. DEFAULT_API_VERSION = "2.1" # name of attribute to keep version method information VER_METHOD_ATTR = 'versioned_methods' # Name of header used by clients to request a specific version # of the REST API API_VERSION_REQUEST_HEADER = 'X-OpenStack-Nova-API-Version' ENV_LEGACY_V2 = 'openstack.legacy_v2' def get_supported_content_types(): return _SUPPORTED_CONTENT_TYPES def get_media_map(): return dict(_MEDIA_TYPE_MAP.items()) class Request(wsgi.Request): """Add some OpenStack API-specific logic to the base webob.Request.""" def __init__(self, *args, **kwargs): super(Request, self).__init__(*args, **kwargs) self._extension_data = {'db_items': {}} if not hasattr(self, 'api_version_request'): self.api_version_request = api_version.APIVersionRequest() def cache_db_items(self, key, items, item_key='id'): """Allow API methods to store objects from a DB query to be used by API extensions within the same API request. An instance of this class only lives for the lifetime of a single API request, so there's no need to implement full cache management. """ db_items = self._extension_data['db_items'].setdefault(key, {}) for item in items: db_items[item[item_key]] = item def get_db_items(self, key): """Allow an API extension to get previously stored objects within the same API request. Note that the object data will be slightly stale. """ return self._extension_data['db_items'][key] def get_db_item(self, key, item_key): """Allow an API extension to get a previously stored object within the same API request. Note that the object data will be slightly stale. """ return self.get_db_items(key).get(item_key) def cache_db_instances(self, instances): self.cache_db_items('instances', instances, 'uuid') def cache_db_instance(self, instance): self.cache_db_items('instances', [instance], 'uuid') def get_db_instances(self): return self.get_db_items('instances') def get_db_instance(self, instance_uuid): return self.get_db_item('instances', instance_uuid) def cache_db_flavors(self, flavors): self.cache_db_items('flavors', flavors, 'flavorid') def cache_db_flavor(self, flavor): self.cache_db_items('flavors', [flavor], 'flavorid') def get_db_flavors(self): return self.get_db_items('flavors') def get_db_flavor(self, flavorid): return self.get_db_item('flavors', flavorid) def cache_db_compute_nodes(self, compute_nodes): self.cache_db_items('compute_nodes', compute_nodes, 'id') def cache_db_compute_node(self, compute_node): self.cache_db_items('compute_nodes', [compute_node], 'id') def get_db_compute_nodes(self): return self.get_db_items('compute_nodes') def get_db_compute_node(self, id): return self.get_db_item('compute_nodes', id) def best_match_content_type(self): """Determine the requested response content-type.""" if 'nova.best_content_type' not in self.environ: # Calculate the best MIME type content_type = None # Check URL path suffix parts = self.path.rsplit('.', 1) if len(parts) > 1: possible_type = 'application/' + parts[1] if possible_type in get_supported_content_types(): content_type = possible_type if not content_type: content_type = self.accept.best_match( get_supported_content_types()) self.environ['nova.best_content_type'] = (content_type or 'application/json') return self.environ['nova.best_content_type'] def get_content_type(self): """Determine content type of the request body. Does not do any body introspection, only checks header """ if "Content-Type" not in self.headers: return None content_type = self.content_type # NOTE(markmc): text/plain is the default for eventlet and # other webservers which use mimetools.Message.gettype() # whereas twisted defaults to ''. if not content_type or content_type == 'text/plain': return None if content_type not in get_supported_content_types(): raise exception.InvalidContentType(content_type=content_type) return content_type def best_match_language(self): """Determine the best available language for the request. :returns: the best language match or None if the 'Accept-Language' header was not available in the request. """ if not self.accept_language: return None return self.accept_language.best_match( i18n.get_available_languages()) def set_api_version_request(self): """Set API version request based on the request header information.""" if API_VERSION_REQUEST_HEADER in self.headers: hdr_string = self.headers[API_VERSION_REQUEST_HEADER] # 'latest' is a special keyword which is equivalent to requesting # the maximum version of the API supported if hdr_string == 'latest': self.api_version_request = api_version.max_api_version() else: self.api_version_request = api_version.APIVersionRequest( hdr_string) # Check that the version requested is within the global # minimum/maximum of supported API versions if not self.api_version_request.matches( api_version.min_api_version(), api_version.max_api_version()): raise exception.InvalidGlobalAPIVersion( req_ver=self.api_version_request.get_string(), min_ver=api_version.min_api_version().get_string(), max_ver=api_version.max_api_version().get_string()) else: self.api_version_request = api_version.APIVersionRequest( api_version.DEFAULT_API_VERSION) def set_legacy_v2(self): self.environ[ENV_LEGACY_V2] = True def is_legacy_v2(self): return self.environ.get(ENV_LEGACY_V2, False) class ActionDispatcher(object): """Maps method name to local methods through action name.""" def dispatch(self, *args, **kwargs): """Find and call local method.""" action = kwargs.pop('action', 'default') action_method = getattr(self, str(action), self.default) return action_method(*args, **kwargs) def default(self, data): raise NotImplementedError() class TextDeserializer(ActionDispatcher): """Default request body deserialization.""" def deserialize(self, datastring, action='default'): return self.dispatch(datastring, action=action) def default(self, datastring): return {} class JSONDeserializer(TextDeserializer): def _from_json(self, datastring): try: return jsonutils.loads(datastring) except ValueError: msg = _("cannot understand JSON") raise exception.MalformedRequestBody(reason=msg) def default(self, datastring): return {'body': self._from_json(datastring)} class DictSerializer(ActionDispatcher): """Default request body serialization.""" def serialize(self, data, action='default'): return self.dispatch(data, action=action) def default(self, data): return "" class JSONDictSerializer(DictSerializer): """Default JSON request body serialization.""" def default(self, data): return jsonutils.dumps(data) def serializers(**serializers): """Attaches serializers to a method. This decorator associates a dictionary of serializers with a method. Note that the function attributes are directly manipulated; the method is not wrapped. """ def decorator(func): if not hasattr(func, 'wsgi_serializers'): func.wsgi_serializers = {} func.wsgi_serializers.update(serializers) return func return decorator def deserializers(**deserializers): """Attaches deserializers to a method. This decorator associates a dictionary of deserializers with a method. Note that the function attributes are directly manipulated; the method is not wrapped. """ def decorator(func): if not hasattr(func, 'wsgi_deserializers'): func.wsgi_deserializers = {} func.wsgi_deserializers.update(deserializers) return func return decorator def response(code): """Attaches response code to a method. This decorator associates a response code with a method. Note that the function attributes are directly manipulated; the method is not wrapped. """ def decorator(func): func.wsgi_code = code return func return decorator class ResponseObject(object): """Bundles a response object with appropriate serializers. Object that app methods may return in order to bind alternate serializers with a response object to be serialized. Its use is optional. """ def __init__(self, obj, code=None, headers=None, **serializers): """Binds serializers with an object. Takes keyword arguments akin to the @serializer() decorator for specifying serializers. Serializers specified will be given preference over default serializers or method-specific serializers on return. """ self.obj = obj self.serializers = serializers self._default_code = 200 self._code = code self._headers = headers or {} self.serializer = None self.media_type = None def __getitem__(self, key): """Retrieves a header with the given name.""" return self._headers[key.lower()] def __setitem__(self, key, value): """Sets a header with the given name to the given value.""" self._headers[key.lower()] = value def __delitem__(self, key): """Deletes the header with the given name.""" del self._headers[key.lower()] def _bind_method_serializers(self, meth_serializers): """Binds method serializers with the response object. Binds the method serializers with the response object. Serializers specified to the constructor will take precedence over serializers specified to this method. :param meth_serializers: A dictionary with keys mapping to response types and values containing serializer objects. """ # We can't use update because that would be the wrong # precedence for mtype, serializer in meth_serializers.items(): self.serializers.setdefault(mtype, serializer) def get_serializer(self, content_type, default_serializers=None): """Returns the serializer for the wrapped object. Returns the serializer for the wrapped object subject to the indicated content type. If no serializer matching the content type is attached, an appropriate serializer drawn from the default serializers will be used. If no appropriate serializer is available, raises InvalidContentType. """ default_serializers = default_serializers or {} try: mtype = get_media_map().get(content_type, content_type) if mtype in self.serializers: return mtype, self.serializers[mtype] else: return mtype, default_serializers[mtype] except (KeyError, TypeError): raise exception.InvalidContentType(content_type=content_type) def preserialize(self, content_type, default_serializers=None): """Prepares the serializer that will be used to serialize. Determines the serializer that will be used and prepares an instance of it for later call. This allows the serializer to be accessed by extensions for, e.g., template extension. """ mtype, serializer = self.get_serializer(content_type, default_serializers) self.media_type = mtype self.serializer = serializer() def attach(self, **kwargs): """Attach slave templates to serializers.""" if self.media_type in kwargs: self.serializer.attach(kwargs[self.media_type]) def serialize(self, request, content_type, default_serializers=None): """Serializes the wrapped object. Utility method for serializing the wrapped object. Returns a webob.Response object. """ if self.serializer: serializer = self.serializer else: _mtype, _serializer = self.get_serializer(content_type, default_serializers) serializer = _serializer() response = webob.Response() response.status_int = self.code for hdr, value in self._headers.items(): response.headers[hdr] = utils.utf8(str(value)) response.headers['Content-Type'] = utils.utf8(content_type) if self.obj is not None: response.body = serializer.serialize(self.obj) return response @property def code(self): """Retrieve the response status.""" return self._code or self._default_code @property def headers(self): """Retrieve the headers.""" return self._headers.copy() def action_peek_json(body): """Determine action to invoke.""" try: decoded = jsonutils.loads(body) except ValueError: msg = _("cannot understand JSON") raise exception.MalformedRequestBody(reason=msg) # Make sure there's exactly one key... if len(decoded) != 1: msg = _("too many body keys") raise exception.MalformedRequestBody(reason=msg) # Return the action and the decoded body... return decoded.keys()[0] class ResourceExceptionHandler(object): """Context manager to handle Resource exceptions. Used when processing exceptions generated by API implementation methods (or their extensions). Converts most exceptions to Fault exceptions, with the appropriate logging. """ def __enter__(self): return None def __exit__(self, ex_type, ex_value, ex_traceback): if not ex_value: return True if isinstance(ex_value, exception.Forbidden): raise Fault(webob.exc.HTTPForbidden( explanation=ex_value.format_message())) elif isinstance(ex_value, exception.VersionNotFoundForAPIMethod): raise elif isinstance(ex_value, exception.Invalid): raise Fault(exception.ConvertedException( code=ex_value.code, explanation=ex_value.format_message())) elif isinstance(ex_value, TypeError): exc_info = (ex_type, ex_value, ex_traceback) LOG.error(_LE('Exception handling resource: %s'), ex_value, exc_info=exc_info) raise Fault(webob.exc.HTTPBadRequest()) elif isinstance(ex_value, Fault): LOG.info(_LI("Fault thrown: %s"), ex_value) raise ex_value elif isinstance(ex_value, webob.exc.HTTPException): LOG.info(_LI("HTTP exception thrown: %s"), ex_value) raise Fault(ex_value) # We didn't handle the exception return False class Resource(wsgi.Application): """WSGI app that handles (de)serialization and controller dispatch. WSGI app that reads routing information supplied by RoutesMiddleware and calls the requested action method upon its controller. All controller action methods must accept a 'req' argument, which is the incoming wsgi.Request. If the operation is a PUT or POST, the controller method must also accept a 'body' argument (the deserialized request body). They may raise a webob.exc exception or return a dict, which will be serialized by requested content type. Exceptions derived from webob.exc.HTTPException will be automatically wrapped in Fault() to provide API friendly error responses. """ support_api_request_version = False def __init__(self, controller, action_peek=None, inherits=None, **deserializers): """:param controller: object that implement methods created by routes lib :param action_peek: dictionary of routines for peeking into an action request body to determine the desired action :param inherits: another resource object that this resource should inherit extensions from. Any action extensions that are applied to the parent resource will also apply to this resource. """ self.controller = controller default_deserializers = dict(json=JSONDeserializer) default_deserializers.update(deserializers) self.default_deserializers = default_deserializers self.default_serializers = dict(json=JSONDictSerializer) self.action_peek = dict(json=action_peek_json) self.action_peek.update(action_peek or {}) # Copy over the actions dictionary self.wsgi_actions = {} if controller: self.register_actions(controller) # Save a mapping of extensions self.wsgi_extensions = {} self.wsgi_action_extensions = {} self.inherits = inherits def register_actions(self, controller): """Registers controller actions with this resource.""" actions = getattr(controller, 'wsgi_actions', {}) for key, method_name in actions.items(): self.wsgi_actions[key] = getattr(controller, method_name) def register_extensions(self, controller): """Registers controller extensions with this resource.""" extensions = getattr(controller, 'wsgi_extensions', []) for method_name, action_name in extensions: # Look up the extending method extension = getattr(controller, method_name) if action_name: # Extending an action... if action_name not in self.wsgi_action_extensions: self.wsgi_action_extensions[action_name] = [] self.wsgi_action_extensions[action_name].append(extension) else: # Extending a regular method if method_name not in self.wsgi_extensions: self.wsgi_extensions[method_name] = [] self.wsgi_extensions[method_name].append(extension) def get_action_args(self, request_environment): """Parse dictionary created by routes library.""" # NOTE(Vek): Check for get_action_args() override in the # controller if hasattr(self.controller, 'get_action_args'): return self.controller.get_action_args(request_environment) try: args = request_environment['wsgiorg.routing_args'][1].copy() except (KeyError, IndexError, AttributeError): return {} try: del args['controller'] except KeyError: pass try: del args['format'] except KeyError: pass return args def get_body(self, request): try: content_type = request.get_content_type() except exception.InvalidContentType: LOG.debug("Unrecognized Content-Type provided in request") return None, '' return content_type, request.body def deserialize(self, meth, content_type, body): meth_deserializers = getattr(meth, 'wsgi_deserializers', {}) try: mtype = get_media_map().get(content_type, content_type) if mtype in meth_deserializers: deserializer = meth_deserializers[mtype] else: deserializer = self.default_deserializers[mtype] except (KeyError, TypeError): raise exception.InvalidContentType(content_type=content_type) if (hasattr(deserializer, 'want_controller') and deserializer.want_controller): return deserializer(self.controller).deserialize(body) else: return deserializer().deserialize(body) def pre_process_extensions(self, extensions, request, action_args): # List of callables for post-processing extensions post = [] for ext in extensions: if inspect.isgeneratorfunction(ext): response = None # If it's a generator function, the part before the # yield is the preprocessing stage try: with ResourceExceptionHandler(): gen = ext(req=request, **action_args) response = next(gen) except Fault as ex: response = ex # We had a response... if response: return response, [] # No response, queue up generator for post-processing post.append(gen) else: # Regular functions only perform post-processing post.append(ext) # Run post-processing in the reverse order return None, reversed(post) def post_process_extensions(self, extensions, resp_obj, request, action_args): for ext in extensions: response = None if inspect.isgenerator(ext): # If it's a generator, run the second half of # processing try: with ResourceExceptionHandler(): response = ext.send(resp_obj) except StopIteration: # Normal exit of generator continue except Fault as ex: response = ex else: # Regular functions get post-processing... try: with ResourceExceptionHandler(): response = ext(req=request, resp_obj=resp_obj, **action_args) except exception.VersionNotFoundForAPIMethod: # If an attached extension (@wsgi.extends) for the # method has no version match its not an error. We # just don't run the extends code continue except Fault as ex: response = ex # We had a response... if response: return response return None def _should_have_body(self, request): return request.method in _METHODS_WITH_BODY @webob.dec.wsgify(RequestClass=Request) def __call__(self, request): """WSGI method that controls (de)serialization and method dispatch.""" if self.support_api_request_version: # Set the version of the API requested based on the header try: request.set_api_version_request() except exception.InvalidAPIVersionString as e: return Fault(webob.exc.HTTPBadRequest( explanation=e.format_message())) except exception.InvalidGlobalAPIVersion as e: return Fault(webob.exc.HTTPNotAcceptable( explanation=e.format_message())) # Identify the action, its arguments, and the requested # content type action_args = self.get_action_args(request.environ) action = action_args.pop('action', None) content_type, body = self.get_body(request) accept = request.best_match_content_type() # NOTE(Vek): Splitting the function up this way allows for # auditing by external tools that wrap the existing # function. If we try to audit __call__(), we can # run into troubles due to the @webob.dec.wsgify() # decorator. return self._process_stack(request, action, action_args, content_type, body, accept) def _process_stack(self, request, action, action_args, content_type, body, accept): """Implement the processing stack.""" # Get the implementing method try: meth, extensions = self.get_method(request, action, content_type, body) except (AttributeError, TypeError): return Fault(webob.exc.HTTPNotFound()) except KeyError as ex: msg = _("There is no such action: %s") % ex.args[0] return Fault(webob.exc.HTTPBadRequest(explanation=msg)) except exception.MalformedRequestBody: msg = _("Malformed request body") return Fault(webob.exc.HTTPBadRequest(explanation=msg)) if body: msg = _("Action: '%(action)s', calling method: %(meth)s, body: " "%(body)s") % {'action': action, 'body': six.text_type(body, 'utf-8'), 'meth': str(meth)} LOG.debug(strutils.mask_password(msg)) else: LOG.debug("Calling method '%(meth)s'", {'meth': str(meth)}) # Now, deserialize the request body... try: contents = {} if self._should_have_body(request): # allow empty body with PUT and POST if request.content_length == 0: contents = {'body': None} else: contents = self.deserialize(meth, content_type, body) except exception.InvalidContentType: msg = _("Unsupported Content-Type") return Fault(webob.exc.HTTPBadRequest(explanation=msg)) except exception.MalformedRequestBody: msg = _("Malformed request body") return Fault(webob.exc.HTTPBadRequest(explanation=msg)) # Update the action args action_args.update(contents) project_id = action_args.pop("project_id", None) context = request.environ.get('nova.context') if (context and project_id and (project_id != context.project_id)): msg = _("Malformed request URL: URL's project_id '%(project_id)s'" " doesn't match Context's project_id" " '%(context_project_id)s'") % \ {'project_id': project_id, 'context_project_id': context.project_id} return Fault(webob.exc.HTTPBadRequest(explanation=msg)) # Run pre-processing extensions response, post = self.pre_process_extensions(extensions, request, action_args) if not response: try: with ResourceExceptionHandler(): action_result = self.dispatch(meth, request, action_args) except Fault as ex: response = ex if not response: # No exceptions; convert action_result into a # ResponseObject resp_obj = None if type(action_result) is dict or action_result is None: resp_obj = ResponseObject(action_result) elif isinstance(action_result, ResponseObject): resp_obj = action_result else: response = action_result # Run post-processing extensions if resp_obj: # Do a preserialize to set up the response object serializers = getattr(meth, 'wsgi_serializers', {}) resp_obj._bind_method_serializers(serializers) if hasattr(meth, 'wsgi_code'): resp_obj._default_code = meth.wsgi_code resp_obj.preserialize(accept, self.default_serializers) # Process post-processing extensions response = self.post_process_extensions(post, resp_obj, request, action_args) if resp_obj and not response: response = resp_obj.serialize(request, accept, self.default_serializers) if hasattr(response, 'headers'): for hdr, val in response.headers.items(): # Headers must be utf-8 strings response.headers[hdr] = utils.utf8(str(val)) if not request.api_version_request.is_null(): response.headers[API_VERSION_REQUEST_HEADER] = \ request.api_version_request.get_string() response.headers['Vary'] = API_VERSION_REQUEST_HEADER return response def get_method(self, request, action, content_type, body): meth, extensions = self._get_method(request, action, content_type, body) if self.inherits: _meth, parent_ext = self.inherits.get_method(request, action, content_type, body) extensions.extend(parent_ext) return meth, extensions def _get_method(self, request, action, content_type, body): """Look up the action-specific method and its extensions.""" # Look up the method try: if not self.controller: meth = getattr(self, action) else: meth = getattr(self.controller, action) except AttributeError: if (not self.wsgi_actions or action not in _ROUTES_METHODS + ['action']): # Propagate the error raise else: return meth, self.wsgi_extensions.get(action, []) if action == 'action': # OK, it's an action; figure out which action... mtype = get_media_map().get(content_type) action_name = self.action_peek[mtype](body) else: action_name = action # Look up the action method return (self.wsgi_actions[action_name], self.wsgi_action_extensions.get(action_name, [])) def dispatch(self, method, request, action_args): """Dispatch a call to the action-specific method.""" try: return method(req=request, **action_args) except exception.VersionNotFoundForAPIMethod: # We deliberately don't return any message information # about the exception to the user so it looks as if # the method is simply not implemented. return Fault(webob.exc.HTTPNotFound()) class ResourceV21(Resource): support_api_request_version = True def action(name): """Mark a function as an action. The given name will be taken as the action key in the body. This is also overloaded to allow extensions to provide non-extending definitions of create and delete operations. """ def decorator(func): func.wsgi_action = name return func return decorator def extends(*args, **kwargs): """Indicate a function extends an operation. Can be used as either:: @extends def index(...): pass or as:: @extends(action='resize') def _action_resize(...): pass """ def decorator(func): # Store enough information to find what we're extending func.wsgi_extends = (func.__name__, kwargs.get('action')) return func # If we have positional arguments, call the decorator if args: return decorator(*args) # OK, return the decorator instead return decorator class ControllerMetaclass(type): """Controller metaclass. This metaclass automates the task of assembling a dictionary mapping action keys to method names. """ def __new__(mcs, name, bases, cls_dict): """Adds the wsgi_actions dictionary to the class.""" # Find all actions actions = {} extensions = [] versioned_methods = None # start with wsgi actions from base classes for base in bases: actions.update(getattr(base, 'wsgi_actions', {})) if base.__name__ == "Controller": # NOTE(cyeoh): This resets the VER_METHOD_ATTR attribute # between API controller class creations. This allows us # to use a class decorator on the API methods that doesn't # require naming explicitly what method is being versioned as # it can be implicit based on the method decorated. It is a bit # ugly. if VER_METHOD_ATTR in base.__dict__: versioned_methods = getattr(base, VER_METHOD_ATTR) delattr(base, VER_METHOD_ATTR) for key, value in cls_dict.items(): if not callable(value): continue if getattr(value, 'wsgi_action', None): actions[value.wsgi_action] = key elif getattr(value, 'wsgi_extends', None): extensions.append(value.wsgi_extends) # Add the actions and extensions to the class dict cls_dict['wsgi_actions'] = actions cls_dict['wsgi_extensions'] = extensions if versioned_methods: cls_dict[VER_METHOD_ATTR] = versioned_methods return super(ControllerMetaclass, mcs).__new__(mcs, name, bases, cls_dict) @six.add_metaclass(ControllerMetaclass) class Controller(object): """Default controller.""" _view_builder_class = None def __init__(self, view_builder=None): """Initialize controller with a view builder instance.""" if view_builder: self._view_builder = view_builder elif self._view_builder_class: self._view_builder = self._view_builder_class() else: self._view_builder = None def __getattribute__(self, key): def version_select(*args, **kwargs): """Look for the method which matches the name supplied and version constraints and calls it with the supplied arguments. @return: Returns the result of the method called @raises: VersionNotFoundForAPIMethod if there is no method which matches the name and version constraints """ # The first arg to all versioned methods is always the request # object. The version for the request is attached to the # request object if len(args) == 0: ver = kwargs['req'].api_version_request else: ver = args[0].api_version_request func_list = self.versioned_methods[key] for func in func_list: if ver.matches(func.start_version, func.end_version): # Update the version_select wrapper function so # other decorator attributes like wsgi.response # are still respected. functools.update_wrapper(version_select, func.func) return func.func(self, *args, **kwargs) # No version match raise exception.VersionNotFoundForAPIMethod(version=ver) try: version_meth_dict = object.__getattribute__(self, VER_METHOD_ATTR) except AttributeError: # No versioning on this class return object.__getattribute__(self, key) if version_meth_dict and \ key in object.__getattribute__(self, VER_METHOD_ATTR): return version_select return object.__getattribute__(self, key) # NOTE(cyeoh): This decorator MUST appear first (the outermost # decorator) on an API method for it to work correctly @classmethod def api_version(cls, min_ver, max_ver=None): """Decorator for versioning api methods. Add the decorator to any method which takes a request object as the first parameter and belongs to a class which inherits from wsgi.Controller. @min_ver: string representing minimum version @max_ver: optional string representing maximum version """ def decorator(f): obj_min_ver = api_version.APIVersionRequest(min_ver) if max_ver: obj_max_ver = api_version.APIVersionRequest(max_ver) else: obj_max_ver = api_version.APIVersionRequest() # Add to list of versioned methods registered func_name = f.__name__ new_func = versioned_method.VersionedMethod( func_name, obj_min_ver, obj_max_ver, f) func_dict = getattr(cls, VER_METHOD_ATTR, {}) if not func_dict: setattr(cls, VER_METHOD_ATTR, func_dict) func_list = func_dict.get(func_name, []) if not func_list: func_dict[func_name] = func_list func_list.append(new_func) # Ensure the list is sorted by minimum version (reversed) # so later when we work through the list in order we find # the method which has the latest version which supports # the version requested. # TODO(cyeoh): Add check to ensure that there are no overlapping # ranges of valid versions as that is amibiguous func_list.sort(key=lambda f: f.start_version, reverse=True) return f return decorator @staticmethod def is_valid_body(body, entity_name): if not (body and entity_name in body): return False def is_dict(d): try: d.get(None) return True except AttributeError: return False return is_dict(body[entity_name]) class Fault(webob.exc.HTTPException): """Wrap webob.exc.HTTPException to provide API friendly response.""" _fault_names = { 400: "badRequest", 401: "unauthorized", 403: "forbidden", 404: "itemNotFound", 405: "badMethod", 409: "conflictingRequest", 413: "overLimit", 415: "badMediaType", 429: "overLimit", 501: "notImplemented", 503: "serviceUnavailable"} def __init__(self, exception): """Create a Fault for the given webob.exc.exception.""" self.wrapped_exc = exception for key, value in self.wrapped_exc.headers.items(): self.wrapped_exc.headers[key] = str(value) self.status_int = exception.status_int @webob.dec.wsgify(RequestClass=Request) def __call__(self, req): """Generate a WSGI response based on the exception passed to ctor.""" user_locale = req.best_match_language() # Replace the body with fault details. code = self.wrapped_exc.status_int fault_name = self._fault_names.get(code, "computeFault") explanation = self.wrapped_exc.explanation LOG.debug("Returning %(code)s to user: %(explanation)s", {'code': code, 'explanation': explanation}) explanation = i18n.translate(explanation, user_locale) fault_data = { fault_name: { 'code': code, 'message': explanation}} if code == 413 or code == 429: retry = self.wrapped_exc.headers.get('Retry-After', None) if retry: fault_data[fault_name]['retryAfter'] = retry if not req.api_version_request.is_null(): self.wrapped_exc.headers[API_VERSION_REQUEST_HEADER] = \ req.api_version_request.get_string() self.wrapped_exc.headers['Vary'] = \ API_VERSION_REQUEST_HEADER content_type = req.best_match_content_type() serializer = { 'application/json': JSONDictSerializer(), }[content_type] self.wrapped_exc.body = serializer.serialize(fault_data) self.wrapped_exc.content_type = content_type return self.wrapped_exc def __str__(self): return self.wrapped_exc.__str__() class RateLimitFault(webob.exc.HTTPException): """Rate-limited request response.""" def __init__(self, message, details, retry_time): """Initialize new `RateLimitFault` with relevant information.""" hdrs = RateLimitFault._retry_after(retry_time) self.wrapped_exc = webob.exc.HTTPTooManyRequests(headers=hdrs) self.content = { "overLimit": { "code": self.wrapped_exc.status_int, "message": message, "details": details, "retryAfter": hdrs['Retry-After'], }, } @staticmethod def _retry_after(retry_time): delay = int(math.ceil(retry_time - time.time())) retry_after = delay if delay > 0 else 0 headers = {'Retry-After': '%d' % retry_after} return headers @webob.dec.wsgify(RequestClass=Request) def __call__(self, request): """Return the wrapped exception with a serialized body conforming to our error format. """ user_locale = request.best_match_language() content_type = request.best_match_content_type() self.content['overLimit']['message'] = \ i18n.translate(self.content['overLimit']['message'], user_locale) self.content['overLimit']['details'] = \ i18n.translate(self.content['overLimit']['details'], user_locale) serializer = { 'application/json': JSONDictSerializer(), }[content_type] content = serializer.serialize(self.content) self.wrapped_exc.body = content self.wrapped_exc.content_type = content_type return self.wrapped_exc
35.721246
79
0.612034
import functools import inspect import math import time from oslo_log import log as logging from oslo_serialization import jsonutils from oslo_utils import strutils import six import webob from nova.api.openstack import api_version_request as api_version from nova.api.openstack import versioned_method from nova import exception from nova import i18n from nova.i18n import _ from nova.i18n import _LE from nova.i18n import _LI from nova import utils from nova import wsgi LOG = logging.getLogger(__name__) _SUPPORTED_CONTENT_TYPES = ( 'application/json', 'application/vnd.openstack.compute+json', ) _MEDIA_TYPE_MAP = { 'application/vnd.openstack.compute+json': 'json', 'application/json': 'json', } _ROUTES_METHODS = [ 'create', 'delete', 'show', 'update', ] _METHODS_WITH_BODY = [ 'POST', 'PUT', ] DEFAULT_API_VERSION = "2.1" VER_METHOD_ATTR = 'versioned_methods' API_VERSION_REQUEST_HEADER = 'X-OpenStack-Nova-API-Version' ENV_LEGACY_V2 = 'openstack.legacy_v2' def get_supported_content_types(): return _SUPPORTED_CONTENT_TYPES def get_media_map(): return dict(_MEDIA_TYPE_MAP.items()) class Request(wsgi.Request): def __init__(self, *args, **kwargs): super(Request, self).__init__(*args, **kwargs) self._extension_data = {'db_items': {}} if not hasattr(self, 'api_version_request'): self.api_version_request = api_version.APIVersionRequest() def cache_db_items(self, key, items, item_key='id'): db_items = self._extension_data['db_items'].setdefault(key, {}) for item in items: db_items[item[item_key]] = item def get_db_items(self, key): return self._extension_data['db_items'][key] def get_db_item(self, key, item_key): return self.get_db_items(key).get(item_key) def cache_db_instances(self, instances): self.cache_db_items('instances', instances, 'uuid') def cache_db_instance(self, instance): self.cache_db_items('instances', [instance], 'uuid') def get_db_instances(self): return self.get_db_items('instances') def get_db_instance(self, instance_uuid): return self.get_db_item('instances', instance_uuid) def cache_db_flavors(self, flavors): self.cache_db_items('flavors', flavors, 'flavorid') def cache_db_flavor(self, flavor): self.cache_db_items('flavors', [flavor], 'flavorid') def get_db_flavors(self): return self.get_db_items('flavors') def get_db_flavor(self, flavorid): return self.get_db_item('flavors', flavorid) def cache_db_compute_nodes(self, compute_nodes): self.cache_db_items('compute_nodes', compute_nodes, 'id') def cache_db_compute_node(self, compute_node): self.cache_db_items('compute_nodes', [compute_node], 'id') def get_db_compute_nodes(self): return self.get_db_items('compute_nodes') def get_db_compute_node(self, id): return self.get_db_item('compute_nodes', id) def best_match_content_type(self): if 'nova.best_content_type' not in self.environ: content_type = None parts = self.path.rsplit('.', 1) if len(parts) > 1: possible_type = 'application/' + parts[1] if possible_type in get_supported_content_types(): content_type = possible_type if not content_type: content_type = self.accept.best_match( get_supported_content_types()) self.environ['nova.best_content_type'] = (content_type or 'application/json') return self.environ['nova.best_content_type'] def get_content_type(self): if "Content-Type" not in self.headers: return None content_type = self.content_type if not content_type or content_type == 'text/plain': return None if content_type not in get_supported_content_types(): raise exception.InvalidContentType(content_type=content_type) return content_type def best_match_language(self): if not self.accept_language: return None return self.accept_language.best_match( i18n.get_available_languages()) def set_api_version_request(self): if API_VERSION_REQUEST_HEADER in self.headers: hdr_string = self.headers[API_VERSION_REQUEST_HEADER] if hdr_string == 'latest': self.api_version_request = api_version.max_api_version() else: self.api_version_request = api_version.APIVersionRequest( hdr_string) if not self.api_version_request.matches( api_version.min_api_version(), api_version.max_api_version()): raise exception.InvalidGlobalAPIVersion( req_ver=self.api_version_request.get_string(), min_ver=api_version.min_api_version().get_string(), max_ver=api_version.max_api_version().get_string()) else: self.api_version_request = api_version.APIVersionRequest( api_version.DEFAULT_API_VERSION) def set_legacy_v2(self): self.environ[ENV_LEGACY_V2] = True def is_legacy_v2(self): return self.environ.get(ENV_LEGACY_V2, False) class ActionDispatcher(object): def dispatch(self, *args, **kwargs): action = kwargs.pop('action', 'default') action_method = getattr(self, str(action), self.default) return action_method(*args, **kwargs) def default(self, data): raise NotImplementedError() class TextDeserializer(ActionDispatcher): def deserialize(self, datastring, action='default'): return self.dispatch(datastring, action=action) def default(self, datastring): return {} class JSONDeserializer(TextDeserializer): def _from_json(self, datastring): try: return jsonutils.loads(datastring) except ValueError: msg = _("cannot understand JSON") raise exception.MalformedRequestBody(reason=msg) def default(self, datastring): return {'body': self._from_json(datastring)} class DictSerializer(ActionDispatcher): def serialize(self, data, action='default'): return self.dispatch(data, action=action) def default(self, data): return "" class JSONDictSerializer(DictSerializer): def default(self, data): return jsonutils.dumps(data) def serializers(**serializers): def decorator(func): if not hasattr(func, 'wsgi_serializers'): func.wsgi_serializers = {} func.wsgi_serializers.update(serializers) return func return decorator def deserializers(**deserializers): def decorator(func): if not hasattr(func, 'wsgi_deserializers'): func.wsgi_deserializers = {} func.wsgi_deserializers.update(deserializers) return func return decorator def response(code): def decorator(func): func.wsgi_code = code return func return decorator class ResponseObject(object): def __init__(self, obj, code=None, headers=None, **serializers): self.obj = obj self.serializers = serializers self._default_code = 200 self._code = code self._headers = headers or {} self.serializer = None self.media_type = None def __getitem__(self, key): return self._headers[key.lower()] def __setitem__(self, key, value): self._headers[key.lower()] = value def __delitem__(self, key): del self._headers[key.lower()] def _bind_method_serializers(self, meth_serializers): # precedence for mtype, serializer in meth_serializers.items(): self.serializers.setdefault(mtype, serializer) def get_serializer(self, content_type, default_serializers=None): default_serializers = default_serializers or {} try: mtype = get_media_map().get(content_type, content_type) if mtype in self.serializers: return mtype, self.serializers[mtype] else: return mtype, default_serializers[mtype] except (KeyError, TypeError): raise exception.InvalidContentType(content_type=content_type) def preserialize(self, content_type, default_serializers=None): mtype, serializer = self.get_serializer(content_type, default_serializers) self.media_type = mtype self.serializer = serializer() def attach(self, **kwargs): if self.media_type in kwargs: self.serializer.attach(kwargs[self.media_type]) def serialize(self, request, content_type, default_serializers=None): if self.serializer: serializer = self.serializer else: _mtype, _serializer = self.get_serializer(content_type, default_serializers) serializer = _serializer() response = webob.Response() response.status_int = self.code for hdr, value in self._headers.items(): response.headers[hdr] = utils.utf8(str(value)) response.headers['Content-Type'] = utils.utf8(content_type) if self.obj is not None: response.body = serializer.serialize(self.obj) return response @property def code(self): return self._code or self._default_code @property def headers(self): return self._headers.copy() def action_peek_json(body): try: decoded = jsonutils.loads(body) except ValueError: msg = _("cannot understand JSON") raise exception.MalformedRequestBody(reason=msg) # Make sure there's exactly one key... if len(decoded) != 1: msg = _("too many body keys") raise exception.MalformedRequestBody(reason=msg) return decoded.keys()[0] class ResourceExceptionHandler(object): def __enter__(self): return None def __exit__(self, ex_type, ex_value, ex_traceback): if not ex_value: return True if isinstance(ex_value, exception.Forbidden): raise Fault(webob.exc.HTTPForbidden( explanation=ex_value.format_message())) elif isinstance(ex_value, exception.VersionNotFoundForAPIMethod): raise elif isinstance(ex_value, exception.Invalid): raise Fault(exception.ConvertedException( code=ex_value.code, explanation=ex_value.format_message())) elif isinstance(ex_value, TypeError): exc_info = (ex_type, ex_value, ex_traceback) LOG.error(_LE('Exception handling resource: %s'), ex_value, exc_info=exc_info) raise Fault(webob.exc.HTTPBadRequest()) elif isinstance(ex_value, Fault): LOG.info(_LI("Fault thrown: %s"), ex_value) raise ex_value elif isinstance(ex_value, webob.exc.HTTPException): LOG.info(_LI("HTTP exception thrown: %s"), ex_value) raise Fault(ex_value) return False class Resource(wsgi.Application): support_api_request_version = False def __init__(self, controller, action_peek=None, inherits=None, **deserializers): self.controller = controller default_deserializers = dict(json=JSONDeserializer) default_deserializers.update(deserializers) self.default_deserializers = default_deserializers self.default_serializers = dict(json=JSONDictSerializer) self.action_peek = dict(json=action_peek_json) self.action_peek.update(action_peek or {}) # Copy over the actions dictionary self.wsgi_actions = {} if controller: self.register_actions(controller) # Save a mapping of extensions self.wsgi_extensions = {} self.wsgi_action_extensions = {} self.inherits = inherits def register_actions(self, controller): actions = getattr(controller, 'wsgi_actions', {}) for key, method_name in actions.items(): self.wsgi_actions[key] = getattr(controller, method_name) def register_extensions(self, controller): extensions = getattr(controller, 'wsgi_extensions', []) for method_name, action_name in extensions: # Look up the extending method extension = getattr(controller, method_name) if action_name: # Extending an action... if action_name not in self.wsgi_action_extensions: self.wsgi_action_extensions[action_name] = [] self.wsgi_action_extensions[action_name].append(extension) else: # Extending a regular method if method_name not in self.wsgi_extensions: self.wsgi_extensions[method_name] = [] self.wsgi_extensions[method_name].append(extension) def get_action_args(self, request_environment): # NOTE(Vek): Check for get_action_args() override in the # controller if hasattr(self.controller, 'get_action_args'): return self.controller.get_action_args(request_environment) try: args = request_environment['wsgiorg.routing_args'][1].copy() except (KeyError, IndexError, AttributeError): return {} try: del args['controller'] except KeyError: pass try: del args['format'] except KeyError: pass return args def get_body(self, request): try: content_type = request.get_content_type() except exception.InvalidContentType: LOG.debug("Unrecognized Content-Type provided in request") return None, '' return content_type, request.body def deserialize(self, meth, content_type, body): meth_deserializers = getattr(meth, 'wsgi_deserializers', {}) try: mtype = get_media_map().get(content_type, content_type) if mtype in meth_deserializers: deserializer = meth_deserializers[mtype] else: deserializer = self.default_deserializers[mtype] except (KeyError, TypeError): raise exception.InvalidContentType(content_type=content_type) if (hasattr(deserializer, 'want_controller') and deserializer.want_controller): return deserializer(self.controller).deserialize(body) else: return deserializer().deserialize(body) def pre_process_extensions(self, extensions, request, action_args): # List of callables for post-processing extensions post = [] for ext in extensions: if inspect.isgeneratorfunction(ext): response = None # If it's a generator function, the part before the try: with ResourceExceptionHandler(): gen = ext(req=request, **action_args) response = next(gen) except Fault as ex: response = ex if response: return response, [] post.append(gen) else: post.append(ext) return None, reversed(post) def post_process_extensions(self, extensions, resp_obj, request, action_args): for ext in extensions: response = None if inspect.isgenerator(ext): # processing try: with ResourceExceptionHandler(): response = ext.send(resp_obj) except StopIteration: # Normal exit of generator continue except Fault as ex: response = ex else: # Regular functions get post-processing... try: with ResourceExceptionHandler(): response = ext(req=request, resp_obj=resp_obj, **action_args) except exception.VersionNotFoundForAPIMethod: # If an attached extension (@wsgi.extends) for the # method has no version match its not an error. We # just don't run the extends code continue except Fault as ex: response = ex if response: return response return None def _should_have_body(self, request): return request.method in _METHODS_WITH_BODY @webob.dec.wsgify(RequestClass=Request) def __call__(self, request): if self.support_api_request_version: try: request.set_api_version_request() except exception.InvalidAPIVersionString as e: return Fault(webob.exc.HTTPBadRequest( explanation=e.format_message())) except exception.InvalidGlobalAPIVersion as e: return Fault(webob.exc.HTTPNotAcceptable( explanation=e.format_message())) action_args = self.get_action_args(request.environ) action = action_args.pop('action', None) content_type, body = self.get_body(request) accept = request.best_match_content_type() return self._process_stack(request, action, action_args, content_type, body, accept) def _process_stack(self, request, action, action_args, content_type, body, accept): try: meth, extensions = self.get_method(request, action, content_type, body) except (AttributeError, TypeError): return Fault(webob.exc.HTTPNotFound()) except KeyError as ex: msg = _("There is no such action: %s") % ex.args[0] return Fault(webob.exc.HTTPBadRequest(explanation=msg)) except exception.MalformedRequestBody: msg = _("Malformed request body") return Fault(webob.exc.HTTPBadRequest(explanation=msg)) if body: msg = _("Action: '%(action)s', calling method: %(meth)s, body: " "%(body)s") % {'action': action, 'body': six.text_type(body, 'utf-8'), 'meth': str(meth)} LOG.debug(strutils.mask_password(msg)) else: LOG.debug("Calling method '%(meth)s'", {'meth': str(meth)}) try: contents = {} if self._should_have_body(request): if request.content_length == 0: contents = {'body': None} else: contents = self.deserialize(meth, content_type, body) except exception.InvalidContentType: msg = _("Unsupported Content-Type") return Fault(webob.exc.HTTPBadRequest(explanation=msg)) except exception.MalformedRequestBody: msg = _("Malformed request body") return Fault(webob.exc.HTTPBadRequest(explanation=msg)) action_args.update(contents) project_id = action_args.pop("project_id", None) context = request.environ.get('nova.context') if (context and project_id and (project_id != context.project_id)): msg = _("Malformed request URL: URL's project_id '%(project_id)s'" " doesn't match Context's project_id" " '%(context_project_id)s'") % \ {'project_id': project_id, 'context_project_id': context.project_id} return Fault(webob.exc.HTTPBadRequest(explanation=msg)) # Run pre-processing extensions response, post = self.pre_process_extensions(extensions, request, action_args) if not response: try: with ResourceExceptionHandler(): action_result = self.dispatch(meth, request, action_args) except Fault as ex: response = ex if not response: # No exceptions; convert action_result into a # ResponseObject resp_obj = None if type(action_result) is dict or action_result is None: resp_obj = ResponseObject(action_result) elif isinstance(action_result, ResponseObject): resp_obj = action_result else: response = action_result # Run post-processing extensions if resp_obj: # Do a preserialize to set up the response object serializers = getattr(meth, 'wsgi_serializers', {}) resp_obj._bind_method_serializers(serializers) if hasattr(meth, 'wsgi_code'): resp_obj._default_code = meth.wsgi_code resp_obj.preserialize(accept, self.default_serializers) # Process post-processing extensions response = self.post_process_extensions(post, resp_obj, request, action_args) if resp_obj and not response: response = resp_obj.serialize(request, accept, self.default_serializers) if hasattr(response, 'headers'): for hdr, val in response.headers.items(): # Headers must be utf-8 strings response.headers[hdr] = utils.utf8(str(val)) if not request.api_version_request.is_null(): response.headers[API_VERSION_REQUEST_HEADER] = \ request.api_version_request.get_string() response.headers['Vary'] = API_VERSION_REQUEST_HEADER return response def get_method(self, request, action, content_type, body): meth, extensions = self._get_method(request, action, content_type, body) if self.inherits: _meth, parent_ext = self.inherits.get_method(request, action, content_type, body) extensions.extend(parent_ext) return meth, extensions def _get_method(self, request, action, content_type, body): # Look up the method try: if not self.controller: meth = getattr(self, action) else: meth = getattr(self.controller, action) except AttributeError: if (not self.wsgi_actions or action not in _ROUTES_METHODS + ['action']): # Propagate the error raise else: return meth, self.wsgi_extensions.get(action, []) if action == 'action': # OK, it's an action; figure out which action... mtype = get_media_map().get(content_type) action_name = self.action_peek[mtype](body) else: action_name = action return (self.wsgi_actions[action_name], self.wsgi_action_extensions.get(action_name, [])) def dispatch(self, method, request, action_args): try: return method(req=request, **action_args) except exception.VersionNotFoundForAPIMethod: # about the exception to the user so it looks as if # the method is simply not implemented. return Fault(webob.exc.HTTPNotFound()) class ResourceV21(Resource): support_api_request_version = True def action(name): def decorator(func): func.wsgi_action = name return func return decorator def extends(*args, **kwargs): def decorator(func): # Store enough information to find what we're extending func.wsgi_extends = (func.__name__, kwargs.get('action')) return func if args: return decorator(*args) return decorator class ControllerMetaclass(type): def __new__(mcs, name, bases, cls_dict): actions = {} extensions = [] versioned_methods = None for base in bases: actions.update(getattr(base, 'wsgi_actions', {})) if base.__name__ == "Controller": # require naming explicitly what method is being versioned as # it can be implicit based on the method decorated. It is a bit # ugly. if VER_METHOD_ATTR in base.__dict__: versioned_methods = getattr(base, VER_METHOD_ATTR) delattr(base, VER_METHOD_ATTR) for key, value in cls_dict.items(): if not callable(value): continue if getattr(value, 'wsgi_action', None): actions[value.wsgi_action] = key elif getattr(value, 'wsgi_extends', None): extensions.append(value.wsgi_extends) # Add the actions and extensions to the class dict cls_dict['wsgi_actions'] = actions cls_dict['wsgi_extensions'] = extensions if versioned_methods: cls_dict[VER_METHOD_ATTR] = versioned_methods return super(ControllerMetaclass, mcs).__new__(mcs, name, bases, cls_dict) @six.add_metaclass(ControllerMetaclass) class Controller(object): _view_builder_class = None def __init__(self, view_builder=None): if view_builder: self._view_builder = view_builder elif self._view_builder_class: self._view_builder = self._view_builder_class() else: self._view_builder = None def __getattribute__(self, key): def version_select(*args, **kwargs): # The first arg to all versioned methods is always the request # object. The version for the request is attached to the # request object if len(args) == 0: ver = kwargs['req'].api_version_request else: ver = args[0].api_version_request func_list = self.versioned_methods[key] for func in func_list: if ver.matches(func.start_version, func.end_version): # Update the version_select wrapper function so # other decorator attributes like wsgi.response # are still respected. functools.update_wrapper(version_select, func.func) return func.func(self, *args, **kwargs) # No version match raise exception.VersionNotFoundForAPIMethod(version=ver) try: version_meth_dict = object.__getattribute__(self, VER_METHOD_ATTR) except AttributeError: # No versioning on this class return object.__getattribute__(self, key) if version_meth_dict and \ key in object.__getattribute__(self, VER_METHOD_ATTR): return version_select return object.__getattribute__(self, key) # NOTE(cyeoh): This decorator MUST appear first (the outermost # decorator) on an API method for it to work correctly @classmethod def api_version(cls, min_ver, max_ver=None): def decorator(f): obj_min_ver = api_version.APIVersionRequest(min_ver) if max_ver: obj_max_ver = api_version.APIVersionRequest(max_ver) else: obj_max_ver = api_version.APIVersionRequest() # Add to list of versioned methods registered func_name = f.__name__ new_func = versioned_method.VersionedMethod( func_name, obj_min_ver, obj_max_ver, f) func_dict = getattr(cls, VER_METHOD_ATTR, {}) if not func_dict: setattr(cls, VER_METHOD_ATTR, func_dict) func_list = func_dict.get(func_name, []) if not func_list: func_dict[func_name] = func_list func_list.append(new_func) # Ensure the list is sorted by minimum version (reversed) # so later when we work through the list in order we find # the method which has the latest version which supports # the version requested. # TODO(cyeoh): Add check to ensure that there are no overlapping # ranges of valid versions as that is amibiguous func_list.sort(key=lambda f: f.start_version, reverse=True) return f return decorator @staticmethod def is_valid_body(body, entity_name): if not (body and entity_name in body): return False def is_dict(d): try: d.get(None) return True except AttributeError: return False return is_dict(body[entity_name]) class Fault(webob.exc.HTTPException): _fault_names = { 400: "badRequest", 401: "unauthorized", 403: "forbidden", 404: "itemNotFound", 405: "badMethod", 409: "conflictingRequest", 413: "overLimit", 415: "badMediaType", 429: "overLimit", 501: "notImplemented", 503: "serviceUnavailable"} def __init__(self, exception): self.wrapped_exc = exception for key, value in self.wrapped_exc.headers.items(): self.wrapped_exc.headers[key] = str(value) self.status_int = exception.status_int @webob.dec.wsgify(RequestClass=Request) def __call__(self, req): user_locale = req.best_match_language() # Replace the body with fault details. code = self.wrapped_exc.status_int fault_name = self._fault_names.get(code, "computeFault") explanation = self.wrapped_exc.explanation LOG.debug("Returning %(code)s to user: %(explanation)s", {'code': code, 'explanation': explanation}) explanation = i18n.translate(explanation, user_locale) fault_data = { fault_name: { 'code': code, 'message': explanation}} if code == 413 or code == 429: retry = self.wrapped_exc.headers.get('Retry-After', None) if retry: fault_data[fault_name]['retryAfter'] = retry if not req.api_version_request.is_null(): self.wrapped_exc.headers[API_VERSION_REQUEST_HEADER] = \ req.api_version_request.get_string() self.wrapped_exc.headers['Vary'] = \ API_VERSION_REQUEST_HEADER content_type = req.best_match_content_type() serializer = { 'application/json': JSONDictSerializer(), }[content_type] self.wrapped_exc.body = serializer.serialize(fault_data) self.wrapped_exc.content_type = content_type return self.wrapped_exc def __str__(self): return self.wrapped_exc.__str__() class RateLimitFault(webob.exc.HTTPException): def __init__(self, message, details, retry_time): hdrs = RateLimitFault._retry_after(retry_time) self.wrapped_exc = webob.exc.HTTPTooManyRequests(headers=hdrs) self.content = { "overLimit": { "code": self.wrapped_exc.status_int, "message": message, "details": details, "retryAfter": hdrs['Retry-After'], }, } @staticmethod def _retry_after(retry_time): delay = int(math.ceil(retry_time - time.time())) retry_after = delay if delay > 0 else 0 headers = {'Retry-After': '%d' % retry_after} return headers @webob.dec.wsgify(RequestClass=Request) def __call__(self, request): user_locale = request.best_match_language() content_type = request.best_match_content_type() self.content['overLimit']['message'] = \ i18n.translate(self.content['overLimit']['message'], user_locale) self.content['overLimit']['details'] = \ i18n.translate(self.content['overLimit']['details'], user_locale) serializer = { 'application/json': JSONDictSerializer(), }[content_type] content = serializer.serialize(self.content) self.wrapped_exc.body = content self.wrapped_exc.content_type = content_type return self.wrapped_exc
true
true
1c4531d80c6d31acc1cfb7c059317df37a5ce0ad
896
py
Python
nally/core/layers/raw_packet.py
FreibergVlad/port-scanner
432dd9a07cb5118f3a0722fe4908434c76191b3b
[ "MIT" ]
null
null
null
nally/core/layers/raw_packet.py
FreibergVlad/port-scanner
432dd9a07cb5118f3a0722fe4908434c76191b3b
[ "MIT" ]
null
null
null
nally/core/layers/raw_packet.py
FreibergVlad/port-scanner
432dd9a07cb5118f3a0722fe4908434c76191b3b
[ "MIT" ]
null
null
null
from nally.core.layers.packet import Packet class RawPacket(Packet): """ Raw implementation of Packet interface. Actually, just a holder of raw bytes """ def __init__(self, raw_packet): super().__init__() self.__raw_packet = bytes(raw_packet) def to_bytes(self): return self.__raw_packet @staticmethod def from_bytes(bytes_packet: bytes): return RawPacket(bytes_packet) def is_response(self, packet) -> bool: return True @property def raw_payload(self) -> bytes: return self.__raw_packet @Packet.upper_layer.setter def upper_layer(self, upper_layer): raise NotImplementedError("Raw packet doesn't support payload") def __eq__(self, other: object) -> bool: if isinstance(other, RawPacket): return self.raw_payload == other.raw_payload return False
24.888889
71
0.66183
from nally.core.layers.packet import Packet class RawPacket(Packet): def __init__(self, raw_packet): super().__init__() self.__raw_packet = bytes(raw_packet) def to_bytes(self): return self.__raw_packet @staticmethod def from_bytes(bytes_packet: bytes): return RawPacket(bytes_packet) def is_response(self, packet) -> bool: return True @property def raw_payload(self) -> bytes: return self.__raw_packet @Packet.upper_layer.setter def upper_layer(self, upper_layer): raise NotImplementedError("Raw packet doesn't support payload") def __eq__(self, other: object) -> bool: if isinstance(other, RawPacket): return self.raw_payload == other.raw_payload return False
true
true
1c453226bdc6a0908183e8c5c8f5eb83db899edf
17,813
py
Python
ProjectFiles/bin/Release/2.80/scripts/addons/add_advanced_objects_panels/__init__.py
BlazesRus/Bforartists
126bdd9e47cc984fd97ba5299bfb92ec5278e754
[ "Naumen", "Condor-1.1", "MS-PL" ]
1
2019-07-08T15:51:14.000Z
2019-07-08T15:51:14.000Z
ProjectFiles/bin/Release/2.80/scripts/addons/add_advanced_objects_panels/__init__.py
BlazesRus/Bforartists
126bdd9e47cc984fd97ba5299bfb92ec5278e754
[ "Naumen", "Condor-1.1", "MS-PL" ]
null
null
null
ProjectFiles/bin/Release/2.80/scripts/addons/add_advanced_objects_panels/__init__.py
BlazesRus/Bforartists
126bdd9e47cc984fd97ba5299bfb92ec5278e754
[ "Naumen", "Condor-1.1", "MS-PL" ]
null
null
null
# ##### BEGIN GPL LICENSE BLOCK ##### # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU General Public License # as published by the Free Software Foundation; either version 2 # of the License, or (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software Foundation, # Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. # # ##### END GPL LICENSE BLOCK ##### # Contributed to by: # meta-androcto, Bill Currie, Jorge Hernandez - Melenedez Jacob Morris, Oscurart # # Rebellion, Antonis Karvelas, Eleanor Howick, lijenstina, Daniel Schalla, Domlysz # # Unnikrishnan(kodemax), Florian Meyer, Omar ahmed, Brian Hinton (Nichod), liero # # Atom, Dannyboy, Mano-Wii, Kursad Karatas, teldredge, Phil Cote # bl_info = { "name": "Add Advanced Object Panels", "author": "meta-androcto", "version": (1, 1, 5), "blender": (2, 7, 7), "description": "Individual Create Panel Activation List", "location": "Addons Preferences", "warning": "", "wiki_url": "https://wiki.blender.org/index.php/Extensions:2.6" "/Py/Scripts/Object/Add_Advanced", "category": "Object" } import bpy from bpy.types import ( AddonPreferences, PropertyGroup, ) from bpy.props import ( BoolProperty, BoolVectorProperty, EnumProperty, FloatProperty, FloatVectorProperty, IntProperty, StringProperty, PointerProperty, ) sub_modules_names = ( "drop_to_ground", "object_laplace_lightning", "object_mangle_tools", "unfold_transition", "delaunay_voronoi", "oscurart_constellation", ) sub_modules = [__import__(__package__ + "." + submod, {}, {}, submod) for submod in sub_modules_names] sub_modules.sort(key=lambda mod: (mod.bl_info['category'], mod.bl_info['name'])) # Add-ons Preferences def _get_pref_class(mod): import inspect for obj in vars(mod).values(): if inspect.isclass(obj) and issubclass(obj, PropertyGroup): if hasattr(obj, 'bl_idname') and obj.bl_idname == mod.__name__: return obj def get_addon_preferences(name=''): """Acquisition and registration""" addons = bpy.context.preferences.addons if __name__ not in addons: # wm.read_factory_settings() return None addon_prefs = addons[__name__].preferences if name: if not hasattr(addon_prefs, name): for mod in sub_modules: if mod.__name__.split('.')[-1] == name: cls = _get_pref_class(mod) if cls: prop = PointerProperty(type=cls) setattr(AdvancedObjPreferences1, name, prop) bpy.utils.unregister_class(AdvancedObjPreferences1) bpy.utils.register_class(AdvancedObjPreferences1) return getattr(addon_prefs, name, None) else: return addon_prefs def register_submodule(mod): if not hasattr(mod, '__addon_enabled__'): mod.__addon_enabled__ = False if not mod.__addon_enabled__: mod.register() mod.__addon_enabled__ = True def unregister_submodule(mod): if mod.__addon_enabled__: mod.unregister() mod.__addon_enabled__ = False prefs = get_addon_preferences() name = mod.__name__.split('.')[-1] if hasattr(AdvancedObjPreferences1, name): delattr(AdvancedObjPreferences1, name) if prefs: bpy.utils.unregister_class(AdvancedObjPreferences1) bpy.utils.register_class(AdvancedObjPreferences1) if name in prefs: del prefs[name] def enable_all_modules(self, context): for mod in sub_modules: mod_name = mod.__name__.split('.')[-1] setattr(self, 'use_' + mod_name, False) if not mod.__addon_enabled__: setattr(self, 'use_' + mod_name, True) mod.__addon_enabled__ = True return None def disable_all_modules(self, context): for mod in sub_modules: mod_name = mod.__name__.split('.')[-1] if mod.__addon_enabled__: setattr(self, 'use_' + mod_name, False) mod.__addon_enabled__ = False return None class AdvancedObjPreferences1(AddonPreferences): bl_idname = __name__ enable_all = BoolProperty( name="Enable all", description="Enable all Advanced Objects' Panels", default=False, update=enable_all_modules ) disable_all = BoolProperty( name="Disable all", description="Disable all Advanced Objects' Panels", default=False, update=disable_all_modules ) def draw(self, context): layout = self.layout split = layout.split(percentage=0.5, align=True) row = split.row() row.alignment = "LEFT" sub_box = row.box() sub_box.prop(self, "enable_all", emboss=False, icon="VISIBLE_IPO_ON", icon_only=True) row.label("Enable All") row = split.row() row.alignment = "RIGHT" row.label("Disable All") sub_box = row.box() sub_box.prop(self, "disable_all", emboss=False, icon="VISIBLE_IPO_OFF", icon_only=True) for mod in sub_modules: mod_name = mod.__name__.split('.')[-1] info = mod.bl_info column = layout.column() box = column.box() # first stage expand = getattr(self, 'show_expanded_' + mod_name) icon = 'TRIA_DOWN' if expand else 'TRIA_RIGHT' col = box.column() row = col.row() sub = row.row() sub.context_pointer_set('addon_prefs', self) op = sub.operator('wm.context_toggle', text='', icon=icon, emboss=False) op.data_path = 'addon_prefs.show_expanded_' + mod_name sub.label('{}: {}'.format(info['category'], info['name'])) sub = row.row() sub.alignment = 'RIGHT' if info.get('warning'): sub.label('', icon='ERROR') sub.prop(self, 'use_' + mod_name, text='') # The second stage if expand: if info.get('description'): split = col.row().split(percentage=0.15) split.label('Description:') split.label(info['description']) if info.get('location'): split = col.row().split(percentage=0.15) split.label('Location:') split.label(info['location']) if info.get('author'): split = col.row().split(percentage=0.15) split.label('Author:') split.label(info['author']) if info.get('version'): split = col.row().split(percentage=0.15) split.label('Version:') split.label('.'.join(str(x) for x in info['version']), translate=False) if info.get('warning'): split = col.row().split(percentage=0.15) split.label('Warning:') split.label(' ' + info['warning'], icon='ERROR') tot_row = int(bool(info.get('wiki_url'))) if tot_row: split = col.row().split(percentage=0.15) split.label(text='Internet:') if info.get('wiki_url'): op = split.operator('wm.url_open', text='Documentation', icon='HELP') op.url = info.get('wiki_url') for i in range(4 - tot_row): split.separator() # Details and settings if getattr(self, 'use_' + mod_name): prefs = get_addon_preferences(mod_name) if prefs and hasattr(prefs, 'draw'): box = box.column() prefs.layout = box try: prefs.draw(context) except: import traceback traceback.print_exc() box.label(text="Error (see console)", icon="ERROR") del prefs.layout row = layout.row() row.label(text="End of Advanced Object Panels Activations", icon="FILE_PARENT") for mod in sub_modules: info = mod.bl_info mod_name = mod.__name__.split('.')[-1] def gen_update(mod): def update(self, context): if getattr(self, 'use_' + mod.__name__.split('.')[-1]): if not mod.__addon_enabled__: register_submodule(mod) else: if mod.__addon_enabled__: unregister_submodule(mod) return update prop = BoolProperty( name=info['name'], description=info.get('description', ''), update=gen_update(mod), ) setattr(AdvancedObjPreferences1, 'use_' + mod_name, prop) prop = BoolProperty() setattr(AdvancedObjPreferences1, 'show_expanded_' + mod_name, prop) class AdvancedObjProperties1(PropertyGroup): # object_laplace_lighting props ORIGIN = FloatVectorProperty( name="Origin charge" ) GROUNDZ = IntProperty( name="Ground Z coordinate" ) HORDER = IntProperty( name="Secondary paths orders", default=1 ) # object_laplace_lighting UI props TSTEPS = IntProperty( name="Iterations", default=350, description="Number of cells to create\n" "Will end early if hits ground plane or cloud" ) GSCALE = FloatProperty( name="Grid unit size", default=0.12, description="scale of cells, .25 = 4 cells per blenderUnit" ) BIGVAR = FloatProperty( name="Straightness", default=6.3, description="Straightness/branchiness of bolt, \n" "<2 is mush, >12 is staight line, 6.3 is good" ) GROUNDBOOL = BoolProperty( name="Use Ground object", description="Use ground plane or not", default=True ) GROUNDC = IntProperty( name="Ground charge", default=-250, description="Charge of the ground plane" ) CLOUDBOOL = BoolProperty( name="Use Cloud object", default=False, description="Use cloud object - attracts and terminates like ground but\n" "any obj instead of z plane\n" "Can slow down loop if obj is large, overrides ground" ) CLOUDC = IntProperty( name="Cloud charge", default=-1, description="Charge of a cell in cloud object\n" "(so total charge also depends on obj size)" ) VMMESH = BoolProperty( name="Multi mesh", default=True, description="Output to multi-meshes for different materials on main/sec/side branches" ) VSMESH = BoolProperty( name="Single mesh", default=False, description="Output to single mesh for using build modifier and particles for effects" ) VCUBE = BoolProperty( name="Cubes", default=False, description="CTRL-J after run to JOIN\n" "Outputs a bunch of cube objects, mostly for testing" ) VVOX = BoolProperty( name="Voxel (experimental)", default=False, description="Output to a voxel file to bpy.data.filepath\FSLGvoxels.raw\n" "(doesn't work well right now)" ) IBOOL = BoolProperty( name="Use Insulator object", default=False, description="Use insulator mesh object to prevent growth of bolt in areas" ) OOB = StringProperty( name="Select", default="", description="Origin of bolt, can be an Empty\n" "if object is a mesh will use all verts as charges") GOB = StringProperty( name="Select", default="", description="Object to use as ground plane, uses z coord only" ) COB = StringProperty( name="Select", default="", description="Object to use as cloud, best to use a cube" ) IOB = StringProperty( name="Select", default="", description="Object to use as insulator, 'voxelized'\n" "before generating bolt (can be slow)" ) # object_mangle_tools properties mangle_constraint_vector = BoolVectorProperty( name="Mangle Constraint", default=(True, True, True), subtype='XYZ', description="Constrains Mangle Direction" ) mangle_random_magnitude = IntProperty( name="Mangle Severity", default=5, min=1, max=30, description="Severity of mangling" ) mangle_name = StringProperty( name="Shape Key Name", default="mangle", description="Name given for mangled shape keys" ) # unfold_transition properties unfold_arm_name = StringProperty( default="" ) unfold_modo = EnumProperty( name="", items=[("cursor", "3D Cursor", "Use the Distance to 3D Cursor"), ("weight", "Weight Map", "Use a Painted Weight map"), ("index", "Mesh Indices", "Use Faces and Vertices index")], description="How to Sort Bones for animation", default="cursor" ) unfold_flip = BoolProperty( name="Flipping Faces", default=False, description="Rotate faces around the Center and skip Scaling - " "keep checked for both operators" ) unfold_fold_duration = IntProperty( name="Total Time", min=5, soft_min=25, max=10000, soft_max=2500, default=200, description="Total animation length" ) unfold_sca_time = IntProperty( name="Scale Time", min=1, max=5000, soft_max=500, default=10, description="Faces scaling time" ) unfold_rot_time = IntProperty( name="Rotation Time", min=1, soft_min=5, max=5000, soft_max=500, default=15, description="Faces rotation time" ) unfold_rot_max = IntProperty( name="Angle", min=-180, max=180, default=135, description="Faces rotation angle" ) unfold_fold_noise = IntProperty( name="Noise", min=0, max=500, soft_max=50, default=0, description="Offset some faces animation" ) unfold_bounce = FloatProperty( name="Bounce", min=0, max=10, soft_max=2.5, default=0, description="Add some bounce to rotation" ) unfold_from_point = BoolProperty( name="Point", default=False, description="Scale faces from a Point instead of from an Edge" ) unfold_wiggle_rot = BoolProperty( name="Wiggle", default=False, description="Use all Axis + Random Rotation instead of X Aligned" ) # oscurart_constellation constellation_limit = FloatProperty( name="Initial Threshold", description="Edges will be created only if the distance\n" "between vertices is smaller than this value\n" "This is a starting value on Operator Invoke", default=2, min=0 ) # Class list classes = ( AdvancedObjPreferences1, AdvancedObjProperties1, ) def register(): for cls in classes: bpy.utils.register_class(cls) bpy.types.Scene.advanced_objects1 = PointerProperty( type=AdvancedObjProperties1 ) prefs = get_addon_preferences() for mod in sub_modules: if not hasattr(mod, '__addon_enabled__'): mod.__addon_enabled__ = False name = mod.__name__.split('.')[-1] if getattr(prefs, 'use_' + name): register_submodule(mod) def unregister(): for mod in sub_modules: if mod.__addon_enabled__: unregister_submodule(mod) del bpy.types.Scene.advanced_objects1 for cls in reversed(classes): bpy.utils.unregister_class(cls) if __name__ == "__main__": register()
34.521318
102
0.547016
"/Py/Scripts/Object/Add_Advanced", "category": "Object" } import bpy from bpy.types import ( AddonPreferences, PropertyGroup, ) from bpy.props import ( BoolProperty, BoolVectorProperty, EnumProperty, FloatProperty, FloatVectorProperty, IntProperty, StringProperty, PointerProperty, ) sub_modules_names = ( "drop_to_ground", "object_laplace_lightning", "object_mangle_tools", "unfold_transition", "delaunay_voronoi", "oscurart_constellation", ) sub_modules = [__import__(__package__ + "." + submod, {}, {}, submod) for submod in sub_modules_names] sub_modules.sort(key=lambda mod: (mod.bl_info['category'], mod.bl_info['name'])) def _get_pref_class(mod): import inspect for obj in vars(mod).values(): if inspect.isclass(obj) and issubclass(obj, PropertyGroup): if hasattr(obj, 'bl_idname') and obj.bl_idname == mod.__name__: return obj def get_addon_preferences(name=''): addons = bpy.context.preferences.addons if __name__ not in addons: return None addon_prefs = addons[__name__].preferences if name: if not hasattr(addon_prefs, name): for mod in sub_modules: if mod.__name__.split('.')[-1] == name: cls = _get_pref_class(mod) if cls: prop = PointerProperty(type=cls) setattr(AdvancedObjPreferences1, name, prop) bpy.utils.unregister_class(AdvancedObjPreferences1) bpy.utils.register_class(AdvancedObjPreferences1) return getattr(addon_prefs, name, None) else: return addon_prefs def register_submodule(mod): if not hasattr(mod, '__addon_enabled__'): mod.__addon_enabled__ = False if not mod.__addon_enabled__: mod.register() mod.__addon_enabled__ = True def unregister_submodule(mod): if mod.__addon_enabled__: mod.unregister() mod.__addon_enabled__ = False prefs = get_addon_preferences() name = mod.__name__.split('.')[-1] if hasattr(AdvancedObjPreferences1, name): delattr(AdvancedObjPreferences1, name) if prefs: bpy.utils.unregister_class(AdvancedObjPreferences1) bpy.utils.register_class(AdvancedObjPreferences1) if name in prefs: del prefs[name] def enable_all_modules(self, context): for mod in sub_modules: mod_name = mod.__name__.split('.')[-1] setattr(self, 'use_' + mod_name, False) if not mod.__addon_enabled__: setattr(self, 'use_' + mod_name, True) mod.__addon_enabled__ = True return None def disable_all_modules(self, context): for mod in sub_modules: mod_name = mod.__name__.split('.')[-1] if mod.__addon_enabled__: setattr(self, 'use_' + mod_name, False) mod.__addon_enabled__ = False return None class AdvancedObjPreferences1(AddonPreferences): bl_idname = __name__ enable_all = BoolProperty( name="Enable all", description="Enable all Advanced Objects' Panels", default=False, update=enable_all_modules ) disable_all = BoolProperty( name="Disable all", description="Disable all Advanced Objects' Panels", default=False, update=disable_all_modules ) def draw(self, context): layout = self.layout split = layout.split(percentage=0.5, align=True) row = split.row() row.alignment = "LEFT" sub_box = row.box() sub_box.prop(self, "enable_all", emboss=False, icon="VISIBLE_IPO_ON", icon_only=True) row.label("Enable All") row = split.row() row.alignment = "RIGHT" row.label("Disable All") sub_box = row.box() sub_box.prop(self, "disable_all", emboss=False, icon="VISIBLE_IPO_OFF", icon_only=True) for mod in sub_modules: mod_name = mod.__name__.split('.')[-1] info = mod.bl_info column = layout.column() box = column.box() expand = getattr(self, 'show_expanded_' + mod_name) icon = 'TRIA_DOWN' if expand else 'TRIA_RIGHT' col = box.column() row = col.row() sub = row.row() sub.context_pointer_set('addon_prefs', self) op = sub.operator('wm.context_toggle', text='', icon=icon, emboss=False) op.data_path = 'addon_prefs.show_expanded_' + mod_name sub.label('{}: {}'.format(info['category'], info['name'])) sub = row.row() sub.alignment = 'RIGHT' if info.get('warning'): sub.label('', icon='ERROR') sub.prop(self, 'use_' + mod_name, text='') if expand: if info.get('description'): split = col.row().split(percentage=0.15) split.label('Description:') split.label(info['description']) if info.get('location'): split = col.row().split(percentage=0.15) split.label('Location:') split.label(info['location']) if info.get('author'): split = col.row().split(percentage=0.15) split.label('Author:') split.label(info['author']) if info.get('version'): split = col.row().split(percentage=0.15) split.label('Version:') split.label('.'.join(str(x) for x in info['version']), translate=False) if info.get('warning'): split = col.row().split(percentage=0.15) split.label('Warning:') split.label(' ' + info['warning'], icon='ERROR') tot_row = int(bool(info.get('wiki_url'))) if tot_row: split = col.row().split(percentage=0.15) split.label(text='Internet:') if info.get('wiki_url'): op = split.operator('wm.url_open', text='Documentation', icon='HELP') op.url = info.get('wiki_url') for i in range(4 - tot_row): split.separator() if getattr(self, 'use_' + mod_name): prefs = get_addon_preferences(mod_name) if prefs and hasattr(prefs, 'draw'): box = box.column() prefs.layout = box try: prefs.draw(context) except: import traceback traceback.print_exc() box.label(text="Error (see console)", icon="ERROR") del prefs.layout row = layout.row() row.label(text="End of Advanced Object Panels Activations", icon="FILE_PARENT") for mod in sub_modules: info = mod.bl_info mod_name = mod.__name__.split('.')[-1] def gen_update(mod): def update(self, context): if getattr(self, 'use_' + mod.__name__.split('.')[-1]): if not mod.__addon_enabled__: register_submodule(mod) else: if mod.__addon_enabled__: unregister_submodule(mod) return update prop = BoolProperty( name=info['name'], description=info.get('description', ''), update=gen_update(mod), ) setattr(AdvancedObjPreferences1, 'use_' + mod_name, prop) prop = BoolProperty() setattr(AdvancedObjPreferences1, 'show_expanded_' + mod_name, prop) class AdvancedObjProperties1(PropertyGroup): ORIGIN = FloatVectorProperty( name="Origin charge" ) GROUNDZ = IntProperty( name="Ground Z coordinate" ) HORDER = IntProperty( name="Secondary paths orders", default=1 ) TSTEPS = IntProperty( name="Iterations", default=350, description="Number of cells to create\n" "Will end early if hits ground plane or cloud" ) GSCALE = FloatProperty( name="Grid unit size", default=0.12, description="scale of cells, .25 = 4 cells per blenderUnit" ) BIGVAR = FloatProperty( name="Straightness", default=6.3, description="Straightness/branchiness of bolt, \n" "<2 is mush, >12 is staight line, 6.3 is good" ) GROUNDBOOL = BoolProperty( name="Use Ground object", description="Use ground plane or not", default=True ) GROUNDC = IntProperty( name="Ground charge", default=-250, description="Charge of the ground plane" ) CLOUDBOOL = BoolProperty( name="Use Cloud object", default=False, description="Use cloud object - attracts and terminates like ground but\n" "any obj instead of z plane\n" "Can slow down loop if obj is large, overrides ground" ) CLOUDC = IntProperty( name="Cloud charge", default=-1, description="Charge of a cell in cloud object\n" "(so total charge also depends on obj size)" ) VMMESH = BoolProperty( name="Multi mesh", default=True, description="Output to multi-meshes for different materials on main/sec/side branches" ) VSMESH = BoolProperty( name="Single mesh", default=False, description="Output to single mesh for using build modifier and particles for effects" ) VCUBE = BoolProperty( name="Cubes", default=False, description="CTRL-J after run to JOIN\n" "Outputs a bunch of cube objects, mostly for testing" ) VVOX = BoolProperty( name="Voxel (experimental)", default=False, description="Output to a voxel file to bpy.data.filepath\FSLGvoxels.raw\n" "(doesn't work well right now)" ) IBOOL = BoolProperty( name="Use Insulator object", default=False, description="Use insulator mesh object to prevent growth of bolt in areas" ) OOB = StringProperty( name="Select", default="", description="Origin of bolt, can be an Empty\n" "if object is a mesh will use all verts as charges") GOB = StringProperty( name="Select", default="", description="Object to use as ground plane, uses z coord only" ) COB = StringProperty( name="Select", default="", description="Object to use as cloud, best to use a cube" ) IOB = StringProperty( name="Select", default="", description="Object to use as insulator, 'voxelized'\n" "before generating bolt (can be slow)" ) # object_mangle_tools properties mangle_constraint_vector = BoolVectorProperty( name="Mangle Constraint", default=(True, True, True), subtype='XYZ', description="Constrains Mangle Direction" ) mangle_random_magnitude = IntProperty( name="Mangle Severity", default=5, min=1, max=30, description="Severity of mangling" ) mangle_name = StringProperty( name="Shape Key Name", default="mangle", description="Name given for mangled shape keys" ) # unfold_transition properties unfold_arm_name = StringProperty( default="" ) unfold_modo = EnumProperty( name="", items=[("cursor", "3D Cursor", "Use the Distance to 3D Cursor"), ("weight", "Weight Map", "Use a Painted Weight map"), ("index", "Mesh Indices", "Use Faces and Vertices index")], description="How to Sort Bones for animation", default="cursor" ) unfold_flip = BoolProperty( name="Flipping Faces", default=False, description="Rotate faces around the Center and skip Scaling - " "keep checked for both operators" ) unfold_fold_duration = IntProperty( name="Total Time", min=5, soft_min=25, max=10000, soft_max=2500, default=200, description="Total animation length" ) unfold_sca_time = IntProperty( name="Scale Time", min=1, max=5000, soft_max=500, default=10, description="Faces scaling time" ) unfold_rot_time = IntProperty( name="Rotation Time", min=1, soft_min=5, max=5000, soft_max=500, default=15, description="Faces rotation time" ) unfold_rot_max = IntProperty( name="Angle", min=-180, max=180, default=135, description="Faces rotation angle" ) unfold_fold_noise = IntProperty( name="Noise", min=0, max=500, soft_max=50, default=0, description="Offset some faces animation" ) unfold_bounce = FloatProperty( name="Bounce", min=0, max=10, soft_max=2.5, default=0, description="Add some bounce to rotation" ) unfold_from_point = BoolProperty( name="Point", default=False, description="Scale faces from a Point instead of from an Edge" ) unfold_wiggle_rot = BoolProperty( name="Wiggle", default=False, description="Use all Axis + Random Rotation instead of X Aligned" ) # oscurart_constellation constellation_limit = FloatProperty( name="Initial Threshold", description="Edges will be created only if the distance\n" "between vertices is smaller than this value\n" "This is a starting value on Operator Invoke", default=2, min=0 ) # Class list classes = ( AdvancedObjPreferences1, AdvancedObjProperties1, ) def register(): for cls in classes: bpy.utils.register_class(cls) bpy.types.Scene.advanced_objects1 = PointerProperty( type=AdvancedObjProperties1 ) prefs = get_addon_preferences() for mod in sub_modules: if not hasattr(mod, '__addon_enabled__'): mod.__addon_enabled__ = False name = mod.__name__.split('.')[-1] if getattr(prefs, 'use_' + name): register_submodule(mod) def unregister(): for mod in sub_modules: if mod.__addon_enabled__: unregister_submodule(mod) del bpy.types.Scene.advanced_objects1 for cls in reversed(classes): bpy.utils.unregister_class(cls) if __name__ == "__main__": register()
true
true
1c4533e70cb3d4cda0a63ef32b57e6f92afbb550
433
py
Python
setup_moleval.py
MorganCThomas/MolScore
b12b7b5539bb3211982fc7a1b5938c0f383a05c0
[ "MIT" ]
28
2020-12-11T22:10:16.000Z
2022-02-25T05:00:51.000Z
setup_moleval.py
MorganCThomas/MolScore
b12b7b5539bb3211982fc7a1b5938c0f383a05c0
[ "MIT" ]
3
2021-08-31T22:50:41.000Z
2021-11-04T15:41:01.000Z
setup_moleval.py
MorganCThomas/MolScore
b12b7b5539bb3211982fc7a1b5938c0f383a05c0
[ "MIT" ]
9
2021-03-03T12:10:10.000Z
2022-02-15T06:53:11.000Z
from setuptools import setup, find_packages setup( name='moleval', version='1.0', packages=['moleval'] + ['moleval.'+p for p in find_packages(where="moleval")], license='MIT', author='Morgan Thomas', author_email='morganthomas263@gmail.com', description='A evaluation framework for goal directed generative models', include_package_data=True, package_data={'moleval': ['test/data/sample.smi']} )
30.928571
82
0.69746
from setuptools import setup, find_packages setup( name='moleval', version='1.0', packages=['moleval'] + ['moleval.'+p for p in find_packages(where="moleval")], license='MIT', author='Morgan Thomas', author_email='morganthomas263@gmail.com', description='A evaluation framework for goal directed generative models', include_package_data=True, package_data={'moleval': ['test/data/sample.smi']} )
true
true
1c45356cce2b4f69b3bb2ad77abcc74a79c6c0af
272
py
Python
src/openbiolink/gui/tqdmbuf.py
jerryhluo/OpenBioLink
6fc073af978daec0b0db5938b73beed37f57f495
[ "MIT" ]
97
2019-11-26T09:53:18.000Z
2022-03-19T10:33:10.000Z
src/openbiolink/gui/tqdmbuf.py
jerryhluo/OpenBioLink
6fc073af978daec0b0db5938b73beed37f57f495
[ "MIT" ]
67
2019-12-09T21:01:52.000Z
2021-12-21T15:19:41.000Z
src/openbiolink/gui/tqdmbuf.py
jerryhluo/OpenBioLink
6fc073af978daec0b0db5938b73beed37f57f495
[ "MIT" ]
20
2020-01-13T23:02:25.000Z
2022-03-16T21:43:31.000Z
import io class TqdmBuffer(io.StringIO): foo = "" buf = "" def __init__(self): super(TqdmBuffer, self).__init__() def write(self, buf): TqdmBuffer.foo = buf.strip("\r\n\t ") def flush(self): TqdmBuffer.buf = TqdmBuffer.foo
17
45
0.580882
import io class TqdmBuffer(io.StringIO): foo = "" buf = "" def __init__(self): super(TqdmBuffer, self).__init__() def write(self, buf): TqdmBuffer.foo = buf.strip("\r\n\t ") def flush(self): TqdmBuffer.buf = TqdmBuffer.foo
true
true
1c453596a670a84db2e2af489075f7f2a241bdfa
154
py
Python
arc086_a.py
hythof/atc
12cb94ebe693e1f469ce0d982bc2924b586552cd
[ "CC0-1.0" ]
null
null
null
arc086_a.py
hythof/atc
12cb94ebe693e1f469ce0d982bc2924b586552cd
[ "CC0-1.0" ]
null
null
null
arc086_a.py
hythof/atc
12cb94ebe693e1f469ce0d982bc2924b586552cd
[ "CC0-1.0" ]
null
null
null
from collections import Counter N,K,*A = [int(x) for x in open(0).read().split()] c=Counter(A) s=c.most_common()[K:] ans=sum([n for _,n in s]) print(ans)
22
49
0.655844
from collections import Counter N,K,*A = [int(x) for x in open(0).read().split()] c=Counter(A) s=c.most_common()[K:] ans=sum([n for _,n in s]) print(ans)
true
true
1c4535bc026eff090d7af84d54154e33b7a62cfe
2,673
py
Python
rgd/geodata/api/download.py
Erotemic/ResonantGeoData
ff9aec9daf73353bcc95a9d30e98fcc5cdffc6e0
[ "Apache-2.0" ]
null
null
null
rgd/geodata/api/download.py
Erotemic/ResonantGeoData
ff9aec9daf73353bcc95a9d30e98fcc5cdffc6e0
[ "Apache-2.0" ]
null
null
null
rgd/geodata/api/download.py
Erotemic/ResonantGeoData
ff9aec9daf73353bcc95a9d30e98fcc5cdffc6e0
[ "Apache-2.0" ]
null
null
null
from django.http import HttpResponseRedirect from django.shortcuts import get_object_or_404 # , render from drf_yasg.utils import swagger_auto_schema from rest_framework.decorators import api_view from rest_framework.response import Response from rgd.geodata import models from rgd.geodata.permissions import check_read_perm @swagger_auto_schema( method='GET', operation_summary='Download ChecksumFile data directly from S3.', ) @api_view(['GET']) def download_checksum_file(request, pk): instance = models.common.ChecksumFile.objects.get(pk=pk) check_read_perm(request.user, instance) return HttpResponseRedirect(instance.get_url()) @swagger_auto_schema( method='GET', operation_summary='Download the associated ImageFile data for this ImageEntry directly from S3.', ) @api_view(['GET']) def download_image_entry_file(request, pk): instance = models.imagery.ImageEntry.objects.get(pk=pk) check_read_perm(request.user, instance) url = instance.image_file.imagefile.file.get_url() return HttpResponseRedirect(url) @swagger_auto_schema( method='GET', operation_summary='Download the associated ChecksumFile data for this ConvertedImageFile directly from S3.', ) @api_view(['GET']) def download_cog_file(request, pk): instance = models.imagery.ConvertedImageFile.objects.get(pk=pk) check_read_perm(request.user, instance) af_id = instance.converted_file.id instance = models.common.ChecksumFile.objects.get(pk=af_id) return HttpResponseRedirect(instance.get_url()) def _get_status_response(request, model, pk): model_class = ''.join([part[:1].upper() + part[1:] for part in model.split('_')]) if not hasattr(models, model_class): raise AttributeError(f'No such model ({model})') instance = get_object_or_404(getattr(models, model_class), pk=pk) check_read_perm(request.user, instance) if not hasattr(instance, 'status'): raise AttributeError(f'Model ({model}) has no attribute (status).') data = { 'pk': instance.pk, 'model': model, 'status': instance.status, } return Response(data) @swagger_auto_schema( method='GET', operation_summary='Check the status.', ) @api_view(['GET']) def get_status(request, model, pk): """Get the status of any TaskEventMixin model.""" return _get_status_response(request, model, pk) @swagger_auto_schema( method='GET', operation_summary='Check the status of SubsampledImage.', ) @api_view(['GET']) def get_status_subsampled_image(request, pk): """Get the status of any SubsampledImage model.""" return _get_status_response(request, 'SubsampledImage', pk)
33
112
0.737748
from django.http import HttpResponseRedirect from django.shortcuts import get_object_or_404 from drf_yasg.utils import swagger_auto_schema from rest_framework.decorators import api_view from rest_framework.response import Response from rgd.geodata import models from rgd.geodata.permissions import check_read_perm @swagger_auto_schema( method='GET', operation_summary='Download ChecksumFile data directly from S3.', ) @api_view(['GET']) def download_checksum_file(request, pk): instance = models.common.ChecksumFile.objects.get(pk=pk) check_read_perm(request.user, instance) return HttpResponseRedirect(instance.get_url()) @swagger_auto_schema( method='GET', operation_summary='Download the associated ImageFile data for this ImageEntry directly from S3.', ) @api_view(['GET']) def download_image_entry_file(request, pk): instance = models.imagery.ImageEntry.objects.get(pk=pk) check_read_perm(request.user, instance) url = instance.image_file.imagefile.file.get_url() return HttpResponseRedirect(url) @swagger_auto_schema( method='GET', operation_summary='Download the associated ChecksumFile data for this ConvertedImageFile directly from S3.', ) @api_view(['GET']) def download_cog_file(request, pk): instance = models.imagery.ConvertedImageFile.objects.get(pk=pk) check_read_perm(request.user, instance) af_id = instance.converted_file.id instance = models.common.ChecksumFile.objects.get(pk=af_id) return HttpResponseRedirect(instance.get_url()) def _get_status_response(request, model, pk): model_class = ''.join([part[:1].upper() + part[1:] for part in model.split('_')]) if not hasattr(models, model_class): raise AttributeError(f'No such model ({model})') instance = get_object_or_404(getattr(models, model_class), pk=pk) check_read_perm(request.user, instance) if not hasattr(instance, 'status'): raise AttributeError(f'Model ({model}) has no attribute (status).') data = { 'pk': instance.pk, 'model': model, 'status': instance.status, } return Response(data) @swagger_auto_schema( method='GET', operation_summary='Check the status.', ) @api_view(['GET']) def get_status(request, model, pk): return _get_status_response(request, model, pk) @swagger_auto_schema( method='GET', operation_summary='Check the status of SubsampledImage.', ) @api_view(['GET']) def get_status_subsampled_image(request, pk): return _get_status_response(request, 'SubsampledImage', pk)
true
true
1c45386d87d0096209f4bdb484bfc04696f23f4b
15,690
py
Python
python/ccxt/async_support/bit2c.py
FullStackHan/ccxt
1efa15e162e23bae91215aa5d1e5199ebb7fe39e
[ "MIT" ]
null
null
null
python/ccxt/async_support/bit2c.py
FullStackHan/ccxt
1efa15e162e23bae91215aa5d1e5199ebb7fe39e
[ "MIT" ]
null
null
null
python/ccxt/async_support/bit2c.py
FullStackHan/ccxt
1efa15e162e23bae91215aa5d1e5199ebb7fe39e
[ "MIT" ]
null
null
null
# -*- coding: utf-8 -*- # PLEASE DO NOT EDIT THIS FILE, IT IS GENERATED AND WILL BE OVERWRITTEN: # https://github.com/ccxt/ccxt/blob/master/CONTRIBUTING.md#how-to-contribute-code from ccxt.async_support.base.exchange import Exchange # ----------------------------------------------------------------------------- try: basestring # Python 3 except NameError: basestring = str # Python 2 import hashlib from ccxt.base.errors import ExchangeError from ccxt.base.errors import ArgumentsRequired class bit2c (Exchange): def describe(self): return self.deep_extend(super(bit2c, self).describe(), { 'id': 'bit2c', 'name': 'Bit2C', 'countries': ['IL'], # Israel 'rateLimit': 3000, 'has': { 'CORS': False, 'fetchOpenOrders': True, 'fetchMyTrades': True, }, 'urls': { 'logo': 'https://user-images.githubusercontent.com/1294454/27766119-3593220e-5ece-11e7-8b3a-5a041f6bcc3f.jpg', 'api': 'https://bit2c.co.il', 'www': 'https://www.bit2c.co.il', 'referral': 'https://bit2c.co.il/Aff/63bfed10-e359-420c-ab5a-ad368dab0baf', 'doc': [ 'https://www.bit2c.co.il/home/api', 'https://github.com/OferE/bit2c', ], }, 'api': { 'public': { 'get': [ 'Exchanges/{pair}/Ticker', 'Exchanges/{pair}/orderbook', 'Exchanges/{pair}/trades', 'Exchanges/{pair}/lasttrades', ], }, 'private': { 'post': [ 'Merchant/CreateCheckout', 'Order/AddCoinFundsRequest', 'Order/AddFund', 'Order/AddOrder', 'Order/AddOrderMarketPriceBuy', 'Order/AddOrderMarketPriceSell', 'Order/CancelOrder', 'Order/AddCoinFundsRequest', 'Order/AddStopOrder', 'Payment/GetMyId', 'Payment/Send', 'Payment/Pay', ], 'get': [ 'Account/Balance', 'Account/Balance/v2', 'Order/MyOrders', 'Order/GetById', 'Order/AccountHistory', 'Order/OrderHistory', ], }, }, 'markets': { 'BTC/NIS': {'id': 'BtcNis', 'symbol': 'BTC/NIS', 'base': 'BTC', 'quote': 'NIS', 'baseId': 'Btc', 'quoteId': 'Nis'}, 'ETH/NIS': {'id': 'EthNis', 'symbol': 'ETH/NIS', 'base': 'ETH', 'quote': 'NIS', 'baseId': 'Eth', 'quoteId': 'Nis'}, 'BCH/NIS': {'id': 'BchabcNis', 'symbol': 'BCH/NIS', 'base': 'BCH', 'quote': 'NIS', 'baseId': 'Bchabc', 'quoteId': 'Nis'}, 'LTC/NIS': {'id': 'LtcNis', 'symbol': 'LTC/NIS', 'base': 'LTC', 'quote': 'NIS', 'baseId': 'Ltc', 'quoteId': 'Nis'}, 'ETC/NIS': {'id': 'EtcNis', 'symbol': 'ETC/NIS', 'base': 'ETC', 'quote': 'NIS', 'baseId': 'Etc', 'quoteId': 'Nis'}, 'BTG/NIS': {'id': 'BtgNis', 'symbol': 'BTG/NIS', 'base': 'BTG', 'quote': 'NIS', 'baseId': 'Btg', 'quoteId': 'Nis'}, 'BSV/NIS': {'id': 'BchsvNis', 'symbol': 'BSV/NIS', 'base': 'BSV', 'quote': 'NIS', 'baseId': 'Bchsv', 'quoteId': 'Nis'}, 'GRIN/NIS': {'id': 'GrinNis', 'symbol': 'GRIN/NIS', 'base': 'GRIN', 'quote': 'NIS', 'baseId': 'Grin', 'quoteId': 'Nis'}, }, 'fees': { 'trading': { 'maker': 0.5 / 100, 'taker': 0.5 / 100, }, }, 'options': { 'fetchTradesMethod': 'public_get_exchanges_pair_lasttrades', }, 'exceptions': { # {"error" : "Please provide valid APIkey"} # {"error" : "Please provide valid nonce in Request UInt64.TryParse failed for nonce :"} }, }) async def fetch_balance(self, params={}): await self.load_markets() balance = await self.privateGetAccountBalanceV2(params) # # { # "AVAILABLE_NIS": 0.0, # "NIS": 0.0, # "LOCKED_NIS": 0.0, # "AVAILABLE_BTC": 0.0, # "BTC": 0.0, # "LOCKED_BTC": 0.0, # "AVAILABLE_ETH": 0.0, # "ETH": 0.0, # "LOCKED_ETH": 0.0, # "AVAILABLE_BCHSV": 0.0, # "BCHSV": 0.0, # "LOCKED_BCHSV": 0.0, # "AVAILABLE_BCHABC": 0.0, # "BCHABC": 0.0, # "LOCKED_BCHABC": 0.0, # "AVAILABLE_LTC": 0.0, # "LTC": 0.0, # "LOCKED_LTC": 0.0, # "AVAILABLE_ETC": 0.0, # "ETC": 0.0, # "LOCKED_ETC": 0.0, # "AVAILABLE_BTG": 0.0, # "BTG": 0.0, # "LOCKED_BTG": 0.0, # "AVAILABLE_GRIN": 0.0, # "GRIN": 0.0, # "LOCKED_GRIN": 0.0, # "Fees": { # "BtcNis": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "EthNis": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "BchabcNis": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "LtcNis": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "EtcNis": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "BtgNis": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "LtcBtc": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "BchsvNis": {"FeeMaker": 1.0, "FeeTaker": 1.0}, # "GrinNis": {"FeeMaker": 1.0, "FeeTaker": 1.0} # } # } # result = {'info': balance} codes = list(self.currencies.keys()) for i in range(0, len(codes)): code = codes[i] account = self.account() currency = self.currency(code) uppercase = currency['id'].upper() if uppercase in balance: account['free'] = self.safe_float(balance, 'AVAILABLE_' + uppercase) account['total'] = self.safe_float(balance, uppercase) account['used'] = account['total'] - account['free'] result[code] = account return self.parse_balance(result) async def fetch_order_book(self, symbol, limit=None, params={}): await self.load_markets() request = { 'pair': self.market_id(symbol), } orderbook = await self.publicGetExchangesPairOrderbook(self.extend(request, params)) return self.parse_order_book(orderbook) async def fetch_ticker(self, symbol, params={}): await self.load_markets() request = { 'pair': self.market_id(symbol), } ticker = await self.publicGetExchangesPairTicker(self.extend(request, params)) timestamp = self.milliseconds() averagePrice = self.safe_float(ticker, 'av') baseVolume = self.safe_float(ticker, 'a') quoteVolume = None if baseVolume is not None and averagePrice is not None: quoteVolume = baseVolume * averagePrice last = self.safe_float(ticker, 'll') return { 'symbol': symbol, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'high': None, 'low': None, 'bid': self.safe_float(ticker, 'h'), 'bidVolume': None, 'ask': self.safe_float(ticker, 'l'), 'askVolume': None, 'vwap': None, 'open': None, 'close': last, 'last': last, 'previousClose': None, 'change': None, 'percentage': None, 'average': averagePrice, 'baseVolume': baseVolume, 'quoteVolume': quoteVolume, 'info': ticker, } async def fetch_trades(self, symbol, since=None, limit=None, params={}): await self.load_markets() market = self.market(symbol) method = self.options['fetchTradesMethod'] request = { 'pair': market['id'], } response = await getattr(self, method)(self.extend(request, params)) if isinstance(response, basestring): raise ExchangeError(response) return self.parse_trades(response, market, since, limit) async def create_order(self, symbol, type, side, amount, price=None, params={}): await self.load_markets() method = 'privatePostOrderAddOrder' request = { 'Amount': amount, 'Pair': self.market_id(symbol), } if type == 'market': method += 'MarketPrice' + self.capitalize(side) else: request['Price'] = price request['Total'] = amount * price request['IsBid'] = (side == 'buy') response = await getattr(self, method)(self.extend(request, params)) return { 'info': response, 'id': response['NewOrder']['id'], } async def cancel_order(self, id, symbol=None, params={}): request = { 'id': id, } return await self.privatePostOrderCancelOrder(self.extend(request, params)) async def fetch_open_orders(self, symbol=None, since=None, limit=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' fetchOpenOrders() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'pair': market['id'], } response = await self.privateGetOrderMyOrders(self.extend(request, params)) orders = self.safe_value(response, market['id'], {}) asks = self.safe_value(orders, 'ask', []) bids = self.safe_value(orders, 'bid', []) return self.parse_orders(self.array_concat(asks, bids), market, since, limit) def parse_order(self, order, market=None): timestamp = self.safe_integer(order, 'created') price = self.safe_float(order, 'price') amount = self.safe_float(order, 'amount') cost = None if price is not None: if amount is not None: cost = price * amount symbol = None if market is not None: symbol = market['symbol'] side = self.safe_value(order, 'type') if side == 0: side = 'buy' elif side == 1: side = 'sell' id = self.safe_string(order, 'id') status = self.safe_string(order, 'status') return { 'id': id, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'lastTradeTimestamp': None, 'status': status, 'symbol': symbol, 'type': None, 'side': side, 'price': price, 'amount': amount, 'filled': None, 'remaining': None, 'cost': cost, 'trades': None, 'fee': None, 'info': order, } async def fetch_my_trades(self, symbol=None, since=None, limit=None, params={}): await self.load_markets() market = None method = 'privateGetOrderOrderhistory' request = {} if limit is not None: request['take'] = limit request['take'] = limit if since is not None: request['toTime'] = self.ymd(self.milliseconds(), '.') request['fromTime'] = self.ymd(since, '.') if symbol is not None: market = self.market(symbol) request['pair'] = market['id'] response = await getattr(self, method)(self.extend(request, params)) return self.parse_trades(response, market, since, limit) def parse_trade(self, trade, market=None): timestamp = None id = None price = None amount = None orderId = None feeCost = None side = None reference = self.safe_string(trade, 'reference') if reference is not None: timestamp = self.safe_integer(trade, 'ticks') * 1000 price = self.safe_float(trade, 'price') amount = self.safe_float(trade, 'firstAmount') reference_parts = reference.split('|') # reference contains: 'pair|orderId|tradeId' if market is None: marketId = self.safe_string(trade, 'pair') if marketId in self.markets_by_id[marketId]: market = self.markets_by_id[marketId] elif reference_parts[0] in self.markets_by_id: market = self.markets_by_id[reference_parts[0]] orderId = reference_parts[1] id = reference_parts[2] side = self.safe_integer(trade, 'action') if side == 0: side = 'buy' elif side == 1: side = 'sell' feeCost = self.safe_float(trade, 'feeAmount') else: timestamp = self.safe_integer(trade, 'date') * 1000 id = self.safe_string(trade, 'tid') price = self.safe_float(trade, 'price') amount = self.safe_float(trade, 'amount') side = self.safe_value(trade, 'isBid') if side is not None: if side: side = 'buy' else: side = 'sell' symbol = None if market is not None: symbol = market['symbol'] return { 'info': trade, 'id': id, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'symbol': symbol, 'order': orderId, 'type': None, 'side': side, 'takerOrMaker': None, 'price': price, 'amount': amount, 'cost': price * amount, 'fee': { 'cost': feeCost, 'currency': 'NIS', 'rate': None, }, } def sign(self, path, api='public', method='GET', params={}, headers=None, body=None): url = self.urls['api'] + '/' + self.implode_params(path, params) if api == 'public': # lasttrades is the only endpoint that doesn't require the .json extension/suffix if path.find('lasttrades') < 0: url += '.json' else: self.check_required_credentials() nonce = self.nonce() query = self.extend({ 'nonce': nonce, }, params) auth = self.urlencode(query) if method == 'GET': if query: url += '?' + auth else: body = auth signature = self.hmac(self.encode(auth), self.encode(self.secret), hashlib.sha512, 'base64') headers = { 'Content-Type': 'application/x-www-form-urlencoded', 'key': self.apiKey, 'sign': self.decode(signature), } return {'url': url, 'method': method, 'body': body, 'headers': headers}
39.621212
137
0.476801
rt.base.exchange import Exchange try: basestring except NameError: basestring = str import hashlib from ccxt.base.errors import ExchangeError from ccxt.base.errors import ArgumentsRequired class bit2c (Exchange): def describe(self): return self.deep_extend(super(bit2c, self).describe(), { 'id': 'bit2c', 'name': 'Bit2C', 'countries': ['IL'], 'rateLimit': 3000, 'has': { 'CORS': False, 'fetchOpenOrders': True, 'fetchMyTrades': True, }, 'urls': { 'logo': 'https://user-images.githubusercontent.com/1294454/27766119-3593220e-5ece-11e7-8b3a-5a041f6bcc3f.jpg', 'api': 'https://bit2c.co.il', 'www': 'https://www.bit2c.co.il', 'referral': 'https://bit2c.co.il/Aff/63bfed10-e359-420c-ab5a-ad368dab0baf', 'doc': [ 'https://www.bit2c.co.il/home/api', 'https://github.com/OferE/bit2c', ], }, 'api': { 'public': { 'get': [ 'Exchanges/{pair}/Ticker', 'Exchanges/{pair}/orderbook', 'Exchanges/{pair}/trades', 'Exchanges/{pair}/lasttrades', ], }, 'private': { 'post': [ 'Merchant/CreateCheckout', 'Order/AddCoinFundsRequest', 'Order/AddFund', 'Order/AddOrder', 'Order/AddOrderMarketPriceBuy', 'Order/AddOrderMarketPriceSell', 'Order/CancelOrder', 'Order/AddCoinFundsRequest', 'Order/AddStopOrder', 'Payment/GetMyId', 'Payment/Send', 'Payment/Pay', ], 'get': [ 'Account/Balance', 'Account/Balance/v2', 'Order/MyOrders', 'Order/GetById', 'Order/AccountHistory', 'Order/OrderHistory', ], }, }, 'markets': { 'BTC/NIS': {'id': 'BtcNis', 'symbol': 'BTC/NIS', 'base': 'BTC', 'quote': 'NIS', 'baseId': 'Btc', 'quoteId': 'Nis'}, 'ETH/NIS': {'id': 'EthNis', 'symbol': 'ETH/NIS', 'base': 'ETH', 'quote': 'NIS', 'baseId': 'Eth', 'quoteId': 'Nis'}, 'BCH/NIS': {'id': 'BchabcNis', 'symbol': 'BCH/NIS', 'base': 'BCH', 'quote': 'NIS', 'baseId': 'Bchabc', 'quoteId': 'Nis'}, 'LTC/NIS': {'id': 'LtcNis', 'symbol': 'LTC/NIS', 'base': 'LTC', 'quote': 'NIS', 'baseId': 'Ltc', 'quoteId': 'Nis'}, 'ETC/NIS': {'id': 'EtcNis', 'symbol': 'ETC/NIS', 'base': 'ETC', 'quote': 'NIS', 'baseId': 'Etc', 'quoteId': 'Nis'}, 'BTG/NIS': {'id': 'BtgNis', 'symbol': 'BTG/NIS', 'base': 'BTG', 'quote': 'NIS', 'baseId': 'Btg', 'quoteId': 'Nis'}, 'BSV/NIS': {'id': 'BchsvNis', 'symbol': 'BSV/NIS', 'base': 'BSV', 'quote': 'NIS', 'baseId': 'Bchsv', 'quoteId': 'Nis'}, 'GRIN/NIS': {'id': 'GrinNis', 'symbol': 'GRIN/NIS', 'base': 'GRIN', 'quote': 'NIS', 'baseId': 'Grin', 'quoteId': 'Nis'}, }, 'fees': { 'trading': { 'maker': 0.5 / 100, 'taker': 0.5 / 100, }, }, 'options': { 'fetchTradesMethod': 'public_get_exchanges_pair_lasttrades', }, 'exceptions': { }, }) async def fetch_balance(self, params={}): await self.load_markets() balance = await self.privateGetAccountBalanceV2(params) result = {'info': balance} codes = list(self.currencies.keys()) for i in range(0, len(codes)): code = codes[i] account = self.account() currency = self.currency(code) uppercase = currency['id'].upper() if uppercase in balance: account['free'] = self.safe_float(balance, 'AVAILABLE_' + uppercase) account['total'] = self.safe_float(balance, uppercase) account['used'] = account['total'] - account['free'] result[code] = account return self.parse_balance(result) async def fetch_order_book(self, symbol, limit=None, params={}): await self.load_markets() request = { 'pair': self.market_id(symbol), } orderbook = await self.publicGetExchangesPairOrderbook(self.extend(request, params)) return self.parse_order_book(orderbook) async def fetch_ticker(self, symbol, params={}): await self.load_markets() request = { 'pair': self.market_id(symbol), } ticker = await self.publicGetExchangesPairTicker(self.extend(request, params)) timestamp = self.milliseconds() averagePrice = self.safe_float(ticker, 'av') baseVolume = self.safe_float(ticker, 'a') quoteVolume = None if baseVolume is not None and averagePrice is not None: quoteVolume = baseVolume * averagePrice last = self.safe_float(ticker, 'll') return { 'symbol': symbol, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'high': None, 'low': None, 'bid': self.safe_float(ticker, 'h'), 'bidVolume': None, 'ask': self.safe_float(ticker, 'l'), 'askVolume': None, 'vwap': None, 'open': None, 'close': last, 'last': last, 'previousClose': None, 'change': None, 'percentage': None, 'average': averagePrice, 'baseVolume': baseVolume, 'quoteVolume': quoteVolume, 'info': ticker, } async def fetch_trades(self, symbol, since=None, limit=None, params={}): await self.load_markets() market = self.market(symbol) method = self.options['fetchTradesMethod'] request = { 'pair': market['id'], } response = await getattr(self, method)(self.extend(request, params)) if isinstance(response, basestring): raise ExchangeError(response) return self.parse_trades(response, market, since, limit) async def create_order(self, symbol, type, side, amount, price=None, params={}): await self.load_markets() method = 'privatePostOrderAddOrder' request = { 'Amount': amount, 'Pair': self.market_id(symbol), } if type == 'market': method += 'MarketPrice' + self.capitalize(side) else: request['Price'] = price request['Total'] = amount * price request['IsBid'] = (side == 'buy') response = await getattr(self, method)(self.extend(request, params)) return { 'info': response, 'id': response['NewOrder']['id'], } async def cancel_order(self, id, symbol=None, params={}): request = { 'id': id, } return await self.privatePostOrderCancelOrder(self.extend(request, params)) async def fetch_open_orders(self, symbol=None, since=None, limit=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' fetchOpenOrders() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'pair': market['id'], } response = await self.privateGetOrderMyOrders(self.extend(request, params)) orders = self.safe_value(response, market['id'], {}) asks = self.safe_value(orders, 'ask', []) bids = self.safe_value(orders, 'bid', []) return self.parse_orders(self.array_concat(asks, bids), market, since, limit) def parse_order(self, order, market=None): timestamp = self.safe_integer(order, 'created') price = self.safe_float(order, 'price') amount = self.safe_float(order, 'amount') cost = None if price is not None: if amount is not None: cost = price * amount symbol = None if market is not None: symbol = market['symbol'] side = self.safe_value(order, 'type') if side == 0: side = 'buy' elif side == 1: side = 'sell' id = self.safe_string(order, 'id') status = self.safe_string(order, 'status') return { 'id': id, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'lastTradeTimestamp': None, 'status': status, 'symbol': symbol, 'type': None, 'side': side, 'price': price, 'amount': amount, 'filled': None, 'remaining': None, 'cost': cost, 'trades': None, 'fee': None, 'info': order, } async def fetch_my_trades(self, symbol=None, since=None, limit=None, params={}): await self.load_markets() market = None method = 'privateGetOrderOrderhistory' request = {} if limit is not None: request['take'] = limit request['take'] = limit if since is not None: request['toTime'] = self.ymd(self.milliseconds(), '.') request['fromTime'] = self.ymd(since, '.') if symbol is not None: market = self.market(symbol) request['pair'] = market['id'] response = await getattr(self, method)(self.extend(request, params)) return self.parse_trades(response, market, since, limit) def parse_trade(self, trade, market=None): timestamp = None id = None price = None amount = None orderId = None feeCost = None side = None reference = self.safe_string(trade, 'reference') if reference is not None: timestamp = self.safe_integer(trade, 'ticks') * 1000 price = self.safe_float(trade, 'price') amount = self.safe_float(trade, 'firstAmount') reference_parts = reference.split('|') if market is None: marketId = self.safe_string(trade, 'pair') if marketId in self.markets_by_id[marketId]: market = self.markets_by_id[marketId] elif reference_parts[0] in self.markets_by_id: market = self.markets_by_id[reference_parts[0]] orderId = reference_parts[1] id = reference_parts[2] side = self.safe_integer(trade, 'action') if side == 0: side = 'buy' elif side == 1: side = 'sell' feeCost = self.safe_float(trade, 'feeAmount') else: timestamp = self.safe_integer(trade, 'date') * 1000 id = self.safe_string(trade, 'tid') price = self.safe_float(trade, 'price') amount = self.safe_float(trade, 'amount') side = self.safe_value(trade, 'isBid') if side is not None: if side: side = 'buy' else: side = 'sell' symbol = None if market is not None: symbol = market['symbol'] return { 'info': trade, 'id': id, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'symbol': symbol, 'order': orderId, 'type': None, 'side': side, 'takerOrMaker': None, 'price': price, 'amount': amount, 'cost': price * amount, 'fee': { 'cost': feeCost, 'currency': 'NIS', 'rate': None, }, } def sign(self, path, api='public', method='GET', params={}, headers=None, body=None): url = self.urls['api'] + '/' + self.implode_params(path, params) if api == 'public': if path.find('lasttrades') < 0: url += '.json' else: self.check_required_credentials() nonce = self.nonce() query = self.extend({ 'nonce': nonce, }, params) auth = self.urlencode(query) if method == 'GET': if query: url += '?' + auth else: body = auth signature = self.hmac(self.encode(auth), self.encode(self.secret), hashlib.sha512, 'base64') headers = { 'Content-Type': 'application/x-www-form-urlencoded', 'key': self.apiKey, 'sign': self.decode(signature), } return {'url': url, 'method': method, 'body': body, 'headers': headers}
true
true
1c4538cc2359718686d6db32146a5a2b4f7febf8
801
py
Python
apps/MixMaster/Units/specificEntropy.py
VishalKandala/Cantera-1.7
750786f9b845a56fc177a9f1d5a9c5bb6ebd87cc
[ "BSD-3-Clause" ]
null
null
null
apps/MixMaster/Units/specificEntropy.py
VishalKandala/Cantera-1.7
750786f9b845a56fc177a9f1d5a9c5bb6ebd87cc
[ "BSD-3-Clause" ]
null
null
null
apps/MixMaster/Units/specificEntropy.py
VishalKandala/Cantera-1.7
750786f9b845a56fc177a9f1d5a9c5bb6ebd87cc
[ "BSD-3-Clause" ]
null
null
null
#!/bin/env python # #-------------------------------------------------------------------------- # # $License$ # #-------------------------------------------------------------------------- # $Log: specificEntropy.py,v $ # Revision 1.1.1.1 2003/04/14 17:57:49 dggoodwin # Initial import. # # Revision 1.1 2002/12/20 13:23:41 dgg # first commit # # Revision 1.1.1.1 2000/01/21 22:59:51 dgg # dgg Cantera # # Revision 1.1 1999/11/27 17:27:35 dgg # initial import to Cantera repository # # Revision 1.1 1999/11/25 19:50:58 aivazis # Original source # import SI, energy, mass units = ['J__kg_K', 'kJ__kg_K', 'cal__g_K'] J__kg_K = SI.joule/(SI.kilogram * SI.kelvin) kJ__kg_K = 1000.0*J__kg_K cal__g_K = energy.calorie/(mass.gram * SI.kelvin) # # End of file
22.25
76
0.515605
import SI, energy, mass units = ['J__kg_K', 'kJ__kg_K', 'cal__g_K'] J__kg_K = SI.joule/(SI.kilogram * SI.kelvin) kJ__kg_K = 1000.0*J__kg_K cal__g_K = energy.calorie/(mass.gram * SI.kelvin)
true
true
1c4538dde779970879db26d139380a7fc2409bbd
683
py
Python
architectures/arch_dsprite_burgess-g_kyle_d_vae.py
christopher-beckham/amr
1bd67b9b4fb2fcf07cc8faba3c863f5ad5d4c4c0
[ "BSD-3-Clause" ]
35
2019-08-27T08:59:53.000Z
2021-09-19T15:55:34.000Z
architectures/arch_dsprite_burgess-g_kyle_d_vae.py
christopher-beckham/amr
1bd67b9b4fb2fcf07cc8faba3c863f5ad5d4c4c0
[ "BSD-3-Clause" ]
4
2020-01-14T05:09:31.000Z
2020-05-25T20:39:55.000Z
architectures/arch_dsprite_burgess-g_kyle_d_vae.py
christopher-beckham/amr
1bd67b9b4fb2fcf07cc8faba3c863f5ad5d4c4c0
[ "BSD-3-Clause" ]
3
2019-12-24T01:29:49.000Z
2020-12-06T01:56:19.000Z
import torch from torch import nn import torch.nn.functional as F #from .shared import networks from .konny.model import BetaVAE_B from . import discriminators from functools import partial # TODO: add logging to this def get_network(n_channels, ndf, **kwargs): gen = BetaVAE_B(nc=n_channels, vae=True) disc_x = discriminators.Discriminator(nf=ndf, input_nc=n_channels, n_classes=1, sigmoid=True, spec_norm=True) return { 'gen': gen, 'disc_x': disc_x, 'class_mixer': None }
31.045455
62
0.541728
import torch from torch import nn import torch.nn.functional as F from .konny.model import BetaVAE_B from . import discriminators from functools import partial def get_network(n_channels, ndf, **kwargs): gen = BetaVAE_B(nc=n_channels, vae=True) disc_x = discriminators.Discriminator(nf=ndf, input_nc=n_channels, n_classes=1, sigmoid=True, spec_norm=True) return { 'gen': gen, 'disc_x': disc_x, 'class_mixer': None }
true
true
1c4539377f1b84b2035abe30a51c80e4b68b7573
4,856
py
Python
.venv/lib/python2.7/site-packages/celery/backends/cache.py
MansoorHanif/FYP-web-app
918008d3b5eedaa904f3e720296afde9d73ac3f4
[ "BSD-3-Clause" ]
4
2018-10-19T04:36:20.000Z
2020-02-13T16:14:09.000Z
.venv/lib/python2.7/site-packages/celery/backends/cache.py
MansoorHanif/FYP-web-app
918008d3b5eedaa904f3e720296afde9d73ac3f4
[ "BSD-3-Clause" ]
3
2020-02-11T23:03:45.000Z
2021-06-10T18:05:11.000Z
oo/lib/python3.5/site-packages/celery/backends/cache.py
chunky2808/SPOJ-history-Django-App
490c58b1593cd3626f0ddc27fdd09c6e8d1c56e1
[ "MIT" ]
1
2019-10-26T04:20:52.000Z
2019-10-26T04:20:52.000Z
# -*- coding: utf-8 -*- """Memcached and in-memory cache result backend.""" from __future__ import absolute_import, unicode_literals import sys from kombu.utils.encoding import bytes_to_str, ensure_bytes from kombu.utils.objects import cached_property from celery.exceptions import ImproperlyConfigured from celery.utils.functional import LRUCache from .base import KeyValueStoreBackend __all__ = ['CacheBackend'] _imp = [None] PY3 = sys.version_info[0] == 3 REQUIRES_BACKEND = """\ The Memcached backend requires either pylibmc or python-memcached.\ """ UNKNOWN_BACKEND = """\ The cache backend {0!r} is unknown, Please use one of the following backends instead: {1}\ """ def import_best_memcache(): if _imp[0] is None: is_pylibmc, memcache_key_t = False, ensure_bytes try: import pylibmc as memcache is_pylibmc = True except ImportError: try: import memcache # noqa except ImportError: raise ImproperlyConfigured(REQUIRES_BACKEND) if PY3: # pragma: no cover memcache_key_t = bytes_to_str _imp[0] = (is_pylibmc, memcache, memcache_key_t) return _imp[0] def get_best_memcache(*args, **kwargs): # pylint: disable=unpacking-non-sequence # This is most definitely a sequence, but pylint thinks it's not. is_pylibmc, memcache, key_t = import_best_memcache() Client = _Client = memcache.Client if not is_pylibmc: def Client(*args, **kwargs): # noqa kwargs.pop('behaviors', None) return _Client(*args, **kwargs) return Client, key_t class DummyClient(object): def __init__(self, *args, **kwargs): self.cache = LRUCache(limit=5000) def get(self, key, *args, **kwargs): return self.cache.get(key) def get_multi(self, keys): cache = self.cache return {k: cache[k] for k in keys if k in cache} def set(self, key, value, *args, **kwargs): self.cache[key] = value def delete(self, key, *args, **kwargs): self.cache.pop(key, None) def incr(self, key, delta=1): return self.cache.incr(key, delta) def touch(self, key, expire): pass backends = { 'memcache': get_best_memcache, 'memcached': get_best_memcache, 'pylibmc': get_best_memcache, 'memory': lambda: (DummyClient, ensure_bytes), } class CacheBackend(KeyValueStoreBackend): """Cache result backend.""" servers = None supports_autoexpire = True supports_native_join = True implements_incr = True def __init__(self, app, expires=None, backend=None, options={}, url=None, **kwargs): super(CacheBackend, self).__init__(app, **kwargs) self.url = url self.options = dict(self.app.conf.cache_backend_options, **options) self.backend = url or backend or self.app.conf.cache_backend if self.backend: self.backend, _, servers = self.backend.partition('://') self.servers = servers.rstrip('/').split(';') self.expires = self.prepare_expires(expires, type=int) try: self.Client, self.key_t = backends[self.backend]() except KeyError: raise ImproperlyConfigured(UNKNOWN_BACKEND.format( self.backend, ', '.join(backends))) self._encode_prefixes() # rencode the keyprefixes def get(self, key): return self.client.get(key) def mget(self, keys): return self.client.get_multi(keys) def set(self, key, value): return self.client.set(key, value, self.expires) def delete(self, key): return self.client.delete(key) def _apply_chord_incr(self, header, partial_args, group_id, body, **opts): self.client.set(self.get_key_for_chord(group_id), 0, time=self.expires) return super(CacheBackend, self)._apply_chord_incr( header, partial_args, group_id, body, **opts) def incr(self, key): return self.client.incr(key) def expire(self, key, value): return self.client.touch(key, value) @cached_property def client(self): return self.Client(self.servers, **self.options) def __reduce__(self, args=(), kwargs={}): servers = ';'.join(self.servers) backend = '{0}://{1}/'.format(self.backend, servers) kwargs.update( dict(backend=backend, expires=self.expires, options=self.options)) return super(CacheBackend, self).__reduce__(args, kwargs) def as_uri(self, *args, **kwargs): """Return the backend as an URI. This properly handles the case of multiple servers. """ servers = ';'.join(self.servers) return '{0}://{1}/'.format(self.backend, servers)
29.975309
79
0.632208
from __future__ import absolute_import, unicode_literals import sys from kombu.utils.encoding import bytes_to_str, ensure_bytes from kombu.utils.objects import cached_property from celery.exceptions import ImproperlyConfigured from celery.utils.functional import LRUCache from .base import KeyValueStoreBackend __all__ = ['CacheBackend'] _imp = [None] PY3 = sys.version_info[0] == 3 REQUIRES_BACKEND = """\ The Memcached backend requires either pylibmc or python-memcached.\ """ UNKNOWN_BACKEND = """\ The cache backend {0!r} is unknown, Please use one of the following backends instead: {1}\ """ def import_best_memcache(): if _imp[0] is None: is_pylibmc, memcache_key_t = False, ensure_bytes try: import pylibmc as memcache is_pylibmc = True except ImportError: try: import memcache except ImportError: raise ImproperlyConfigured(REQUIRES_BACKEND) if PY3: memcache_key_t = bytes_to_str _imp[0] = (is_pylibmc, memcache, memcache_key_t) return _imp[0] def get_best_memcache(*args, **kwargs): is_pylibmc, memcache, key_t = import_best_memcache() Client = _Client = memcache.Client if not is_pylibmc: def Client(*args, **kwargs): # noqa kwargs.pop('behaviors', None) return _Client(*args, **kwargs) return Client, key_t class DummyClient(object): def __init__(self, *args, **kwargs): self.cache = LRUCache(limit=5000) def get(self, key, *args, **kwargs): return self.cache.get(key) def get_multi(self, keys): cache = self.cache return {k: cache[k] for k in keys if k in cache} def set(self, key, value, *args, **kwargs): self.cache[key] = value def delete(self, key, *args, **kwargs): self.cache.pop(key, None) def incr(self, key, delta=1): return self.cache.incr(key, delta) def touch(self, key, expire): pass backends = { 'memcache': get_best_memcache, 'memcached': get_best_memcache, 'pylibmc': get_best_memcache, 'memory': lambda: (DummyClient, ensure_bytes), } class CacheBackend(KeyValueStoreBackend): servers = None supports_autoexpire = True supports_native_join = True implements_incr = True def __init__(self, app, expires=None, backend=None, options={}, url=None, **kwargs): super(CacheBackend, self).__init__(app, **kwargs) self.url = url self.options = dict(self.app.conf.cache_backend_options, **options) self.backend = url or backend or self.app.conf.cache_backend if self.backend: self.backend, _, servers = self.backend.partition('://') self.servers = servers.rstrip('/').split(';') self.expires = self.prepare_expires(expires, type=int) try: self.Client, self.key_t = backends[self.backend]() except KeyError: raise ImproperlyConfigured(UNKNOWN_BACKEND.format( self.backend, ', '.join(backends))) self._encode_prefixes() # rencode the keyprefixes def get(self, key): return self.client.get(key) def mget(self, keys): return self.client.get_multi(keys) def set(self, key, value): return self.client.set(key, value, self.expires) def delete(self, key): return self.client.delete(key) def _apply_chord_incr(self, header, partial_args, group_id, body, **opts): self.client.set(self.get_key_for_chord(group_id), 0, time=self.expires) return super(CacheBackend, self)._apply_chord_incr( header, partial_args, group_id, body, **opts) def incr(self, key): return self.client.incr(key) def expire(self, key, value): return self.client.touch(key, value) @cached_property def client(self): return self.Client(self.servers, **self.options) def __reduce__(self, args=(), kwargs={}): servers = ';'.join(self.servers) backend = '{0}://{1}/'.format(self.backend, servers) kwargs.update( dict(backend=backend, expires=self.expires, options=self.options)) return super(CacheBackend, self).__reduce__(args, kwargs) def as_uri(self, *args, **kwargs): servers = ';'.join(self.servers) return '{0}://{1}/'.format(self.backend, servers)
true
true
1c453bfaaf39c5377c870fdd45ad36ff26553b79
13,662
py
Python
Behavioral decoding/HPC code/Flint_HPC_BDP_S_test.py
Next-Generation-Neural-Interfaces/Hardware-efficient-MUA-compression
853c6e0f3d085812e88fd0572ac7c64a172255d7
[ "MIT" ]
null
null
null
Behavioral decoding/HPC code/Flint_HPC_BDP_S_test.py
Next-Generation-Neural-Interfaces/Hardware-efficient-MUA-compression
853c6e0f3d085812e88fd0572ac7c64a172255d7
[ "MIT" ]
null
null
null
Behavioral decoding/HPC code/Flint_HPC_BDP_S_test.py
Next-Generation-Neural-Interfaces/Hardware-efficient-MUA-compression
853c6e0f3d085812e88fd0572ac7c64a172255d7
[ "MIT" ]
1
2022-02-23T21:52:02.000Z
2022-02-23T21:52:02.000Z
""" Evaluating spike-based BMI decoding using Wiener filter Load Flint data from matlab. HPC version. """ # import packages import numpy as np from HPC_working_dir.functions.preprocess import input_shaping, split_index from HPC_working_dir.functions.decoders import WienerCascadeDecoder from HPC_working_dir.functions.metrics import compute_rmse, compute_pearson import time as timer import pickle from scipy import io import copy import os from os.path import exists def moving_average(a, n=3) : a = np.hstack((np.zeros(n-1),a)) ret = np.cumsum(a, dtype=float) ret[n:] = ret[n:] - ret[:-n] return ret[n - 1:] / n # Create formatted data folder on HPC directory "working_directory", upload # formatted data (only the .mat files, all_binned_data.pkl not required) to it, # and add the path below. # Create a results_test_Flint folder, and add the path below. # Upload filenames_Flint_test.txt to the HPC "working_directory". def BDP_for_S_and_BP(): # Path to HPC working directory (where neural data and results folders are loctaed) working_directory = '' if working_directory == '': print('Fill in path to working directory') return 0 file_names = working_directory + 'filenames_Flint_test.txt' # Directories mat_folder = working_directory + 'neural_data/' # spike features folder result_folder = working_directory + 'results_test_Flint/' # results folder delta_time_vec = [0.001, 0.005, 0.01, 0.02, 0.05, 0.1] time_steps_vec = [5, 10, 15] lag_values_vec = [0, 5, 10] window_len_vec = [0, 0.05, 0.1, 0.2] alpha_vec = [0, 1e-4, 1e-2] degree_vec = [2,3,4] regular = 'l2' # regularisation type num_fold = 5 # number of cross-validation folds PBS_ARRAY_INDEX = int(os.environ['PBS_ARRAY_INDEX']) print('PBS_ARRAY_INDEX: ' + str(PBS_ARRAY_INDEX)) print ("Starting simulation") run_start = timer.time() # Look at all stored file names, we have it this way so the indexing is # consistent, always relative to the .txt file with open(file_names) as f: lines = f.readlines() # Rec indexing PBS_ARRAY_INDEX_rec = PBS_ARRAY_INDEX % len(lines) count_1 = int(np.floor(PBS_ARRAY_INDEX/(len(lines)))) # BP indexing PBS_ARRAY_INDEX_BP = count_1 % len(delta_time_vec) count_2 = int(np.floor(count_1/(len(delta_time_vec)))) # Wdw indexing PBS_ARRAY_INDEX_wdw = count_2 % len(window_len_vec) delta_time = delta_time_vec[PBS_ARRAY_INDEX_BP] file_name = lines[PBS_ARRAY_INDEX_rec].replace('\n','') wdw_time = window_len_vec[PBS_ARRAY_INDEX_wdw] print('BP: ' + str(delta_time*1000) + '; Rec-sub: ' + file_name + ' - wdw: ' + str(wdw_time)) # Load neural data mat_filename = mat_folder+file_name + '_BP_'+ str(int(delta_time*1000))+'_ms.mat' print ("Loading input features from file: "+mat_filename) f = io.loadmat(mat_filename) model = WienerCascadeDecoder() # instantiate model # Moving average window wdw_samples = int(np.round(wdw_time / delta_time)) input_feature_1 = f['binned_MUA'][:] cursor_vel_1 = f['collated_hand_vel'][:] # in mm/s print('input shape: ' + str(np.shape(input_feature_1))) print('output shape: ' + str(np.shape(cursor_vel_1))) for timesteps in time_steps_vec: input_feature = copy.deepcopy(input_feature_1) cursor_vel = copy.deepcopy(cursor_vel_1[:,:2]) # ignore z-axis input_dim = input_feature.shape[1] # input dimension output_dim = cursor_vel.shape[1] # output dimension NOTE CHANGE FOR ORIG # Initialise performance scores (RMSE and CC) with nan values rmse_valid = np.full((num_fold,output_dim),np.nan) rmse_test = np.copy(rmse_valid) cc_valid = np.copy(rmse_valid) cc_test = np.copy(rmse_valid) time_train = np.full((num_fold),np.nan) time_test = np.copy(time_train) print ("Formatting input feature data") stride = 1 # number of samples to be skipped X_in = input_shaping(input_feature,timesteps,stride) X_in = X_in.reshape(X_in.shape[0],(X_in.shape[1]*X_in.shape[2]),order='F') print ("Formatting output (kinematic) data") diff_samp = cursor_vel.shape[0]-X_in.shape[0] Y_out = cursor_vel[diff_samp:,:] # in mm/s (remove it for new corrected velocity) print ("Splitting input dataset into training, validation, and testing subdataset") all_train_idx,all_valid_idx,all_test_idx = split_index(X_in,num_fold) S_vector = np.arange(2,40) copy_X_in = copy.deepcopy(X_in) for S in S_vector: X_in = copy.deepcopy(copy_X_in) # Clip dynamic range X_in[X_in>S] = S print('S: ' + str(S)) # Moving average window if wdw_samples != 0: for channel in np.arange(len(X_in[0,:])): X_in[:,channel] = moving_average(X_in[:,channel],wdw_samples) for lag_value in lag_values_vec: lag = int(-0.004 / delta_time * lag_value) # lag between kinematic and ´neural data (minus indicates neural input occurs before kinematic) for alpha in alpha_vec: for degree in degree_vec: params = {'timesteps':timesteps, 'regular': regular, 'alpha':alpha, 'degree':degree} # Storing evaluation results into pkl file result_filename = result_folder+file_name+\ '_delta_'+str(int(delta_time*1e3))+'ms_S_'+str(int(S))+\ '_wdw_' + str(int(wdw_time*1000)) + '_lag_'+str(lag_value)\ + '_timestep_'+str(timesteps) +\ '_alpha_' + str(alpha) + '_deg_' \ + str(degree) + '.pkl' if exists(result_filename): print('Results exist \n') continue for i in range(num_fold): train_idx = all_train_idx[i] valid_idx = all_valid_idx[i] test_idx = all_test_idx[i] # specify training dataset X_train = X_in[train_idx,:] Y_train = Y_out[train_idx,:] # specify validation dataset X_valid = X_in[valid_idx,:] Y_valid = Y_out[valid_idx,:] # specify validation dataset X_test = X_in[test_idx,:] Y_test = Y_out[test_idx,:] # Standardise (z-score) input dataset X_train_mean = np.nanmean(X_train,axis=0) X_train_std = np.nanstd(X_train,axis=0) X_train = (X_train - X_train_mean)/X_train_std X_valid = (X_valid - X_train_mean)/X_train_std X_test = (X_test - X_train_mean)/X_train_std # Remove nan columns remove = np.isnan(X_train[0,:]) X_train = np.delete(X_train,remove,1) X_valid = np.delete(X_valid,remove,1) X_test = np.delete(X_test,remove,1) # Zero mean (centering) output dataset Y_train_mean = np.nanmean(Y_train,axis=0) Y_train = Y_train - Y_train_mean Y_valid = Y_valid - Y_train_mean Y_test = Y_test - Y_train_mean #Re-align data to take lag into account if lag < 0: X_train = X_train[:lag,:] # remove lag first from end (X lag behind Y) Y_train = Y_train[-lag:,:] # reomve lag first from beginning X_valid = X_valid[:lag,:] Y_valid = Y_valid[-lag:,:] X_test = X_test[:lag,:] Y_test = Y_test[-lag:,:] if lag > 0: X_train = X_train[lag:,:] # remove lag first from beginning Y_train = Y_train[:-lag,:] # remove lag first from end (X lead in front of Y) X_valid = X_valid[lag:,:] Y_valid = Y_valid[:-lag,:] X_test = X_test[lag:,:] Y_test = Y_test[:-lag,:] print("Instantiating and training model...") model = WienerCascadeDecoder() # instantiate model start = timer.time() model.fit(X_train,Y_train,**params) # train model end = timer.time() print("Model training took {:.2f} seconds".format(end - start)) time_train[i] = end - start print("Evaluating model...") Y_valid_predict = model.predict(X_valid) start = timer.time() Y_test_predict = model.predict(X_test) end = timer.time() print("Model testing took {:.2f} seconds".format(end - start)) time_test[i] = end - start # Compute performance metrics rmse_vld = compute_rmse(Y_valid,Y_valid_predict) rmse_tst = compute_rmse(Y_test,Y_test_predict) cc_vld = compute_pearson(Y_valid,Y_valid_predict) cc_tst = compute_pearson(Y_test,Y_test_predict) rmse_valid[i,:] = rmse_vld rmse_test[i,:] = rmse_tst cc_valid[i,:] = cc_vld cc_test[i,:] = cc_tst print("Fold-{} | Validation RMSE: {:.2f}".format(i,np.mean(rmse_vld))) print("Fold-{} | Validation CC: {:.2f}".format(i,np.mean(cc_vld))) print("Fold-{} | Testing RMSE: {:.2f}".format(i,np.mean(rmse_tst))) print("Fold-{} | Testing CC: {:.2f}".format(i,np.mean(cc_tst))) run_end = timer.time() mean_rmse_valid = np.nanmean(rmse_valid,axis=0) mean_rmse_test = np.nanmean(rmse_test,axis=0) mean_cc_valid = np.nanmean(cc_valid,axis=0) mean_cc_test = np.nanmean(cc_test,axis=0) mean_time = np.nanmean(time_train,axis=0) print("----------------------------------------------------------------------") print("Validation Mean RMSE: %.3f " %(np.mean(mean_rmse_valid))) print("Validation Mean CC: %.3f " %(np.mean(mean_cc_valid))) print("Testing Mean RMSE: %.3f " %(np.mean(mean_rmse_test))) print("Testing Mean CC: %.3f " %(np.mean(mean_cc_test))) print("----------------------------------------------------------------------") print ("Storing results into file: "+result_filename) # Store results with open(result_filename, 'wb') as file: results = {'rmse_valid': rmse_valid, 'rmse_test': rmse_test, 'cc_valid': cc_valid, 'cc_test': cc_test} # Shows how much of the validation data is used for assignment vs CR #'Y_true': Y_test, # Shows how much of the validation data is used for assignment vs CR #'Y_predict': Y_test_predict} # A new file will be created pickle.dump(results, file) run_time = run_end - run_start print ("Finished whole processes within %.2f seconds" % run_time) print("All done")
48.792857
155
0.480091
import numpy as np from HPC_working_dir.functions.preprocess import input_shaping, split_index from HPC_working_dir.functions.decoders import WienerCascadeDecoder from HPC_working_dir.functions.metrics import compute_rmse, compute_pearson import time as timer import pickle from scipy import io import copy import os from os.path import exists def moving_average(a, n=3) : a = np.hstack((np.zeros(n-1),a)) ret = np.cumsum(a, dtype=float) ret[n:] = ret[n:] - ret[:-n] return ret[n - 1:] / n def BDP_for_S_and_BP(): working_directory = '' if working_directory == '': print('Fill in path to working directory') return 0 file_names = working_directory + 'filenames_Flint_test.txt' mat_folder = working_directory + 'neural_data/' result_folder = working_directory + 'results_test_Flint/' delta_time_vec = [0.001, 0.005, 0.01, 0.02, 0.05, 0.1] time_steps_vec = [5, 10, 15] lag_values_vec = [0, 5, 10] window_len_vec = [0, 0.05, 0.1, 0.2] alpha_vec = [0, 1e-4, 1e-2] degree_vec = [2,3,4] regular = 'l2' num_fold = 5 PBS_ARRAY_INDEX = int(os.environ['PBS_ARRAY_INDEX']) print('PBS_ARRAY_INDEX: ' + str(PBS_ARRAY_INDEX)) print ("Starting simulation") run_start = timer.time() with open(file_names) as f: lines = f.readlines() PBS_ARRAY_INDEX_rec = PBS_ARRAY_INDEX % len(lines) count_1 = int(np.floor(PBS_ARRAY_INDEX/(len(lines)))) PBS_ARRAY_INDEX_BP = count_1 % len(delta_time_vec) count_2 = int(np.floor(count_1/(len(delta_time_vec)))) PBS_ARRAY_INDEX_wdw = count_2 % len(window_len_vec) delta_time = delta_time_vec[PBS_ARRAY_INDEX_BP] file_name = lines[PBS_ARRAY_INDEX_rec].replace('\n','') wdw_time = window_len_vec[PBS_ARRAY_INDEX_wdw] print('BP: ' + str(delta_time*1000) + '; Rec-sub: ' + file_name + ' - wdw: ' + str(wdw_time)) mat_filename = mat_folder+file_name + '_BP_'+ str(int(delta_time*1000))+'_ms.mat' print ("Loading input features from file: "+mat_filename) f = io.loadmat(mat_filename) model = WienerCascadeDecoder() wdw_samples = int(np.round(wdw_time / delta_time)) input_feature_1 = f['binned_MUA'][:] cursor_vel_1 = f['collated_hand_vel'][:] print('input shape: ' + str(np.shape(input_feature_1))) print('output shape: ' + str(np.shape(cursor_vel_1))) for timesteps in time_steps_vec: input_feature = copy.deepcopy(input_feature_1) cursor_vel = copy.deepcopy(cursor_vel_1[:,:2]) input_dim = input_feature.shape[1] output_dim = cursor_vel.shape[1] rmse_valid = np.full((num_fold,output_dim),np.nan) rmse_test = np.copy(rmse_valid) cc_valid = np.copy(rmse_valid) cc_test = np.copy(rmse_valid) time_train = np.full((num_fold),np.nan) time_test = np.copy(time_train) print ("Formatting input feature data") stride = 1 X_in = input_shaping(input_feature,timesteps,stride) X_in = X_in.reshape(X_in.shape[0],(X_in.shape[1]*X_in.shape[2]),order='F') print ("Formatting output (kinematic) data") diff_samp = cursor_vel.shape[0]-X_in.shape[0] Y_out = cursor_vel[diff_samp:,:] print ("Splitting input dataset into training, validation, and testing subdataset") all_train_idx,all_valid_idx,all_test_idx = split_index(X_in,num_fold) S_vector = np.arange(2,40) copy_X_in = copy.deepcopy(X_in) for S in S_vector: X_in = copy.deepcopy(copy_X_in) X_in[X_in>S] = S print('S: ' + str(S)) if wdw_samples != 0: for channel in np.arange(len(X_in[0,:])): X_in[:,channel] = moving_average(X_in[:,channel],wdw_samples) for lag_value in lag_values_vec: lag = int(-0.004 / delta_time * lag_value) for alpha in alpha_vec: for degree in degree_vec: params = {'timesteps':timesteps, 'regular': regular, 'alpha':alpha, 'degree':degree} result_filename = result_folder+file_name+\ '_delta_'+str(int(delta_time*1e3))+'ms_S_'+str(int(S))+\ '_wdw_' + str(int(wdw_time*1000)) + '_lag_'+str(lag_value)\ + '_timestep_'+str(timesteps) +\ '_alpha_' + str(alpha) + '_deg_' \ + str(degree) + '.pkl' if exists(result_filename): print('Results exist \n') continue for i in range(num_fold): train_idx = all_train_idx[i] valid_idx = all_valid_idx[i] test_idx = all_test_idx[i] X_train = X_in[train_idx,:] Y_train = Y_out[train_idx,:] X_valid = X_in[valid_idx,:] Y_valid = Y_out[valid_idx,:] X_test = X_in[test_idx,:] Y_test = Y_out[test_idx,:] X_train_mean = np.nanmean(X_train,axis=0) X_train_std = np.nanstd(X_train,axis=0) X_train = (X_train - X_train_mean)/X_train_std X_valid = (X_valid - X_train_mean)/X_train_std X_test = (X_test - X_train_mean)/X_train_std remove = np.isnan(X_train[0,:]) X_train = np.delete(X_train,remove,1) X_valid = np.delete(X_valid,remove,1) X_test = np.delete(X_test,remove,1) Y_train_mean = np.nanmean(Y_train,axis=0) Y_train = Y_train - Y_train_mean Y_valid = Y_valid - Y_train_mean Y_test = Y_test - Y_train_mean if lag < 0: X_train = X_train[:lag,:] Y_train = Y_train[-lag:,:] X_valid = X_valid[:lag,:] Y_valid = Y_valid[-lag:,:] X_test = X_test[:lag,:] Y_test = Y_test[-lag:,:] if lag > 0: X_train = X_train[lag:,:] Y_train = Y_train[:-lag,:] X_valid = X_valid[lag:,:] Y_valid = Y_valid[:-lag,:] X_test = X_test[lag:,:] Y_test = Y_test[:-lag,:] print("Instantiating and training model...") model = WienerCascadeDecoder() start = timer.time() model.fit(X_train,Y_train,**params) end = timer.time() print("Model training took {:.2f} seconds".format(end - start)) time_train[i] = end - start print("Evaluating model...") Y_valid_predict = model.predict(X_valid) start = timer.time() Y_test_predict = model.predict(X_test) end = timer.time() print("Model testing took {:.2f} seconds".format(end - start)) time_test[i] = end - start rmse_vld = compute_rmse(Y_valid,Y_valid_predict) rmse_tst = compute_rmse(Y_test,Y_test_predict) cc_vld = compute_pearson(Y_valid,Y_valid_predict) cc_tst = compute_pearson(Y_test,Y_test_predict) rmse_valid[i,:] = rmse_vld rmse_test[i,:] = rmse_tst cc_valid[i,:] = cc_vld cc_test[i,:] = cc_tst print("Fold-{} | Validation RMSE: {:.2f}".format(i,np.mean(rmse_vld))) print("Fold-{} | Validation CC: {:.2f}".format(i,np.mean(cc_vld))) print("Fold-{} | Testing RMSE: {:.2f}".format(i,np.mean(rmse_tst))) print("Fold-{} | Testing CC: {:.2f}".format(i,np.mean(cc_tst))) run_end = timer.time() mean_rmse_valid = np.nanmean(rmse_valid,axis=0) mean_rmse_test = np.nanmean(rmse_test,axis=0) mean_cc_valid = np.nanmean(cc_valid,axis=0) mean_cc_test = np.nanmean(cc_test,axis=0) mean_time = np.nanmean(time_train,axis=0) print("----------------------------------------------------------------------") print("Validation Mean RMSE: %.3f " %(np.mean(mean_rmse_valid))) print("Validation Mean CC: %.3f " %(np.mean(mean_cc_valid))) print("Testing Mean RMSE: %.3f " %(np.mean(mean_rmse_test))) print("Testing Mean CC: %.3f " %(np.mean(mean_cc_test))) print("----------------------------------------------------------------------") print ("Storing results into file: "+result_filename) with open(result_filename, 'wb') as file: results = {'rmse_valid': rmse_valid, 'rmse_test': rmse_test, 'cc_valid': cc_valid, 'cc_test': cc_test} pickle.dump(results, file) run_time = run_end - run_start print ("Finished whole processes within %.2f seconds" % run_time) print("All done")
true
true
1c453de5d7c24725e9fd95307eec625076dae59e
9,931
py
Python
hchztests/tests/test_container_virtualssh.py
codedsk/hubcheck-hubzero-tests
89dd7164fed9161a5bf80e0a5635cec3da5be31d
[ "MIT" ]
1
2016-01-02T01:36:14.000Z
2016-01-02T01:36:14.000Z
hchztests/tests/test_container_virtualssh.py
codedsk/hubcheck-hubzero-tests
89dd7164fed9161a5bf80e0a5635cec3da5be31d
[ "MIT" ]
null
null
null
hchztests/tests/test_container_virtualssh.py
codedsk/hubcheck-hubzero-tests
89dd7164fed9161a5bf80e0a5635cec3da5be31d
[ "MIT" ]
null
null
null
import hubcheck import os import pytest import re import sys pytestmark = [ pytest.mark.container, pytest.mark.virtualssh, pytest.mark.reboot ] class TestToolSession(hubcheck.testcase.TestCase2): def setup_method(self,method): self.username,self.userpass = \ self.testdata.find_account_for('registeredworkspace') hubname = self.testdata.find_url_for('https') self.session = hubcheck.shell.ToolSession( host=hubname, username=self.username, password=self.userpass) self._session_number = -1 self.shell = None def teardown_method(self,method): if self.shell is not None: self.shell.close() if self._session_number > 0: self.session.stop(self._session_number) del(self.session) def test_session_help(self): """test issuing the 'session help' command""" i,o,e = self.session.help() output = o.read(1024) assert output != '', "output is empty, no help data printed" # def test_session_access_1(self): # """test issuing 'ssh user@<hub> session' # interactive shell without pty is not currently supported # """ # shell = self.session.access(use_pty=False) # # since there is no pty, there is no prompt and # # we cannot use the execute() function # shell.send('echo $SESSION') # buf = self.get_buffer() # idx = shell.expect(['(\d+)']) # assert idx == 0,"echo $SESSION returned '%s'" % (buf) # def test_session_access_2_1(self): # """test issuing 'ssh -t user@<hub> session' # with no other open sessions # """ # # self.shell = self.session.access() # output,es = self.shell.execute('echo hi') # assert output == 'hi',"output = %s" % (output) def test_session_access_2_2(self): """test issuing 'ssh -t user@<hub> session' with other open sessions """ # start up a session so we can get the session number i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number self.shell = self.session.access() output,es = self.shell.execute('echo hi') assert output == 'hi',"output = %s" % (output) # def test_session_access_3_1(self): # """test issuing 'ssh -t user@<hub> session <command>' # with no other open sessions # """ # # i,o,e = self.session.access(command='echo hi') # output = o.read(1024) # assert output == 'hi\n',"output = %s" % (output) def test_session_access_3_2(self): """test issuing 'ssh -t user@<hub> session <command>' with other open sessions """ # start up a session so we can get the session number i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number i,o,e = self.session.access(command='echo hi') output = o.read(1024) assert output == 'hi\n',"output = %s" % (output) def test_session_access_4(self): """test issuing 'ssh -t user@<hub> session <session #>' """ # start up a session so we can get the session number i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number # try to access the newly started session self.shell = self.session.access(session_number=session_number) output,es = self.shell.execute('echo $SESSION') assert int(output) > 0,"output = %s" % (output) def test_session_access_5(self): """test issuing 'ssh -t user@<hub> session <session #> <command>' """ # start up a session so we can get the session number i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number # access the newly started session to run a command i,o,e = self.session.access( session_number=session_number, command='echo $SESSION') output = int(re.search('(\d+)',o.read(1024)).group(0)) assert session_number == output, "output = %s" % (output) def test_session_list(self): """test issuing 'ssh user@<hub> session list'""" i,o,e = self.session.list() output = o.read(1024) assert output != '',"output of list command is empty" def test_session_create_1(self): """test issuing 'ssh user@<hub> session create'""" i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "output = %s\ninvalid session number: %s" % \ (output,session_number) self._session_number = session_number def test_session_create_2(self): """test issuing 'ssh user@<hub> session create <title>'""" i,o,e = self.session.create(title="hc_test_workspace") output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "output = %s\ninvalid session number: %s" % \ (output,session_number) self._session_number = session_number def test_session_start(self): """test issuing 'ssh -t user@<hub> session start'""" self.shell = self.session.start() output,es = self.shell.execute('echo $SESSION') assert int(output) > 0,"output = %s" % (output) self._session_number = int(output) def test_session_stop(self): """test issuing 'ssh -t user@<hub> session stop <session #>'""" # start up a session so we can get the session number i,o,e = self.session.create() session_number = int(re.search('(\d+)',o.read(1024)).group(0)) assert session_number > 0, "session_number = %s" % (session_number) self._session_number = session_number # stop the session i,o,e = self.session.stop(session_number=session_number) output = o.read(1024) # 'stopping session' message doesnt seem to come across stdout or stderr # match = re.search("stopping session (\d+)",output) # # self.assertTrue(match is not None,"output = %s" % (output)) # # out_session_number = match.group(0) # self.assertTrue(out_session_number == session_number, # "out_session_number = %s\nsession_number=%s" % \ # (out_session_number,session_number)) # self._session_number = -1 def test_get_open_session_detail_1(self): """test that get_open_session_detail, a wrapper for 'session list', returns a dict""" data = self.session.get_open_session_detail() def test_get_open_session_detail_2(self): """test that opening a new session shows up in get_open_session_detail""" self.shell = self.session.start() session_number = int(self.shell.execute('echo $SESSION')[0]) assert session_number > 0, \ "invalid session number: %s" % (session_number) self._session_number = session_number # account for the 5 seconds it takes between when the # session is created to when the 'session list' command # is updated import time time.sleep(5) data = self.session.get_open_session_detail() # check if the session number shows up in the # 'session list' command output has_session = False for session_info in data.values(): if int(session_info['session_number']) == session_number: has_session = True break assert has_session, \ "newly opened session number %d does not appear in %s" % \ (session_number,data) def test_get_session_number_by_title_1(self): """test searching the 'session list' command for a session by title when there is a matching title. """ title = 'tstest1' # start a test session with a title i,o,e = self.session.create(title) output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "invalid session number: %s\noutput = '%s'" % \ (session_number,output) self._session_number = session_number # account for the 5 seconds it takes between when the # session is created to when the 'session list' command # is updated import time time.sleep(5) test_sn = int(self.session.get_session_number_by_title(title)) assert session_number == test_sn, \ "session_number = '%s', test_sn = '%s', output = '%s'" % \ (session_number,test_sn,output) def test_get_session_number_by_title_2(self): """test searching the 'session list' command for a session by title when there is no matching title. """ title = 'tstest2' test_sn = int(self.session.get_session_number_by_title(title)) assert test_sn == -1, "test_sn = '%s'" % (test_sn)
32.243506
93
0.598631
import hubcheck import os import pytest import re import sys pytestmark = [ pytest.mark.container, pytest.mark.virtualssh, pytest.mark.reboot ] class TestToolSession(hubcheck.testcase.TestCase2): def setup_method(self,method): self.username,self.userpass = \ self.testdata.find_account_for('registeredworkspace') hubname = self.testdata.find_url_for('https') self.session = hubcheck.shell.ToolSession( host=hubname, username=self.username, password=self.userpass) self._session_number = -1 self.shell = None def teardown_method(self,method): if self.shell is not None: self.shell.close() if self._session_number > 0: self.session.stop(self._session_number) del(self.session) def test_session_help(self): i,o,e = self.session.help() output = o.read(1024) assert output != '', "output is empty, no help data printed" # interactive shell without pty is not currently supported # """ sion_access_2_2(self): i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number self.shell = self.session.access() output,es = self.shell.execute('echo hi') assert output == 'hi',"output = %s" % (output) # with no other open sessions # """ def test_session_access_3_2(self): i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number i,o,e = self.session.access(command='echo hi') output = o.read(1024) assert output == 'hi\n',"output = %s" % (output) def test_session_access_4(self): i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number self.shell = self.session.access(session_number=session_number) output,es = self.shell.execute('echo $SESSION') assert int(output) > 0,"output = %s" % (output) def test_session_access_5(self): i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "session_number = %s\noutput = %s" % (session_number,output) self._session_number = session_number i,o,e = self.session.access( session_number=session_number, command='echo $SESSION') output = int(re.search('(\d+)',o.read(1024)).group(0)) assert session_number == output, "output = %s" % (output) def test_session_list(self): i,o,e = self.session.list() output = o.read(1024) assert output != '',"output of list command is empty" def test_session_create_1(self): i,o,e = self.session.create() output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "output = %s\ninvalid session number: %s" % \ (output,session_number) self._session_number = session_number def test_session_create_2(self): i,o,e = self.session.create(title="hc_test_workspace") output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "output = %s\ninvalid session number: %s" % \ (output,session_number) self._session_number = session_number def test_session_start(self): self.shell = self.session.start() output,es = self.shell.execute('echo $SESSION') assert int(output) > 0,"output = %s" % (output) self._session_number = int(output) def test_session_stop(self): i,o,e = self.session.create() session_number = int(re.search('(\d+)',o.read(1024)).group(0)) assert session_number > 0, "session_number = %s" % (session_number) self._session_number = session_number i,o,e = self.session.stop(session_number=session_number) output = o.read(1024) self._session_number = -1 def test_get_open_session_detail_1(self): data = self.session.get_open_session_detail() def test_get_open_session_detail_2(self): self.shell = self.session.start() session_number = int(self.shell.execute('echo $SESSION')[0]) assert session_number > 0, \ "invalid session number: %s" % (session_number) self._session_number = session_number import time time.sleep(5) data = self.session.get_open_session_detail() has_session = False for session_info in data.values(): if int(session_info['session_number']) == session_number: has_session = True break assert has_session, \ "newly opened session number %d does not appear in %s" % \ (session_number,data) def test_get_session_number_by_title_1(self): title = 'tstest1' i,o,e = self.session.create(title) output = o.read(1024) session_number = int(re.search('(\d+)',output).group(0)) assert session_number > 0, \ "invalid session number: %s\noutput = '%s'" % \ (session_number,output) self._session_number = session_number import time time.sleep(5) test_sn = int(self.session.get_session_number_by_title(title)) assert session_number == test_sn, \ "session_number = '%s', test_sn = '%s', output = '%s'" % \ (session_number,test_sn,output) def test_get_session_number_by_title_2(self): title = 'tstest2' test_sn = int(self.session.get_session_number_by_title(title)) assert test_sn == -1, "test_sn = '%s'" % (test_sn)
true
true
1c453f426ef1cb4b8320f235713f540c29364267
14,600
py
Python
shade/tests/unit/test__utils.py
obourdon/shade
6d9a821d722d270bf9b04827a8a65bddbaa68266
[ "Apache-2.0" ]
null
null
null
shade/tests/unit/test__utils.py
obourdon/shade
6d9a821d722d270bf9b04827a8a65bddbaa68266
[ "Apache-2.0" ]
null
null
null
shade/tests/unit/test__utils.py
obourdon/shade
6d9a821d722d270bf9b04827a8a65bddbaa68266
[ "Apache-2.0" ]
null
null
null
# -*- coding: utf-8 -*- # Licensed under the Apache License, Version 2.0 (the "License"); you may # not use this file except in compliance with the License. You may obtain # a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, WITHOUT # WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the # License for the specific language governing permissions and limitations # under the License. import random import string import tempfile from uuid import uuid4 import mock import testtools from shade import _utils from shade import exc from shade.tests.unit import base RANGE_DATA = [ dict(id=1, key1=1, key2=5), dict(id=2, key1=1, key2=20), dict(id=3, key1=2, key2=10), dict(id=4, key1=2, key2=30), dict(id=5, key1=3, key2=40), dict(id=6, key1=3, key2=40), ] class TestUtils(base.TestCase): def test__filter_list_name_or_id(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto') data = [el1, el2] ret = _utils._filter_list(data, 'donald', None) self.assertEqual([el1], ret) def test__filter_list_name_or_id_special(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto[2017-01-10]', None) self.assertEqual([el2], ret) def test__filter_list_name_or_id_partial_bad(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto[2017-01]', None) self.assertEqual([], ret) def test__filter_list_name_or_id_partial_glob(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto*', None) self.assertEqual([el2], ret) def test__filter_list_name_or_id_non_glob_glob(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto', None) self.assertEqual([], ret) def test__filter_list_name_or_id_glob(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto') el3 = dict(id=200, name='pluto-2') data = [el1, el2, el3] ret = _utils._filter_list(data, 'pluto*', None) self.assertEqual([el2, el3], ret) def test__filter_list_name_or_id_glob_not_found(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto') el3 = dict(id=200, name='pluto-2') data = [el1, el2, el3] ret = _utils._filter_list(data, 'q*', None) self.assertEqual([], ret) def test__filter_list_unicode(self): el1 = dict(id=100, name=u'中文', last='duck', other=dict(category='duck', financial=dict(status='poor'))) el2 = dict(id=200, name=u'中文', last='trump', other=dict(category='human', financial=dict(status='rich'))) el3 = dict(id=300, name='donald', last='ronald mac', other=dict(category='clown', financial=dict(status='rich'))) data = [el1, el2, el3] ret = _utils._filter_list( data, u'中文', {'other': { 'financial': {'status': 'rich'} }}) self.assertEqual([el2], ret) def test__filter_list_filter(self): el1 = dict(id=100, name='donald', other='duck') el2 = dict(id=200, name='donald', other='trump') data = [el1, el2] ret = _utils._filter_list(data, 'donald', {'other': 'duck'}) self.assertEqual([el1], ret) def test__filter_list_filter_jmespath(self): el1 = dict(id=100, name='donald', other='duck') el2 = dict(id=200, name='donald', other='trump') data = [el1, el2] ret = _utils._filter_list(data, 'donald', "[?other == `duck`]") self.assertEqual([el1], ret) def test__filter_list_dict1(self): el1 = dict(id=100, name='donald', last='duck', other=dict(category='duck')) el2 = dict(id=200, name='donald', last='trump', other=dict(category='human')) el3 = dict(id=300, name='donald', last='ronald mac', other=dict(category='clown')) data = [el1, el2, el3] ret = _utils._filter_list( data, 'donald', {'other': {'category': 'clown'}}) self.assertEqual([el3], ret) def test__filter_list_dict2(self): el1 = dict(id=100, name='donald', last='duck', other=dict(category='duck', financial=dict(status='poor'))) el2 = dict(id=200, name='donald', last='trump', other=dict(category='human', financial=dict(status='rich'))) el3 = dict(id=300, name='donald', last='ronald mac', other=dict(category='clown', financial=dict(status='rich'))) data = [el1, el2, el3] ret = _utils._filter_list( data, 'donald', {'other': { 'financial': {'status': 'rich'} }}) self.assertEqual([el2, el3], ret) def test_safe_dict_min_ints(self): """Test integer comparison""" data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_strs(self): """Test integer as strings comparison""" data = [{'f1': '3'}, {'f1': '2'}, {'f1': '1'}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_None(self): """Test None values""" data = [{'f1': 3}, {'f1': None}, {'f1': 1}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_key_missing(self): """Test missing key for an entry still works""" data = [{'f1': 3}, {'x': 2}, {'f1': 1}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_key_not_found(self): """Test key not found in any elements returns None""" data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_min('doesnotexist', data) self.assertIsNone(retval) def test_safe_dict_min_not_int(self): """Test non-integer key value raises OSCE""" data = [{'f1': 3}, {'f1': "aaa"}, {'f1': 1}] with testtools.ExpectedException( exc.OpenStackCloudException, "Search for minimum value failed. " "Value for f1 is not an integer: aaa" ): _utils.safe_dict_min('f1', data) def test_safe_dict_max_ints(self): """Test integer comparison""" data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_strs(self): """Test integer as strings comparison""" data = [{'f1': '3'}, {'f1': '2'}, {'f1': '1'}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_None(self): """Test None values""" data = [{'f1': 3}, {'f1': None}, {'f1': 1}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_key_missing(self): """Test missing key for an entry still works""" data = [{'f1': 3}, {'x': 2}, {'f1': 1}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_key_not_found(self): """Test key not found in any elements returns None""" data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_max('doesnotexist', data) self.assertIsNone(retval) def test_safe_dict_max_not_int(self): """Test non-integer key value raises OSCE""" data = [{'f1': 3}, {'f1': "aaa"}, {'f1': 1}] with testtools.ExpectedException( exc.OpenStackCloudException, "Search for maximum value failed. " "Value for f1 is not an integer: aaa" ): _utils.safe_dict_max('f1', data) def test_parse_range_None(self): self.assertIsNone(_utils.parse_range(None)) def test_parse_range_invalid(self): self.assertIsNone(_utils.parse_range("<invalid")) def test_parse_range_int_only(self): retval = _utils.parse_range("1024") self.assertIsInstance(retval, tuple) self.assertIsNone(retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_lt(self): retval = _utils.parse_range("<1024") self.assertIsInstance(retval, tuple) self.assertEqual("<", retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_gt(self): retval = _utils.parse_range(">1024") self.assertIsInstance(retval, tuple) self.assertEqual(">", retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_le(self): retval = _utils.parse_range("<=1024") self.assertIsInstance(retval, tuple) self.assertEqual("<=", retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_ge(self): retval = _utils.parse_range(">=1024") self.assertIsInstance(retval, tuple) self.assertEqual(">=", retval[0]) self.assertEqual(1024, retval[1]) def test_range_filter_min(self): retval = _utils.range_filter(RANGE_DATA, "key1", "min") self.assertIsInstance(retval, list) self.assertEqual(2, len(retval)) self.assertEqual(RANGE_DATA[:2], retval) def test_range_filter_max(self): retval = _utils.range_filter(RANGE_DATA, "key1", "max") self.assertIsInstance(retval, list) self.assertEqual(2, len(retval)) self.assertEqual(RANGE_DATA[-2:], retval) def test_range_filter_range(self): retval = _utils.range_filter(RANGE_DATA, "key1", "<3") self.assertIsInstance(retval, list) self.assertEqual(4, len(retval)) self.assertEqual(RANGE_DATA[:4], retval) def test_range_filter_exact(self): retval = _utils.range_filter(RANGE_DATA, "key1", "2") self.assertIsInstance(retval, list) self.assertEqual(2, len(retval)) self.assertEqual(RANGE_DATA[2:4], retval) def test_range_filter_invalid_int(self): with testtools.ExpectedException( exc.OpenStackCloudException, "Invalid range value: <1A0" ): _utils.range_filter(RANGE_DATA, "key1", "<1A0") def test_range_filter_invalid_op(self): with testtools.ExpectedException( exc.OpenStackCloudException, "Invalid range value: <>100" ): _utils.range_filter(RANGE_DATA, "key1", "<>100") def test_file_segment(self): file_size = 4200 content = ''.join(random.SystemRandom().choice( string.ascii_uppercase + string.digits) for _ in range(file_size)).encode('latin-1') self.imagefile = tempfile.NamedTemporaryFile(delete=False) self.imagefile.write(content) self.imagefile.close() segments = self.cloud._get_file_segments( endpoint='test_container/test_image', filename=self.imagefile.name, file_size=file_size, segment_size=1000) self.assertEqual(len(segments), 5) segment_content = b'' for (index, (name, segment)) in enumerate(segments.items()): self.assertEqual( 'test_container/test_image/{index:0>6}'.format(index=index), name) segment_content += segment.read() self.assertEqual(content, segment_content) def test_get_entity_pass_object(self): obj = mock.Mock(id=uuid4().hex) self.cloud.use_direct_get = True self.assertEqual(obj, _utils._get_entity(self.cloud, '', obj, {})) def test_get_entity_no_use_direct_get(self): # test we are defaulting to the search_<resource> methods # if the use_direct_get flag is set to False(default). uuid = uuid4().hex resource = 'network' func = 'search_%ss' % resource filters = {} with mock.patch.object(self.cloud, func) as search: _utils._get_entity(self.cloud, resource, uuid, filters) search.assert_called_once_with(uuid, filters) def test_get_entity_no_uuid_like(self): # test we are defaulting to the search_<resource> methods # if the name_or_id param is a name(string) but not a uuid. self.cloud.use_direct_get = True name = 'name_no_uuid' resource = 'network' func = 'search_%ss' % resource filters = {} with mock.patch.object(self.cloud, func) as search: _utils._get_entity(self.cloud, resource, name, filters) search.assert_called_once_with(name, filters) def test_get_entity_pass_uuid(self): uuid = uuid4().hex self.cloud.use_direct_get = True resources = ['flavor', 'image', 'volume', 'network', 'subnet', 'port', 'floating_ip', 'security_group'] for r in resources: f = 'get_%s_by_id' % r with mock.patch.object(self.cloud, f) as get: _utils._get_entity(self.cloud, r, uuid, {}) get.assert_called_once_with(uuid) def test_get_entity_pass_search_methods(self): self.cloud.use_direct_get = True resources = ['flavor', 'image', 'volume', 'network', 'subnet', 'port', 'floating_ip', 'security_group'] filters = {} name = 'name_no_uuid' for r in resources: f = 'search_%ss' % r with mock.patch.object(self.cloud, f) as search: _utils._get_entity(self.cloud, r, name, {}) search.assert_called_once_with(name, filters) def test_get_entity_get_and_search(self): resources = ['flavor', 'image', 'volume', 'network', 'subnet', 'port', 'floating_ip', 'security_group'] for r in resources: self.assertTrue(hasattr(self.cloud, 'get_%s_by_id' % r)) self.assertTrue(hasattr(self.cloud, 'search_%ss' % r))
38.32021
79
0.597603
import random import string import tempfile from uuid import uuid4 import mock import testtools from shade import _utils from shade import exc from shade.tests.unit import base RANGE_DATA = [ dict(id=1, key1=1, key2=5), dict(id=2, key1=1, key2=20), dict(id=3, key1=2, key2=10), dict(id=4, key1=2, key2=30), dict(id=5, key1=3, key2=40), dict(id=6, key1=3, key2=40), ] class TestUtils(base.TestCase): def test__filter_list_name_or_id(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto') data = [el1, el2] ret = _utils._filter_list(data, 'donald', None) self.assertEqual([el1], ret) def test__filter_list_name_or_id_special(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto[2017-01-10]', None) self.assertEqual([el2], ret) def test__filter_list_name_or_id_partial_bad(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto[2017-01]', None) self.assertEqual([], ret) def test__filter_list_name_or_id_partial_glob(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto*', None) self.assertEqual([el2], ret) def test__filter_list_name_or_id_non_glob_glob(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto[2017-01-10]') data = [el1, el2] ret = _utils._filter_list(data, 'pluto', None) self.assertEqual([], ret) def test__filter_list_name_or_id_glob(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto') el3 = dict(id=200, name='pluto-2') data = [el1, el2, el3] ret = _utils._filter_list(data, 'pluto*', None) self.assertEqual([el2, el3], ret) def test__filter_list_name_or_id_glob_not_found(self): el1 = dict(id=100, name='donald') el2 = dict(id=200, name='pluto') el3 = dict(id=200, name='pluto-2') data = [el1, el2, el3] ret = _utils._filter_list(data, 'q*', None) self.assertEqual([], ret) def test__filter_list_unicode(self): el1 = dict(id=100, name=u'中文', last='duck', other=dict(category='duck', financial=dict(status='poor'))) el2 = dict(id=200, name=u'中文', last='trump', other=dict(category='human', financial=dict(status='rich'))) el3 = dict(id=300, name='donald', last='ronald mac', other=dict(category='clown', financial=dict(status='rich'))) data = [el1, el2, el3] ret = _utils._filter_list( data, u'中文', {'other': { 'financial': {'status': 'rich'} }}) self.assertEqual([el2], ret) def test__filter_list_filter(self): el1 = dict(id=100, name='donald', other='duck') el2 = dict(id=200, name='donald', other='trump') data = [el1, el2] ret = _utils._filter_list(data, 'donald', {'other': 'duck'}) self.assertEqual([el1], ret) def test__filter_list_filter_jmespath(self): el1 = dict(id=100, name='donald', other='duck') el2 = dict(id=200, name='donald', other='trump') data = [el1, el2] ret = _utils._filter_list(data, 'donald', "[?other == `duck`]") self.assertEqual([el1], ret) def test__filter_list_dict1(self): el1 = dict(id=100, name='donald', last='duck', other=dict(category='duck')) el2 = dict(id=200, name='donald', last='trump', other=dict(category='human')) el3 = dict(id=300, name='donald', last='ronald mac', other=dict(category='clown')) data = [el1, el2, el3] ret = _utils._filter_list( data, 'donald', {'other': {'category': 'clown'}}) self.assertEqual([el3], ret) def test__filter_list_dict2(self): el1 = dict(id=100, name='donald', last='duck', other=dict(category='duck', financial=dict(status='poor'))) el2 = dict(id=200, name='donald', last='trump', other=dict(category='human', financial=dict(status='rich'))) el3 = dict(id=300, name='donald', last='ronald mac', other=dict(category='clown', financial=dict(status='rich'))) data = [el1, el2, el3] ret = _utils._filter_list( data, 'donald', {'other': { 'financial': {'status': 'rich'} }}) self.assertEqual([el2, el3], ret) def test_safe_dict_min_ints(self): data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_strs(self): data = [{'f1': '3'}, {'f1': '2'}, {'f1': '1'}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_None(self): data = [{'f1': 3}, {'f1': None}, {'f1': 1}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_key_missing(self): data = [{'f1': 3}, {'x': 2}, {'f1': 1}] retval = _utils.safe_dict_min('f1', data) self.assertEqual(1, retval) def test_safe_dict_min_key_not_found(self): data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_min('doesnotexist', data) self.assertIsNone(retval) def test_safe_dict_min_not_int(self): data = [{'f1': 3}, {'f1': "aaa"}, {'f1': 1}] with testtools.ExpectedException( exc.OpenStackCloudException, "Search for minimum value failed. " "Value for f1 is not an integer: aaa" ): _utils.safe_dict_min('f1', data) def test_safe_dict_max_ints(self): data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_strs(self): data = [{'f1': '3'}, {'f1': '2'}, {'f1': '1'}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_None(self): data = [{'f1': 3}, {'f1': None}, {'f1': 1}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_key_missing(self): data = [{'f1': 3}, {'x': 2}, {'f1': 1}] retval = _utils.safe_dict_max('f1', data) self.assertEqual(3, retval) def test_safe_dict_max_key_not_found(self): data = [{'f1': 3}, {'f1': 2}, {'f1': 1}] retval = _utils.safe_dict_max('doesnotexist', data) self.assertIsNone(retval) def test_safe_dict_max_not_int(self): data = [{'f1': 3}, {'f1': "aaa"}, {'f1': 1}] with testtools.ExpectedException( exc.OpenStackCloudException, "Search for maximum value failed. " "Value for f1 is not an integer: aaa" ): _utils.safe_dict_max('f1', data) def test_parse_range_None(self): self.assertIsNone(_utils.parse_range(None)) def test_parse_range_invalid(self): self.assertIsNone(_utils.parse_range("<invalid")) def test_parse_range_int_only(self): retval = _utils.parse_range("1024") self.assertIsInstance(retval, tuple) self.assertIsNone(retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_lt(self): retval = _utils.parse_range("<1024") self.assertIsInstance(retval, tuple) self.assertEqual("<", retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_gt(self): retval = _utils.parse_range(">1024") self.assertIsInstance(retval, tuple) self.assertEqual(">", retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_le(self): retval = _utils.parse_range("<=1024") self.assertIsInstance(retval, tuple) self.assertEqual("<=", retval[0]) self.assertEqual(1024, retval[1]) def test_parse_range_ge(self): retval = _utils.parse_range(">=1024") self.assertIsInstance(retval, tuple) self.assertEqual(">=", retval[0]) self.assertEqual(1024, retval[1]) def test_range_filter_min(self): retval = _utils.range_filter(RANGE_DATA, "key1", "min") self.assertIsInstance(retval, list) self.assertEqual(2, len(retval)) self.assertEqual(RANGE_DATA[:2], retval) def test_range_filter_max(self): retval = _utils.range_filter(RANGE_DATA, "key1", "max") self.assertIsInstance(retval, list) self.assertEqual(2, len(retval)) self.assertEqual(RANGE_DATA[-2:], retval) def test_range_filter_range(self): retval = _utils.range_filter(RANGE_DATA, "key1", "<3") self.assertIsInstance(retval, list) self.assertEqual(4, len(retval)) self.assertEqual(RANGE_DATA[:4], retval) def test_range_filter_exact(self): retval = _utils.range_filter(RANGE_DATA, "key1", "2") self.assertIsInstance(retval, list) self.assertEqual(2, len(retval)) self.assertEqual(RANGE_DATA[2:4], retval) def test_range_filter_invalid_int(self): with testtools.ExpectedException( exc.OpenStackCloudException, "Invalid range value: <1A0" ): _utils.range_filter(RANGE_DATA, "key1", "<1A0") def test_range_filter_invalid_op(self): with testtools.ExpectedException( exc.OpenStackCloudException, "Invalid range value: <>100" ): _utils.range_filter(RANGE_DATA, "key1", "<>100") def test_file_segment(self): file_size = 4200 content = ''.join(random.SystemRandom().choice( string.ascii_uppercase + string.digits) for _ in range(file_size)).encode('latin-1') self.imagefile = tempfile.NamedTemporaryFile(delete=False) self.imagefile.write(content) self.imagefile.close() segments = self.cloud._get_file_segments( endpoint='test_container/test_image', filename=self.imagefile.name, file_size=file_size, segment_size=1000) self.assertEqual(len(segments), 5) segment_content = b'' for (index, (name, segment)) in enumerate(segments.items()): self.assertEqual( 'test_container/test_image/{index:0>6}'.format(index=index), name) segment_content += segment.read() self.assertEqual(content, segment_content) def test_get_entity_pass_object(self): obj = mock.Mock(id=uuid4().hex) self.cloud.use_direct_get = True self.assertEqual(obj, _utils._get_entity(self.cloud, '', obj, {})) def test_get_entity_no_use_direct_get(self): uuid = uuid4().hex resource = 'network' func = 'search_%ss' % resource filters = {} with mock.patch.object(self.cloud, func) as search: _utils._get_entity(self.cloud, resource, uuid, filters) search.assert_called_once_with(uuid, filters) def test_get_entity_no_uuid_like(self): self.cloud.use_direct_get = True name = 'name_no_uuid' resource = 'network' func = 'search_%ss' % resource filters = {} with mock.patch.object(self.cloud, func) as search: _utils._get_entity(self.cloud, resource, name, filters) search.assert_called_once_with(name, filters) def test_get_entity_pass_uuid(self): uuid = uuid4().hex self.cloud.use_direct_get = True resources = ['flavor', 'image', 'volume', 'network', 'subnet', 'port', 'floating_ip', 'security_group'] for r in resources: f = 'get_%s_by_id' % r with mock.patch.object(self.cloud, f) as get: _utils._get_entity(self.cloud, r, uuid, {}) get.assert_called_once_with(uuid) def test_get_entity_pass_search_methods(self): self.cloud.use_direct_get = True resources = ['flavor', 'image', 'volume', 'network', 'subnet', 'port', 'floating_ip', 'security_group'] filters = {} name = 'name_no_uuid' for r in resources: f = 'search_%ss' % r with mock.patch.object(self.cloud, f) as search: _utils._get_entity(self.cloud, r, name, {}) search.assert_called_once_with(name, filters) def test_get_entity_get_and_search(self): resources = ['flavor', 'image', 'volume', 'network', 'subnet', 'port', 'floating_ip', 'security_group'] for r in resources: self.assertTrue(hasattr(self.cloud, 'get_%s_by_id' % r)) self.assertTrue(hasattr(self.cloud, 'search_%ss' % r))
true
true
1c453fdbba1ac5b86f5831ece9560ce0e7000157
2,630
py
Python
pytext/utils/distributed.py
twild-fb/pytext
07cadc0d130dac30d71d9da70380f124b3f5ac59
[ "BSD-3-Clause" ]
2
2019-06-27T21:32:26.000Z
2019-10-16T06:20:25.000Z
pytext/utils/distributed.py
twild-fb/pytext
07cadc0d130dac30d71d9da70380f124b3f5ac59
[ "BSD-3-Clause" ]
null
null
null
pytext/utils/distributed.py
twild-fb/pytext
07cadc0d130dac30d71d9da70380f124b3f5ac59
[ "BSD-3-Clause" ]
1
2019-10-16T06:20:26.000Z
2019-10-16T06:20:26.000Z
#!/usr/bin/env python3 # Copyright (c) Facebook, Inc. and its affiliates. All Rights Reserved import torch import torch.distributed as dist_c10d def dist_init( distributed_rank: int, world_size: int, init_method: str, device_id: int, backend: str = "nccl", ): """ 1. After spawn process per GPU, we want all workers to call init_process_group around the same time or times out. 2. After dist_init, we want all workers to start calling all_reduce/barrier around the same time or NCCL timeouts. """ if init_method and world_size > 1 and torch.cuda.is_available(): dist_c10d.init_process_group( backend=backend, init_method=init_method, world_size=world_size, rank=distributed_rank, ) # calling all_reduce for synchronzing all workers dist_tensor = torch.tensor( [1], dtype=torch.float32, device="cuda:{}".format(device_id) ) dist_c10d.all_reduce(dist_tensor) if distributed_rank != 0: suppress_output() def suppress_output(): import builtins as __builtin__ builtin_print = __builtin__.print def print(*args, **kwargs): # force print the result when kwargs contains force and value is True if kwargs.pop("force", False): builtin_print(*args, **kwargs) __builtin__.print = print def get_shard_range(dataset_size: int, rank: int, world_size: int): """ In case dataset_size is not evenly divided by world_size, we need to pad one extra example in each shard shard_len = dataset_size // world_size + 1 Case 1 rank < remainder: each shard start position is rank * shard_len Case 2 rank >= remainder: without padding, each shard start position is rank * (shard_len - 1) + remainder = rank * shard_len - (rank - remainder) But to make sure all shard have same size, we need to pad one extra example when rank >= remainder, so start_position = start_position - 1 For example, dataset_size = 21, world_size = 8 rank 0 to 4: [0, 1, 2], [3, 4, 5], [6, 7, 8], [9, 10, 11], [12, 13, 14] rank 5 to 7: [14, 15, 16], [16, 17, 18], [18, 19, 20] """ remainder = dataset_size % world_size shard_len = dataset_size // world_size if remainder == 0: shard_offset = rank * shard_len else: # take one extra when dataset_size is not evenly divided by world_size shard_len += 1 shard_offset = rank * shard_len - max(0, rank + 1 - remainder) shard_end = shard_offset + shard_len - 1 return (shard_offset, shard_end)
32.875
82
0.653232
import torch import torch.distributed as dist_c10d def dist_init( distributed_rank: int, world_size: int, init_method: str, device_id: int, backend: str = "nccl", ): if init_method and world_size > 1 and torch.cuda.is_available(): dist_c10d.init_process_group( backend=backend, init_method=init_method, world_size=world_size, rank=distributed_rank, ) dist_tensor = torch.tensor( [1], dtype=torch.float32, device="cuda:{}".format(device_id) ) dist_c10d.all_reduce(dist_tensor) if distributed_rank != 0: suppress_output() def suppress_output(): import builtins as __builtin__ builtin_print = __builtin__.print def print(*args, **kwargs): if kwargs.pop("force", False): builtin_print(*args, **kwargs) __builtin__.print = print def get_shard_range(dataset_size: int, rank: int, world_size: int): remainder = dataset_size % world_size shard_len = dataset_size // world_size if remainder == 0: shard_offset = rank * shard_len else: shard_len += 1 shard_offset = rank * shard_len - max(0, rank + 1 - remainder) shard_end = shard_offset + shard_len - 1 return (shard_offset, shard_end)
true
true
1c4542bacaf77780be537b1e01682b77026b72b7
1,980
py
Python
twitter_bot.py
sankarsh98/Twitter-Bot
34e7503ef31c452ff596a60aba8bfbb7fecf08b6
[ "MIT" ]
7
2021-12-12T16:34:19.000Z
2022-02-14T12:07:56.000Z
twitter_bot.py
sankarsh98/Twitter-Bot
34e7503ef31c452ff596a60aba8bfbb7fecf08b6
[ "MIT" ]
1
2021-12-12T17:00:04.000Z
2021-12-12T17:00:04.000Z
twitter_bot.py
sankarsh98/Twitter-Bot
34e7503ef31c452ff596a60aba8bfbb7fecf08b6
[ "MIT" ]
1
2021-12-12T13:21:52.000Z
2021-12-12T13:21:52.000Z
import time from selenium import webdriver from selenium.common.exceptions import NoSuchElementException from selenium.webdriver.common.keys import Keys # path to chrome driver, download it from https://sites.google.com/a/chromium.org/chromedriver/downloads chrome_driver = "/Users/sanky/Downloads/chromedriver" class TwitterBot: def __init__(self,username,password,mobile): self.browser=webdriver.Chrome(chrome_driver) self.username=username self.password=password self.mobile=mobile # signin to the account def signIn(self): self.browser.get("https://www.twitter.com/login") time.sleep(5) usernameInput = self.browser.find_element_by_name('text') usernameInput.send_keys(self.username) time.sleep(3) self.browser.maximize_window() nextButton1 = self.browser.find_element_by_xpath('//span[.="Next"]') nextButton1.click() time.sleep(3) try: middleInput = self.browser.find_element_by_name('text') middleInput.send_keys(self.mobile) time.sleep(3) nextButton2 = self.browser.find_element_by_xpath('//span[.="Next"]') nextButton2.click() time.sleep(3) except NoSuchElementException: print ("exception") passwordInput = self.browser.find_element_by_xpath('//input[@name="password"]') passwordInput.send_keys(self.password) # passwordInput.send_keys(Keys.ENTER) time.sleep(5) loginButton = self.browser.find_element_by_xpath('//span[.="Log in"]') loginButton.click() def TweetSomething(self, message): time.sleep(5) tweet_button = self.browser.find_element_by_xpath('//span[.="Tweet"]') tweet_button.click() tweet = self.browser.find_element_by_xpath('//div[@aria-label="Tweet text"]') tweet.send_keys(message) tweet.send_keys(Keys.COMMAND, Keys.ENTER)
31.935484
104
0.664646
import time from selenium import webdriver from selenium.common.exceptions import NoSuchElementException from selenium.webdriver.common.keys import Keys chrome_driver = "/Users/sanky/Downloads/chromedriver" class TwitterBot: def __init__(self,username,password,mobile): self.browser=webdriver.Chrome(chrome_driver) self.username=username self.password=password self.mobile=mobile def signIn(self): self.browser.get("https://www.twitter.com/login") time.sleep(5) usernameInput = self.browser.find_element_by_name('text') usernameInput.send_keys(self.username) time.sleep(3) self.browser.maximize_window() nextButton1 = self.browser.find_element_by_xpath('//span[.="Next"]') nextButton1.click() time.sleep(3) try: middleInput = self.browser.find_element_by_name('text') middleInput.send_keys(self.mobile) time.sleep(3) nextButton2 = self.browser.find_element_by_xpath('//span[.="Next"]') nextButton2.click() time.sleep(3) except NoSuchElementException: print ("exception") passwordInput = self.browser.find_element_by_xpath('//input[@name="password"]') passwordInput.send_keys(self.password) time.sleep(5) loginButton = self.browser.find_element_by_xpath('//span[.="Log in"]') loginButton.click() def TweetSomething(self, message): time.sleep(5) tweet_button = self.browser.find_element_by_xpath('//span[.="Tweet"]') tweet_button.click() tweet = self.browser.find_element_by_xpath('//div[@aria-label="Tweet text"]') tweet.send_keys(message) tweet.send_keys(Keys.COMMAND, Keys.ENTER)
true
true
1c45432e3476eee07bd3665a03b2d5e4c182b9bb
6,538
py
Python
selfdrive/manager/manager.py
cfranyota/openpilot
977a0d829f0c6e373ffc6c3876d2cff77a1a5df2
[ "MIT" ]
2
2022-01-07T09:00:14.000Z
2022-01-07T10:06:02.000Z
selfdrive/manager/manager.py
cfranyota/openpilot
977a0d829f0c6e373ffc6c3876d2cff77a1a5df2
[ "MIT" ]
null
null
null
selfdrive/manager/manager.py
cfranyota/openpilot
977a0d829f0c6e373ffc6c3876d2cff77a1a5df2
[ "MIT" ]
3
2021-12-18T18:58:35.000Z
2022-01-29T05:05:08.000Z
#!/usr/bin/env python3 import datetime import os import signal import subprocess import sys import traceback from typing import List, Tuple, Union import cereal.messaging as messaging import selfdrive.sentry as sentry from common.basedir import BASEDIR from common.params import Params, ParamKeyType from common.text_window import TextWindow from selfdrive.boardd.set_time import set_time from selfdrive.hardware import HARDWARE, PC from selfdrive.manager.helpers import unblock_stdout from selfdrive.manager.process import ensure_running from selfdrive.manager.process_config import managed_processes from selfdrive.athena.registration import register, UNREGISTERED_DONGLE_ID from selfdrive.swaglog import cloudlog, add_file_handler from selfdrive.version import is_dirty, get_commit, get_version, get_origin, get_short_branch, \ terms_version, training_version sys.path.append(os.path.join(BASEDIR, "pyextra")) def manager_init() -> None: # update system time from panda set_time(cloudlog) # save boot log subprocess.call("./bootlog", cwd=os.path.join(BASEDIR, "selfdrive/loggerd")) params = Params() params.clear_all(ParamKeyType.CLEAR_ON_MANAGER_START) default_params: List[Tuple[str, Union[str, bytes]]] = [ ("CompletedTrainingVersion", "0"), ("HasAcceptedTerms", "0"), ("OpenpilotEnabledToggle", "1"), #("DisableRadar_Allow", "1"), ] if not PC: default_params.append(("LastUpdateTime", datetime.datetime.utcnow().isoformat().encode('utf8'))) if params.get_bool("RecordFrontLock"): params.put_bool("RecordFront", True) if not params.get_bool("DisableRadar_Allow"): params.delete("DisableRadar") # set unset params for k, v in default_params: if params.get(k) is None: params.put(k, v) # is this dashcam? if os.getenv("PASSIVE") is not None: params.put_bool("Passive", bool(int(os.getenv("PASSIVE", "0")))) if params.get("Passive") is None: raise Exception("Passive must be set to continue") # Create folders needed for msgq try: os.mkdir("/dev/shm") except FileExistsError: pass except PermissionError: print("WARNING: failed to make /dev/shm") # set version params params.put("Version", get_version()) params.put("TermsVersion", terms_version) params.put("TrainingVersion", training_version) params.put("GitCommit", get_commit(default="")) params.put("GitBranch", get_short_branch(default="")) params.put("GitRemote", get_origin(default="")) # set dongle id reg_res = register(show_spinner=True) if reg_res: dongle_id = reg_res else: serial = params.get("HardwareSerial") raise Exception(f"Registration failed for device {serial}") os.environ['DONGLE_ID'] = dongle_id # Needed for swaglog if not is_dirty(): os.environ['CLEAN'] = '1' # init logging sentry.init(sentry.SentryProject.SELFDRIVE) cloudlog.bind_global(dongle_id=dongle_id, version=get_version(), dirty=is_dirty(), device=HARDWARE.get_device_type()) def manager_prepare() -> None: for p in managed_processes.values(): p.prepare() def manager_cleanup() -> None: # send signals to kill all procs for p in managed_processes.values(): p.stop(block=False) # ensure all are killed for p in managed_processes.values(): p.stop(block=True) cloudlog.info("everything is dead") def manager_thread() -> None: cloudlog.bind(daemon="manager") cloudlog.info("manager start") cloudlog.info({"environ": os.environ}) params = Params() ignore: List[str] = [] if params.get("DongleId", encoding='utf8') in (None, UNREGISTERED_DONGLE_ID): ignore += ["manage_athenad", "uploader"] if os.getenv("NOBOARD") is not None: ignore.append("pandad") ignore += [x for x in os.getenv("BLOCK", "").split(",") if len(x) > 0] ensure_running(managed_processes.values(), started=False, not_run=ignore) started_prev = False sm = messaging.SubMaster(['deviceState']) pm = messaging.PubMaster(['managerState']) while True: sm.update() not_run = ignore[:] started = sm['deviceState'].started driverview = params.get_bool("IsDriverViewEnabled") ensure_running(managed_processes.values(), started, driverview, not_run) # trigger an update after going offroad if started_prev and not started and 'updated' in managed_processes: os.sync() managed_processes['updated'].signal(signal.SIGHUP) started_prev = started running = ' '.join("%s%s\u001b[0m" % ("\u001b[32m" if p.proc.is_alive() else "\u001b[31m", p.name) for p in managed_processes.values() if p.proc) print(running) cloudlog.debug(running) # send managerState msg = messaging.new_message('managerState') msg.managerState.processes = [p.get_process_state_msg() for p in managed_processes.values()] pm.send('managerState', msg) # Exit main loop when uninstall/shutdown/reboot is needed shutdown = False for param in ("DoUninstall", "DoShutdown", "DoReboot"): if params.get_bool(param): shutdown = True params.put("LastManagerExitReason", param) cloudlog.warning(f"Shutting down manager - {param} set") if shutdown: break def main() -> None: prepare_only = os.getenv("PREPAREONLY") is not None manager_init() # Start UI early so prepare can happen in the background if not prepare_only: managed_processes['ui'].start() manager_prepare() if prepare_only: return # SystemExit on sigterm signal.signal(signal.SIGTERM, lambda signum, frame: sys.exit(1)) try: manager_thread() except Exception: traceback.print_exc() sentry.capture_exception() finally: manager_cleanup() params = Params() if params.get_bool("DoUninstall"): cloudlog.warning("uninstalling") HARDWARE.uninstall() elif params.get_bool("DoReboot"): cloudlog.warning("reboot") HARDWARE.reboot() elif params.get_bool("DoShutdown"): cloudlog.warning("shutdown") HARDWARE.shutdown() if __name__ == "__main__": unblock_stdout() try: main() except Exception: add_file_handler(cloudlog) cloudlog.exception("Manager failed to start") try: managed_processes['ui'].stop() except Exception: pass # Show last 3 lines of traceback error = traceback.format_exc(-3) error = "Manager failed to start\n\n" + error with TextWindow(error) as t: t.wait_for_exit() raise # manual exit because we are forked sys.exit(0)
27.821277
102
0.701285
import datetime import os import signal import subprocess import sys import traceback from typing import List, Tuple, Union import cereal.messaging as messaging import selfdrive.sentry as sentry from common.basedir import BASEDIR from common.params import Params, ParamKeyType from common.text_window import TextWindow from selfdrive.boardd.set_time import set_time from selfdrive.hardware import HARDWARE, PC from selfdrive.manager.helpers import unblock_stdout from selfdrive.manager.process import ensure_running from selfdrive.manager.process_config import managed_processes from selfdrive.athena.registration import register, UNREGISTERED_DONGLE_ID from selfdrive.swaglog import cloudlog, add_file_handler from selfdrive.version import is_dirty, get_commit, get_version, get_origin, get_short_branch, \ terms_version, training_version sys.path.append(os.path.join(BASEDIR, "pyextra")) def manager_init() -> None: set_time(cloudlog) subprocess.call("./bootlog", cwd=os.path.join(BASEDIR, "selfdrive/loggerd")) params = Params() params.clear_all(ParamKeyType.CLEAR_ON_MANAGER_START) default_params: List[Tuple[str, Union[str, bytes]]] = [ ("CompletedTrainingVersion", "0"), ("HasAcceptedTerms", "0"), ("OpenpilotEnabledToggle", "1"), ] if not PC: default_params.append(("LastUpdateTime", datetime.datetime.utcnow().isoformat().encode('utf8'))) if params.get_bool("RecordFrontLock"): params.put_bool("RecordFront", True) if not params.get_bool("DisableRadar_Allow"): params.delete("DisableRadar") for k, v in default_params: if params.get(k) is None: params.put(k, v) if os.getenv("PASSIVE") is not None: params.put_bool("Passive", bool(int(os.getenv("PASSIVE", "0")))) if params.get("Passive") is None: raise Exception("Passive must be set to continue") try: os.mkdir("/dev/shm") except FileExistsError: pass except PermissionError: print("WARNING: failed to make /dev/shm") params.put("Version", get_version()) params.put("TermsVersion", terms_version) params.put("TrainingVersion", training_version) params.put("GitCommit", get_commit(default="")) params.put("GitBranch", get_short_branch(default="")) params.put("GitRemote", get_origin(default="")) reg_res = register(show_spinner=True) if reg_res: dongle_id = reg_res else: serial = params.get("HardwareSerial") raise Exception(f"Registration failed for device {serial}") os.environ['DONGLE_ID'] = dongle_id if not is_dirty(): os.environ['CLEAN'] = '1' sentry.init(sentry.SentryProject.SELFDRIVE) cloudlog.bind_global(dongle_id=dongle_id, version=get_version(), dirty=is_dirty(), device=HARDWARE.get_device_type()) def manager_prepare() -> None: for p in managed_processes.values(): p.prepare() def manager_cleanup() -> None: for p in managed_processes.values(): p.stop(block=False) for p in managed_processes.values(): p.stop(block=True) cloudlog.info("everything is dead") def manager_thread() -> None: cloudlog.bind(daemon="manager") cloudlog.info("manager start") cloudlog.info({"environ": os.environ}) params = Params() ignore: List[str] = [] if params.get("DongleId", encoding='utf8') in (None, UNREGISTERED_DONGLE_ID): ignore += ["manage_athenad", "uploader"] if os.getenv("NOBOARD") is not None: ignore.append("pandad") ignore += [x for x in os.getenv("BLOCK", "").split(",") if len(x) > 0] ensure_running(managed_processes.values(), started=False, not_run=ignore) started_prev = False sm = messaging.SubMaster(['deviceState']) pm = messaging.PubMaster(['managerState']) while True: sm.update() not_run = ignore[:] started = sm['deviceState'].started driverview = params.get_bool("IsDriverViewEnabled") ensure_running(managed_processes.values(), started, driverview, not_run) if started_prev and not started and 'updated' in managed_processes: os.sync() managed_processes['updated'].signal(signal.SIGHUP) started_prev = started running = ' '.join("%s%s\u001b[0m" % ("\u001b[32m" if p.proc.is_alive() else "\u001b[31m", p.name) for p in managed_processes.values() if p.proc) print(running) cloudlog.debug(running) msg = messaging.new_message('managerState') msg.managerState.processes = [p.get_process_state_msg() for p in managed_processes.values()] pm.send('managerState', msg) shutdown = False for param in ("DoUninstall", "DoShutdown", "DoReboot"): if params.get_bool(param): shutdown = True params.put("LastManagerExitReason", param) cloudlog.warning(f"Shutting down manager - {param} set") if shutdown: break def main() -> None: prepare_only = os.getenv("PREPAREONLY") is not None manager_init() if not prepare_only: managed_processes['ui'].start() manager_prepare() if prepare_only: return signal.signal(signal.SIGTERM, lambda signum, frame: sys.exit(1)) try: manager_thread() except Exception: traceback.print_exc() sentry.capture_exception() finally: manager_cleanup() params = Params() if params.get_bool("DoUninstall"): cloudlog.warning("uninstalling") HARDWARE.uninstall() elif params.get_bool("DoReboot"): cloudlog.warning("reboot") HARDWARE.reboot() elif params.get_bool("DoShutdown"): cloudlog.warning("shutdown") HARDWARE.shutdown() if __name__ == "__main__": unblock_stdout() try: main() except Exception: add_file_handler(cloudlog) cloudlog.exception("Manager failed to start") try: managed_processes['ui'].stop() except Exception: pass error = traceback.format_exc(-3) error = "Manager failed to start\n\n" + error with TextWindow(error) as t: t.wait_for_exit() raise sys.exit(0)
true
true
1c45433433a647c579569bbb598afc58791b69df
402
py
Python
utils/convert.py
alanhuang122/skyless-utils
773f23c37a95d97a3346948997b19eccbed8cc24
[ "MIT" ]
2
2018-09-12T19:47:19.000Z
2019-11-07T07:46:10.000Z
utils/convert.py
alanhuang122/skyless-utils
773f23c37a95d97a3346948997b19eccbed8cc24
[ "MIT" ]
11
2018-08-29T01:49:29.000Z
2019-07-08T18:54:16.000Z
utils/convert.py
alanhuang122/skyless-utils
773f23c37a95d97a3346948997b19eccbed8cc24
[ "MIT" ]
null
null
null
import json with open('skyless.dat', 'w') as f: for name in ['areas', 'bargains', 'domiciles', 'events', 'exchanges', 'personae', 'prospects', 'qualities', 'settings', 'ports']: with open(f'{name}.txt') as g: data = json.loads(g.read()) for line in data: f.write(f"{{\"key\": \"{name}:{line['Id']}\", \"value\": {json.dumps(line)}}}\n")
44.666667
133
0.512438
import json with open('skyless.dat', 'w') as f: for name in ['areas', 'bargains', 'domiciles', 'events', 'exchanges', 'personae', 'prospects', 'qualities', 'settings', 'ports']: with open(f'{name}.txt') as g: data = json.loads(g.read()) for line in data: f.write(f"{{\"key\": \"{name}:{line['Id']}\", \"value\": {json.dumps(line)}}}\n")
true
true
1c45439138577fd473020f8d53be33fe6f9ba3bf
421
py
Python
src/config/config.py
burakkkara/SeniorProject
1f878a5c007c910f210c900911897ff34c498b12
[ "Apache-2.0" ]
2
2022-01-10T07:24:06.000Z
2022-01-10T16:19:18.000Z
src/config/config.py
burakkkara/SeniorProject
1f878a5c007c910f210c900911897ff34c498b12
[ "Apache-2.0" ]
null
null
null
src/config/config.py
burakkkara/SeniorProject
1f878a5c007c910f210c900911897ff34c498b12
[ "Apache-2.0" ]
null
null
null
# Primary connection info primary = { 'ip': '192.168.1.34', 'port': 8080 } # Secondary connection info secondary = { 'ip': '192.168.43.38', # 'ip': '192.168.43.3854', 'port': 8081 } # Test server info # Resides on AWS server = { 'ip': '3.134.95.115', 'port': 8080 } # Request info requested = { 'httpVersion': 'http://', 'httpPort': 80, 'httpsPort': 443 } use_anonymous = True
14.517241
30
0.565321
primary = { 'ip': '192.168.1.34', 'port': 8080 } secondary = { 'ip': '192.168.43.38', 'port': 8081 } server = { 'ip': '3.134.95.115', 'port': 8080 } requested = { 'httpVersion': 'http://', 'httpPort': 80, 'httpsPort': 443 } use_anonymous = True
true
true
1c45441e2bef433e828fef7485bbc809e1defc92
1,097
py
Python
tests/nark/log_tests.py
shadowmint/python-nark
7919c544c8386a023f6a9d0ffbc50e1145604528
[ "Apache-2.0" ]
null
null
null
tests/nark/log_tests.py
shadowmint/python-nark
7919c544c8386a023f6a9d0ffbc50e1145604528
[ "Apache-2.0" ]
null
null
null
tests/nark/log_tests.py
shadowmint/python-nark
7919c544c8386a023f6a9d0ffbc50e1145604528
[ "Apache-2.0" ]
null
null
null
# Copyright 2013 Douglas Linder # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at: # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import unittest import bootstrap import nark class LogTests(unittest.TestCase): def test_can_create_logger(self): a = nark.Assert() i = nark.Logging.get() a.not_null(i, "Unable to create log instance") def test_can_log_message(self): a = nark.Assert() i = nark.Logging.get() i.debug("Hello %s", "world") i.info("Hello %s", "world") i.warning("Hello %s", "world") i.error("Hello %s", "world") i.critical("Hello %s", "world") if __name__ == "__main__": unittest.main()
28.868421
74
0.703737
import unittest import bootstrap import nark class LogTests(unittest.TestCase): def test_can_create_logger(self): a = nark.Assert() i = nark.Logging.get() a.not_null(i, "Unable to create log instance") def test_can_log_message(self): a = nark.Assert() i = nark.Logging.get() i.debug("Hello %s", "world") i.info("Hello %s", "world") i.warning("Hello %s", "world") i.error("Hello %s", "world") i.critical("Hello %s", "world") if __name__ == "__main__": unittest.main()
true
true
1c4544f61fe44587878d56854ec0f0a9d3c481cd
9,875
py
Python
src/server.py
HintikkaKimmo/rasa_nlu
cf71683351f86a9880793273c8ce877c411f9de1
[ "Apache-2.0" ]
2
2016-12-20T13:19:44.000Z
2017-01-16T10:44:35.000Z
src/server.py
HintikkaKimmo/rasa_nlu
cf71683351f86a9880793273c8ce877c411f9de1
[ "Apache-2.0" ]
null
null
null
src/server.py
HintikkaKimmo/rasa_nlu
cf71683351f86a9880793273c8ce877c411f9de1
[ "Apache-2.0" ]
1
2017-01-02T15:16:49.000Z
2017-01-02T15:16:49.000Z
import argparse import json import os import urllib.parse import multiprocessing import glob import warnings import logging from http.server import BaseHTTPRequestHandler, HTTPServer from rasa_nlu.train import do_train from rasa_nlu.config import RasaNLUConfig class RasaNLUServer(object): def __init__(self, config): self.server = None self.config = config self.logfile = config.write self.emulator = self.__create_emulator() self.interpreter = self.__create_interpreter() self.data_router = DataRouter(config, self.interpreter, self.emulator) if 'DYNO' in os.environ and config.backend == 'mitie': # running on Heroku from rasa_nlu.featurizers.mitie_featurizer import MITIEFeaturizer MITIEFeaturizer(config.mitie_file) def __create_interpreter(self): model_dir = self.config.server_model_dir metadata, backend = None, None if model_dir is not None: # download model from S3 if needed if not os.path.isdir(model_dir): try: from rasa_nlu.persistor import Persistor p = Persistor(self.config.path, self.config.aws_region, self.config.bucket_name) p.fetch_and_extract('{0}.tar.gz'.format(os.path.basename(model_dir))) except: warnings.warn("using default interpreter, couldn't find model dir or fetch it from S3") metadata = json.loads(open(os.path.join(model_dir, 'metadata.json'), 'rb').read()) backend = metadata["backend"] if backend is None: from .interpreters.simple_interpreter import HelloGoodbyeInterpreter return HelloGoodbyeInterpreter() elif backend.lower() == 'mitie': logging.info("using mitie backend") from .interpreters.mitie_interpreter import MITIEInterpreter return MITIEInterpreter(**metadata) elif backend.lower() == 'spacy_sklearn': logging.info("using spacy + sklearn backend") from .interpreters.spacy_sklearn_interpreter import SpacySklearnInterpreter return SpacySklearnInterpreter(**metadata) else: raise ValueError("unknown backend : {0}".format(backend)) def __create_emulator(self): mode = self.config.emulate if mode is None: from .emulators import NoEmulator return NoEmulator() elif mode.lower() == 'wit': from .emulators.wit import WitEmulator return WitEmulator() elif mode.lower() == 'luis': from .emulators.luis import LUISEmulator return LUISEmulator() elif mode.lower() == 'api': from .emulators.api import ApiEmulator return ApiEmulator() else: raise ValueError("unknown mode : {0}".format(mode)) def start(self): self.server = HTTPServer(('', self.config.port), lambda *args: RasaRequestHandler(self.data_router, *args)) logging.info('Started http server on port %s' % self.config.port) self.server.serve_forever() def stop(self): logging.info('^C received. Aborting.') if len(self.data_router.responses) > 0: logging.info('saving logs') self.data_router.write_logs() if self.server is not None: logging.info('shutting down server') self.server.socket.close() class DataRouter(object): def __init__(self, config, interpreter, emulator): self.config = config self.interpreter = interpreter self.emulator = emulator self.logfile = config.write self.responses = set() self.train_proc = None self.model_dir = config.path self.token = config.token def extract(self, data): return self.emulator.normalise_request_json(data) def parse(self, text): result = self.interpreter.parse(text) self.responses.add(json.dumps(result, sort_keys=True)) return result def format(self, data): return self.emulator.normalise_response_json(data) def write_logs(self): with open(self.logfile, 'w') as f: responses = [json.loads(r) for r in self.responses] f.write(json.dumps(responses, indent=2)) def get_status(self): if self.train_proc is not None: training = self.train_proc.is_alive() else: training = False models = glob.glob(os.path.join(self.model_dir, 'model*')) return json.dumps({ "training": training, "available_models": models }) def auth(self, path): if self.token is None: return True else: parsed_path = urllib.parse.urlparse(path) data = urllib.parse.parse_qs(parsed_path.query) valid = ("token" in data and data["token"][0] == self.token) return valid def start_train_proc(self, data): logging.info("starting train") if self.train_proc is not None and self.train_proc.is_alive(): self.train_proc.terminate() logging.info("training process {0} killed".format(self.train_proc)) fname = 'tmp_training_data.json' with open(fname, 'w') as f: f.write(data) _config = dict(list(self.config.items())) _config["data"] = fname train_config = RasaNLUConfig(cmdline_args=_config) self.train_proc = multiprocessing.Process(target=do_train, args=(train_config,)) self.train_proc.start() logging.info("training process {0} started".format(self.train_proc)) class RasaRequestHandler(BaseHTTPRequestHandler): def __init__(self, data_router, *args): self.data_router = data_router BaseHTTPRequestHandler.__init__(self, *args) def _set_headers(self): self.send_response(200) self.send_header('Content-type', 'application/json') self.end_headers() def auth_err(self): self.send_response(401) self.wfile.write("unauthorized") def get_response(self, data_dict): if 'q' not in data_dict: return json.dumps({"error": "Invalid parse parameter specified"}) data = self.data_router.extract(data_dict) result = self.data_router.parse(data["text"]) response = self.data_router.format(result) return json.dumps(response) def do_GET(self): if self.data_router.auth(self.path): self._set_headers() if self.path.startswith("/parse"): parsed_path = urllib.parse.urlparse(urllib.parse.unquote(self.path)) data = urllib.parse.parse_qs(parsed_path.query) self.wfile.write(self.get_response(data).encode('utf-8')) elif self.path.startswith("/status"): response = self.data_router.get_status() self.wfile.write(response) else: self.wfile.write("hello") else: self.auth_err() return def do_POST(self): if self.data_router.auth(self.path): if self.path.startswith("/parse"): self._set_headers() data_string = self.rfile.read(int(self.headers['Content-Length'])) data_dict = json.loads(data_string.decode("utf-8")) self.wfile.write(self.get_response(data_dict)) if self.path.startswith("/train"): self._set_headers() data_string = self.rfile.read(int(self.headers['Content-Length'])) self.data_router.start_train_proc(data_string) self.data_router.start_train_proc(data_string.decode("utf-8")) self.wfile.write( json.dumps({"info": "training started with pid {0}".format(self.data_router.train_proc.pid)}) ) else: self.auth_err() return def create_argparser(): parser = argparse.ArgumentParser(description='parse incoming text') parser.add_argument('-c', '--config', help="config file, all the command line options can also be passed via a (json-formatted) " + "config file. NB command line args take precedence") parser.add_argument('-d', '--server_model_dir', help='directory containing model to for parser to use') parser.add_argument('-e', '--emulate', choices=['wit', 'luis', 'api'], help='which service to emulate (default: None i.e. use simple built in format)') parser.add_argument('-l', '--language', choices=['de', 'en'], help="model and data language") parser.add_argument('-m', '--mitie_file', help='file with mitie total_word_feature_extractor') parser.add_argument('-p', '--path', help="path where model files will be saved") parser.add_argument('-P', '--port', type=int, help='port on which to run server') parser.add_argument('-t', '--token', help="auth token. If set, reject requests which don't provide this token as a query parameter") parser.add_argument('-w', '--write', help='file where logs will be saved') return parser if __name__ == "__main__": parser = create_argparser() cmdline_args = {key: val for key, val in list(vars(parser.parse_args()).items()) if val is not None} config = RasaNLUConfig(cmdline_args.get("config"), os.environ, cmdline_args) print((config.view())) logging.basicConfig(filename=config.log_file, level=config.log_level) logging.captureWarnings(True) logging.debug(config.view()) try: server = RasaNLUServer(config) server.start() except KeyboardInterrupt: server.stop()
39.342629
119
0.621165
import argparse import json import os import urllib.parse import multiprocessing import glob import warnings import logging from http.server import BaseHTTPRequestHandler, HTTPServer from rasa_nlu.train import do_train from rasa_nlu.config import RasaNLUConfig class RasaNLUServer(object): def __init__(self, config): self.server = None self.config = config self.logfile = config.write self.emulator = self.__create_emulator() self.interpreter = self.__create_interpreter() self.data_router = DataRouter(config, self.interpreter, self.emulator) if 'DYNO' in os.environ and config.backend == 'mitie': from rasa_nlu.featurizers.mitie_featurizer import MITIEFeaturizer MITIEFeaturizer(config.mitie_file) def __create_interpreter(self): model_dir = self.config.server_model_dir metadata, backend = None, None if model_dir is not None: if not os.path.isdir(model_dir): try: from rasa_nlu.persistor import Persistor p = Persistor(self.config.path, self.config.aws_region, self.config.bucket_name) p.fetch_and_extract('{0}.tar.gz'.format(os.path.basename(model_dir))) except: warnings.warn("using default interpreter, couldn't find model dir or fetch it from S3") metadata = json.loads(open(os.path.join(model_dir, 'metadata.json'), 'rb').read()) backend = metadata["backend"] if backend is None: from .interpreters.simple_interpreter import HelloGoodbyeInterpreter return HelloGoodbyeInterpreter() elif backend.lower() == 'mitie': logging.info("using mitie backend") from .interpreters.mitie_interpreter import MITIEInterpreter return MITIEInterpreter(**metadata) elif backend.lower() == 'spacy_sklearn': logging.info("using spacy + sklearn backend") from .interpreters.spacy_sklearn_interpreter import SpacySklearnInterpreter return SpacySklearnInterpreter(**metadata) else: raise ValueError("unknown backend : {0}".format(backend)) def __create_emulator(self): mode = self.config.emulate if mode is None: from .emulators import NoEmulator return NoEmulator() elif mode.lower() == 'wit': from .emulators.wit import WitEmulator return WitEmulator() elif mode.lower() == 'luis': from .emulators.luis import LUISEmulator return LUISEmulator() elif mode.lower() == 'api': from .emulators.api import ApiEmulator return ApiEmulator() else: raise ValueError("unknown mode : {0}".format(mode)) def start(self): self.server = HTTPServer(('', self.config.port), lambda *args: RasaRequestHandler(self.data_router, *args)) logging.info('Started http server on port %s' % self.config.port) self.server.serve_forever() def stop(self): logging.info('^C received. Aborting.') if len(self.data_router.responses) > 0: logging.info('saving logs') self.data_router.write_logs() if self.server is not None: logging.info('shutting down server') self.server.socket.close() class DataRouter(object): def __init__(self, config, interpreter, emulator): self.config = config self.interpreter = interpreter self.emulator = emulator self.logfile = config.write self.responses = set() self.train_proc = None self.model_dir = config.path self.token = config.token def extract(self, data): return self.emulator.normalise_request_json(data) def parse(self, text): result = self.interpreter.parse(text) self.responses.add(json.dumps(result, sort_keys=True)) return result def format(self, data): return self.emulator.normalise_response_json(data) def write_logs(self): with open(self.logfile, 'w') as f: responses = [json.loads(r) for r in self.responses] f.write(json.dumps(responses, indent=2)) def get_status(self): if self.train_proc is not None: training = self.train_proc.is_alive() else: training = False models = glob.glob(os.path.join(self.model_dir, 'model*')) return json.dumps({ "training": training, "available_models": models }) def auth(self, path): if self.token is None: return True else: parsed_path = urllib.parse.urlparse(path) data = urllib.parse.parse_qs(parsed_path.query) valid = ("token" in data and data["token"][0] == self.token) return valid def start_train_proc(self, data): logging.info("starting train") if self.train_proc is not None and self.train_proc.is_alive(): self.train_proc.terminate() logging.info("training process {0} killed".format(self.train_proc)) fname = 'tmp_training_data.json' with open(fname, 'w') as f: f.write(data) _config = dict(list(self.config.items())) _config["data"] = fname train_config = RasaNLUConfig(cmdline_args=_config) self.train_proc = multiprocessing.Process(target=do_train, args=(train_config,)) self.train_proc.start() logging.info("training process {0} started".format(self.train_proc)) class RasaRequestHandler(BaseHTTPRequestHandler): def __init__(self, data_router, *args): self.data_router = data_router BaseHTTPRequestHandler.__init__(self, *args) def _set_headers(self): self.send_response(200) self.send_header('Content-type', 'application/json') self.end_headers() def auth_err(self): self.send_response(401) self.wfile.write("unauthorized") def get_response(self, data_dict): if 'q' not in data_dict: return json.dumps({"error": "Invalid parse parameter specified"}) data = self.data_router.extract(data_dict) result = self.data_router.parse(data["text"]) response = self.data_router.format(result) return json.dumps(response) def do_GET(self): if self.data_router.auth(self.path): self._set_headers() if self.path.startswith("/parse"): parsed_path = urllib.parse.urlparse(urllib.parse.unquote(self.path)) data = urllib.parse.parse_qs(parsed_path.query) self.wfile.write(self.get_response(data).encode('utf-8')) elif self.path.startswith("/status"): response = self.data_router.get_status() self.wfile.write(response) else: self.wfile.write("hello") else: self.auth_err() return def do_POST(self): if self.data_router.auth(self.path): if self.path.startswith("/parse"): self._set_headers() data_string = self.rfile.read(int(self.headers['Content-Length'])) data_dict = json.loads(data_string.decode("utf-8")) self.wfile.write(self.get_response(data_dict)) if self.path.startswith("/train"): self._set_headers() data_string = self.rfile.read(int(self.headers['Content-Length'])) self.data_router.start_train_proc(data_string) self.data_router.start_train_proc(data_string.decode("utf-8")) self.wfile.write( json.dumps({"info": "training started with pid {0}".format(self.data_router.train_proc.pid)}) ) else: self.auth_err() return def create_argparser(): parser = argparse.ArgumentParser(description='parse incoming text') parser.add_argument('-c', '--config', help="config file, all the command line options can also be passed via a (json-formatted) " + "config file. NB command line args take precedence") parser.add_argument('-d', '--server_model_dir', help='directory containing model to for parser to use') parser.add_argument('-e', '--emulate', choices=['wit', 'luis', 'api'], help='which service to emulate (default: None i.e. use simple built in format)') parser.add_argument('-l', '--language', choices=['de', 'en'], help="model and data language") parser.add_argument('-m', '--mitie_file', help='file with mitie total_word_feature_extractor') parser.add_argument('-p', '--path', help="path where model files will be saved") parser.add_argument('-P', '--port', type=int, help='port on which to run server') parser.add_argument('-t', '--token', help="auth token. If set, reject requests which don't provide this token as a query parameter") parser.add_argument('-w', '--write', help='file where logs will be saved') return parser if __name__ == "__main__": parser = create_argparser() cmdline_args = {key: val for key, val in list(vars(parser.parse_args()).items()) if val is not None} config = RasaNLUConfig(cmdline_args.get("config"), os.environ, cmdline_args) print((config.view())) logging.basicConfig(filename=config.log_file, level=config.log_level) logging.captureWarnings(True) logging.debug(config.view()) try: server = RasaNLUServer(config) server.start() except KeyboardInterrupt: server.stop()
true
true
1c4545eeb5ecae107979a9aeead1b4bcf5bbd9f8
1,011
py
Python
var/spack/repos/builtin/packages/r-lsei/package.py
adrianjhpc/spack
0a9e4fcee57911f2db586aa50c8873d9cca8de92
[ "ECL-2.0", "Apache-2.0", "MIT" ]
2
2020-10-15T01:08:42.000Z
2021-10-18T01:28:18.000Z
var/spack/repos/builtin/packages/r-lsei/package.py
adrianjhpc/spack
0a9e4fcee57911f2db586aa50c8873d9cca8de92
[ "ECL-2.0", "Apache-2.0", "MIT" ]
2
2019-07-30T10:12:28.000Z
2019-12-17T09:02:27.000Z
var/spack/repos/builtin/packages/r-lsei/package.py
adrianjhpc/spack
0a9e4fcee57911f2db586aa50c8873d9cca8de92
[ "ECL-2.0", "Apache-2.0", "MIT" ]
5
2019-07-30T09:42:14.000Z
2021-01-25T05:39:20.000Z
# Copyright 2013-2019 Lawrence Livermore National Security, LLC and other # Spack Project Developers. See the top-level COPYRIGHT file for details. # # SPDX-License-Identifier: (Apache-2.0 OR MIT) from spack import * class RLsei(RPackage): """It contains functions that solve least squares linear regression problems under linear equality/inequality constraints. Functions for solving quadratic programming problems are also available, which transform such problems into least squares ones first. It is developed based on the 'Fortran' program of Lawson and Hanson (1974, 1995), which is public domain and available at <http://www.netlib.org/lawson-hanson>.""" homepage = "https://cloud.r-project.org/package=lsei" url = "https://cloud.r-project.org/src/contrib/lsei_1.2-0.tar.gz" list_url = "https://cloud.r-project.org/src/contrib/Archive/lsei" version('1.2-0', sha256='4781ebd9ef93880260d5d5f23066580ac06061e95c1048fb25e4e838963380f6')
43.956522
95
0.736894
from spack import * class RLsei(RPackage): homepage = "https://cloud.r-project.org/package=lsei" url = "https://cloud.r-project.org/src/contrib/lsei_1.2-0.tar.gz" list_url = "https://cloud.r-project.org/src/contrib/Archive/lsei" version('1.2-0', sha256='4781ebd9ef93880260d5d5f23066580ac06061e95c1048fb25e4e838963380f6')
true
true
1c45462adfeb644306dbba088d37aea211810842
77,143
py
Python
if/python/hpdf.py
yabaud/libharu
d84867ebf9f3de6afd661d2cdaff102457fbc371
[ "Zlib" ]
1,118
2015-01-09T10:40:33.000Z
2022-03-28T08:19:56.000Z
if/python/hpdf.py
yabaud/libharu
d84867ebf9f3de6afd661d2cdaff102457fbc371
[ "Zlib" ]
148
2015-01-09T02:47:40.000Z
2022-03-31T21:10:14.000Z
if/python/hpdf.py
yabaud/libharu
d84867ebf9f3de6afd661d2cdaff102457fbc371
[ "Zlib" ]
394
2015-01-23T17:06:52.000Z
2022-03-25T03:50:06.000Z
## ## * << Haru Free PDF Library 2.0.8 >> -- hpdf.h ## * ## * URL http://libharu.org/ ## * ## * Copyright (c) 1999-2006 Takeshi Kanno ## * ## * Permission to use, copy, modify, distribute and sell this software ## * and its documentation for any purpose is hereby granted without fee, ## * provided that the above copyright notice appear in all copies and ## * that both that copyright notice and this permission notice appear ## * in supporting documentation. ## * It is provided "as is" without express or implied warranty. ## * ## ## port to python by Li Jun ## http://groups.google.com/group/pythoncia import os import sys import types def setpath(): dllpath='%s/dll' %(os.path.dirname(os.path.realpath(__file__))) if 'PATH' in os.environ: if dllpath not in os.environ['PATH']: os.environ['PATH']='%s;%s' % (dllpath, os.environ['PATH']) else: os.environ['PATH']=dllpath setpath() from hpdf_consts import * from hpdf_types import * if os.sys.platform=='win32': harudll='libhpdf.dll' #haru=WinDLL(harudll) haru=CDLL(harudll) else: harudll='libhpdf.so' haru=CDLL(harudll) HPDF_HANDLE=c_void_p HPDF_Doc=HPDF_HANDLE HPDF_Page=HPDF_HANDLE HPDF_Pages=HPDF_HANDLE HPDF_Stream=HPDF_HANDLE HPDF_Image=HPDF_HANDLE HPDF_Font=HPDF_HANDLE HPDF_Outline=HPDF_HANDLE HPDF_Encoder=HPDF_HANDLE HPDF_Destination=HPDF_HANDLE HPDF_XObject=HPDF_HANDLE HPDF_Annotation=HPDF_HANDLE HPDF_ExtGState=HPDF_HANDLE #const char * HPDF_GetVersion (void) HPDF_GetVersion=haru.HPDF_GetVersion HPDF_GetVersion.restype=c_char_p #HPDF_Doc HPDF_NewEx (HPDF_Error_Handler user_error_fn, HPDF_Alloc_Func user_alloc_fn, HPDF_Free_Func user_free_fn, HPDF_UINT mem_pool_buf_size, void *user_data) HPDF_NewEx=haru.HPDF_NewEx HPDF_NewEx.restype=HPDF_Doc #HPDF_Doc HPDF_New (HPDF_Error_Handler user_error_fn, void *user_data) HPDF_New=haru.HPDF_New HPDF_New.restype=HPDF_Doc #HPDF_STATUS HPDF_SetErrorHandler (HPDF_Doc pdf, HPDF_Error_Handler user_error_fn) HPDF_SetErrorHandler=haru.HPDF_SetErrorHandler HPDF_SetErrorHandler.restype=HPDF_STATUS #void HPDF_Free (HPDF_Doc pdf) HPDF_Free=haru.HPDF_Free HPDF_Free.restype=None #HPDF_STATUS HPDF_NewDoc (HPDF_Doc pdf) HPDF_NewDoc=haru.HPDF_NewDoc HPDF_NewDoc.restype=HPDF_STATUS #void HPDF_FreeDoc (HPDF_Doc pdf) HPDF_FreeDoc=haru.HPDF_FreeDoc HPDF_FreeDoc.restype=None #HPDF_BOOL HPDF_HasDoc (HPDF_Doc pdf) HPDF_HasDoc=haru.HPDF_HasDoc HPDF_HasDoc.restype=HPDF_BOOL #void HPDF_FreeDocAll (HPDF_Doc pdf) HPDF_FreeDocAll=haru.HPDF_FreeDocAll HPDF_FreeDocAll.restype=None #HPDF_STATUS HPDF_SaveToStream (HPDF_Doc pdf) HPDF_SaveToStream=haru.HPDF_SaveToStream HPDF_SaveToStream.restype=HPDF_STATUS #HPDF_UINT32 HPDF_GetStreamSize (HPDF_Doc pdf) HPDF_GetStreamSize=haru.HPDF_GetStreamSize HPDF_GetStreamSize.restype=HPDF_UINT32 #HPDF_STATUS HPDF_ReadFromStream (HPDF_Doc pdf, HPDF_BYTE *buf, HPDF_UINT32 *size) _HPDF_ReadFromStream=haru.HPDF_ReadFromStream _HPDF_ReadFromStream.restype=HPDF_STATUS def HPDF_ReadFromStream( pdf, #HPDF_Doc buf, #POINTER(HPDF_BYTE) size, #POINTER(HPDF_UINT32) ): if type(buf) in (types.ListType, types.TupleType): size=len(buf) buf=pointer((HPDF_BYTE*size)(*buf)) size=HPDF_UINT32(int(size)) return _HPDF_ReadFromStream( pdf, #HPDF_Doc buf, #POINTER(HPDF_BYTE) size, #POINTER(HPDF_UINT32) ) #HPDF_STATUS HPDF_ResetStream (HPDF_Doc pdf) HPDF_ResetStream=haru.HPDF_ResetStream HPDF_ResetStream.restype=HPDF_STATUS #HPDF_STATUS HPDF_SaveToFile (HPDF_Doc pdf, const char *file_name) HPDF_SaveToFile=haru.HPDF_SaveToFile HPDF_SaveToFile.restype=HPDF_STATUS #HPDF_STATUS HPDF_GetError (HPDF_Doc pdf) HPDF_GetError=haru.HPDF_GetError HPDF_GetError.restype=HPDF_STATUS #HPDF_STATUS HPDF_GetErrorDetail (HPDF_Doc pdf) HPDF_GetErrorDetail=haru.HPDF_GetErrorDetail HPDF_GetErrorDetail.restype=HPDF_STATUS #void HPDF_ResetError (HPDF_Doc pdf) HPDF_ResetError=haru.HPDF_ResetError HPDF_ResetError.restype=None #HPDF_STATUS HPDF_SetPagesConfiguration (HPDF_Doc pdf, HPDF_UINT page_per_pages) _HPDF_SetPagesConfiguration=haru.HPDF_SetPagesConfiguration _HPDF_SetPagesConfiguration.restype=HPDF_STATUS def HPDF_SetPagesConfiguration( pdf, #HPDF_Doc page_per_pages, #HPDF_UINT ): page_per_pages=HPDF_UINT(int(page_per_pages)) return _HPDF_SetPagesConfiguration( pdf, #HPDF_Doc page_per_pages, #HPDF_UINT ) #HPDF_Page HPDF_GetPageByIndex (HPDF_Doc pdf, HPDF_UINT index) HPDF_GetPageByIndex=haru.HPDF_GetPageByIndex HPDF_GetPageByIndex.restype=HPDF_Page #--------------------------------------------------------------------------- #--------------------------------------------------------------------------- #HPDF_PageLayout HPDF_GetPageLayout (HPDF_Doc pdf) HPDF_GetPageLayout=haru.HPDF_GetPageLayout HPDF_GetPageLayout.restype=HPDF_PageLayout #HPDF_STATUS HPDF_SetPageLayout (HPDF_Doc pdf, HPDF_PageLayout layout) HPDF_SetPageLayout=haru.HPDF_SetPageLayout HPDF_SetPageLayout.restype=HPDF_STATUS #HPDF_PageMode HPDF_GetPageMode (HPDF_Doc pdf) HPDF_GetPageMode=haru.HPDF_GetPageMode HPDF_GetPageMode.restype=HPDF_PageMode #HPDF_STATUS HPDF_SetPageMode (HPDF_Doc pdf, HPDF_PageMode mode) HPDF_SetPageMode=haru.HPDF_SetPageMode HPDF_SetPageMode.restype=HPDF_STATUS #HPDF_UINT HPDF_GetViewerPreference (HPDF_Doc pdf) HPDF_GetViewerPreference=haru.HPDF_GetViewerPreference HPDF_GetViewerPreference.restype=HPDF_UINT #HPDF_STATUS HPDF_SetViewerPreference (HPDF_Doc pdf, HPDF_UINT value) HPDF_SetViewerPreference=haru.HPDF_SetViewerPreference HPDF_SetViewerPreference.restype=HPDF_STATUS #HPDF_STATUS HPDF_SetOpenAction (HPDF_Doc pdf, HPDF_Destination open_action) HPDF_SetOpenAction=haru.HPDF_SetOpenAction HPDF_SetOpenAction.restype=HPDF_STATUS #--------------------------------------------------------------------------- #----- page handling ------------------------------------------------------- #HPDF_Page HPDF_GetCurrentPage (HPDF_Doc pdf) HPDF_GetCurrentPage=haru.HPDF_GetCurrentPage HPDF_GetCurrentPage.restype=HPDF_Page #HPDF_Page HPDF_AddPage (HPDF_Doc pdf) HPDF_AddPage=haru.HPDF_AddPage HPDF_AddPage.restype=HPDF_Page #HPDF_Page HPDF_InsertPage (HPDF_Doc pdf, HPDF_Page page) HPDF_InsertPage=haru.HPDF_InsertPage HPDF_InsertPage.restype=HPDF_Page #HPDF_STATUS HPDF_Page_SetWidth (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetWidth=haru.HPDF_Page_SetWidth _HPDF_Page_SetWidth.restype=HPDF_STATUS def HPDF_Page_SetWidth( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetWidth( page, #HPDF_Page value, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_SetHeight (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetHeight=haru.HPDF_Page_SetHeight _HPDF_Page_SetHeight.restype=HPDF_STATUS def HPDF_Page_SetHeight( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetHeight( page, #HPDF_Page value, #HPDF_REAL ) #HPDF_STATUS #HPDF_Page_SetSize (HPDF_Page page, # HPDF_PageSizes size, # HPDF_PageDirection direction); HPDF_Page_SetSize=haru.HPDF_Page_SetSize HPDF_Page_SetSize.restype=HPDF_STATUS #HPDF_STATUS HPDF_Page_SetRotate (HPDF_Page page, HPDF_UINT16 angle) _HPDF_Page_SetRotate=haru.HPDF_Page_SetRotate _HPDF_Page_SetRotate.restype=HPDF_STATUS def HPDF_Page_SetRotate( page, #HPDF_Page angle, #HPDF_UINT16 ): angle=HPDF_UINT16(int(angle)) return _HPDF_Page_SetRotate( page, #HPDF_Page angle, #HPDF_UINT16 ) #--------------------------------------------------------------------------- #----- font handling ------------------------------------------------------- #HPDF_Font HPDF_GetFont (HPDF_Doc pdf, const char *font_name, const char *encoding_name) HPDF_GetFont=haru.HPDF_GetFont HPDF_GetFont.restype=HPDF_Font #const char* HPDF_LoadType1FontFromFile (HPDF_Doc pdf, const char *afm_file_name, const char *data_file_name) HPDF_LoadType1FontFromFile=haru.HPDF_LoadType1FontFromFile HPDF_LoadType1FontFromFile.restype=c_char_p #const char* HPDF_LoadTTFontFromFile (HPDF_Doc pdf, const char *file_name, HPDF_BOOL embedding) HPDF_LoadTTFontFromFile=haru.HPDF_LoadTTFontFromFile HPDF_LoadTTFontFromFile.restype=c_char_p #const char* HPDF_LoadTTFontFromFile2 (HPDF_Doc pdf, const char *file_name, HPDF_UINT index, HPDF_BOOL embedding) HPDF_LoadTTFontFromFile2=haru.HPDF_LoadTTFontFromFile2 HPDF_LoadTTFontFromFile2.restype=c_char_p #HPDF_STATUS HPDF_AddPageLabel (HPDF_Doc pdf, HPDF_UINT page_num, HPDF_PageNumStyle style, HPDF_UINT first_page, const char *prefix) _HPDF_AddPageLabel=haru.HPDF_AddPageLabel _HPDF_AddPageLabel.restype=HPDF_STATUS def HPDF_AddPageLabel( pdf, #HPDF_Doc page_num, #HPDF_UINT style, #HPDF_PageNumStyle first_page, #HPDF_UINT prefix, #c_char_p ): page_num, first_page=[HPDF_UINT(int(i))for i in (page_num, first_page)] return _HPDF_AddPageLabel( pdf, #HPDF_Doc page_num, #HPDF_UINT style, #HPDF_PageNumStyle first_page, #HPDF_UINT prefix, #c_char_p ) #HPDF_STATUS HPDF_UseJPFonts (HPDF_Doc pdf) HPDF_UseJPFonts=haru.HPDF_UseJPFonts HPDF_UseJPFonts.restype=HPDF_STATUS #HPDF_STATUS HPDF_UseKRFonts (HPDF_Doc pdf) HPDF_UseKRFonts=haru.HPDF_UseKRFonts HPDF_UseKRFonts.restype=HPDF_STATUS #HPDF_STATUS HPDF_UseCNSFonts (HPDF_Doc pdf) HPDF_UseCNSFonts=haru.HPDF_UseCNSFonts HPDF_UseCNSFonts.restype=HPDF_STATUS #HPDF_STATUS HPDF_UseCNTFonts (HPDF_Doc pdf) HPDF_UseCNTFonts=haru.HPDF_UseCNTFonts HPDF_UseCNTFonts.restype=HPDF_STATUS #-------------------------------------------------------------------------- #----- outline ------------------------------------------------------------ #HPDF_Outline HPDF_CreateOutline (HPDF_Doc pdf, HPDF_Outline parent, const char *title, HPDF_Encoder encoder) HPDF_CreateOutline=haru.HPDF_CreateOutline HPDF_CreateOutline.restype=HPDF_Outline #HPDF_STATUS HPDF_Outline_SetOpened (HPDF_Outline outline, HPDF_BOOL opened) HPDF_Outline_SetOpened=haru.HPDF_Outline_SetOpened HPDF_Outline_SetOpened.restype=HPDF_STATUS #HPDF_STATUS HPDF_Outline_SetDestination (HPDF_Outline outline, HPDF_Destination dst) HPDF_Outline_SetDestination=haru.HPDF_Outline_SetDestination HPDF_Outline_SetDestination.restype=HPDF_STATUS #-------------------------------------------------------------------------- #----- destination -------------------------------------------------------- #HPDF_Destination HPDF_Page_CreateDestination (HPDF_Page page) HPDF_Page_CreateDestination=haru.HPDF_Page_CreateDestination HPDF_Page_CreateDestination.restype=HPDF_Destination #HPDF_STATUS HPDF_Destination_SetXYZ (HPDF_Destination dst, HPDF_REAL left, HPDF_REAL top, HPDF_REAL zoom) _HPDF_Destination_SetXYZ=haru.HPDF_Destination_SetXYZ _HPDF_Destination_SetXYZ.restype=HPDF_STATUS def HPDF_Destination_SetXYZ( dst, #HPDF_Destination left, #HPDF_REAL top, #HPDF_REAL zoom, #HPDF_REAL ): left=HPDF_REAL(left) top=HPDF_REAL(top) zoom=HPDF_REAL(zoom) return _HPDF_Destination_SetXYZ( dst, #HPDF_Destination left, #HPDF_REAL top, #HPDF_REAL zoom, #HPDF_REAL ) #HPDF_STATUS HPDF_Destination_SetFit (HPDF_Destination dst) HPDF_Destination_SetFit=haru.HPDF_Destination_SetFit HPDF_Destination_SetFit.restype=HPDF_STATUS #HPDF_STATUS HPDF_Destination_SetFitH (HPDF_Destination dst, HPDF_REAL top) _HPDF_Destination_SetFitH=haru.HPDF_Destination_SetFitH _HPDF_Destination_SetFitH.restype=HPDF_STATUS def HPDF_Destination_SetFitH( dst, #HPDF_Destination top, #HPDF_REAL ): top=HPDF_REAL(top) return _HPDF_Destination_SetFitH( dst, #HPDF_Destination top, #HPDF_REAL ) #HPDF_STATUS HPDF_Destination_SetFitV (HPDF_Destination dst, HPDF_REAL left) _HPDF_Destination_SetFitV=haru.HPDF_Destination_SetFitV _HPDF_Destination_SetFitV.restype=HPDF_STATUS def HPDF_Destination_SetFitV( dst, #HPDF_Destination left, #HPDF_REAL ): left=HPDF_REAL(left) return _HPDF_Destination_SetFitV( dst, #HPDF_Destination left, #HPDF_REAL ) #HPDF_STATUS HPDF_Destination_SetFitR (HPDF_Destination dst, HPDF_REAL left, HPDF_REAL bottom, HPDF_REAL right, HPDF_REAL top) _HPDF_Destination_SetFitR=haru.HPDF_Destination_SetFitR _HPDF_Destination_SetFitR.restype=HPDF_STATUS def HPDF_Destination_SetFitR( dst, #HPDF_Destination left, #HPDF_REAL bottom, #HPDF_REAL right, #HPDF_REAL top, #HPDF_REAL ): left=HPDF_REAL(left) bottom=HPDF_REAL(bottom) right=HPDF_REAL(right) top=HPDF_REAL(top) return _HPDF_Destination_SetFitR( dst, #HPDF_Destination left, #HPDF_REAL bottom, #HPDF_REAL right, #HPDF_REAL top, #HPDF_REAL ) #HPDF_STATUS HPDF_Destination_SetFitB (HPDF_Destination dst) HPDF_Destination_SetFitB=haru.HPDF_Destination_SetFitB HPDF_Destination_SetFitB.restype=HPDF_STATUS #HPDF_STATUS HPDF_Destination_SetFitBH (HPDF_Destination dst, HPDF_REAL top) _HPDF_Destination_SetFitBH=haru.HPDF_Destination_SetFitBH _HPDF_Destination_SetFitBH.restype=HPDF_STATUS def HPDF_Destination_SetFitBH( dst, #HPDF_Destination top, #HPDF_REAL ): top=HPDF_REAL(top) return _HPDF_Destination_SetFitBH( dst, #HPDF_Destination top, #HPDF_REAL ) #HPDF_STATUS HPDF_Destination_SetFitBV (HPDF_Destination dst, HPDF_REAL left) _HPDF_Destination_SetFitBV=haru.HPDF_Destination_SetFitBV _HPDF_Destination_SetFitBV.restype=HPDF_STATUS def HPDF_Destination_SetFitBV( dst, #HPDF_Destination left, #HPDF_REAL ): left=HPDF_REAL(left) return _HPDF_Destination_SetFitBV( dst, #HPDF_Destination left, #HPDF_REAL ) #-------------------------------------------------------------------------- #----- encoder ------------------------------------------------------------ #HPDF_Encoder HPDF_GetEncoder (HPDF_Doc pdf, const char *encoding_name) HPDF_GetEncoder=haru.HPDF_GetEncoder HPDF_GetEncoder.restype=HPDF_Encoder #HPDF_Encoder HPDF_GetCurrentEncoder (HPDF_Doc pdf) HPDF_GetCurrentEncoder=haru.HPDF_GetCurrentEncoder HPDF_GetCurrentEncoder.restype=HPDF_Encoder #HPDF_STATUS HPDF_SetCurrentEncoder (HPDF_Doc pdf, const char *encoding_name) HPDF_SetCurrentEncoder=haru.HPDF_SetCurrentEncoder HPDF_SetCurrentEncoder.restype=HPDF_STATUS #HPDF_EncoderType HPDF_Encoder_GetType (HPDF_Encoder encoder) HPDF_Encoder_GetType=haru.HPDF_Encoder_GetType HPDF_Encoder_GetType.restype=HPDF_EncoderType #HPDF_ByteType HPDF_Encoder_GetByteType (HPDF_Encoder encoder, const char *text, HPDF_UINT index) _HPDF_Encoder_GetByteType=haru.HPDF_Encoder_GetByteType _HPDF_Encoder_GetByteType.restype=HPDF_ByteType def HPDF_Encoder_GetByteType( encoder, #HPDF_Encoder text, #const char * index #HPDF_UINT ): if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Encoder_GetByteType( encoder, #HPDF_Encoder text, #const char * index #HPDF_UINT ) #HPDF_UNICODE HPDF_Encoder_GetUnicode (HPDF_Encoder encoder, HPDF_UINT16 code) HPDF_Encoder_GetUnicode=haru.HPDF_Encoder_GetUnicode HPDF_Encoder_GetUnicode.restype=HPDF_UNICODE #HPDF_WritingMode HPDF_Encoder_GetWritingMode (HPDF_Encoder encoder) HPDF_Encoder_GetWritingMode=haru.HPDF_Encoder_GetWritingMode HPDF_Encoder_GetWritingMode.restype=HPDF_WritingMode #HPDF_STATUS HPDF_UseJPEncodings (HPDF_Doc pdf) HPDF_UseJPEncodings=haru.HPDF_UseJPEncodings HPDF_UseJPEncodings.restype=HPDF_STATUS #HPDF_STATUS HPDF_UseKREncodings (HPDF_Doc pdf) HPDF_UseKREncodings=haru.HPDF_UseKREncodings HPDF_UseKREncodings.restype=HPDF_STATUS #HPDF_STATUS HPDF_UseCNSEncodings (HPDF_Doc pdf) HPDF_UseCNSEncodings=haru.HPDF_UseCNSEncodings HPDF_UseCNSEncodings.restype=HPDF_STATUS #HPDF_STATUS HPDF_UseCNTEncodings (HPDF_Doc pdf) HPDF_UseCNTEncodings=haru.HPDF_UseCNTEncodings HPDF_UseCNTEncodings.restype=HPDF_STATUS #-------------------------------------------------------------------------- #----- annotation --------------------------------------------------------- #HPDF_Annotation HPDF_Page_CreateTextAnnot (HPDF_Page page, HPDF_Rect rect, const char *text, HPDF_Encoder encoder) HPDF_Page_CreateTextAnnot=haru.HPDF_Page_CreateTextAnnot HPDF_Page_CreateTextAnnot.restype=HPDF_Annotation #HPDF_Annotation HPDF_Page_CreateLinkAnnot (HPDF_Page page, HPDF_Rect rect, HPDF_Destination dst) HPDF_Page_CreateLinkAnnot=haru.HPDF_Page_CreateLinkAnnot HPDF_Page_CreateLinkAnnot.restype=HPDF_Annotation #HPDF_Annotation HPDF_Page_CreateURILinkAnnot (HPDF_Page page, HPDF_Rect rect, const char *uri) HPDF_Page_CreateURILinkAnnot=haru.HPDF_Page_CreateURILinkAnnot HPDF_Page_CreateURILinkAnnot.restype=HPDF_Annotation #HPDF_STATUS HPDF_LinkAnnot_SetHighlightMode (HPDF_Annotation annot, HPDF_AnnotHighlightMode mode) HPDF_LinkAnnot_SetHighlightMode=haru.HPDF_LinkAnnot_SetHighlightMode HPDF_LinkAnnot_SetHighlightMode.restype=HPDF_STATUS #HPDF_STATUS HPDF_LinkAnnot_SetBorderStyle (HPDF_Annotation annot, HPDF_REAL width, HPDF_UINT16 dash_on, HPDF_UINT16 dash_off) _HPDF_LinkAnnot_SetBorderStyle=haru.HPDF_LinkAnnot_SetBorderStyle _HPDF_LinkAnnot_SetBorderStyle.restype=HPDF_STATUS def HPDF_LinkAnnot_SetBorderStyle( annot, #HPDF_Annotation width, #HPDF_REAL dash_on, #HPDF_UINT16 dash_off, #HPDF_UINT16 ): width=HPDF_REAL(width) dash_on=HPDF_UINT16(dash_on) dash_off=HPDF_UINT16(dash_off) return _HPDF_LinkAnnot_SetBorderStyle( annot, #HPDF_Annotation width, #HPDF_REAL dash_on, #HPDF_UINT16 dash_off, #HPDF_UINT16 ) #HPDF_STATUS HPDF_TextAnnot_SetIcon (HPDF_Annotation annot, HPDF_AnnotIcon icon) HPDF_TextAnnot_SetIcon=haru.HPDF_TextAnnot_SetIcon HPDF_TextAnnot_SetIcon.restype=HPDF_STATUS #HPDF_STATUS HPDF_TextAnnot_SetOpened (HPDF_Annotation annot, HPDF_BOOL opened) HPDF_TextAnnot_SetOpened=haru.HPDF_TextAnnot_SetOpened HPDF_TextAnnot_SetOpened.restype=HPDF_STATUS #-------------------------------------------------------------------------- #----- image data --------------------------------------------------------- #HPDF_Image HPDF_LoadPngImageFromFile (HPDF_Doc pdf, const char *filename) HPDF_LoadPngImageFromFile=haru.HPDF_LoadPngImageFromFile HPDF_LoadPngImageFromFile.restype=HPDF_Image #HPDF_Image HPDF_LoadPngImageFromFile2 (HPDF_Doc pdf, const char *filename) HPDF_LoadPngImageFromFile2=haru.HPDF_LoadPngImageFromFile2 HPDF_LoadPngImageFromFile2.restype=HPDF_Image #HPDF_Image HPDF_LoadJpegImageFromFile (HPDF_Doc pdf, const char *filename) HPDF_LoadJpegImageFromFile=haru.HPDF_LoadJpegImageFromFile HPDF_LoadJpegImageFromFile.restype=HPDF_Image #HPDF_Image HPDF_LoadRawImageFromFile (HPDF_Doc pdf, const char *filename, HPDF_UINT width, HPDF_UINT height, HPDF_ColorSpace color_space) _HPDF_LoadRawImageFromFile=haru.HPDF_LoadRawImageFromFile _HPDF_LoadRawImageFromFile.restype=HPDF_Image def HPDF_LoadRawImageFromFile( pdf, #HPDF_Doc filename, #c_char_p width, #HPDF_UINT height, #HPDF_UINT color_space, #HPDF_ColorSpace ): width=HPDF_UINT(width) height=HPDF_UINT(height) return _HPDF_LoadRawImageFromFile( pdf, #HPDF_Doc filename, #c_char_p width, #HPDF_UINT height, #HPDF_UINT color_space, #HPDF_ColorSpace ) #HPDF_Image HPDF_LoadRawImageFromMem (HPDF_Doc pdf, const HPDF_BYTE *buf, HPDF_UINT width, HPDF_UINT height, HPDF_ColorSpace color_space, HPDF_UINT bits_per_component) _HPDF_LoadRawImageFromMem=haru.HPDF_LoadRawImageFromMem _HPDF_LoadRawImageFromMem.restype=HPDF_Image def HPDF_LoadRawImageFromMem( pdf, #HPDF_Doc buf, #POINTER(HPDF_BYTE) width, #HPDF_UINT height, #HPDF_UINT color_space, #HPDF_ColorSpace bits_per_component, #HPDF_UINT ): if type(buf) in (types.ListType, types.TupleType): size=len(buf) buf=pointer((HPDF_BYTE*size)(*buf)) if height in [0, None]: height=size/width width=HPDF_UINT(width) height=HPDF_UINT(height) bits_per_component=HPDF_UINT(bits_per_component) return _HPDF_LoadRawImageFromMem( pdf, #HPDF_Doc buf, #POINTER(HPDF_BYTE) width, #HPDF_UINT height, #HPDF_UINT color_space, #HPDF_ColorSpace bits_per_component, #HPDF_UINT ) #HPDF_Point HPDF_Image_GetSize (HPDF_Image image) HPDF_Image_GetSize=haru.HPDF_Image_GetSize HPDF_Image_GetSize.restype=HPDF_Point #HPDF_STATUS HPDF_Image_GetSize2 (HPDF_Image image, HPDF_Point *size) _HPDF_Image_GetSize2=haru.HPDF_Image_GetSize2 _HPDF_Image_GetSize2.restype=HPDF_STATUS def HPDF_Image_GetSize2( image, #HPDF_Image size=None, #POINTER(HPDF_Point) ): size=HPDF_Point ret= _HPDF_Image_GetSize2( image, #HPDF_Image size, #POINTER(HPDF_Point) ) return ret, size.x, size.y #HPDF_UINT HPDF_Image_GetWidth (HPDF_Image image) HPDF_Image_GetWidth=haru.HPDF_Image_GetWidth HPDF_Image_GetWidth.restype=HPDF_UINT #HPDF_UINT HPDF_Image_GetHeight (HPDF_Image image) HPDF_Image_GetHeight=haru.HPDF_Image_GetHeight HPDF_Image_GetHeight.restype=HPDF_UINT #HPDF_UINT HPDF_Image_GetBitsPerComponent (HPDF_Image image) HPDF_Image_GetBitsPerComponent=haru.HPDF_Image_GetBitsPerComponent HPDF_Image_GetBitsPerComponent.restype=HPDF_UINT #const char* HPDF_Image_GetColorSpace (HPDF_Image image) HPDF_Image_GetColorSpace=haru.HPDF_Image_GetColorSpace HPDF_Image_GetColorSpace.restype=c_char_p #HPDF_STATUS HPDF_Image_SetColorMask (HPDF_Image image, HPDF_UINT rmin, HPDF_UINT rmax, HPDF_UINT gmin, HPDF_UINT gmax, HPDF_UINT bmin, HPDF_UINT bmax) _HPDF_Image_SetColorMask=haru.HPDF_Image_SetColorMask _HPDF_Image_SetColorMask.restype=HPDF_STATUS def HPDF_Image_SetColorMask( image, #HPDF_Image rmin, #HPDF_UINT rmax, #HPDF_UINT gmin, #HPDF_UINT gmax, #HPDF_UINT bmin, #HPDF_UINT bmax, #HPDF_UINT ): rmin=HPDF_UINT(rmin) rmax=HPDF_UINT(rmax) gmin=HPDF_UINT(gmin) gmax=HPDF_UINT(gmax) bmin=HPDF_UINT(bmin) bmax=HPDF_UINT(bmax) return _HPDF_Image_SetColorMask( image, #HPDF_Image rmin, #HPDF_UINT rmax, #HPDF_UINT gmin, #HPDF_UINT gmax, #HPDF_UINT bmin, #HPDF_UINT bmax, #HPDF_UINT ) #HPDF_STATUS HPDF_Image_SetMaskImage (HPDF_Image image, HPDF_Image mask_image) HPDF_Image_SetMaskImage=haru.HPDF_Image_SetMaskImage HPDF_Image_SetMaskImage.restype=HPDF_STATUS #-------------------------------------------------------------------------- #----- info dictionary ---------------------------------------------------- #HPDF_STATUS HPDF_SetInfoAttr (HPDF_Doc pdf, HPDF_InfoType type, const char *value) HPDF_SetInfoAttr=haru.HPDF_SetInfoAttr HPDF_SetInfoAttr.restype=HPDF_STATUS #const char* HPDF_GetInfoAttr (HPDF_Doc pdf, HPDF_InfoType type) HPDF_GetInfoAttr=haru.HPDF_GetInfoAttr HPDF_GetInfoAttr.restype=c_char_p #HPDF_STATUS HPDF_SetInfoDateAttr (HPDF_Doc pdf, HPDF_InfoType type, HPDF_Date value) HPDF_SetInfoDateAttr=haru.HPDF_SetInfoDateAttr HPDF_SetInfoDateAttr.restype=HPDF_STATUS #-------------------------------------------------------------------------- #----- encryption --------------------------------------------------------- #HPDF_STATUS HPDF_SetPassword (HPDF_Doc pdf, const char *owner_passwd, const char *user_passwd) HPDF_SetPassword=haru.HPDF_SetPassword HPDF_SetPassword.restype=HPDF_STATUS #HPDF_STATUS HPDF_SetPermission (HPDF_Doc pdf, HPDF_UINT permission) _HPDF_SetPermission=haru.HPDF_SetPermission _HPDF_SetPermission.restype=HPDF_STATUS def HPDF_SetPermission( pdf, #HPDF_Doc permission, #HPDF_UINT ): permission=HPDF_UINT(int(permission)) return _HPDF_SetPermission( pdf, #HPDF_Doc permission, #HPDF_UINT ) #HPDF_STATUS HPDF_SetEncryptionMode (HPDF_Doc pdf, HPDF_EncryptMode mode, HPDF_UINT key_len) _HPDF_SetEncryptionMode=haru.HPDF_SetEncryptionMode _HPDF_SetEncryptionMode.restype=HPDF_STATUS def HPDF_SetEncryptionMode( pdf, #HPDF_Doc mode, #HPDF_EncryptMode key_len, #HPDF_UINT ): key_len=HPDF_UINT(int(key_len)) return _HPDF_SetEncryptionMode( pdf, #HPDF_Doc mode, #HPDF_EncryptMode key_len, #HPDF_UINT ) #-------------------------------------------------------------------------- #----- compression -------------------------------------------------------- #HPDF_STATUS HPDF_SetCompressionMode (HPDF_Doc pdf, HPDF_UINT mode) HPDF_SetCompressionMode=haru.HPDF_SetCompressionMode HPDF_SetCompressionMode.restype=HPDF_STATUS #-------------------------------------------------------------------------- #----- font --------------------------------------------------------------- #const char* HPDF_Font_GetFontName (HPDF_Font font) HPDF_Font_GetFontName=haru.HPDF_Font_GetFontName HPDF_Font_GetFontName.restype=c_char_p #const char* HPDF_Font_GetEncodingName (HPDF_Font font) HPDF_Font_GetEncodingName=haru.HPDF_Font_GetEncodingName HPDF_Font_GetEncodingName.restype=c_char_p #HPDF_INT HPDF_Font_GetUnicodeWidth (HPDF_Font font, HPDF_UNICODE code) HPDF_Font_GetUnicodeWidth=haru.HPDF_Font_GetUnicodeWidth HPDF_Font_GetUnicodeWidth.restype=HPDF_INT #HPDF_Box HPDF_Font_GetBBox (HPDF_Font font) HPDF_Font_GetBBox=haru.HPDF_Font_GetBBox HPDF_Font_GetBBox.restype=HPDF_Box #HPDF_INT HPDF_Font_GetAscent (HPDF_Font font) HPDF_Font_GetAscent=haru.HPDF_Font_GetAscent HPDF_Font_GetAscent.restype=HPDF_INT #HPDF_INT HPDF_Font_GetDescent (HPDF_Font font) HPDF_Font_GetDescent=haru.HPDF_Font_GetDescent HPDF_Font_GetDescent.restype=HPDF_INT #HPDF_UINT HPDF_Font_GetXHeight (HPDF_Font font) HPDF_Font_GetXHeight=haru.HPDF_Font_GetXHeight HPDF_Font_GetXHeight.restype=HPDF_UINT #HPDF_UINT HPDF_Font_GetCapHeight (HPDF_Font font) HPDF_Font_GetCapHeight=haru.HPDF_Font_GetCapHeight HPDF_Font_GetCapHeight.restype=HPDF_UINT #HPDF_TextWidth HPDF_Font_TextWidth (HPDF_Font font, const HPDF_BYTE *text, HPDF_UINT len) HPDF_Font_TextWidth=haru.HPDF_Font_TextWidth HPDF_Font_TextWidth.restype=HPDF_TextWidth #HPDF_UINT HPDF_Font_MeasureText (HPDF_Font font, const HPDF_BYTE *text, HPDF_UINT len, HPDF_REAL width, HPDF_REAL font_size, HPDF_REAL char_space, HPDF_REAL word_space, HPDF_BOOL wordwrap, HPDF_REAL *real_width) _HPDF_Font_MeasureText=haru.HPDF_Font_MeasureText _HPDF_Font_MeasureText.restype=HPDF_UINT def HPDF_Font_MeasureText( font, #HPDF_Font text, #POINTER(HPDF_BYTE) length, #HPDF_UINT width, #HPDF_REAL font_size, #HPDF_REAL char_space, #HPDF_REAL word_space, #HPDF_REAL wordwrap, #HPDF_BOOL real_width, #POINTER(HPDF_REAL) ): if type(text) in (types.TupleType, types.ListType): length=len(text) text=pointer((HPDF_BYTE*length)(*text)) length=HPDF_UINT(int(length)) width=HPDF_REAL(width) font_size=HPDF_REAL(font_size) char_space=HPDF_REAL(char_space) word_space=HPDF_REAL(word_space) real_width=HPDF_REAL(real_width) return _HPDF_Font_MeasureText( font, #HPDF_Font text, #POINTER(HPDF_BYTE) length, #HPDF_UINT width, #HPDF_REAL font_size, #HPDF_REAL char_space, #HPDF_REAL word_space, #HPDF_REAL wordwrap, #HPDF_BOOL real_width, #POINTER(HPDF_REAL) ) #-------------------------------------------------------------------------- #----- extended graphics state -------------------------------------------- #HPDF_ExtGState HPDF_CreateExtGState (HPDF_Doc pdf) HPDF_CreateExtGState=haru.HPDF_CreateExtGState HPDF_CreateExtGState.restype=HPDF_ExtGState #HPDF_STATUS HPDF_ExtGState_SetAlphaStroke (HPDF_ExtGState ext_gstate, HPDF_REAL value) _HPDF_ExtGState_SetAlphaStroke=haru.HPDF_ExtGState_SetAlphaStroke _HPDF_ExtGState_SetAlphaStroke.restype=HPDF_STATUS def HPDF_ExtGState_SetAlphaStroke( ext_gstate, #HPDF_ExtGState value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_ExtGState_SetAlphaStroke( ext_gstate, #HPDF_ExtGState value, #HPDF_REAL ) #HPDF_STATUS HPDF_ExtGState_SetAlphaFill (HPDF_ExtGState ext_gstate, HPDF_REAL value) _HPDF_ExtGState_SetAlphaFill=haru.HPDF_ExtGState_SetAlphaFill _HPDF_ExtGState_SetAlphaFill.restype=HPDF_STATUS def HPDF_ExtGState_SetAlphaFill( ext_gstate, #HPDF_ExtGState value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_ExtGState_SetAlphaFill( ext_gstate, #HPDF_ExtGState value, #HPDF_REAL ) #HPDF_STATUS HPDF_ExtGState_SetBlendMode (HPDF_ExtGState ext_gstate, HPDF_BlendMode mode) HPDF_ExtGState_SetBlendMode=haru.HPDF_ExtGState_SetBlendMode HPDF_ExtGState_SetBlendMode.restype=HPDF_STATUS #-------------------------------------------------------------------------- #-------------------------------------------------------------------------- #HPDF_REAL HPDF_Page_TextWidth (HPDF_Page page, const char *text) _HPDF_Page_TextWidth=haru.HPDF_Page_TextWidth _HPDF_Page_TextWidth.restype=HPDF_REAL def HPDF_Page_TextWidth( page, #HPDF_Page text, #c_char_p ): if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Page_TextWidth( page, #HPDF_Page text, #c_char_p ) #HPDF_UINT HPDF_Page_MeasureText (HPDF_Page page, const char *text, HPDF_REAL width, HPDF_BOOL wordwrap, HPDF_REAL *real_width) _HPDF_Page_MeasureText=haru.HPDF_Page_MeasureText _HPDF_Page_MeasureText.restype=HPDF_UINT def HPDF_Page_MeasureText( page, #HPDF_Page text, #c_char_p width, #HPDF_REAL wordwrap, #HPDF_BOOL real_width, #POINTER(HPDF_REAL) ): width=HPDF_REAL(width) real_width=HPDF_REAL(real_width) return _HPDF_Page_MeasureText( page, #HPDF_Page text, #c_char_p width, #HPDF_REAL wordwrap, #HPDF_BOOL real_width, #POINTER(HPDF_REAL) ) #HPDF_REAL #HPDF_Page_GetWidth (HPDF_Page page); HPDF_Page_GetWidth=haru.HPDF_Page_GetWidth HPDF_Page_GetWidth.restype=HPDF_REAL #HPDF_REAL HPDF_Page_GetHeight (HPDF_Page page) HPDF_Page_GetHeight=haru.HPDF_Page_GetHeight HPDF_Page_GetHeight.restype=HPDF_REAL #HPDF_UINT16 HPDF_Page_GetGMode (HPDF_Page page) HPDF_Page_GetGMode=haru.HPDF_Page_GetGMode HPDF_Page_GetGMode.restype=HPDF_UINT16 #HPDF_Point HPDF_Page_GetCurrentPos (HPDF_Page page) HPDF_Page_GetCurrentPos=haru.HPDF_Page_GetCurrentPos HPDF_Page_GetCurrentPos.restype=HPDF_Point #HPDF_STATUS HPDF_Page_GetCurrentPos2 (HPDF_Page page, HPDF_Point *pos) _HPDF_Page_GetCurrentPos2=haru.HPDF_Page_GetCurrentPos2 _HPDF_Page_GetCurrentPos2.restype=HPDF_STATUS def HPDF_Page_GetCurrentPos2( page, #HPDF_Page pos=None, #POINTER(HPDF_Point) ): pos=HPDF_Point() ret= _HPDF_Page_GetCurrentPos2( page, #HPDF_Page pos, #POINTER(HPDF_Point) ) return ret, pos.x, pos.y #HPDF_Point HPDF_Page_GetCurrentTextPos (HPDF_Page page) HPDF_Page_GetCurrentTextPos=haru.HPDF_Page_GetCurrentTextPos HPDF_Page_GetCurrentTextPos.restype=HPDF_Point #HPDF_STATUS HPDF_Page_GetCurrentTextPos2 (HPDF_Page page, HPDF_Point *pos) _HPDF_Page_GetCurrentTextPos2=haru.HPDF_Page_GetCurrentTextPos2 _HPDF_Page_GetCurrentTextPos2.restype=HPDF_STATUS def HPDF_Page_GetCurrentTextPos2( page, #HPDF_Page pos=None, #POINTER(HPDF_Point) ): pos=HPDF_Point() ret= _HPDF_Page_GetCurrentTextPos2( page, #HPDF_Page pos, #POINTER(HPDF_Point) ) return ret, pos.x, pos.y #HPDF_Font HPDF_Page_GetCurrentFont (HPDF_Page page) HPDF_Page_GetCurrentFont=haru.HPDF_Page_GetCurrentFont HPDF_Page_GetCurrentFont.restype=HPDF_Font #HPDF_REAL HPDF_Page_GetCurrentFontSize (HPDF_Page page) HPDF_Page_GetCurrentFontSize=haru.HPDF_Page_GetCurrentFontSize HPDF_Page_GetCurrentFontSize.restype=HPDF_REAL #HPDF_TransMatrix HPDF_Page_GetTransMatrix (HPDF_Page page) HPDF_Page_GetTransMatrix=haru.HPDF_Page_GetTransMatrix HPDF_Page_GetTransMatrix.restype=HPDF_TransMatrix #HPDF_REAL HPDF_Page_GetLineWidth (HPDF_Page page) HPDF_Page_GetLineWidth=haru.HPDF_Page_GetLineWidth HPDF_Page_GetLineWidth.restype=HPDF_REAL #HPDF_LineCap HPDF_Page_GetLineCap (HPDF_Page page) HPDF_Page_GetLineCap=haru.HPDF_Page_GetLineCap HPDF_Page_GetLineCap.restype=HPDF_LineCap #HPDF_LineJoin HPDF_Page_GetLineJoin (HPDF_Page page) HPDF_Page_GetLineJoin=haru.HPDF_Page_GetLineJoin HPDF_Page_GetLineJoin.restype=HPDF_LineJoin #HPDF_REAL HPDF_Page_GetMiterLimit (HPDF_Page page) HPDF_Page_GetMiterLimit=haru.HPDF_Page_GetMiterLimit HPDF_Page_GetMiterLimit.restype=HPDF_REAL #HPDF_DashMode HPDF_Page_GetDash (HPDF_Page page) HPDF_Page_GetDash=haru.HPDF_Page_GetDash HPDF_Page_GetDash.restype=HPDF_DashMode #HPDF_REAL HPDF_Page_GetFlat (HPDF_Page page) HPDF_Page_GetFlat=haru.HPDF_Page_GetFlat HPDF_Page_GetFlat.restype=HPDF_REAL #HPDF_REAL HPDF_Page_GetCharSpace (HPDF_Page page) HPDF_Page_GetCharSpace=haru.HPDF_Page_GetCharSpace HPDF_Page_GetCharSpace.restype=HPDF_REAL #HPDF_REAL HPDF_Page_GetWordSpace (HPDF_Page page) HPDF_Page_GetWordSpace=haru.HPDF_Page_GetWordSpace HPDF_Page_GetWordSpace.restype=HPDF_REAL #HPDF_REAL HPDF_Page_GetHorizontalScalling (HPDF_Page page) HPDF_Page_GetHorizontalScalling=haru.HPDF_Page_GetHorizontalScalling HPDF_Page_GetHorizontalScalling.restype=HPDF_REAL #HPDF_REAL HPDF_Page_GetTextLeading (HPDF_Page page) HPDF_Page_GetTextLeading=haru.HPDF_Page_GetTextLeading HPDF_Page_GetTextLeading.restype=HPDF_REAL #HPDF_TextRenderingMode HPDF_Page_GetTextRenderingMode (HPDF_Page page) HPDF_Page_GetTextRenderingMode=haru.HPDF_Page_GetTextRenderingMode HPDF_Page_GetTextRenderingMode.restype=HPDF_TextRenderingMode # This function is obsolete. Use HPDF_Page_GetTextRise. #HPDF_REAL HPDF_Page_GetTextRaise (HPDF_Page page) HPDF_Page_GetTextRaise=haru.HPDF_Page_GetTextRaise HPDF_Page_GetTextRaise.restype=HPDF_REAL #HPDF_REAL HPDF_Page_GetTextRise (HPDF_Page page) HPDF_Page_GetTextRise=haru.HPDF_Page_GetTextRise HPDF_Page_GetTextRise.restype=HPDF_REAL #HPDF_RGBColor HPDF_Page_GetRGBFill (HPDF_Page page) HPDF_Page_GetRGBFill=haru.HPDF_Page_GetRGBFill HPDF_Page_GetRGBFill.restype=HPDF_RGBColor #HPDF_RGBColor HPDF_Page_GetRGBStroke (HPDF_Page page) HPDF_Page_GetRGBStroke=haru.HPDF_Page_GetRGBStroke HPDF_Page_GetRGBStroke.restype=HPDF_RGBColor #HPDF_CMYKColor HPDF_Page_GetCMYKFill (HPDF_Page page) HPDF_Page_GetCMYKFill=haru.HPDF_Page_GetCMYKFill HPDF_Page_GetCMYKFill.restype=HPDF_CMYKColor #HPDF_CMYKColor HPDF_Page_GetCMYKStroke (HPDF_Page page) HPDF_Page_GetCMYKStroke=haru.HPDF_Page_GetCMYKStroke HPDF_Page_GetCMYKStroke.restype=HPDF_CMYKColor #HPDF_REAL HPDF_Page_GetGrayFill (HPDF_Page page) HPDF_Page_GetGrayFill=haru.HPDF_Page_GetGrayFill HPDF_Page_GetGrayFill.restype=HPDF_REAL #HPDF_REAL HPDF_Page_GetGrayStroke (HPDF_Page page) HPDF_Page_GetGrayStroke=haru.HPDF_Page_GetGrayStroke HPDF_Page_GetGrayStroke.restype=HPDF_REAL #HPDF_ColorSpace HPDF_Page_GetStrokingColorSpace (HPDF_Page page) HPDF_Page_GetStrokingColorSpace=haru.HPDF_Page_GetStrokingColorSpace HPDF_Page_GetStrokingColorSpace.restype=HPDF_ColorSpace #HPDF_ColorSpace HPDF_Page_GetFillingColorSpace (HPDF_Page page) HPDF_Page_GetFillingColorSpace=haru.HPDF_Page_GetFillingColorSpace HPDF_Page_GetFillingColorSpace.restype=HPDF_ColorSpace #HPDF_TransMatrix HPDF_Page_GetTextMatrix (HPDF_Page page) HPDF_Page_GetTextMatrix=haru.HPDF_Page_GetTextMatrix HPDF_Page_GetTextMatrix.restype=HPDF_TransMatrix #HPDF_UINT HPDF_Page_GetGStateDepth (HPDF_Page page) HPDF_Page_GetGStateDepth=haru.HPDF_Page_GetGStateDepth HPDF_Page_GetGStateDepth.restype=HPDF_UINT #-------------------------------------------------------------------------- #----- GRAPHICS OPERATORS ------------------------------------------------- #--- General graphics state --------------------------------------------- # w #HPDF_STATUS HPDF_Page_SetLineWidth (HPDF_Page page, HPDF_REAL line_width) _HPDF_Page_SetLineWidth=haru.HPDF_Page_SetLineWidth _HPDF_Page_SetLineWidth.restype=HPDF_STATUS def HPDF_Page_SetLineWidth( page, #HPDF_Page line_width, #HPDF_REAL ): line_width=HPDF_REAL(line_width) return _HPDF_Page_SetLineWidth( page, #HPDF_Page line_width, #HPDF_REAL ) # J #HPDF_STATUS HPDF_Page_SetLineCap (HPDF_Page page, HPDF_LineCap line_cap) HPDF_Page_SetLineCap=haru.HPDF_Page_SetLineCap HPDF_Page_SetLineCap.restype=HPDF_STATUS # j #HPDF_STATUS HPDF_Page_SetLineJoin (HPDF_Page page, HPDF_LineJoin line_join) HPDF_Page_SetLineJoin=haru.HPDF_Page_SetLineJoin HPDF_Page_SetLineJoin.restype=HPDF_STATUS # M #HPDF_STATUS HPDF_Page_SetMiterLimit (HPDF_Page page, HPDF_REAL miter_limit) _HPDF_Page_SetMiterLimit=haru.HPDF_Page_SetMiterLimit _HPDF_Page_SetMiterLimit.restype=HPDF_STATUS def HPDF_Page_SetMiterLimit( page, #HPDF_Page miter_limit, #HPDF_REAL ): miter_limit=HPDF_REAL(miter_limit) return _HPDF_Page_SetMiterLimit( page, #HPDF_Page miter_limit, #HPDF_REAL ) # d #HPDF_STATUS HPDF_Page_SetDash (HPDF_Page page, const HPDF_UINT16 *dash_ptn, HPDF_UINT num_param, HPDF_UINT phase) _HPDF_Page_SetDash=haru.HPDF_Page_SetDash _HPDF_Page_SetDash.restype=HPDF_STATUS def HPDF_Page_SetDash( page, #HPDF_Page dash_ptn, #POINTER(HPDF_UINT16) num_param, #HPDF_UINT phase, #HPDF_UINT ): if type(dash_ptn) in (types.ListType, types.TupleType): num_param=len(dash_ptn) dash_ptn=pointer((HPDF_UINT16*num_param)(*dash_ptn)) return _HPDF_Page_SetDash( page, #HPDF_Page dash_ptn, #POINTER(HPDF_UINT16) num_param, #HPDF_UINT phase, #HPDF_UINT ) # ri --not implemented yet # i #HPDF_STATUS HPDF_Page_SetFlat (HPDF_Page page, HPDF_REAL flatness) _HPDF_Page_SetFlat=haru.HPDF_Page_SetFlat _HPDF_Page_SetFlat.restype=HPDF_STATUS def HPDF_Page_SetFlat( page, #HPDF_Page flatness, #HPDF_REAL ): flatness=HPDF_REAL(flatness) return _HPDF_Page_SetFlat( page, #HPDF_Page flatness, #HPDF_REAL ) # gs #HPDF_STATUS HPDF_Page_SetExtGState (HPDF_Page page, HPDF_ExtGState ext_gstate) HPDF_Page_SetExtGState=haru.HPDF_Page_SetExtGState HPDF_Page_SetExtGState.restype=HPDF_STATUS #--- Special graphic state operator -------------------------------------- # q #HPDF_STATUS HPDF_Page_GSave (HPDF_Page page) HPDF_Page_GSave=haru.HPDF_Page_GSave HPDF_Page_GSave.restype=HPDF_STATUS # Q #HPDF_STATUS HPDF_Page_GRestore (HPDF_Page page) HPDF_Page_GRestore=haru.HPDF_Page_GRestore HPDF_Page_GRestore.restype=HPDF_STATUS # cm #HPDF_STATUS HPDF_Page_Concat (HPDF_Page page, HPDF_REAL a, HPDF_REAL b, HPDF_REAL c, HPDF_REAL d, HPDF_REAL x, HPDF_REAL y) _HPDF_Page_Concat=haru.HPDF_Page_Concat _HPDF_Page_Concat.restype=HPDF_STATUS def HPDF_Page_Concat( page, #HPDF_Page a, #HPDF_REAL b, #HPDF_REAL c, #HPDF_REAL d, #HPDF_REAL x, #HPDF_REAL y, #HPDF_REAL ): a=HPDF_REAL(a) b=HPDF_REAL(b) c=HPDF_REAL(c) d=HPDF_REAL(d) x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_Concat( page, #HPDF_Page a, #HPDF_REAL b, #HPDF_REAL c, #HPDF_REAL d, #HPDF_REAL x, #HPDF_REAL y, #HPDF_REAL ) #--- Path construction operator ------------------------------------------ # m #HPDF_STATUS HPDF_Page_MoveTo (HPDF_Page page, HPDF_REAL x, HPDF_REAL y) _HPDF_Page_MoveTo=haru.HPDF_Page_MoveTo _HPDF_Page_MoveTo.restype=HPDF_STATUS def HPDF_Page_MoveTo( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_MoveTo( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ) # l #HPDF_STATUS HPDF_Page_LineTo (HPDF_Page page, HPDF_REAL x, HPDF_REAL y) _HPDF_Page_LineTo=haru.HPDF_Page_LineTo _HPDF_Page_LineTo.restype=HPDF_STATUS def HPDF_Page_LineTo( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_LineTo( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ) # c #HPDF_STATUS HPDF_Page_CurveTo (HPDF_Page page, HPDF_REAL x1, HPDF_REAL y1, HPDF_REAL x2, HPDF_REAL y2, HPDF_REAL x3, HPDF_REAL y3) _HPDF_Page_CurveTo=haru.HPDF_Page_CurveTo _HPDF_Page_CurveTo.restype=HPDF_STATUS def HPDF_Page_CurveTo( page, #HPDF_Page x1, #HPDF_REAL y1, #HPDF_REAL x2, #HPDF_REAL y2, #HPDF_REAL x3, #HPDF_REAL y3, #HPDF_REAL ): x1=HPDF_REAL(x1) y1=HPDF_REAL(y1) x2=HPDF_REAL(x2) y2=HPDF_REAL(y2) x3=HPDF_REAL(x3) y3=HPDF_REAL(y3) return _HPDF_Page_CurveTo( page, #HPDF_Page x1, #HPDF_REAL y1, #HPDF_REAL x2, #HPDF_REAL y2, #HPDF_REAL x3, #HPDF_REAL y3, #HPDF_REAL ) # v #HPDF_STATUS HPDF_Page_CurveTo2 (HPDF_Page page, HPDF_REAL x2, HPDF_REAL y2, HPDF_REAL x3, HPDF_REAL y3) _HPDF_Page_CurveTo2=haru.HPDF_Page_CurveTo2 _HPDF_Page_CurveTo2.restype=HPDF_STATUS def HPDF_Page_CurveTo2( page, #HPDF_Page x2, #HPDF_REAL y2, #HPDF_REAL x3, #HPDF_REAL y3, #HPDF_REAL ): x2=HPDF_REAL(x2) y2=HPDF_REAL(y2) x3=HPDF_REAL(x3) y3=HPDF_REAL(y3) return _HPDF_Page_CurveTo2( page, #HPDF_Page x2, #HPDF_REAL y2, #HPDF_REAL x3, #HPDF_REAL y3, #HPDF_REAL ) # y #HPDF_STATUS HPDF_Page_CurveTo3 (HPDF_Page page, HPDF_REAL x1, HPDF_REAL y1, HPDF_REAL x3, HPDF_REAL y3) _HPDF_Page_CurveTo3=haru.HPDF_Page_CurveTo3 _HPDF_Page_CurveTo3.restype=HPDF_STATUS def HPDF_Page_CurveTo3( page, #HPDF_Page x1, #HPDF_REAL y1, #HPDF_REAL x3, #HPDF_REAL y3, #HPDF_REAL ): x1=HPDF_REAL(x1) y1=HPDF_REAL(y1) x3=HPDF_REAL(x3) y3=HPDF_REAL(y3) return _HPDF_Page_CurveTo3( page, #HPDF_Page x1, #HPDF_REAL y1, #HPDF_REAL x3, #HPDF_REAL y3, #HPDF_REAL ) # h #HPDF_STATUS HPDF_Page_ClosePath (HPDF_Page page) HPDF_Page_ClosePath=haru.HPDF_Page_ClosePath HPDF_Page_ClosePath.restype=HPDF_STATUS # re #HPDF_STATUS HPDF_Page_Rectangle (HPDF_Page page, HPDF_REAL x, HPDF_REAL y, HPDF_REAL width, HPDF_REAL height) _HPDF_Page_Rectangle=haru.HPDF_Page_Rectangle _HPDF_Page_Rectangle.restype=HPDF_STATUS def HPDF_Page_Rectangle( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL width, #HPDF_REAL height, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) width=HPDF_REAL(width) height=HPDF_REAL(height) return _HPDF_Page_Rectangle( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL width, #HPDF_REAL height, #HPDF_REAL ) #--- Path painting operator --------------------------------------------- # S #HPDF_STATUS HPDF_Page_Stroke (HPDF_Page page) _HPDF_Page_Stroke=haru.HPDF_Page_Stroke _HPDF_Page_Stroke.restype=HPDF_STATUS def HPDF_Page_Stroke( page, #HPDF_Page ): return _HPDF_Page_Stroke( page, #HPDF_Page ) # s #HPDF_STATUS HPDF_Page_ClosePathStroke (HPDF_Page page) HPDF_Page_ClosePathStroke=haru.HPDF_Page_ClosePathStroke HPDF_Page_ClosePathStroke.restype=HPDF_STATUS # f #HPDF_STATUS HPDF_Page_Fill (HPDF_Page page) HPDF_Page_Fill=haru.HPDF_Page_Fill HPDF_Page_Fill.restype=HPDF_STATUS # f* #HPDF_STATUS HPDF_Page_Eofill (HPDF_Page page) HPDF_Page_Eofill=haru.HPDF_Page_Eofill HPDF_Page_Eofill.restype=HPDF_STATUS # B #HPDF_STATUS HPDF_Page_FillStroke (HPDF_Page page) HPDF_Page_FillStroke=haru.HPDF_Page_FillStroke HPDF_Page_FillStroke.restype=HPDF_STATUS # B* #HPDF_STATUS HPDF_Page_EofillStroke (HPDF_Page page) HPDF_Page_EofillStroke=haru.HPDF_Page_EofillStroke HPDF_Page_EofillStroke.restype=HPDF_STATUS # b #HPDF_STATUS HPDF_Page_ClosePathFillStroke (HPDF_Page page) HPDF_Page_ClosePathFillStroke=haru.HPDF_Page_ClosePathFillStroke HPDF_Page_ClosePathFillStroke.restype=HPDF_STATUS # b* #HPDF_STATUS HPDF_Page_ClosePathEofillStroke (HPDF_Page page) HPDF_Page_ClosePathEofillStroke=haru.HPDF_Page_ClosePathEofillStroke HPDF_Page_ClosePathEofillStroke.restype=HPDF_STATUS # n #HPDF_STATUS HPDF_Page_EndPath (HPDF_Page page) HPDF_Page_EndPath=haru.HPDF_Page_EndPath HPDF_Page_EndPath.restype=HPDF_STATUS #--- Clipping paths operator -------------------------------------------- # W #HPDF_STATUS HPDF_Page_Clip (HPDF_Page page) HPDF_Page_Clip=haru.HPDF_Page_Clip HPDF_Page_Clip.restype=HPDF_STATUS # W* #HPDF_STATUS HPDF_Page_Eoclip (HPDF_Page page) HPDF_Page_Eoclip=haru.HPDF_Page_Eoclip HPDF_Page_Eoclip.restype=HPDF_STATUS #--- Text object operator ----------------------------------------------- # BT #HPDF_STATUS HPDF_Page_BeginText (HPDF_Page page) HPDF_Page_BeginText=haru.HPDF_Page_BeginText HPDF_Page_BeginText.restype=HPDF_STATUS # ET #HPDF_STATUS HPDF_Page_EndText (HPDF_Page page) HPDF_Page_EndText=haru.HPDF_Page_EndText HPDF_Page_EndText.restype=HPDF_STATUS #--- Text state --------------------------------------------------------- # Tc #HPDF_STATUS HPDF_Page_SetCharSpace (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetCharSpace=haru.HPDF_Page_SetCharSpace _HPDF_Page_SetCharSpace.restype=HPDF_STATUS def HPDF_Page_SetCharSpace( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetCharSpace( page, #HPDF_Page value, #HPDF_REAL ) # Tw #HPDF_STATUS HPDF_Page_SetWordSpace (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetWordSpace=haru.HPDF_Page_SetWordSpace _HPDF_Page_SetWordSpace.restype=HPDF_STATUS def HPDF_Page_SetWordSpace( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetWordSpace( page, #HPDF_Page value, #HPDF_REAL ) # Tz #HPDF_STATUS HPDF_Page_SetHorizontalScalling (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetHorizontalScalling=haru.HPDF_Page_SetHorizontalScalling _HPDF_Page_SetHorizontalScalling.restype=HPDF_STATUS def HPDF_Page_SetHorizontalScalling( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetHorizontalScalling( page, #HPDF_Page value, #HPDF_REAL ) # TL #HPDF_STATUS HPDF_Page_SetTextLeading (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetTextLeading=haru.HPDF_Page_SetTextLeading _HPDF_Page_SetTextLeading.restype=HPDF_STATUS def HPDF_Page_SetTextLeading( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetTextLeading( page, #HPDF_Page value, #HPDF_REAL ) # Tf #HPDF_STATUS HPDF_Page_SetFontAndSize (HPDF_Page page, HPDF_Font font, HPDF_REAL size) _HPDF_Page_SetFontAndSize=haru.HPDF_Page_SetFontAndSize _HPDF_Page_SetFontAndSize.restype=HPDF_STATUS def HPDF_Page_SetFontAndSize( page, #HPDF_Page font, #HPDF_Font size, #HPDF_REAL ): size=HPDF_REAL(size) return _HPDF_Page_SetFontAndSize( page, #HPDF_Page font, #HPDF_Font size, #HPDF_REAL ) # Tr #HPDF_STATUS HPDF_Page_SetTextRenderingMode (HPDF_Page page, HPDF_TextRenderingMode mode) HPDF_Page_SetTextRenderingMode=haru.HPDF_Page_SetTextRenderingMode HPDF_Page_SetTextRenderingMode.restype=HPDF_STATUS # Ts #HPDF_STATUS HPDF_Page_SetTextRise (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetTextRise=haru.HPDF_Page_SetTextRise _HPDF_Page_SetTextRise.restype=HPDF_STATUS def HPDF_Page_SetTextRise( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetTextRise( page, #HPDF_Page value, #HPDF_REAL ) # This function is obsolete. Use HPDF_Page_SetTextRise. #HPDF_STATUS HPDF_Page_SetTextRaise (HPDF_Page page, HPDF_REAL value) _HPDF_Page_SetTextRaise=haru.HPDF_Page_SetTextRaise _HPDF_Page_SetTextRaise.restype=HPDF_STATUS def HPDF_Page_SetTextRaise( page, #HPDF_Page value, #HPDF_REAL ): value=HPDF_REAL(value) return _HPDF_Page_SetTextRaise( page, #HPDF_Page value, #HPDF_REAL ) #--- Text positioning --------------------------------------------------- # Td #HPDF_STATUS HPDF_Page_MoveTextPos (HPDF_Page page, HPDF_REAL x, HPDF_REAL y) _HPDF_Page_MoveTextPos=haru.HPDF_Page_MoveTextPos _HPDF_Page_MoveTextPos.restype=HPDF_STATUS def HPDF_Page_MoveTextPos( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_MoveTextPos( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ) # TD #HPDF_STATUS HPDF_Page_MoveTextPos2 (HPDF_Page page, HPDF_REAL x, HPDF_REAL y) _HPDF_Page_MoveTextPos2=haru.HPDF_Page_MoveTextPos2 _HPDF_Page_MoveTextPos2.restype=HPDF_STATUS def HPDF_Page_MoveTextPos2( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_MoveTextPos2( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ) # Tm #HPDF_STATUS HPDF_Page_SetTextMatrix (HPDF_Page page, HPDF_REAL a, HPDF_REAL b, HPDF_REAL c, HPDF_REAL d, HPDF_REAL x, HPDF_REAL y) _HPDF_Page_SetTextMatrix=haru.HPDF_Page_SetTextMatrix _HPDF_Page_SetTextMatrix.restype=HPDF_STATUS def HPDF_Page_SetTextMatrix( page, #HPDF_Page a, #HPDF_REAL b, #HPDF_REAL c, #HPDF_REAL d, #HPDF_REAL x, #HPDF_REAL y, #HPDF_REAL ): a=HPDF_REAL(a) b=HPDF_REAL(b) c=HPDF_REAL(c) d=HPDF_REAL(d) x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_SetTextMatrix( page, #HPDF_Page a, #HPDF_REAL b, #HPDF_REAL c, #HPDF_REAL d, #HPDF_REAL x, #HPDF_REAL y, #HPDF_REAL ) # T* #HPDF_STATUS HPDF_Page_MoveToNextLine (HPDF_Page page) HPDF_Page_MoveToNextLine=haru.HPDF_Page_MoveToNextLine HPDF_Page_MoveToNextLine.restype=HPDF_STATUS #--- Text showing ------------------------------------------------------- # Tj #HPDF_STATUS HPDF_Page_ShowText (HPDF_Page page, const char *text) _HPDF_Page_ShowText=haru.HPDF_Page_ShowText _HPDF_Page_ShowText.restype=HPDF_STATUS def HPDF_Page_ShowText(page, text ): if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Page_ShowText(page, text ) # TJ # ' #HPDF_STATUS HPDF_Page_ShowTextNextLine (HPDF_Page page, const char *text) HPDF_Page_ShowTextNextLine=haru.HPDF_Page_ShowTextNextLine HPDF_Page_ShowTextNextLine.restype=HPDF_STATUS # " #HPDF_STATUS HPDF_Page_ShowTextNextLineEx (HPDF_Page page, HPDF_REAL word_space, HPDF_REAL char_space, const char *text) _HPDF_Page_ShowTextNextLineEx=haru.HPDF_Page_ShowTextNextLineEx _HPDF_Page_ShowTextNextLineEx.restype=HPDF_STATUS def HPDF_Page_ShowTextNextLineEx( page, #HPDF_Page word_space, #HPDF_REAL char_space, #HPDF_REAL text, #c_char_p ): word_space=HPDF_REAL(word_space) char_space=HPDF_REAL(char_space) return _HPDF_Page_ShowTextNextLineEx( page, #HPDF_Page word_space, #HPDF_REAL char_space, #HPDF_REAL text, #c_char_p ) #--- Color showing ------------------------------------------------------ # cs --not implemented yet # CS --not implemented yet # sc --not implemented yet # scn --not implemented yet # SC --not implemented yet # SCN --not implemented yet # g #HPDF_STATUS HPDF_Page_SetGrayFill (HPDF_Page page, HPDF_REAL gray) _HPDF_Page_SetGrayFill=haru.HPDF_Page_SetGrayFill _HPDF_Page_SetGrayFill.restype=HPDF_STATUS def HPDF_Page_SetGrayFill( page, #HPDF_Page gray, #HPDF_REAL ): gray=HPDF_REAL(gray) return _HPDF_Page_SetGrayFill( page, #HPDF_Page gray, #HPDF_REAL ) # G #HPDF_STATUS HPDF_Page_SetGrayStroke (HPDF_Page page, HPDF_REAL gray) _HPDF_Page_SetGrayStroke=haru.HPDF_Page_SetGrayStroke _HPDF_Page_SetGrayStroke.restype=HPDF_STATUS def HPDF_Page_SetGrayStroke( page, #HPDF_Page gray, #HPDF_REAL ): gray=HPDF_REAL(gray) return _HPDF_Page_SetGrayStroke( page, #HPDF_Page gray, #HPDF_REAL ) # rg #HPDF_STATUS HPDF_Page_SetRGBFill (HPDF_Page page, HPDF_REAL r, HPDF_REAL g, HPDF_REAL b) _HPDF_Page_SetRGBFill=haru.HPDF_Page_SetRGBFill _HPDF_Page_SetRGBFill.restype=HPDF_STATUS def HPDF_Page_SetRGBFill( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ): r=HPDF_REAL(r) g=HPDF_REAL(g) b=HPDF_REAL(b) return _HPDF_Page_SetRGBFill( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ) # RG #HPDF_STATUS HPDF_Page_SetRGBStroke (HPDF_Page page, HPDF_REAL r, HPDF_REAL g, HPDF_REAL b) _HPDF_Page_SetRGBStroke=haru.HPDF_Page_SetRGBStroke _HPDF_Page_SetRGBStroke.restype=HPDF_STATUS def HPDF_Page_SetRGBStroke( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ): r=HPDF_REAL(r) g=HPDF_REAL(g) b=HPDF_REAL(b) return _HPDF_Page_SetRGBStroke( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ) # k #HPDF_STATUS HPDF_Page_SetCMYKFill (HPDF_Page page, HPDF_REAL c, HPDF_REAL m, HPDF_REAL y, HPDF_REAL k) _HPDF_Page_SetCMYKFill=haru.HPDF_Page_SetCMYKFill _HPDF_Page_SetCMYKFill.restype=HPDF_STATUS def HPDF_Page_SetCMYKFill( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ): c=HPDF_REAL(c) m=HPDF_REAL(m) y=HPDF_REAL(y) k=HPDF_REAL(k) return _HPDF_Page_SetCMYKFill( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ) # K #HPDF_STATUS HPDF_Page_SetCMYKStroke (HPDF_Page page, HPDF_REAL c, HPDF_REAL m, HPDF_REAL y, HPDF_REAL k) _HPDF_Page_SetCMYKStroke=haru.HPDF_Page_SetCMYKStroke _HPDF_Page_SetCMYKStroke.restype=HPDF_STATUS def HPDF_Page_SetCMYKStroke( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ): c=HPDF_REAL(c) m=HPDF_REAL(m) y=HPDF_REAL(y) k=HPDF_REAL(k) return _HPDF_Page_SetCMYKStroke( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ) #--- Shading patterns --------------------------------------------------- # sh --not implemented yet #--- In-line images ----------------------------------------------------- # BI --not implemented yet # ID --not implemented yet # EI --not implemented yet #--- XObjects ----------------------------------------------------------- # Do #HPDF_STATUS HPDF_Page_ExecuteXObject (HPDF_Page page, HPDF_XObject obj) HPDF_Page_ExecuteXObject=haru.HPDF_Page_ExecuteXObject HPDF_Page_ExecuteXObject.restype=HPDF_STATUS #--- Marked content ----------------------------------------------------- # BMC --not implemented yet # BDC --not implemented yet # EMC --not implemented yet # MP --not implemented yet # DP --not implemented yet #--- Compatibility ------------------------------------------------------ # BX --not implemented yet # EX --not implemented yet #HPDF_STATUS HPDF_Page_DrawImage (HPDF_Page page, HPDF_Image image, HPDF_REAL x, HPDF_REAL y, HPDF_REAL width, HPDF_REAL height) _HPDF_Page_DrawImage=haru.HPDF_Page_DrawImage _HPDF_Page_DrawImage.restype=HPDF_STATUS def HPDF_Page_DrawImage( page, #HPDF_Page image, #HPDF_Image x, #HPDF_REAL y, #HPDF_REAL width, #HPDF_REAL height, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) width=HPDF_REAL(width) height=HPDF_REAL(height) return _HPDF_Page_DrawImage( page, #HPDF_Page image, #HPDF_Image x, #HPDF_REAL y, #HPDF_REAL width, #HPDF_REAL height, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_Circle (HPDF_Page page, HPDF_REAL x, HPDF_REAL y, HPDF_REAL ray) _HPDF_Page_Circle=haru.HPDF_Page_Circle _HPDF_Page_Circle.restype=HPDF_STATUS def HPDF_Page_Circle( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) ray=HPDF_REAL(ray) return _HPDF_Page_Circle( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_Ellipse (HPDF_Page page, HPDF_REAL x, HPDF_REAL y, HPDF_REAL xray, HPDF_REAL yray) _HPDF_Page_Ellipse=haru.HPDF_Page_Ellipse _HPDF_Page_Ellipse.restype=HPDF_STATUS def HPDF_Page_Ellipse( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL xray, #HPDF_REAL yray, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) xray=HPDF_REAL(xray) yray=HPDF_REAL(yray) return _HPDF_Page_Ellipse( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL xray, #HPDF_REAL yray, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_Arc (HPDF_Page page, HPDF_REAL x, HPDF_REAL y, HPDF_REAL ray, HPDF_REAL ang1, HPDF_REAL ang2) _HPDF_Page_Arc=haru.HPDF_Page_Arc _HPDF_Page_Arc.restype=HPDF_STATUS def HPDF_Page_Arc( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ang1, #HPDF_REAL ang2, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) ray=HPDF_REAL(ray) ang1=HPDF_REAL(ang1) ang2=HPDF_REAL(ang2) return _HPDF_Page_Arc( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ang1, #HPDF_REAL ang2, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_TextOut (HPDF_Page page, HPDF_REAL xpos, HPDF_REAL ypos, const char *text) _HPDF_Page_TextOut=haru.HPDF_Page_TextOut _HPDF_Page_TextOut.restype=HPDF_STATUS def HPDF_Page_TextOut( page, #HPDF_Page xpos, #HPDF_REAL ypos, #HPDF_REAL text, #c_char_p ): xpos=HPDF_REAL(xpos) ypos=HPDF_REAL(ypos) if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Page_TextOut( page, #HPDF_Page xpos, #HPDF_REAL ypos, #HPDF_REAL text, #c_char_p ) #HPDF_STATUS HPDF_Page_TextRect (HPDF_Page page, HPDF_REAL left, HPDF_REAL top, HPDF_REAL right, HPDF_REAL bottom, const char *text, HPDF_TextAlignment align, HPDF_UINT *len) #??? _HPDF_Page_TextRect=haru.HPDF_Page_TextRect _HPDF_Page_TextRect.restype=HPDF_STATUS def HPDF_Page_TextRect( page, #HPDF_Page left, #HPDF_REAL top, #HPDF_REAL right, #HPDF_REAL bottom, #HPDF_REAL text, #c_char_p align, #HPDF_TextAlignment length, #POINTER(HPDF_UINT) ): left=HPDF_REAL(left) top=HPDF_REAL(top) right=HPDF_REAL(right) bottom=HPDF_REAL(bottom) if type(length) in (types.ListType, types.TupleType): size=len(length) length=pointer((HPDF_UINT*size)(*length)) return _HPDF_Page_TextRect( page, #HPDF_Page left, #HPDF_REAL top, #HPDF_REAL right, #HPDF_REAL bottom, #HPDF_REAL text, #c_char_p align, #HPDF_TextAlignment length, #POINTER(HPDF_UINT) ) #HPDF_STATUS HPDF_Page_SetSlideShow (HPDF_Page page, HPDF_TransitionStyle type, HPDF_REAL disp_time, HPDF_REAL trans_time) _HPDF_Page_SetSlideShow=haru.HPDF_Page_SetSlideShow _HPDF_Page_SetSlideShow.restype=HPDF_STATUS def HPDF_Page_SetSlideShow( page, #HPDF_Page tType, #HPDF_TransitionStyle disp_time, #HPDF_REAL trans_time, #HPDF_REAL ): disp_time=HPDF_REAL(disp_time) trans_time=HPDF_REAL(trans_time) return _HPDF_Page_SetSlideShow( page, #HPDF_Page tType, #HPDF_TransitionStyle disp_time, #HPDF_REAL trans_time, #HPDF_REAL ) NULL=0 HPDF_NOPNGLIB=False
36.664924
213
0.572962
DF_HANDLE HPDF_Page=HPDF_HANDLE HPDF_Pages=HPDF_HANDLE HPDF_Stream=HPDF_HANDLE HPDF_Image=HPDF_HANDLE HPDF_Font=HPDF_HANDLE HPDF_Outline=HPDF_HANDLE HPDF_Encoder=HPDF_HANDLE HPDF_Destination=HPDF_HANDLE HPDF_XObject=HPDF_HANDLE HPDF_Annotation=HPDF_HANDLE HPDF_ExtGState=HPDF_HANDLE HPDF_GetVersion=haru.HPDF_GetVersion HPDF_GetVersion.restype=c_char_p HPDF_NewEx=haru.HPDF_NewEx HPDF_NewEx.restype=HPDF_Doc HPDF_New=haru.HPDF_New HPDF_New.restype=HPDF_Doc HPDF_SetErrorHandler=haru.HPDF_SetErrorHandler HPDF_SetErrorHandler.restype=HPDF_STATUS HPDF_Free=haru.HPDF_Free HPDF_Free.restype=None HPDF_NewDoc=haru.HPDF_NewDoc HPDF_NewDoc.restype=HPDF_STATUS HPDF_FreeDoc=haru.HPDF_FreeDoc HPDF_FreeDoc.restype=None HPDF_HasDoc=haru.HPDF_HasDoc HPDF_HasDoc.restype=HPDF_BOOL HPDF_FreeDocAll=haru.HPDF_FreeDocAll HPDF_FreeDocAll.restype=None HPDF_SaveToStream=haru.HPDF_SaveToStream HPDF_SaveToStream.restype=HPDF_STATUS HPDF_GetStreamSize=haru.HPDF_GetStreamSize HPDF_GetStreamSize.restype=HPDF_UINT32 _HPDF_ReadFromStream=haru.HPDF_ReadFromStream _HPDF_ReadFromStream.restype=HPDF_STATUS def HPDF_ReadFromStream( pdf, buf, size, ): if type(buf) in (types.ListType, types.TupleType): size=len(buf) buf=pointer((HPDF_BYTE*size)(*buf)) size=HPDF_UINT32(int(size)) return _HPDF_ReadFromStream( pdf, buf, size, ) HPDF_ResetStream=haru.HPDF_ResetStream HPDF_ResetStream.restype=HPDF_STATUS HPDF_SaveToFile=haru.HPDF_SaveToFile HPDF_SaveToFile.restype=HPDF_STATUS HPDF_GetError=haru.HPDF_GetError HPDF_GetError.restype=HPDF_STATUS HPDF_GetErrorDetail=haru.HPDF_GetErrorDetail HPDF_GetErrorDetail.restype=HPDF_STATUS HPDF_ResetError=haru.HPDF_ResetError HPDF_ResetError.restype=None _HPDF_SetPagesConfiguration=haru.HPDF_SetPagesConfiguration _HPDF_SetPagesConfiguration.restype=HPDF_STATUS def HPDF_SetPagesConfiguration( pdf, page_per_pages, ): page_per_pages=HPDF_UINT(int(page_per_pages)) return _HPDF_SetPagesConfiguration( pdf, page_per_pages, ) HPDF_GetPageByIndex=haru.HPDF_GetPageByIndex HPDF_GetPageByIndex.restype=HPDF_Page HPDF_GetPageLayout=haru.HPDF_GetPageLayout HPDF_GetPageLayout.restype=HPDF_PageLayout HPDF_SetPageLayout=haru.HPDF_SetPageLayout HPDF_SetPageLayout.restype=HPDF_STATUS HPDF_GetPageMode=haru.HPDF_GetPageMode HPDF_GetPageMode.restype=HPDF_PageMode HPDF_SetPageMode=haru.HPDF_SetPageMode HPDF_SetPageMode.restype=HPDF_STATUS HPDF_GetViewerPreference=haru.HPDF_GetViewerPreference HPDF_GetViewerPreference.restype=HPDF_UINT HPDF_SetViewerPreference=haru.HPDF_SetViewerPreference HPDF_SetViewerPreference.restype=HPDF_STATUS HPDF_SetOpenAction=haru.HPDF_SetOpenAction HPDF_SetOpenAction.restype=HPDF_STATUS HPDF_GetCurrentPage=haru.HPDF_GetCurrentPage HPDF_GetCurrentPage.restype=HPDF_Page HPDF_AddPage=haru.HPDF_AddPage HPDF_AddPage.restype=HPDF_Page HPDF_InsertPage=haru.HPDF_InsertPage HPDF_InsertPage.restype=HPDF_Page _HPDF_Page_SetWidth=haru.HPDF_Page_SetWidth _HPDF_Page_SetWidth.restype=HPDF_STATUS def HPDF_Page_SetWidth( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetWidth( page, value, ) _HPDF_Page_SetHeight=haru.HPDF_Page_SetHeight _HPDF_Page_SetHeight.restype=HPDF_STATUS def HPDF_Page_SetHeight( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetHeight( page, value, ) HPDF_Page_SetSize=haru.HPDF_Page_SetSize HPDF_Page_SetSize.restype=HPDF_STATUS _HPDF_Page_SetRotate=haru.HPDF_Page_SetRotate _HPDF_Page_SetRotate.restype=HPDF_STATUS def HPDF_Page_SetRotate( page, angle, ): angle=HPDF_UINT16(int(angle)) return _HPDF_Page_SetRotate( page, angle, ) HPDF_GetFont=haru.HPDF_GetFont HPDF_GetFont.restype=HPDF_Font HPDF_LoadType1FontFromFile=haru.HPDF_LoadType1FontFromFile HPDF_LoadType1FontFromFile.restype=c_char_p HPDF_LoadTTFontFromFile=haru.HPDF_LoadTTFontFromFile HPDF_LoadTTFontFromFile.restype=c_char_p HPDF_LoadTTFontFromFile2=haru.HPDF_LoadTTFontFromFile2 HPDF_LoadTTFontFromFile2.restype=c_char_p _HPDF_AddPageLabel=haru.HPDF_AddPageLabel _HPDF_AddPageLabel.restype=HPDF_STATUS def HPDF_AddPageLabel( pdf, page_num, style, first_page, prefix, ): page_num, first_page=[HPDF_UINT(int(i))for i in (page_num, first_page)] return _HPDF_AddPageLabel( pdf, page_num, style, first_page, prefix, ) HPDF_UseJPFonts=haru.HPDF_UseJPFonts HPDF_UseJPFonts.restype=HPDF_STATUS HPDF_UseKRFonts=haru.HPDF_UseKRFonts HPDF_UseKRFonts.restype=HPDF_STATUS HPDF_UseCNSFonts=haru.HPDF_UseCNSFonts HPDF_UseCNSFonts.restype=HPDF_STATUS HPDF_UseCNTFonts=haru.HPDF_UseCNTFonts HPDF_UseCNTFonts.restype=HPDF_STATUS HPDF_CreateOutline=haru.HPDF_CreateOutline HPDF_CreateOutline.restype=HPDF_Outline HPDF_Outline_SetOpened=haru.HPDF_Outline_SetOpened HPDF_Outline_SetOpened.restype=HPDF_STATUS HPDF_Outline_SetDestination=haru.HPDF_Outline_SetDestination HPDF_Outline_SetDestination.restype=HPDF_STATUS HPDF_Page_CreateDestination=haru.HPDF_Page_CreateDestination HPDF_Page_CreateDestination.restype=HPDF_Destination _HPDF_Destination_SetXYZ=haru.HPDF_Destination_SetXYZ _HPDF_Destination_SetXYZ.restype=HPDF_STATUS def HPDF_Destination_SetXYZ( dst, left, top, zoom, ): left=HPDF_REAL(left) top=HPDF_REAL(top) zoom=HPDF_REAL(zoom) return _HPDF_Destination_SetXYZ( dst, left, top, zoom, ) HPDF_Destination_SetFit=haru.HPDF_Destination_SetFit HPDF_Destination_SetFit.restype=HPDF_STATUS _HPDF_Destination_SetFitH=haru.HPDF_Destination_SetFitH _HPDF_Destination_SetFitH.restype=HPDF_STATUS def HPDF_Destination_SetFitH( dst, top, ): top=HPDF_REAL(top) return _HPDF_Destination_SetFitH( dst, top, ) _HPDF_Destination_SetFitV=haru.HPDF_Destination_SetFitV _HPDF_Destination_SetFitV.restype=HPDF_STATUS def HPDF_Destination_SetFitV( dst, left, ): left=HPDF_REAL(left) return _HPDF_Destination_SetFitV( dst, left, ) _HPDF_Destination_SetFitR=haru.HPDF_Destination_SetFitR _HPDF_Destination_SetFitR.restype=HPDF_STATUS def HPDF_Destination_SetFitR( dst, left, bottom, right, top, ): left=HPDF_REAL(left) bottom=HPDF_REAL(bottom) right=HPDF_REAL(right) top=HPDF_REAL(top) return _HPDF_Destination_SetFitR( dst, left, bottom, right, top, ) HPDF_Destination_SetFitB=haru.HPDF_Destination_SetFitB HPDF_Destination_SetFitB.restype=HPDF_STATUS _HPDF_Destination_SetFitBH=haru.HPDF_Destination_SetFitBH _HPDF_Destination_SetFitBH.restype=HPDF_STATUS def HPDF_Destination_SetFitBH( dst, top, ): top=HPDF_REAL(top) return _HPDF_Destination_SetFitBH( dst, top, ) _HPDF_Destination_SetFitBV=haru.HPDF_Destination_SetFitBV _HPDF_Destination_SetFitBV.restype=HPDF_STATUS def HPDF_Destination_SetFitBV( dst, left, ): left=HPDF_REAL(left) return _HPDF_Destination_SetFitBV( dst, left, ) HPDF_GetEncoder=haru.HPDF_GetEncoder HPDF_GetEncoder.restype=HPDF_Encoder HPDF_GetCurrentEncoder=haru.HPDF_GetCurrentEncoder HPDF_GetCurrentEncoder.restype=HPDF_Encoder HPDF_SetCurrentEncoder=haru.HPDF_SetCurrentEncoder HPDF_SetCurrentEncoder.restype=HPDF_STATUS HPDF_Encoder_GetType=haru.HPDF_Encoder_GetType HPDF_Encoder_GetType.restype=HPDF_EncoderType _HPDF_Encoder_GetByteType=haru.HPDF_Encoder_GetByteType _HPDF_Encoder_GetByteType.restype=HPDF_ByteType def HPDF_Encoder_GetByteType( encoder, text, index ): if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Encoder_GetByteType( encoder, text, index ) HPDF_Encoder_GetUnicode=haru.HPDF_Encoder_GetUnicode HPDF_Encoder_GetUnicode.restype=HPDF_UNICODE HPDF_Encoder_GetWritingMode=haru.HPDF_Encoder_GetWritingMode HPDF_Encoder_GetWritingMode.restype=HPDF_WritingMode HPDF_UseJPEncodings=haru.HPDF_UseJPEncodings HPDF_UseJPEncodings.restype=HPDF_STATUS HPDF_UseKREncodings=haru.HPDF_UseKREncodings HPDF_UseKREncodings.restype=HPDF_STATUS HPDF_UseCNSEncodings=haru.HPDF_UseCNSEncodings HPDF_UseCNSEncodings.restype=HPDF_STATUS HPDF_UseCNTEncodings=haru.HPDF_UseCNTEncodings HPDF_UseCNTEncodings.restype=HPDF_STATUS HPDF_Page_CreateTextAnnot=haru.HPDF_Page_CreateTextAnnot HPDF_Page_CreateTextAnnot.restype=HPDF_Annotation HPDF_Page_CreateLinkAnnot=haru.HPDF_Page_CreateLinkAnnot HPDF_Page_CreateLinkAnnot.restype=HPDF_Annotation HPDF_Page_CreateURILinkAnnot=haru.HPDF_Page_CreateURILinkAnnot HPDF_Page_CreateURILinkAnnot.restype=HPDF_Annotation HPDF_LinkAnnot_SetHighlightMode=haru.HPDF_LinkAnnot_SetHighlightMode HPDF_LinkAnnot_SetHighlightMode.restype=HPDF_STATUS _HPDF_LinkAnnot_SetBorderStyle=haru.HPDF_LinkAnnot_SetBorderStyle _HPDF_LinkAnnot_SetBorderStyle.restype=HPDF_STATUS def HPDF_LinkAnnot_SetBorderStyle( annot, width, dash_on, dash_off, ): width=HPDF_REAL(width) dash_on=HPDF_UINT16(dash_on) dash_off=HPDF_UINT16(dash_off) return _HPDF_LinkAnnot_SetBorderStyle( annot, width, dash_on, dash_off, ) HPDF_TextAnnot_SetIcon=haru.HPDF_TextAnnot_SetIcon HPDF_TextAnnot_SetIcon.restype=HPDF_STATUS HPDF_TextAnnot_SetOpened=haru.HPDF_TextAnnot_SetOpened HPDF_TextAnnot_SetOpened.restype=HPDF_STATUS HPDF_LoadPngImageFromFile=haru.HPDF_LoadPngImageFromFile HPDF_LoadPngImageFromFile.restype=HPDF_Image HPDF_LoadPngImageFromFile2=haru.HPDF_LoadPngImageFromFile2 HPDF_LoadPngImageFromFile2.restype=HPDF_Image HPDF_LoadJpegImageFromFile=haru.HPDF_LoadJpegImageFromFile HPDF_LoadJpegImageFromFile.restype=HPDF_Image _HPDF_LoadRawImageFromFile=haru.HPDF_LoadRawImageFromFile _HPDF_LoadRawImageFromFile.restype=HPDF_Image def HPDF_LoadRawImageFromFile( pdf, filename, width, height, color_space, ): width=HPDF_UINT(width) height=HPDF_UINT(height) return _HPDF_LoadRawImageFromFile( pdf, filename, width, height, color_space, ) _HPDF_LoadRawImageFromMem=haru.HPDF_LoadRawImageFromMem _HPDF_LoadRawImageFromMem.restype=HPDF_Image def HPDF_LoadRawImageFromMem( pdf, buf, width, height, color_space, bits_per_component, ): if type(buf) in (types.ListType, types.TupleType): size=len(buf) buf=pointer((HPDF_BYTE*size)(*buf)) if height in [0, None]: height=size/width width=HPDF_UINT(width) height=HPDF_UINT(height) bits_per_component=HPDF_UINT(bits_per_component) return _HPDF_LoadRawImageFromMem( pdf, buf, width, height, color_space, bits_per_component, ) HPDF_Image_GetSize=haru.HPDF_Image_GetSize HPDF_Image_GetSize.restype=HPDF_Point _HPDF_Image_GetSize2=haru.HPDF_Image_GetSize2 _HPDF_Image_GetSize2.restype=HPDF_STATUS def HPDF_Image_GetSize2( image, size=None, ): size=HPDF_Point ret= _HPDF_Image_GetSize2( image, size, ) return ret, size.x, size.y HPDF_Image_GetWidth=haru.HPDF_Image_GetWidth HPDF_Image_GetWidth.restype=HPDF_UINT HPDF_Image_GetHeight=haru.HPDF_Image_GetHeight HPDF_Image_GetHeight.restype=HPDF_UINT HPDF_Image_GetBitsPerComponent=haru.HPDF_Image_GetBitsPerComponent HPDF_Image_GetBitsPerComponent.restype=HPDF_UINT HPDF_Image_GetColorSpace=haru.HPDF_Image_GetColorSpace HPDF_Image_GetColorSpace.restype=c_char_p _HPDF_Image_SetColorMask=haru.HPDF_Image_SetColorMask _HPDF_Image_SetColorMask.restype=HPDF_STATUS def HPDF_Image_SetColorMask( image, rmin, rmax, gmin, gmax, bmin, bmax, ): rmin=HPDF_UINT(rmin) rmax=HPDF_UINT(rmax) gmin=HPDF_UINT(gmin) gmax=HPDF_UINT(gmax) bmin=HPDF_UINT(bmin) bmax=HPDF_UINT(bmax) return _HPDF_Image_SetColorMask( image, rmin, rmax, gmin, gmax, bmin, bmax, ) HPDF_Image_SetMaskImage=haru.HPDF_Image_SetMaskImage HPDF_Image_SetMaskImage.restype=HPDF_STATUS HPDF_SetInfoAttr=haru.HPDF_SetInfoAttr HPDF_SetInfoAttr.restype=HPDF_STATUS HPDF_GetInfoAttr=haru.HPDF_GetInfoAttr HPDF_GetInfoAttr.restype=c_char_p HPDF_SetInfoDateAttr=haru.HPDF_SetInfoDateAttr HPDF_SetInfoDateAttr.restype=HPDF_STATUS HPDF_SetPassword=haru.HPDF_SetPassword HPDF_SetPassword.restype=HPDF_STATUS _HPDF_SetPermission=haru.HPDF_SetPermission _HPDF_SetPermission.restype=HPDF_STATUS def HPDF_SetPermission( pdf, permission, ): permission=HPDF_UINT(int(permission)) return _HPDF_SetPermission( pdf, permission, ) _HPDF_SetEncryptionMode=haru.HPDF_SetEncryptionMode _HPDF_SetEncryptionMode.restype=HPDF_STATUS def HPDF_SetEncryptionMode( pdf, mode, key_len, ): key_len=HPDF_UINT(int(key_len)) return _HPDF_SetEncryptionMode( pdf, mode, key_len, ) HPDF_SetCompressionMode=haru.HPDF_SetCompressionMode HPDF_SetCompressionMode.restype=HPDF_STATUS HPDF_Font_GetFontName=haru.HPDF_Font_GetFontName HPDF_Font_GetFontName.restype=c_char_p HPDF_Font_GetEncodingName=haru.HPDF_Font_GetEncodingName HPDF_Font_GetEncodingName.restype=c_char_p HPDF_Font_GetUnicodeWidth=haru.HPDF_Font_GetUnicodeWidth HPDF_Font_GetUnicodeWidth.restype=HPDF_INT HPDF_Font_GetBBox=haru.HPDF_Font_GetBBox HPDF_Font_GetBBox.restype=HPDF_Box HPDF_Font_GetAscent=haru.HPDF_Font_GetAscent HPDF_Font_GetAscent.restype=HPDF_INT HPDF_Font_GetDescent=haru.HPDF_Font_GetDescent HPDF_Font_GetDescent.restype=HPDF_INT HPDF_Font_GetXHeight=haru.HPDF_Font_GetXHeight HPDF_Font_GetXHeight.restype=HPDF_UINT HPDF_Font_GetCapHeight=haru.HPDF_Font_GetCapHeight HPDF_Font_GetCapHeight.restype=HPDF_UINT HPDF_Font_TextWidth=haru.HPDF_Font_TextWidth HPDF_Font_TextWidth.restype=HPDF_TextWidth _HPDF_Font_MeasureText=haru.HPDF_Font_MeasureText _HPDF_Font_MeasureText.restype=HPDF_UINT def HPDF_Font_MeasureText( font, text, length, width, font_size, char_space, word_space, wordwrap, real_width, ): if type(text) in (types.TupleType, types.ListType): length=len(text) text=pointer((HPDF_BYTE*length)(*text)) length=HPDF_UINT(int(length)) width=HPDF_REAL(width) font_size=HPDF_REAL(font_size) char_space=HPDF_REAL(char_space) word_space=HPDF_REAL(word_space) real_width=HPDF_REAL(real_width) return _HPDF_Font_MeasureText( font, text, length, width, font_size, char_space, word_space, wordwrap, real_width, ) HPDF_CreateExtGState=haru.HPDF_CreateExtGState HPDF_CreateExtGState.restype=HPDF_ExtGState _HPDF_ExtGState_SetAlphaStroke=haru.HPDF_ExtGState_SetAlphaStroke _HPDF_ExtGState_SetAlphaStroke.restype=HPDF_STATUS def HPDF_ExtGState_SetAlphaStroke( ext_gstate, value, ): value=HPDF_REAL(value) return _HPDF_ExtGState_SetAlphaStroke( ext_gstate, value, ) _HPDF_ExtGState_SetAlphaFill=haru.HPDF_ExtGState_SetAlphaFill _HPDF_ExtGState_SetAlphaFill.restype=HPDF_STATUS def HPDF_ExtGState_SetAlphaFill( ext_gstate, value, ): value=HPDF_REAL(value) return _HPDF_ExtGState_SetAlphaFill( ext_gstate, value, ) HPDF_ExtGState_SetBlendMode=haru.HPDF_ExtGState_SetBlendMode HPDF_ExtGState_SetBlendMode.restype=HPDF_STATUS _HPDF_Page_TextWidth=haru.HPDF_Page_TextWidth _HPDF_Page_TextWidth.restype=HPDF_REAL def HPDF_Page_TextWidth( page, text, ): if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Page_TextWidth( page, text, ) _HPDF_Page_MeasureText=haru.HPDF_Page_MeasureText _HPDF_Page_MeasureText.restype=HPDF_UINT def HPDF_Page_MeasureText( page, text, width, wordwrap, real_width, ): width=HPDF_REAL(width) real_width=HPDF_REAL(real_width) return _HPDF_Page_MeasureText( page, text, width, wordwrap, real_width, ) HPDF_Page_GetWidth=haru.HPDF_Page_GetWidth HPDF_Page_GetWidth.restype=HPDF_REAL HPDF_Page_GetHeight=haru.HPDF_Page_GetHeight HPDF_Page_GetHeight.restype=HPDF_REAL HPDF_Page_GetGMode=haru.HPDF_Page_GetGMode HPDF_Page_GetGMode.restype=HPDF_UINT16 HPDF_Page_GetCurrentPos=haru.HPDF_Page_GetCurrentPos HPDF_Page_GetCurrentPos.restype=HPDF_Point _HPDF_Page_GetCurrentPos2=haru.HPDF_Page_GetCurrentPos2 _HPDF_Page_GetCurrentPos2.restype=HPDF_STATUS def HPDF_Page_GetCurrentPos2( page, pos=None, ): pos=HPDF_Point() ret= _HPDF_Page_GetCurrentPos2( page, pos, ) return ret, pos.x, pos.y HPDF_Page_GetCurrentTextPos=haru.HPDF_Page_GetCurrentTextPos HPDF_Page_GetCurrentTextPos.restype=HPDF_Point _HPDF_Page_GetCurrentTextPos2=haru.HPDF_Page_GetCurrentTextPos2 _HPDF_Page_GetCurrentTextPos2.restype=HPDF_STATUS def HPDF_Page_GetCurrentTextPos2( page, pos=None, ): pos=HPDF_Point() ret= _HPDF_Page_GetCurrentTextPos2( page, pos, ) return ret, pos.x, pos.y HPDF_Page_GetCurrentFont=haru.HPDF_Page_GetCurrentFont HPDF_Page_GetCurrentFont.restype=HPDF_Font HPDF_Page_GetCurrentFontSize=haru.HPDF_Page_GetCurrentFontSize HPDF_Page_GetCurrentFontSize.restype=HPDF_REAL HPDF_Page_GetTransMatrix=haru.HPDF_Page_GetTransMatrix HPDF_Page_GetTransMatrix.restype=HPDF_TransMatrix HPDF_Page_GetLineWidth=haru.HPDF_Page_GetLineWidth HPDF_Page_GetLineWidth.restype=HPDF_REAL HPDF_Page_GetLineCap=haru.HPDF_Page_GetLineCap HPDF_Page_GetLineCap.restype=HPDF_LineCap HPDF_Page_GetLineJoin=haru.HPDF_Page_GetLineJoin HPDF_Page_GetLineJoin.restype=HPDF_LineJoin HPDF_Page_GetMiterLimit=haru.HPDF_Page_GetMiterLimit HPDF_Page_GetMiterLimit.restype=HPDF_REAL HPDF_Page_GetDash=haru.HPDF_Page_GetDash HPDF_Page_GetDash.restype=HPDF_DashMode HPDF_Page_GetFlat=haru.HPDF_Page_GetFlat HPDF_Page_GetFlat.restype=HPDF_REAL HPDF_Page_GetCharSpace=haru.HPDF_Page_GetCharSpace HPDF_Page_GetCharSpace.restype=HPDF_REAL HPDF_Page_GetWordSpace=haru.HPDF_Page_GetWordSpace HPDF_Page_GetWordSpace.restype=HPDF_REAL HPDF_Page_GetHorizontalScalling=haru.HPDF_Page_GetHorizontalScalling HPDF_Page_GetHorizontalScalling.restype=HPDF_REAL HPDF_Page_GetTextLeading=haru.HPDF_Page_GetTextLeading HPDF_Page_GetTextLeading.restype=HPDF_REAL HPDF_Page_GetTextRenderingMode=haru.HPDF_Page_GetTextRenderingMode HPDF_Page_GetTextRenderingMode.restype=HPDF_TextRenderingMode HPDF_Page_GetTextRaise=haru.HPDF_Page_GetTextRaise HPDF_Page_GetTextRaise.restype=HPDF_REAL HPDF_Page_GetTextRise=haru.HPDF_Page_GetTextRise HPDF_Page_GetTextRise.restype=HPDF_REAL HPDF_Page_GetRGBFill=haru.HPDF_Page_GetRGBFill HPDF_Page_GetRGBFill.restype=HPDF_RGBColor HPDF_Page_GetRGBStroke=haru.HPDF_Page_GetRGBStroke HPDF_Page_GetRGBStroke.restype=HPDF_RGBColor HPDF_Page_GetCMYKFill=haru.HPDF_Page_GetCMYKFill HPDF_Page_GetCMYKFill.restype=HPDF_CMYKColor HPDF_Page_GetCMYKStroke=haru.HPDF_Page_GetCMYKStroke HPDF_Page_GetCMYKStroke.restype=HPDF_CMYKColor HPDF_Page_GetGrayFill=haru.HPDF_Page_GetGrayFill HPDF_Page_GetGrayFill.restype=HPDF_REAL HPDF_Page_GetGrayStroke=haru.HPDF_Page_GetGrayStroke HPDF_Page_GetGrayStroke.restype=HPDF_REAL HPDF_Page_GetStrokingColorSpace=haru.HPDF_Page_GetStrokingColorSpace HPDF_Page_GetStrokingColorSpace.restype=HPDF_ColorSpace HPDF_Page_GetFillingColorSpace=haru.HPDF_Page_GetFillingColorSpace HPDF_Page_GetFillingColorSpace.restype=HPDF_ColorSpace HPDF_Page_GetTextMatrix=haru.HPDF_Page_GetTextMatrix HPDF_Page_GetTextMatrix.restype=HPDF_TransMatrix HPDF_Page_GetGStateDepth=haru.HPDF_Page_GetGStateDepth HPDF_Page_GetGStateDepth.restype=HPDF_UINT _HPDF_Page_SetLineWidth=haru.HPDF_Page_SetLineWidth _HPDF_Page_SetLineWidth.restype=HPDF_STATUS def HPDF_Page_SetLineWidth( page, line_width, ): line_width=HPDF_REAL(line_width) return _HPDF_Page_SetLineWidth( page, line_width, ) HPDF_Page_SetLineCap=haru.HPDF_Page_SetLineCap HPDF_Page_SetLineCap.restype=HPDF_STATUS HPDF_Page_SetLineJoin=haru.HPDF_Page_SetLineJoin HPDF_Page_SetLineJoin.restype=HPDF_STATUS _HPDF_Page_SetMiterLimit=haru.HPDF_Page_SetMiterLimit _HPDF_Page_SetMiterLimit.restype=HPDF_STATUS def HPDF_Page_SetMiterLimit( page, miter_limit, ): miter_limit=HPDF_REAL(miter_limit) return _HPDF_Page_SetMiterLimit( page, miter_limit, ) _HPDF_Page_SetDash=haru.HPDF_Page_SetDash _HPDF_Page_SetDash.restype=HPDF_STATUS def HPDF_Page_SetDash( page, dash_ptn, num_param, phase, ): if type(dash_ptn) in (types.ListType, types.TupleType): num_param=len(dash_ptn) dash_ptn=pointer((HPDF_UINT16*num_param)(*dash_ptn)) return _HPDF_Page_SetDash( page, dash_ptn, num_param, phase, ) _HPDF_Page_SetFlat=haru.HPDF_Page_SetFlat _HPDF_Page_SetFlat.restype=HPDF_STATUS def HPDF_Page_SetFlat( page, flatness, ): flatness=HPDF_REAL(flatness) return _HPDF_Page_SetFlat( page, flatness, ) HPDF_Page_SetExtGState=haru.HPDF_Page_SetExtGState HPDF_Page_SetExtGState.restype=HPDF_STATUS HPDF_Page_GSave=haru.HPDF_Page_GSave HPDF_Page_GSave.restype=HPDF_STATUS HPDF_Page_GRestore=haru.HPDF_Page_GRestore HPDF_Page_GRestore.restype=HPDF_STATUS _HPDF_Page_Concat=haru.HPDF_Page_Concat _HPDF_Page_Concat.restype=HPDF_STATUS def HPDF_Page_Concat( page, a, b, c, d, x, y, ): a=HPDF_REAL(a) b=HPDF_REAL(b) c=HPDF_REAL(c) d=HPDF_REAL(d) x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_Concat( page, a, b, c, d, x, y, ) _HPDF_Page_MoveTo=haru.HPDF_Page_MoveTo _HPDF_Page_MoveTo.restype=HPDF_STATUS def HPDF_Page_MoveTo( page, x, y, ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_MoveTo( page, x, y, ) _HPDF_Page_LineTo=haru.HPDF_Page_LineTo _HPDF_Page_LineTo.restype=HPDF_STATUS def HPDF_Page_LineTo( page, x, y, ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_LineTo( page, x, y, ) _HPDF_Page_CurveTo=haru.HPDF_Page_CurveTo _HPDF_Page_CurveTo.restype=HPDF_STATUS def HPDF_Page_CurveTo( page, x1, y1, x2, y2, x3, y3, ): x1=HPDF_REAL(x1) y1=HPDF_REAL(y1) x2=HPDF_REAL(x2) y2=HPDF_REAL(y2) x3=HPDF_REAL(x3) y3=HPDF_REAL(y3) return _HPDF_Page_CurveTo( page, x1, y1, x2, y2, x3, y3, ) _HPDF_Page_CurveTo2=haru.HPDF_Page_CurveTo2 _HPDF_Page_CurveTo2.restype=HPDF_STATUS def HPDF_Page_CurveTo2( page, x2, y2, x3, y3, ): x2=HPDF_REAL(x2) y2=HPDF_REAL(y2) x3=HPDF_REAL(x3) y3=HPDF_REAL(y3) return _HPDF_Page_CurveTo2( page, x2, y2, x3, y3, ) _HPDF_Page_CurveTo3=haru.HPDF_Page_CurveTo3 _HPDF_Page_CurveTo3.restype=HPDF_STATUS def HPDF_Page_CurveTo3( page, x1, y1, x3, y3, ): x1=HPDF_REAL(x1) y1=HPDF_REAL(y1) x3=HPDF_REAL(x3) y3=HPDF_REAL(y3) return _HPDF_Page_CurveTo3( page, x1, y1, x3, y3, ) HPDF_Page_ClosePath=haru.HPDF_Page_ClosePath HPDF_Page_ClosePath.restype=HPDF_STATUS _HPDF_Page_Rectangle=haru.HPDF_Page_Rectangle _HPDF_Page_Rectangle.restype=HPDF_STATUS def HPDF_Page_Rectangle( page, x, y, width, height, ): x=HPDF_REAL(x) y=HPDF_REAL(y) width=HPDF_REAL(width) height=HPDF_REAL(height) return _HPDF_Page_Rectangle( page, x, y, width, height, ) _HPDF_Page_Stroke=haru.HPDF_Page_Stroke _HPDF_Page_Stroke.restype=HPDF_STATUS def HPDF_Page_Stroke( page, ): return _HPDF_Page_Stroke( page, ) HPDF_Page_ClosePathStroke=haru.HPDF_Page_ClosePathStroke HPDF_Page_ClosePathStroke.restype=HPDF_STATUS HPDF_Page_Fill=haru.HPDF_Page_Fill HPDF_Page_Fill.restype=HPDF_STATUS HPDF_Page_Eofill=haru.HPDF_Page_Eofill HPDF_Page_Eofill.restype=HPDF_STATUS HPDF_Page_FillStroke=haru.HPDF_Page_FillStroke HPDF_Page_FillStroke.restype=HPDF_STATUS HPDF_Page_EofillStroke=haru.HPDF_Page_EofillStroke HPDF_Page_EofillStroke.restype=HPDF_STATUS HPDF_Page_ClosePathFillStroke=haru.HPDF_Page_ClosePathFillStroke HPDF_Page_ClosePathFillStroke.restype=HPDF_STATUS HPDF_Page_ClosePathEofillStroke=haru.HPDF_Page_ClosePathEofillStroke HPDF_Page_ClosePathEofillStroke.restype=HPDF_STATUS HPDF_Page_EndPath=haru.HPDF_Page_EndPath HPDF_Page_EndPath.restype=HPDF_STATUS HPDF_Page_Clip=haru.HPDF_Page_Clip HPDF_Page_Clip.restype=HPDF_STATUS HPDF_Page_Eoclip=haru.HPDF_Page_Eoclip HPDF_Page_Eoclip.restype=HPDF_STATUS HPDF_Page_BeginText=haru.HPDF_Page_BeginText HPDF_Page_BeginText.restype=HPDF_STATUS HPDF_Page_EndText=haru.HPDF_Page_EndText HPDF_Page_EndText.restype=HPDF_STATUS _HPDF_Page_SetCharSpace=haru.HPDF_Page_SetCharSpace _HPDF_Page_SetCharSpace.restype=HPDF_STATUS def HPDF_Page_SetCharSpace( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetCharSpace( page, value, ) _HPDF_Page_SetWordSpace=haru.HPDF_Page_SetWordSpace _HPDF_Page_SetWordSpace.restype=HPDF_STATUS def HPDF_Page_SetWordSpace( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetWordSpace( page, value, ) _HPDF_Page_SetHorizontalScalling=haru.HPDF_Page_SetHorizontalScalling _HPDF_Page_SetHorizontalScalling.restype=HPDF_STATUS def HPDF_Page_SetHorizontalScalling( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetHorizontalScalling( page, value, ) _HPDF_Page_SetTextLeading=haru.HPDF_Page_SetTextLeading _HPDF_Page_SetTextLeading.restype=HPDF_STATUS def HPDF_Page_SetTextLeading( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetTextLeading( page, value, ) _HPDF_Page_SetFontAndSize=haru.HPDF_Page_SetFontAndSize _HPDF_Page_SetFontAndSize.restype=HPDF_STATUS def HPDF_Page_SetFontAndSize( page, font, size, ): size=HPDF_REAL(size) return _HPDF_Page_SetFontAndSize( page, font, size, ) HPDF_Page_SetTextRenderingMode=haru.HPDF_Page_SetTextRenderingMode HPDF_Page_SetTextRenderingMode.restype=HPDF_STATUS _HPDF_Page_SetTextRise=haru.HPDF_Page_SetTextRise _HPDF_Page_SetTextRise.restype=HPDF_STATUS def HPDF_Page_SetTextRise( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetTextRise( page, value, ) _HPDF_Page_SetTextRaise=haru.HPDF_Page_SetTextRaise _HPDF_Page_SetTextRaise.restype=HPDF_STATUS def HPDF_Page_SetTextRaise( page, value, ): value=HPDF_REAL(value) return _HPDF_Page_SetTextRaise( page, value, ) _HPDF_Page_MoveTextPos=haru.HPDF_Page_MoveTextPos _HPDF_Page_MoveTextPos.restype=HPDF_STATUS def HPDF_Page_MoveTextPos( page, x, y, ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_MoveTextPos( page, x, y, ) _HPDF_Page_MoveTextPos2=haru.HPDF_Page_MoveTextPos2 _HPDF_Page_MoveTextPos2.restype=HPDF_STATUS def HPDF_Page_MoveTextPos2( page, x, y, ): x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_MoveTextPos2( page, x, y, ) _HPDF_Page_SetTextMatrix=haru.HPDF_Page_SetTextMatrix _HPDF_Page_SetTextMatrix.restype=HPDF_STATUS def HPDF_Page_SetTextMatrix( page, a, b, c, d, x, y, ): a=HPDF_REAL(a) b=HPDF_REAL(b) c=HPDF_REAL(c) d=HPDF_REAL(d) x=HPDF_REAL(x) y=HPDF_REAL(y) return _HPDF_Page_SetTextMatrix( page, a, b, c, d, x, y, ) HPDF_Page_MoveToNextLine=haru.HPDF_Page_MoveToNextLine HPDF_Page_MoveToNextLine.restype=HPDF_STATUS _HPDF_Page_ShowText=haru.HPDF_Page_ShowText _HPDF_Page_ShowText.restype=HPDF_STATUS def HPDF_Page_ShowText(page, text ): if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Page_ShowText(page, text ) #HPDF_STATUS HPDF_Page_ShowTextNextLine (HPDF_Page page, const char *text) HPDF_Page_ShowTextNextLine=haru.HPDF_Page_ShowTextNextLine HPDF_Page_ShowTextNextLine.restype=HPDF_STATUS # " #HPDF_STATUS HPDF_Page_ShowTextNextLineEx (HPDF_Page page, HPDF_REAL word_space, HPDF_REAL char_space, const char *text) _HPDF_Page_ShowTextNextLineEx=haru.HPDF_Page_ShowTextNextLineEx _HPDF_Page_ShowTextNextLineEx.restype=HPDF_STATUS def HPDF_Page_ShowTextNextLineEx( page, #HPDF_Page word_space, #HPDF_REAL char_space, #HPDF_REAL text, #c_char_p ): word_space=HPDF_REAL(word_space) char_space=HPDF_REAL(char_space) return _HPDF_Page_ShowTextNextLineEx( page, #HPDF_Page word_space, #HPDF_REAL char_space, #HPDF_REAL text, #c_char_p ) #--- Color showing ------------------------------------------------------ # cs --not implemented yet # CS --not implemented yet # sc --not implemented yet # scn --not implemented yet # SC --not implemented yet # SCN --not implemented yet # g #HPDF_STATUS HPDF_Page_SetGrayFill (HPDF_Page page, HPDF_REAL gray) _HPDF_Page_SetGrayFill=haru.HPDF_Page_SetGrayFill _HPDF_Page_SetGrayFill.restype=HPDF_STATUS def HPDF_Page_SetGrayFill( page, #HPDF_Page gray, #HPDF_REAL ): gray=HPDF_REAL(gray) return _HPDF_Page_SetGrayFill( page, #HPDF_Page gray, #HPDF_REAL ) # G #HPDF_STATUS HPDF_Page_SetGrayStroke (HPDF_Page page, HPDF_REAL gray) _HPDF_Page_SetGrayStroke=haru.HPDF_Page_SetGrayStroke _HPDF_Page_SetGrayStroke.restype=HPDF_STATUS def HPDF_Page_SetGrayStroke( page, #HPDF_Page gray, #HPDF_REAL ): gray=HPDF_REAL(gray) return _HPDF_Page_SetGrayStroke( page, #HPDF_Page gray, #HPDF_REAL ) # rg #HPDF_STATUS HPDF_Page_SetRGBFill (HPDF_Page page, HPDF_REAL r, HPDF_REAL g, HPDF_REAL b) _HPDF_Page_SetRGBFill=haru.HPDF_Page_SetRGBFill _HPDF_Page_SetRGBFill.restype=HPDF_STATUS def HPDF_Page_SetRGBFill( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ): r=HPDF_REAL(r) g=HPDF_REAL(g) b=HPDF_REAL(b) return _HPDF_Page_SetRGBFill( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ) # RG #HPDF_STATUS HPDF_Page_SetRGBStroke (HPDF_Page page, HPDF_REAL r, HPDF_REAL g, HPDF_REAL b) _HPDF_Page_SetRGBStroke=haru.HPDF_Page_SetRGBStroke _HPDF_Page_SetRGBStroke.restype=HPDF_STATUS def HPDF_Page_SetRGBStroke( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ): r=HPDF_REAL(r) g=HPDF_REAL(g) b=HPDF_REAL(b) return _HPDF_Page_SetRGBStroke( page, #HPDF_Page r, #HPDF_REAL g, #HPDF_REAL b, #HPDF_REAL ) # k #HPDF_STATUS HPDF_Page_SetCMYKFill (HPDF_Page page, HPDF_REAL c, HPDF_REAL m, HPDF_REAL y, HPDF_REAL k) _HPDF_Page_SetCMYKFill=haru.HPDF_Page_SetCMYKFill _HPDF_Page_SetCMYKFill.restype=HPDF_STATUS def HPDF_Page_SetCMYKFill( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ): c=HPDF_REAL(c) m=HPDF_REAL(m) y=HPDF_REAL(y) k=HPDF_REAL(k) return _HPDF_Page_SetCMYKFill( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ) # K #HPDF_STATUS HPDF_Page_SetCMYKStroke (HPDF_Page page, HPDF_REAL c, HPDF_REAL m, HPDF_REAL y, HPDF_REAL k) _HPDF_Page_SetCMYKStroke=haru.HPDF_Page_SetCMYKStroke _HPDF_Page_SetCMYKStroke.restype=HPDF_STATUS def HPDF_Page_SetCMYKStroke( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ): c=HPDF_REAL(c) m=HPDF_REAL(m) y=HPDF_REAL(y) k=HPDF_REAL(k) return _HPDF_Page_SetCMYKStroke( page, #HPDF_Page c, #HPDF_REAL m, #HPDF_REAL y, #HPDF_REAL k, #HPDF_REAL ) #--- Shading patterns --------------------------------------------------- # sh --not implemented yet #--- In-line images ----------------------------------------------------- # BI --not implemented yet # ID --not implemented yet # EI --not implemented yet #--- XObjects ----------------------------------------------------------- # Do #HPDF_STATUS HPDF_Page_ExecuteXObject (HPDF_Page page, HPDF_XObject obj) HPDF_Page_ExecuteXObject=haru.HPDF_Page_ExecuteXObject HPDF_Page_ExecuteXObject.restype=HPDF_STATUS #--- Marked content ----------------------------------------------------- # BMC --not implemented yet # BDC --not implemented yet # EMC --not implemented yet # MP --not implemented yet # DP --not implemented yet #--- Compatibility ------------------------------------------------------ # BX --not implemented yet # EX --not implemented yet #HPDF_STATUS HPDF_Page_DrawImage (HPDF_Page page, HPDF_Image image, HPDF_REAL x, HPDF_REAL y, HPDF_REAL width, HPDF_REAL height) _HPDF_Page_DrawImage=haru.HPDF_Page_DrawImage _HPDF_Page_DrawImage.restype=HPDF_STATUS def HPDF_Page_DrawImage( page, #HPDF_Page image, #HPDF_Image x, #HPDF_REAL y, #HPDF_REAL width, #HPDF_REAL height, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) width=HPDF_REAL(width) height=HPDF_REAL(height) return _HPDF_Page_DrawImage( page, #HPDF_Page image, #HPDF_Image x, #HPDF_REAL y, #HPDF_REAL width, #HPDF_REAL height, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_Circle (HPDF_Page page, HPDF_REAL x, HPDF_REAL y, HPDF_REAL ray) _HPDF_Page_Circle=haru.HPDF_Page_Circle _HPDF_Page_Circle.restype=HPDF_STATUS def HPDF_Page_Circle( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) ray=HPDF_REAL(ray) return _HPDF_Page_Circle( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_Ellipse (HPDF_Page page, HPDF_REAL x, HPDF_REAL y, HPDF_REAL xray, HPDF_REAL yray) _HPDF_Page_Ellipse=haru.HPDF_Page_Ellipse _HPDF_Page_Ellipse.restype=HPDF_STATUS def HPDF_Page_Ellipse( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL xray, #HPDF_REAL yray, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) xray=HPDF_REAL(xray) yray=HPDF_REAL(yray) return _HPDF_Page_Ellipse( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL xray, #HPDF_REAL yray, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_Arc (HPDF_Page page, HPDF_REAL x, HPDF_REAL y, HPDF_REAL ray, HPDF_REAL ang1, HPDF_REAL ang2) _HPDF_Page_Arc=haru.HPDF_Page_Arc _HPDF_Page_Arc.restype=HPDF_STATUS def HPDF_Page_Arc( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ang1, #HPDF_REAL ang2, #HPDF_REAL ): x=HPDF_REAL(x) y=HPDF_REAL(y) ray=HPDF_REAL(ray) ang1=HPDF_REAL(ang1) ang2=HPDF_REAL(ang2) return _HPDF_Page_Arc( page, #HPDF_Page x, #HPDF_REAL y, #HPDF_REAL ray, #HPDF_REAL ang1, #HPDF_REAL ang2, #HPDF_REAL ) #HPDF_STATUS HPDF_Page_TextOut (HPDF_Page page, HPDF_REAL xpos, HPDF_REAL ypos, const char *text) _HPDF_Page_TextOut=haru.HPDF_Page_TextOut _HPDF_Page_TextOut.restype=HPDF_STATUS def HPDF_Page_TextOut( page, #HPDF_Page xpos, #HPDF_REAL ypos, #HPDF_REAL text, #c_char_p ): xpos=HPDF_REAL(xpos) ypos=HPDF_REAL(ypos) if type(text) in (types.ListType, types.TupleType): if type(text[-1]) != types.StringType: text=[chr(i) for i in text] text=''.join(text) return _HPDF_Page_TextOut( page, #HPDF_Page xpos, #HPDF_REAL ypos, #HPDF_REAL text, #c_char_p ) #HPDF_STATUS HPDF_Page_TextRect (HPDF_Page page, HPDF_REAL left, HPDF_REAL top, HPDF_REAL right, HPDF_REAL bottom, const char *text, HPDF_TextAlignment align, HPDF_UINT *len) #??? _HPDF_Page_TextRect=haru.HPDF_Page_TextRect _HPDF_Page_TextRect.restype=HPDF_STATUS def HPDF_Page_TextRect( page, #HPDF_Page left, #HPDF_REAL top, #HPDF_REAL right, #HPDF_REAL bottom, #HPDF_REAL text, #c_char_p align, #HPDF_TextAlignment length, #POINTER(HPDF_UINT) ): left=HPDF_REAL(left) top=HPDF_REAL(top) right=HPDF_REAL(right) bottom=HPDF_REAL(bottom) if type(length) in (types.ListType, types.TupleType): size=len(length) length=pointer((HPDF_UINT*size)(*length)) return _HPDF_Page_TextRect( page, #HPDF_Page left, #HPDF_REAL top, #HPDF_REAL right, #HPDF_REAL bottom, #HPDF_REAL text, #c_char_p align, #HPDF_TextAlignment length, #POINTER(HPDF_UINT) ) #HPDF_STATUS HPDF_Page_SetSlideShow (HPDF_Page page, HPDF_TransitionStyle type, HPDF_REAL disp_time, HPDF_REAL trans_time) _HPDF_Page_SetSlideShow=haru.HPDF_Page_SetSlideShow _HPDF_Page_SetSlideShow.restype=HPDF_STATUS def HPDF_Page_SetSlideShow( page, #HPDF_Page tType, #HPDF_TransitionStyle disp_time, #HPDF_REAL trans_time, #HPDF_REAL ): disp_time=HPDF_REAL(disp_time) trans_time=HPDF_REAL(trans_time) return _HPDF_Page_SetSlideShow( page, #HPDF_Page tType, #HPDF_TransitionStyle disp_time, #HPDF_REAL trans_time, #HPDF_REAL ) NULL=0 HPDF_NOPNGLIB=False
true
true
1c45468befaec83596d4e2e0316330f6b9f1a238
1,638
py
Python
generator/generator_test.py
kwyckmans/nonogram
f4a28027a269a37c9f266a2f0f6db9920b549c05
[ "Unlicense" ]
null
null
null
generator/generator_test.py
kwyckmans/nonogram
f4a28027a269a37c9f266a2f0f6db9920b549c05
[ "Unlicense" ]
2
2022-01-13T03:53:51.000Z
2022-03-12T00:59:47.000Z
generator/generator_test.py
kwyckmans/nonogram
f4a28027a269a37c9f266a2f0f6db9920b549c05
[ "Unlicense" ]
null
null
null
import unittest from generator.generator import CellValue, generate_nonogram class GeneratorTest(unittest.TestCase): """Tests generation of nonograms by providing the generator with various pixel configurations. TODO: add a single end-to-end test with a very simple image. """ def test_generator_for_full_black_row(self): pixel_data = {0: [CellValue.BLACK, CellValue.BLACK]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [(2,)]) self.assertEqual(nonogram.col_clues, [(1,), (1,)]) def test_generator_for_full_white_row(self): pixel_data = {0: [CellValue.WHITE, CellValue.WHITE]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [()]) self.assertEqual(nonogram.col_clues, [(), ()]) def test_generator_for_black_in_back_sequence(self): pixel_data = {0: [CellValue.WHITE, CellValue.BLACK]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [(1,)]) self.assertEqual(nonogram.col_clues, [(), (1,)]) def test_generator_for_black_in_front_sequence(self): pixel_data = {0: [CellValue.BLACK, CellValue.WHITE]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [(1,)]) self.assertEqual(nonogram.col_clues, [(1,), ()]) if __name__ == "__main__": unittest.main()
37.227273
98
0.696581
import unittest from generator.generator import CellValue, generate_nonogram class GeneratorTest(unittest.TestCase): def test_generator_for_full_black_row(self): pixel_data = {0: [CellValue.BLACK, CellValue.BLACK]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [(2,)]) self.assertEqual(nonogram.col_clues, [(1,), (1,)]) def test_generator_for_full_white_row(self): pixel_data = {0: [CellValue.WHITE, CellValue.WHITE]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [()]) self.assertEqual(nonogram.col_clues, [(), ()]) def test_generator_for_black_in_back_sequence(self): pixel_data = {0: [CellValue.WHITE, CellValue.BLACK]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [(1,)]) self.assertEqual(nonogram.col_clues, [(), (1,)]) def test_generator_for_black_in_front_sequence(self): pixel_data = {0: [CellValue.BLACK, CellValue.WHITE]} nonogram = generate_nonogram(pixel_data=pixel_data) self.assertIsNotNone(nonogram) self.assertEqual(nonogram.row_clues, [(1,)]) self.assertEqual(nonogram.col_clues, [(1,), ()]) if __name__ == "__main__": unittest.main()
true
true
1c45472ed521b60ea9b1462d18e54e9cdaece161
96,554
py
Python
python/ccxt/async_support/bybit.py
dougvanzee/ccxt
ed06a2d180e02d1006f33be6ba65407ecb0a831b
[ "MIT" ]
3
2021-06-29T16:27:19.000Z
2021-07-18T08:36:07.000Z
python/ccxt/async_support/bybit.py
Bytedex/ccxt
3863b5e1d6c77d719ac102b0243964c4946e7abb
[ "MIT" ]
null
null
null
python/ccxt/async_support/bybit.py
Bytedex/ccxt
3863b5e1d6c77d719ac102b0243964c4946e7abb
[ "MIT" ]
null
null
null
# -*- coding: utf-8 -*- # PLEASE DO NOT EDIT THIS FILE, IT IS GENERATED AND WILL BE OVERWRITTEN: # https://github.com/ccxt/ccxt/blob/master/CONTRIBUTING.md#how-to-contribute-code from ccxt.async_support.base.exchange import Exchange from ccxt.base.errors import ExchangeError from ccxt.base.errors import AuthenticationError from ccxt.base.errors import PermissionDenied from ccxt.base.errors import ArgumentsRequired from ccxt.base.errors import BadRequest from ccxt.base.errors import InsufficientFunds from ccxt.base.errors import InvalidOrder from ccxt.base.errors import OrderNotFound from ccxt.base.errors import RateLimitExceeded from ccxt.base.errors import InvalidNonce from ccxt.base.decimal_to_precision import TICK_SIZE from ccxt.base.precise import Precise class bybit(Exchange): def describe(self): return self.deep_extend(super(bybit, self).describe(), { 'id': 'bybit', 'name': 'Bybit', 'countries': ['VG'], # British Virgin Islands 'version': 'v2', 'userAgent': None, 'rateLimit': 100, 'hostname': 'bybit.com', # bybit.com, bytick.com 'has': { 'cancelOrder': True, 'CORS': True, 'cancelAllOrders': True, 'createOrder': True, 'editOrder': True, 'fetchBalance': True, 'fetchClosedOrders': True, 'fetchDeposits': True, 'fetchLedger': True, 'fetchMarkets': True, 'fetchMyTrades': True, 'fetchOHLCV': True, 'fetchOpenOrders': True, 'fetchOrder': True, 'fetchOrderBook': True, 'fetchOrders': True, 'fetchOrderTrades': True, 'fetchTicker': True, 'fetchTickers': True, 'fetchTime': True, 'fetchTrades': True, 'fetchTransactions': False, 'fetchWithdrawals': True, 'fetchPositions': True, }, 'timeframes': { '1m': '1', '3m': '3', '5m': '5', '15m': '15', '30m': '30', '1h': '60', '2h': '120', '4h': '240', '6h': '360', '12h': '720', '1d': 'D', '1w': 'W', '1M': 'M', '1y': 'Y', }, 'urls': { 'test': 'https://api-testnet.{hostname}', 'logo': 'https://user-images.githubusercontent.com/51840849/76547799-daff5b80-649e-11ea-87fb-3be9bac08954.jpg', 'api': 'https://api.{hostname}', 'www': 'https://www.bybit.com', 'doc': [ 'https://bybit-exchange.github.io/docs/inverse/', 'https://bybit-exchange.github.io/docs/linear/', 'https://github.com/bybit-exchange', ], 'fees': 'https://help.bybit.com/hc/en-us/articles/360039261154', 'referral': 'https://www.bybit.com/app/register?ref=X7Prm', }, 'api': { 'futures': { 'private': { 'get': [ 'position/list', 'order/list', 'order', 'stop-order/list', 'stop-order', 'execution/list', 'trade/closed-pnl/list', ], 'post': [ 'order/create', 'order/cancel', 'order/cancelAll', 'order/replace', 'stop-order/create', 'stop-order/cancel', 'stop-order/cancelAll', 'stop-order/replace', 'position/change-position-margin', 'position/trading-stop', 'position/leverage/save', 'position/switch-mode', 'position/switch-isolated', ], }, }, 'v2': { 'public': { 'get': [ 'orderBook/L2', 'kline/list', 'tickers', 'trading-records', 'symbols', 'liq-records', 'mark-price-kline', 'index-price-kline', 'premium-index-kline', 'open-interest', 'big-deal', 'account-ratio', 'time', 'announcement', ], }, 'private': { 'get': [ 'order/list', 'order', 'stop-order/list', 'stop-order', 'position/list', 'execution/list', 'trade/closed-pnl/list', 'funding/prev-funding-rate', 'funding/prev-funding', 'funding/predicted-funding', 'account/api-key', 'account/lcp', 'wallet/balance', 'wallet/fund/records', 'wallet/withdraw/list', 'exchange-order/list', ], 'post': [ 'order/create', 'order/cancel', 'order/cancelAll', 'order/replace', 'stop-order/create', 'stop-order/cancel', 'stop-order/cancelAll', 'stop-order/replace', 'position/change-position-margin', 'position/trading-stop', 'position/leverage/save', ], }, }, 'public': { 'linear': { 'get': [ 'kline', 'recent-trading-records', 'funding/prev-funding-rate', 'mark-price-kline', 'index-price-kline', 'premium-index-kline', 'risk-limit', ], }, }, 'private': { 'linear': { 'get': [ 'order/list', 'order/search', 'stop-order/list', 'stop-order/search', 'position/list', 'trade/execution/list', 'trade/closed-pnl/list', 'funding/predicted-funding', 'funding/prev-funding', ], 'post': [ 'order/create', 'order/cancel', 'order/cancel-all', 'order/replace', 'stop-order/create', 'stop-order/cancel', 'stop-order/cancel-all', 'stop-order/replace', 'position/set-auto-add-margin', 'position/switch-isolated', 'tpsl/switch-mode', 'position/add-margin', 'position/set-leverage', 'position/trading-stop', ], }, }, 'openapi': { 'wallet': { 'get': [ 'risk-limit/list', ], 'post': [ 'risk-limit', ], }, }, }, 'httpExceptions': { '403': RateLimitExceeded, # Forbidden -- You request too many times }, 'exceptions': { 'exact': { '10001': BadRequest, # parameter error '10002': InvalidNonce, # request expired, check your timestamp and recv_window '10003': AuthenticationError, # Invalid apikey '10004': AuthenticationError, # invalid sign '10005': PermissionDenied, # permission denied for current apikey '10006': RateLimitExceeded, # too many requests '10007': AuthenticationError, # api_key not found in your request parameters '10010': PermissionDenied, # request ip mismatch '10017': BadRequest, # request path not found or request method is invalid '20001': OrderNotFound, # Order not exists '20003': InvalidOrder, # missing parameter side '20004': InvalidOrder, # invalid parameter side '20005': InvalidOrder, # missing parameter symbol '20006': InvalidOrder, # invalid parameter symbol '20007': InvalidOrder, # missing parameter order_type '20008': InvalidOrder, # invalid parameter order_type '20009': InvalidOrder, # missing parameter qty '20010': InvalidOrder, # qty must be greater than 0 '20011': InvalidOrder, # qty must be an integer '20012': InvalidOrder, # qty must be greater than zero and less than 1 million '20013': InvalidOrder, # missing parameter price '20014': InvalidOrder, # price must be greater than 0 '20015': InvalidOrder, # missing parameter time_in_force '20016': InvalidOrder, # invalid value for parameter time_in_force '20017': InvalidOrder, # missing parameter order_id '20018': InvalidOrder, # invalid date format '20019': InvalidOrder, # missing parameter stop_px '20020': InvalidOrder, # missing parameter base_price '20021': InvalidOrder, # missing parameter stop_order_id '20022': BadRequest, # missing parameter leverage '20023': BadRequest, # leverage must be a number '20031': BadRequest, # leverage must be greater than zero '20070': BadRequest, # missing parameter margin '20071': BadRequest, # margin must be greater than zero '20084': BadRequest, # order_id or order_link_id is required '30001': BadRequest, # order_link_id is repeated '30003': InvalidOrder, # qty must be more than the minimum allowed '30004': InvalidOrder, # qty must be less than the maximum allowed '30005': InvalidOrder, # price exceeds maximum allowed '30007': InvalidOrder, # price exceeds minimum allowed '30008': InvalidOrder, # invalid order_type '30009': ExchangeError, # no position found '30010': InsufficientFunds, # insufficient wallet balance '30011': PermissionDenied, # operation not allowed as position is undergoing liquidation '30012': PermissionDenied, # operation not allowed as position is undergoing ADL '30013': PermissionDenied, # position is in liq or adl status '30014': InvalidOrder, # invalid closing order, qty should not greater than size '30015': InvalidOrder, # invalid closing order, side should be opposite '30016': ExchangeError, # TS and SL must be cancelled first while closing position '30017': InvalidOrder, # estimated fill price cannot be lower than current Buy liq_price '30018': InvalidOrder, # estimated fill price cannot be higher than current Sell liq_price '30019': InvalidOrder, # cannot attach TP/SL params for non-zero position when placing non-opening position order '30020': InvalidOrder, # position already has TP/SL params '30021': InvalidOrder, # cannot afford estimated position_margin '30022': InvalidOrder, # estimated buy liq_price cannot be higher than current mark_price '30023': InvalidOrder, # estimated sell liq_price cannot be lower than current mark_price '30024': InvalidOrder, # cannot set TP/SL/TS for zero-position '30025': InvalidOrder, # trigger price should bigger than 10% of last price '30026': InvalidOrder, # price too high '30027': InvalidOrder, # price set for Take profit should be higher than Last Traded Price '30028': InvalidOrder, # price set for Stop loss should be between Liquidation price and Last Traded Price '30029': InvalidOrder, # price set for Stop loss should be between Last Traded Price and Liquidation price '30030': InvalidOrder, # price set for Take profit should be lower than Last Traded Price '30031': InsufficientFunds, # insufficient available balance for order cost '30032': InvalidOrder, # order has been filled or cancelled '30033': RateLimitExceeded, # The number of stop orders exceeds maximum limit allowed '30034': OrderNotFound, # no order found '30035': RateLimitExceeded, # too fast to cancel '30036': ExchangeError, # the expected position value after order execution exceeds the current risk limit '30037': InvalidOrder, # order already cancelled '30041': ExchangeError, # no position found '30042': InsufficientFunds, # insufficient wallet balance '30043': PermissionDenied, # operation not allowed as position is undergoing liquidation '30044': PermissionDenied, # operation not allowed as position is undergoing AD '30045': PermissionDenied, # operation not allowed as position is not normal status '30049': InsufficientFunds, # insufficient available balance '30050': ExchangeError, # any adjustments made will trigger immediate liquidation '30051': ExchangeError, # due to risk limit, cannot adjust leverage '30052': ExchangeError, # leverage can not less than 1 '30054': ExchangeError, # position margin is invalid '30057': ExchangeError, # requested quantity of contracts exceeds risk limit '30063': ExchangeError, # reduce-only rule not satisfied '30067': InsufficientFunds, # insufficient available balance '30068': ExchangeError, # exit value must be positive '34026': ExchangeError, # the limit is no change }, 'broad': { 'unknown orderInfo': OrderNotFound, # {"ret_code":-1,"ret_msg":"unknown orderInfo","ext_code":"","ext_info":"","result":null,"time_now":"1584030414.005545","rate_limit_status":99,"rate_limit_reset_ms":1584030414003,"rate_limit":100} 'invalid api_key': AuthenticationError, # {"ret_code":10003,"ret_msg":"invalid api_key","ext_code":"","ext_info":"","result":null,"time_now":"1599547085.415797"} }, }, 'precisionMode': TICK_SIZE, 'options': { 'marketTypes': { 'BTC/USDT': 'linear', 'BCH/USDT': 'linear', 'ETH/USDT': 'linear', 'LTC/USDT': 'linear', 'XTZ/USDT': 'linear', 'LINK/USDT': 'linear', 'ADA/USDT': 'linear', 'DOT/USDT': 'linear', 'UNI/USDT': 'linear', }, 'defaultType': 'linear', # may also be inverse or inverseFuture 'code': 'BTC', 'cancelAllOrders': { # 'method': 'v2PrivatePostOrderCancelAll', # v2PrivatePostStopOrderCancelAll }, 'recvWindow': 5 * 1000, # 5 sec default 'timeDifference': 0, # the difference between system clock and exchange server clock 'adjustForTimeDifference': False, # controls the adjustment logic upon instantiation }, 'fees': { 'trading': { 'tierBased': False, 'percentage': True, 'taker': 0.00075, 'maker': -0.00025, }, 'funding': { 'tierBased': False, 'percentage': False, 'withdraw': {}, 'deposit': {}, }, }, }) def nonce(self): return self.milliseconds() - self.options['timeDifference'] async def load_time_difference(self, params={}): serverTime = await self.fetch_time(params) after = self.milliseconds() self.options['timeDifference'] = after - serverTime return self.options['timeDifference'] async def fetch_time(self, params={}): response = await self.v2PublicGetTime(params) # # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: {}, # time_now: '1583933682.448826' # } # return self.safe_timestamp(response, 'time_now') async def fetch_markets(self, params={}): if self.options['adjustForTimeDifference']: await self.load_time_difference() response = await self.v2PublicGetSymbols(params) # # { # "ret_code":0, # "ret_msg":"OK", # "ext_code":"", # "ext_info":"", # "result":[ # { # "name":"BTCUSD", # "alias":"BTCUSD", # "status":"Trading", # "base_currency":"BTC", # "quote_currency":"USD", # "price_scale":2, # "taker_fee":"0.00075", # "maker_fee":"-0.00025", # "leverage_filter":{"min_leverage":1,"max_leverage":100,"leverage_step":"0.01"}, # "price_filter":{"min_price":"0.5","max_price":"999999.5","tick_size":"0.5"}, # "lot_size_filter":{"max_trading_qty":1000000,"min_trading_qty":1,"qty_step":1} # }, # { # "name":"BTCUSDT", # "alias":"BTCUSDT", # "status":"Trading", # "base_currency":"BTC", # "quote_currency":"USDT", # "price_scale":2, # "taker_fee":"0.00075", # "maker_fee":"-0.00025", # "leverage_filter":{"min_leverage":1,"max_leverage":100,"leverage_step":"0.01"}, # "price_filter":{"min_price":"0.5","max_price":"999999.5","tick_size":"0.5"}, # "lot_size_filter":{"max_trading_qty":100,"min_trading_qty":0.001,"qty_step":0.001} # }, # ], # "time_now":"1610539664.818033" # } # markets = self.safe_value(response, 'result', []) options = self.safe_value(self.options, 'fetchMarkets', {}) linearQuoteCurrencies = self.safe_value(options, 'linear', {'USDT': True}) result = [] for i in range(0, len(markets)): market = markets[i] id = self.safe_string_2(market, 'name', 'symbol') baseId = self.safe_string(market, 'base_currency') quoteId = self.safe_string(market, 'quote_currency') base = self.safe_currency_code(baseId) quote = self.safe_currency_code(quoteId) linear = (quote in linearQuoteCurrencies) inverse = not linear symbol = base + '/' + quote baseQuote = base + quote if baseQuote != id: symbol = id lotSizeFilter = self.safe_value(market, 'lot_size_filter', {}) priceFilter = self.safe_value(market, 'price_filter', {}) precision = { 'amount': self.safe_number(lotSizeFilter, 'qty_step'), 'price': self.safe_number(priceFilter, 'tick_size'), } status = self.safe_string(market, 'status') active = None if status is not None: active = (status == 'Trading') result.append({ 'id': id, 'symbol': symbol, 'base': base, 'quote': quote, 'active': active, 'precision': precision, 'taker': self.safe_number(market, 'taker_fee'), 'maker': self.safe_number(market, 'maker_fee'), 'type': 'future', 'spot': False, 'future': True, 'option': False, 'linear': linear, 'inverse': inverse, 'limits': { 'amount': { 'min': self.safe_number(lotSizeFilter, 'min_trading_qty'), 'max': self.safe_number(lotSizeFilter, 'max_trading_qty'), }, 'price': { 'min': self.safe_number(priceFilter, 'min_price'), 'max': self.safe_number(priceFilter, 'max_price'), }, 'cost': { 'min': None, 'max': None, }, }, 'info': market, }) return result def parse_ticker(self, ticker, market=None): # # fetchTicker # # { # symbol: 'BTCUSD', # bid_price: '7680', # ask_price: '7680.5', # last_price: '7680.00', # last_tick_direction: 'MinusTick', # prev_price_24h: '7870.50', # price_24h_pcnt: '-0.024204', # high_price_24h: '8035.00', # low_price_24h: '7671.00', # prev_price_1h: '7780.00', # price_1h_pcnt: '-0.012853', # mark_price: '7683.27', # index_price: '7682.74', # open_interest: 188829147, # open_value: '23670.06', # total_turnover: '25744224.90', # turnover_24h: '102997.83', # total_volume: 225448878806, # volume_24h: 809919408, # funding_rate: '0.0001', # predicted_funding_rate: '0.0001', # next_funding_time: '2020-03-12T00:00:00Z', # countdown_hour: 7 # } # timestamp = None marketId = self.safe_string(ticker, 'symbol') symbol = self.safe_symbol(marketId, market) last = self.safe_number(ticker, 'last_price') open = self.safe_number(ticker, 'prev_price_24h') percentage = self.safe_number(ticker, 'price_24h_pcnt') if percentage is not None: percentage *= 100 change = None average = None if (last is not None) and (open is not None): change = last - open average = self.sum(open, last) / 2 baseVolume = self.safe_number(ticker, 'turnover_24h') quoteVolume = self.safe_number(ticker, 'volume_24h') vwap = self.vwap(baseVolume, quoteVolume) return { 'symbol': symbol, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'high': self.safe_number(ticker, 'high_price_24h'), 'low': self.safe_number(ticker, 'low_price_24h'), 'bid': self.safe_number(ticker, 'bid_price'), 'bidVolume': None, 'ask': self.safe_number(ticker, 'ask_price'), 'askVolume': None, 'vwap': vwap, 'open': open, 'close': last, 'last': last, 'previousClose': None, 'change': change, 'percentage': percentage, 'average': average, 'baseVolume': baseVolume, 'quoteVolume': quoteVolume, 'info': ticker, } async def fetch_ticker(self, symbol, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], } response = await self.v2PublicGetTickers(self.extend(request, params)) # # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: [ # { # symbol: 'BTCUSD', # bid_price: '7680', # ask_price: '7680.5', # last_price: '7680.00', # last_tick_direction: 'MinusTick', # prev_price_24h: '7870.50', # price_24h_pcnt: '-0.024204', # high_price_24h: '8035.00', # low_price_24h: '7671.00', # prev_price_1h: '7780.00', # price_1h_pcnt: '-0.012853', # mark_price: '7683.27', # index_price: '7682.74', # open_interest: 188829147, # open_value: '23670.06', # total_turnover: '25744224.90', # turnover_24h: '102997.83', # total_volume: 225448878806, # volume_24h: 809919408, # funding_rate: '0.0001', # predicted_funding_rate: '0.0001', # next_funding_time: '2020-03-12T00:00:00Z', # countdown_hour: 7 # } # ], # time_now: '1583948195.818255' # } # result = self.safe_value(response, 'result', []) first = self.safe_value(result, 0) timestamp = self.safe_timestamp(response, 'time_now') ticker = self.parse_ticker(first, market) ticker['timestamp'] = timestamp ticker['datetime'] = self.iso8601(timestamp) return ticker async def fetch_tickers(self, symbols=None, params={}): await self.load_markets() response = await self.v2PublicGetTickers(params) # # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: [ # { # symbol: 'BTCUSD', # bid_price: '7680', # ask_price: '7680.5', # last_price: '7680.00', # last_tick_direction: 'MinusTick', # prev_price_24h: '7870.50', # price_24h_pcnt: '-0.024204', # high_price_24h: '8035.00', # low_price_24h: '7671.00', # prev_price_1h: '7780.00', # price_1h_pcnt: '-0.012853', # mark_price: '7683.27', # index_price: '7682.74', # open_interest: 188829147, # open_value: '23670.06', # total_turnover: '25744224.90', # turnover_24h: '102997.83', # total_volume: 225448878806, # volume_24h: 809919408, # funding_rate: '0.0001', # predicted_funding_rate: '0.0001', # next_funding_time: '2020-03-12T00:00:00Z', # countdown_hour: 7 # } # ], # time_now: '1583948195.818255' # } # result = self.safe_value(response, 'result', []) tickers = {} for i in range(0, len(result)): ticker = self.parse_ticker(result[i]) symbol = ticker['symbol'] tickers[symbol] = ticker return self.filter_by_array(tickers, 'symbol', symbols) def parse_ohlcv(self, ohlcv, market=None): # # inverse perpetual BTC/USD # # { # symbol: 'BTCUSD', # interval: '1', # open_time: 1583952540, # open: '7760.5', # high: '7764', # low: '7757', # close: '7763.5', # volume: '1259766', # turnover: '162.32773718999994' # } # # linear perpetual BTC/USDT # # { # "id":143536, # "symbol":"BTCUSDT", # "period":"15", # "start_at":1587883500, # "volume":1.035, # "open":7540.5, # "high":7541, # "low":7540.5, # "close":7541 # } # return [ self.safe_timestamp_2(ohlcv, 'open_time', 'start_at'), self.safe_number(ohlcv, 'open'), self.safe_number(ohlcv, 'high'), self.safe_number(ohlcv, 'low'), self.safe_number(ohlcv, 'close'), self.safe_number_2(ohlcv, 'turnover', 'volume'), ] async def fetch_ohlcv(self, symbol, timeframe='1m', since=None, limit=None, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], 'interval': self.timeframes[timeframe], } duration = self.parse_timeframe(timeframe) now = self.seconds() if since is None: if limit is None: raise ArgumentsRequired(self.id + ' fetchOHLCV() requires a since argument or a limit argument') else: request['from'] = now - limit * duration else: request['from'] = int(since / 1000) if limit is not None: request['limit'] = limit # max 200, default 200 marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'publicLinearGetKline' if (marketType == 'linear') else 'v2PublicGetKlineList' response = await getattr(self, method)(self.extend(request, params)) # # inverse perpetual BTC/USD # # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: [ # { # symbol: 'BTCUSD', # interval: '1', # open_time: 1583952540, # open: '7760.5', # high: '7764', # low: '7757', # close: '7763.5', # volume: '1259766', # turnover: '162.32773718999994' # }, # ], # time_now: '1583953082.397330' # } # # linear perpetual BTC/USDT # # { # "ret_code":0, # "ret_msg":"OK", # "ext_code":"", # "ext_info":"", # "result":[ # { # "id":143536, # "symbol":"BTCUSDT", # "period":"15", # "start_at":1587883500, # "volume":1.035, # "open":7540.5, # "high":7541, # "low":7540.5, # "close":7541 # } # ], # "time_now":"1587884120.168077" # } # result = self.safe_value(response, 'result', {}) return self.parse_ohlcvs(result, market, timeframe, since, limit) def parse_trade(self, trade, market=None): # # fetchTrades(public) # # { # id: 43785688, # symbol: 'BTCUSD', # price: 7786, # qty: 67, # side: 'Sell', # time: '2020-03-11T19:18:30.123Z' # } # # fetchMyTrades, fetchOrderTrades(private) # # { # "closed_size": 0, # "cross_seq": 277136382, # "exec_fee": "0.0000001", # "exec_id": "256e5ef8-abfe-5772-971b-f944e15e0d68", # "exec_price": "8178.5", # "exec_qty": 1, # # the docs say the exec_time field is "abandoned" now # # the user should use "trade_time_ms" # "exec_time": "1571676941.70682", # "exec_type": "Trade", #Exec Type Enum # "exec_value": "0.00012227", # "fee_rate": "0.00075", # "last_liquidity_ind": "RemovedLiquidity", #Liquidity Enum # "leaves_qty": 0, # "nth_fill": 2, # "order_id": "7ad50cb1-9ad0-4f74-804b-d82a516e1029", # "order_link_id": "", # "order_price": "8178", # "order_qty": 1, # "order_type": "Market", #Order Type Enum # "side": "Buy", #Side Enum # "symbol": "BTCUSD", #Symbol Enum # "user_id": 1, # "trade_time_ms": 1577480599000 # } # id = self.safe_string_2(trade, 'id', 'exec_id') marketId = self.safe_string(trade, 'symbol') market = self.safe_market(marketId, market) symbol = market['symbol'] amountString = self.safe_string_2(trade, 'qty', 'exec_qty') priceString = self.safe_string_2(trade, 'exec_price', 'price') cost = self.safe_number(trade, 'exec_value') amount = self.parse_number(amountString) price = self.parse_number(priceString) if cost is None: cost = self.parse_number(Precise.string_mul(priceString, amountString)) timestamp = self.parse8601(self.safe_string(trade, 'time')) if timestamp is None: timestamp = self.safe_integer(trade, 'trade_time_ms') side = self.safe_string_lower(trade, 'side') lastLiquidityInd = self.safe_string(trade, 'last_liquidity_ind') takerOrMaker = 'maker' if (lastLiquidityInd == 'AddedLiquidity') else 'taker' feeCost = self.safe_number(trade, 'exec_fee') fee = None if feeCost is not None: feeCurrencyCode = market['base'] if market['inverse'] else market['quote'] fee = { 'cost': feeCost, 'currency': feeCurrencyCode, 'rate': self.safe_number(trade, 'fee_rate'), } return { 'id': id, 'info': trade, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'symbol': symbol, 'order': self.safe_string(trade, 'order_id'), 'type': self.safe_string_lower(trade, 'order_type'), 'side': side, 'takerOrMaker': takerOrMaker, 'price': price, 'amount': amount, 'cost': cost, 'fee': fee, } async def fetch_trades(self, symbol, since=None, limit=None, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], # 'from': 123, # from id } if limit is not None: request['count'] = limit # default 500, max 1000 marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'publicLinearGetRecentTradingRecords' if (marketType == 'linear') else 'v2PublicGetTradingRecords' response = await getattr(self, method)(self.extend(request, params)) # # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: [ # { # id: 43785688, # symbol: 'BTCUSD', # price: 7786, # qty: 67, # side: 'Sell', # time: '2020-03-11T19:18:30.123Z' # }, # ], # time_now: '1583954313.393362' # } # result = self.safe_value(response, 'result', {}) return self.parse_trades(result, market, since, limit) def parse_order_book(self, orderbook, timestamp=None, bidsKey='Buy', asksKey='Sell', priceKey='price', amountKey='size'): bids = [] asks = [] for i in range(0, len(orderbook)): bidask = orderbook[i] side = self.safe_string(bidask, 'side') if side == 'Buy': bids.append(self.parse_bid_ask(bidask, priceKey, amountKey)) elif side == 'Sell': asks.append(self.parse_bid_ask(bidask, priceKey, amountKey)) else: raise ExchangeError(self.id + ' parseOrderBook encountered an unrecognized bidask format: ' + self.json(bidask)) return { 'bids': self.sort_by(bids, 0, True), 'asks': self.sort_by(asks, 0), 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'nonce': None, } async def fetch_order_book(self, symbol, limit=None, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], } response = await self.v2PublicGetOrderBookL2(self.extend(request, params)) # # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: [ # {symbol: 'BTCUSD', price: '7767.5', size: 677956, side: 'Buy'}, # {symbol: 'BTCUSD', price: '7767', size: 580690, side: 'Buy'}, # {symbol: 'BTCUSD', price: '7766.5', size: 475252, side: 'Buy'}, # {symbol: 'BTCUSD', price: '7768', size: 330847, side: 'Sell'}, # {symbol: 'BTCUSD', price: '7768.5', size: 97159, side: 'Sell'}, # {symbol: 'BTCUSD', price: '7769', size: 6508, side: 'Sell'}, # ], # time_now: '1583954829.874823' # } # result = self.safe_value(response, 'result', []) timestamp = self.safe_timestamp(response, 'time_now') return self.parse_order_book(result, timestamp, 'Buy', 'Sell', 'price', 'size') async def fetch_balance(self, params={}): await self.load_markets() request = {} coin = self.safe_string(params, 'coin') code = self.safe_string(params, 'code') if coin is not None: request['coin'] = coin elif code is not None: currency = self.currency(code) request['coin'] = currency['id'] response = await self.v2PrivateGetWalletBalance(self.extend(request, params)) # # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: { # BTC: { # equity: 0, # available_balance: 0, # used_margin: 0, # order_margin: 0, # position_margin: 0, # occ_closing_fee: 0, # occ_funding_fee: 0, # wallet_balance: 0, # realised_pnl: 0, # unrealised_pnl: 0, # cum_realised_pnl: 0, # given_cash: 0, # service_cash: 0 # } # }, # time_now: '1583937810.370020', # rate_limit_status: 119, # rate_limit_reset_ms: 1583937810367, # rate_limit: 120 # } # result = { 'info': response, } balances = self.safe_value(response, 'result', {}) currencyIds = list(balances.keys()) for i in range(0, len(currencyIds)): currencyId = currencyIds[i] balance = balances[currencyId] code = self.safe_currency_code(currencyId) account = self.account() account['free'] = self.safe_string(balance, 'available_balance') account['used'] = self.safe_string(balance, 'used_margin') account['total'] = self.safe_string(balance, 'equity') result[code] = account return self.parse_balance(result, False) def parse_order_status(self, status): statuses = { # basic orders 'Created': 'open', 'Rejected': 'rejected', # order is triggered but failed upon being placed 'New': 'open', 'PartiallyFilled': 'open', 'Filled': 'closed', 'Cancelled': 'canceled', 'PendingCancel': 'canceling', # the engine has received the cancellation but there is no guarantee that it will be successful # conditional orders 'Active': 'open', # order is triggered and placed successfully 'Untriggered': 'open', # order waits to be triggered 'Triggered': 'closed', # order is triggered # 'Cancelled': 'canceled', # order is cancelled # 'Rejected': 'rejected', # order is triggered but fail to be placed 'Deactivated': 'canceled', # conditional order was cancelled before triggering } return self.safe_string(statuses, status, status) def parse_time_in_force(self, timeInForce): timeInForces = { 'GoodTillCancel': 'GTC', 'ImmediateOrCancel': 'IOC', 'FillOrKill': 'FOK', 'PostOnly': 'PO', } return self.safe_string(timeInForces, timeInForce, timeInForce) def parse_order(self, order, market=None): # # createOrder # # { # "user_id": 1, # "order_id": "335fd977-e5a5-4781-b6d0-c772d5bfb95b", # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": 8800, # "qty": 1, # "time_in_force": "GoodTillCancel", # "order_status": "Created", # "last_exec_time": 0, # "last_exec_price": 0, # "leaves_qty": 1, # "cum_exec_qty": 0, # in contracts, where 1 contract = 1 quote currency unit(USD for inverse contracts) # "cum_exec_value": 0, # in contract's underlying currency(BTC for inverse contracts) # "cum_exec_fee": 0, # "reject_reason": "", # "order_link_id": "", # "created_at": "2019-11-30T11:03:43.452Z", # "updated_at": "2019-11-30T11:03:43.455Z" # } # # fetchOrder # # { # "user_id" : 599946, # "symbol" : "BTCUSD", # "side" : "Buy", # "order_type" : "Limit", # "price" : "7948", # "qty" : 10, # "time_in_force" : "GoodTillCancel", # "order_status" : "Filled", # "ext_fields" : { # "o_req_num" : -1600687220498, # "xreq_type" : "x_create" # }, # "last_exec_time" : "1588150113.968422", # "last_exec_price" : "7948", # "leaves_qty" : 0, # "leaves_value" : "0", # "cum_exec_qty" : 10, # "cum_exec_value" : "0.00125817", # "cum_exec_fee" : "-0.00000031", # "reject_reason" : "", # "cancel_type" : "", # "order_link_id" : "", # "created_at" : "2020-04-29T08:45:24.399146Z", # "updated_at" : "2020-04-29T08:48:33.968422Z", # "order_id" : "dd2504b9-0157-406a-99e1-efa522373944" # } # # conditional order # # { # "user_id":##, # "symbol":"BTCUSD", # "side":"Buy", # "order_type":"Market", # "price":0, # "qty":10, # "time_in_force":"GoodTillCancel", # "stop_order_type":"Stop", # "trigger_by":"LastPrice", # "base_price":11833, # "order_status":"Untriggered", # "ext_fields":{ # "stop_order_type":"Stop", # "trigger_by":"LastPrice", # "base_price":11833, # "expected_direction":"Rising", # "trigger_price":12400, # "close_on_trigger":true, # "op_from":"api", # "remark":"145.53.159.48", # "o_req_num":0 # }, # "leaves_qty":10, # "leaves_value":0.00080645, # "reject_reason":null, # "cross_seq":-1, # "created_at":"2020-08-21T09:18:48.000Z", # "updated_at":"2020-08-21T09:18:48.000Z", # "stop_px":12400, # "stop_order_id":"3f3b54b1-3379-42c7-8510-44f4d9915be0" # } # marketId = self.safe_string(order, 'symbol') market = self.safe_market(marketId, market) symbol = market['symbol'] feeCurrency = None timestamp = self.parse8601(self.safe_string(order, 'created_at')) id = self.safe_string_2(order, 'order_id', 'stop_order_id') type = self.safe_string_lower(order, 'order_type') price = self.safe_number(order, 'price') if price == 0.0: price = None average = self.safe_number(order, 'average_price') amount = self.safe_number(order, 'qty') cost = self.safe_number(order, 'cum_exec_value') filled = self.safe_number(order, 'cum_exec_qty') remaining = self.safe_number(order, 'leaves_qty') marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) if market is not None: if marketType == 'linear': feeCurrency = market['quote'] else: feeCurrency = market['base'] lastTradeTimestamp = self.safe_timestamp(order, 'last_exec_time') if lastTradeTimestamp == 0: lastTradeTimestamp = None status = self.parse_order_status(self.safe_string_2(order, 'order_status', 'stop_order_status')) side = self.safe_string_lower(order, 'side') feeCost = self.safe_number(order, 'cum_exec_fee') fee = None if feeCost is not None: feeCost = abs(feeCost) fee = { 'cost': feeCost, 'currency': feeCurrency, } clientOrderId = self.safe_string(order, 'order_link_id') if (clientOrderId is not None) and (len(clientOrderId) < 1): clientOrderId = None timeInForce = self.parse_time_in_force(self.safe_string(order, 'time_in_force')) stopPrice = self.safe_number(order, 'stop_px') postOnly = (timeInForce == 'PO') return self.safe_order({ 'info': order, 'id': id, 'clientOrderId': clientOrderId, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'lastTradeTimestamp': lastTradeTimestamp, 'symbol': symbol, 'type': type, 'timeInForce': timeInForce, 'postOnly': postOnly, 'side': side, 'price': price, 'stopPrice': stopPrice, 'amount': amount, 'cost': cost, 'average': average, 'filled': filled, 'remaining': remaining, 'status': status, 'fee': fee, 'trades': None, }) async def fetch_order(self, id, symbol=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' fetchOrder() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], # 'order_link_id': 'string', # one of order_id, stop_order_id or order_link_id is required # regular orders --------------------------------------------- # 'order_id': id, # one of order_id or order_link_id is required for regular orders # conditional orders --------------------------------------------- # 'stop_order_id': id, # one of stop_order_id or order_link_id is required for conditional orders } marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'privateLinearGetOrderSearch' if (marketType == 'linear') else 'v2PrivateGetOrder' stopOrderId = self.safe_string(params, 'stop_order_id') if stopOrderId is None: orderLinkId = self.safe_string(params, 'order_link_id') if orderLinkId is None: request['order_id'] = id else: method = 'privateLinearGetStopOrderSearch' if (marketType == 'linear') else 'v2PrivateGetStopOrder' response = await getattr(self, method)(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "OK", # "ext_code": "", # "ext_info": "", # "result": { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Sell", # "order_type": "Limit", # "price": "8083", # "qty": 10, # "time_in_force": "GoodTillCancel", # "order_status": "New", # "ext_fields": {"o_req_num": -308787, "xreq_type": "x_create", "xreq_offset": 4154640}, # "leaves_qty": 10, # "leaves_value": "0.00123716", # "cum_exec_qty": 0, # "reject_reason": "", # "order_link_id": "", # "created_at": "2019-10-21T07:28:19.396246Z", # "updated_at": "2019-10-21T07:28:19.396246Z", # "order_id": "efa44157-c355-4a98-b6d6-1d846a936b93" # }, # "time_now": "1571651135.291930", # "rate_limit_status": 99, # The remaining number of accesses in one minute # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "OK", # "ext_code": "", # "ext_info": "", # "result": { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": "8000", # "qty": 1, # "time_in_force": "GoodTillCancel", # "order_status": "Untriggered", # "ext_fields": {}, # "leaves_qty": 1, # "leaves_value": "0.00013333", # "cum_exec_qty": 0, # "cum_exec_value": null, # "cum_exec_fee": null, # "reject_reason": "", # "order_link_id": "", # "created_at": "2019-12-27T19:56:24.052194Z", # "updated_at": "2019-12-27T19:56:24.052194Z", # "order_id": "378a1bbc-a93a-4e75-87f4-502ea754ba36" # }, # "time_now": "1577476584.386958", # "rate_limit_status": 99, # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # result = self.safe_value(response, 'result') return self.parse_order(result, market) async def create_order(self, symbol, type, side, amount, price=None, params={}): await self.load_markets() market = self.market(symbol) qty = self.amount_to_precision(symbol, amount) if market['inverse']: qty = int(qty) else: qty = float(qty) request = { # orders --------------------------------------------------------- 'side': self.capitalize(side), 'symbol': market['id'], 'order_type': self.capitalize(type), 'qty': qty, # order quantity in USD, integer only # 'price': float(self.price_to_precision(symbol, price)), # required for limit orders 'time_in_force': 'GoodTillCancel', # ImmediateOrCancel, FillOrKill, PostOnly # 'take_profit': 123.45, # take profit price, only take effect upon opening the position # 'stop_loss': 123.45, # stop loss price, only take effect upon opening the position # 'reduce_only': False, # reduce only, required for linear orders # when creating a closing order, bybit recommends a True value for # close_on_trigger to avoid failing due to insufficient available margin # 'close_on_trigger': False, required for linear orders # 'order_link_id': 'string', # unique client order id, max 36 characters # conditional orders --------------------------------------------- # base_price is used to compare with the value of stop_px, to decide # whether your conditional order will be triggered by crossing trigger # price from upper side or lower side, mainly used to identify the # expected direction of the current conditional order # 'base_price': 123.45, # required for conditional orders # 'stop_px': 123.45, # trigger price, required for conditional orders # 'trigger_by': 'LastPrice', # IndexPrice, MarkPrice } priceIsRequired = False if type == 'limit': priceIsRequired = True if priceIsRequired: if price is not None: request['price'] = float(self.price_to_precision(symbol, price)) else: raise ArgumentsRequired(self.id + ' createOrder() requires a price argument for a ' + type + ' order') clientOrderId = self.safe_string_2(params, 'order_link_id', 'clientOrderId') if clientOrderId is not None: request['order_link_id'] = clientOrderId params = self.omit(params, ['order_link_id', 'clientOrderId']) stopPx = self.safe_value_2(params, 'stop_px', 'stopPrice') basePrice = self.safe_value(params, 'base_price') marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'privateLinearPostOrderCreate' if (marketType == 'linear') else 'v2PrivatePostOrderCreate' if marketType == 'linear': method = 'privateLinearPostOrderCreate' request['reduce_only'] = False request['close_on_trigger'] = False if stopPx is not None: if basePrice is None: raise ArgumentsRequired(self.id + ' createOrder() requires both the stop_px and base_price params for a conditional ' + type + ' order') else: method = 'privateLinearPostStopOrderCreate' if (marketType == 'linear') else 'v2PrivatePostStopOrderCreate' request['stop_px'] = float(self.price_to_precision(symbol, stopPx)) request['base_price'] = float(self.price_to_precision(symbol, basePrice)) params = self.omit(params, ['stop_px', 'stopPrice', 'base_price']) elif basePrice is not None: raise ArgumentsRequired(self.id + ' createOrder() requires both the stop_px and base_price params for a conditional ' + type + ' order') response = await getattr(self, method)(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "OK", # "ext_code": "", # "ext_info": "", # "result": { # "user_id": 1, # "order_id": "335fd977-e5a5-4781-b6d0-c772d5bfb95b", # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": 8800, # "qty": 1, # "time_in_force": "GoodTillCancel", # "order_status": "Created", # "last_exec_time": 0, # "last_exec_price": 0, # "leaves_qty": 1, # "cum_exec_qty": 0, # "cum_exec_value": 0, # "cum_exec_fee": 0, # "reject_reason": "", # "order_link_id": "", # "created_at": "2019-11-30T11:03:43.452Z", # "updated_at": "2019-11-30T11:03:43.455Z" # }, # "time_now": "1575111823.458705", # "rate_limit_status": 98, # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": 8000, # "qty": 1, # "time_in_force": "GoodTillCancel", # "stop_order_type": "Stop", # "trigger_by": "LastPrice", # "base_price": 7000, # "order_status": "Untriggered", # "ext_fields": { # "stop_order_type": "Stop", # "trigger_by": "LastPrice", # "base_price": 7000, # "expected_direction": "Rising", # "trigger_price": 7500, # "op_from": "api", # "remark": "127.0.01", # "o_req_num": 0 # }, # "leaves_qty": 1, # "leaves_value": 0.00013333, # "reject_reason": null, # "cross_seq": -1, # "created_at": "2019-12-27T12:48:24.000Z", # "updated_at": "2019-12-27T12:48:24.000Z", # "stop_px": 7500, # "stop_order_id": "a85cd1c0-a9a4-49d3-a1bd-bab5ebe946d5" # }, # "ext_info": null, # "time_now": "1577450904.327654", # "rate_limit_status": 99, # "rate_limit_reset_ms": 1577450904335, # "rate_limit": "100" # } # result = self.safe_value(response, 'result') return self.parse_order(result, market) async def edit_order(self, id, symbol, type, side, amount=None, price=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' editOrder() requires an symbol argument') marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) await self.load_markets() market = self.market(symbol) request = { # 'order_id': id, # only for non-conditional orders 'symbol': market['id'], # 'p_r_qty': self.amount_to_precision(symbol, amount), # new order quantity, optional # 'p_r_price' self.priceToprecision(symbol, price), # new order price, optional # ---------------------------------------------------------------- # conditional orders # 'stop_order_id': id, # only for conditional orders # 'p_r_trigger_price': 123.45, # new trigger price also known as stop_px } method = 'privateLinearPostOrderReplace' if (marketType == 'linear') else 'v2PrivatePostOrderReplace' stopOrderId = self.safe_string(params, 'stop_order_id') if stopOrderId is not None: method = 'privateLinearPostStopOrderReplace' if (marketType == 'linear') else 'v2PrivatePostStopOrderReplace' request['stop_order_id'] = stopOrderId params = self.omit(params, ['stop_order_id']) else: request['order_id'] = id if amount is not None: qty = self.amount_to_precision(symbol, amount) if market['inverse']: qty = int(qty) else: qty = float(qty) request['p_r_qty'] = qty if price is not None: request['p_r_price'] = float(self.price_to_precision(symbol, price)) response = await getattr(self, method)(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": {"order_id": "efa44157-c355-4a98-b6d6-1d846a936b93"}, # "time_now": "1539778407.210858", # "rate_limit_status": 99, # remaining number of accesses in one minute # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": {"stop_order_id": "378a1bbc-a93a-4e75-87f4-502ea754ba36"}, # "ext_info": null, # "time_now": "1577475760.604942", # "rate_limit_status": 96, # "rate_limit_reset_ms": 1577475760612, # "rate_limit": "100" # } # result = self.safe_value(response, 'result', {}) return { 'info': response, 'id': self.safe_string_2(result, 'order_id', 'stop_order_id'), 'order_id': self.safe_string(result, 'order_id'), 'stop_order_id': self.safe_string(result, 'stop_order_id'), } async def cancel_order(self, id, symbol=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' cancelOrder() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], # 'order_link_id': 'string', # one of order_id, stop_order_id or order_link_id is required # regular orders --------------------------------------------- # 'order_id': id, # one of order_id or order_link_id is required for regular orders # conditional orders --------------------------------------------- # 'stop_order_id': id, # one of stop_order_id or order_link_id is required for conditional orders } marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_value(marketTypes, symbol) method = 'privateLinearPostOrderCancel' if (marketType == 'linear') else 'v2PrivatePostOrderCancel' stopOrderId = self.safe_string(params, 'stop_order_id') if stopOrderId is None: orderLinkId = self.safe_string(params, 'order_link_id') if orderLinkId is None: request['order_id'] = id else: method = 'privateLinearPostStopOrderCancel' if (marketType == 'linear') else 'v2PrivatePostStopOrderCancel' response = await getattr(self, method)(self.extend(request, params)) result = self.safe_value(response, 'result', {}) return self.parse_order(result, market) async def cancel_all_orders(self, symbol=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' cancelAllOrders() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], } options = self.safe_value(self.options, 'cancelAllOrders', {}) marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) defaultMethod = 'privateLinearPostOrderCancelAll' if (marketType == 'linear') else 'v2PrivatePostOrderCancelAll' method = self.safe_string(options, 'method', defaultMethod) response = await getattr(self, method)(self.extend(request, params)) result = self.safe_value(response, 'result', []) return self.parse_orders(result, market) async def fetch_orders(self, symbol=None, since=None, limit=None, params={}): await self.load_markets() request = { # 'order_id': 'string' # 'order_link_id': 'string', # unique client order id, max 36 characters # 'symbol': market['id'], # default BTCUSD # 'order': 'desc', # asc # 'page': 1, # 'limit': 20, # max 50 # 'order_status': 'Created,New' # conditional orders --------------------------------------------- # 'stop_order_id': 'string', # 'stop_order_status': 'Untriggered', } market = None if symbol is not None: market = self.market(symbol) request['symbol'] = market['id'] if limit is not None: request['limit'] = limit options = self.safe_value(self.options, 'fetchOrders', {}) marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) defaultMethod = 'privateLinearGetOrderList' if (marketType == 'linear') else 'v2PrivateGetOrderList' query = params if ('stop_order_id' in params) or ('stop_order_status' in params): stopOrderStatus = self.safe_value(params, 'stopOrderStatus') if stopOrderStatus is not None: if isinstance(stopOrderStatus, list): stopOrderStatus = ','.join(stopOrderStatus) request['stop_order_status'] = stopOrderStatus query = self.omit(params, 'stop_order_status') defaultMethod = 'privateLinearGetStopOrderList' if (marketType == 'linear') else 'v2PrivateGetStopOrderList' method = self.safe_string(options, 'method', defaultMethod) response = await getattr(self, method)(self.extend(request, query)) # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "current_page": 1, # "last_page": 6, # "data": [ # { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Sell", # "order_type": "Market", # "price": 7074, # "qty": 2, # "time_in_force": "ImmediateOrCancel", # "order_status": "Filled", # "ext_fields": { # "close_on_trigger": True, # "orig_order_type": "BLimit", # "prior_x_req_price": 5898.5, # "op_from": "pc", # "remark": "127.0.0.1", # "o_req_num": -34799032763, # "xreq_type": "x_create" # }, # "last_exec_time": "1577448481.696421", # "last_exec_price": 7070.5, # "leaves_qty": 0, # "leaves_value": 0, # "cum_exec_qty": 2, # "cum_exec_value": 0.00028283, # "cum_exec_fee": 0.00002, # "reject_reason": "NoError", # "order_link_id": "", # "created_at": "2019-12-27T12:08:01.000Z", # "updated_at": "2019-12-27T12:08:01.000Z", # "order_id": "f185806b-b801-40ff-adec-52289370ed62" # } # ] # }, # "ext_info": null, # "time_now": "1577448922.437871", # "rate_limit_status": 98, # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "current_page": 1, # "last_page": 1, # "data": [ # { # "user_id": 1, # "stop_order_status": "Untriggered", # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": 8000, # "qty": 1, # "time_in_force": "GoodTillCancel", # "stop_order_type": "Stop", # "trigger_by": "LastPrice", # "base_price": 7000, # "order_link_id": "", # "created_at": "2019-12-27T12:48:24.000Z", # "updated_at": "2019-12-27T12:48:24.000Z", # "stop_px": 7500, # "stop_order_id": "a85cd1c0-a9a4-49d3-a1bd-bab5ebe946d5" # }, # ] # }, # "ext_info": null, # "time_now": "1577451658.755468", # "rate_limit_status": 599, # "rate_limit_reset_ms": 1577451658762, # "rate_limit": 600 # } # result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_orders(data, market, since, limit) async def fetch_closed_orders(self, symbol=None, since=None, limit=None, params={}): defaultStatuses = [ 'Rejected', 'Filled', 'Cancelled', # conditional orders # 'Active', # 'Triggered', # 'Cancelled', # 'Rejected', # 'Deactivated', ] options = self.safe_value(self.options, 'fetchClosedOrders', {}) status = self.safe_value(options, 'order_status', defaultStatuses) if isinstance(status, list): status = ','.join(status) request = {} stopOrderStatus = self.safe_value(params, 'stop_order_status') if stopOrderStatus is None: request['order_status'] = status else: request['stop_order_status'] = stopOrderStatus return await self.fetch_orders(symbol, since, limit, self.extend(request, params)) async def fetch_open_orders(self, symbol=None, since=None, limit=None, params={}): defaultStatuses = [ 'Created', 'New', 'PartiallyFilled', 'PendingCancel', # conditional orders # 'Untriggered', ] options = self.safe_value(self.options, 'fetchOpenOrders', {}) status = self.safe_value(options, 'order_status', defaultStatuses) if isinstance(status, list): status = ','.join(status) request = {} stopOrderStatus = self.safe_value(params, 'stop_order_status') if stopOrderStatus is None: request['order_status'] = status else: request['stop_order_status'] = stopOrderStatus return await self.fetch_orders(symbol, since, limit, self.extend(request, params)) async def fetch_order_trades(self, id, symbol=None, since=None, limit=None, params={}): request = { 'order_id': id, } return await self.fetch_my_trades(symbol, since, limit, self.extend(request, params)) async def fetch_my_trades(self, symbol=None, since=None, limit=None, params={}): await self.load_markets() request = { # 'order_id': 'f185806b-b801-40ff-adec-52289370ed62', # if not provided will return user's trading records # 'symbol': market['id'], # 'start_time': int(since / 1000), # 'page': 1, # 'limit' 20, # max 50 } market = None if symbol is None: orderId = self.safe_string(params, 'order_id') if orderId is None: raise ArgumentsRequired(self.id + ' fetchMyTrades() requires a symbol argument or an order_id param') else: request['order_id'] = orderId params = self.omit(params, 'order_id') else: market = self.market(symbol) request['symbol'] = market['id'] if since is not None: request['start_time'] = since if limit is not None: request['limit'] = limit # default 20, max 50 marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'privateLinearGetTradeExecutionList' if (marketType == 'linear') else 'v2PrivateGetExecutionList' response = await getattr(self, method)(self.extend(request, params)) # # inverse # # { # "ret_code": 0, # "ret_msg": "OK", # "ext_code": "", # "ext_info": "", # "result": { # "order_id": "Abandonednot !", # Abandonednot ! # "trade_list": [ # { # "closed_size": 0, # "cross_seq": 277136382, # "exec_fee": "0.0000001", # "exec_id": "256e5ef8-abfe-5772-971b-f944e15e0d68", # "exec_price": "8178.5", # "exec_qty": 1, # "exec_time": "1571676941.70682", # "exec_type": "Trade", #Exec Type Enum # "exec_value": "0.00012227", # "fee_rate": "0.00075", # "last_liquidity_ind": "RemovedLiquidity", #Liquidity Enum # "leaves_qty": 0, # "nth_fill": 2, # "order_id": "7ad50cb1-9ad0-4f74-804b-d82a516e1029", # "order_link_id": "", # "order_price": "8178", # "order_qty": 1, # "order_type": "Market", #Order Type Enum # "side": "Buy", #Side Enum # "symbol": "BTCUSD", #Symbol Enum # "user_id": 1 # } # ] # }, # "time_now": "1577483699.281488", # "rate_limit_status": 118, # "rate_limit_reset_ms": 1577483699244737, # "rate_limit": 120 # } # # linear # # { # "ret_code":0, # "ret_msg":"OK", # "ext_code":"", # "ext_info":"", # "result":{ # "current_page":1, # "data":[ # { # "order_id":"b59418ec-14d4-4ef9-b9f4-721d5d576974", # "order_link_id":"", # "side":"Sell", # "symbol":"BTCUSDT", # "exec_id":"0327284d-faec-5191-bd89-acc5b4fafda9", # "price":0.5, # "order_price":0.5, # "order_qty":0.01, # "order_type":"Market", # "fee_rate":0.00075, # "exec_price":9709.5, # "exec_type":"Trade", # "exec_qty":0.01, # "exec_fee":0.07282125, # "exec_value":97.095, # "leaves_qty":0, # "closed_size":0.01, # "last_liquidity_ind":"RemovedLiquidity", # "trade_time":1591648052, # "trade_time_ms":1591648052861 # } # ] # }, # "time_now":"1591736501.979264", # "rate_limit_status":119, # "rate_limit_reset_ms":1591736501974, # "rate_limit":120 # } # result = self.safe_value(response, 'result', {}) trades = self.safe_value_2(result, 'trade_list', 'data', []) return self.parse_trades(trades, market, since, limit) async def fetch_deposits(self, code=None, since=None, limit=None, params={}): await self.load_markets() request = { # 'coin': currency['id'], # 'currency': currency['id'], # alias # 'start_date': self.iso8601(since), # 'end_date': self.iso8601(till), 'wallet_fund_type': 'Deposit', # Deposit, Withdraw, RealisedPNL, Commission, Refund, Prize, ExchangeOrderWithdraw, ExchangeOrderDeposit # 'page': 1, # 'limit': 20, # max 50 } currency = None if code is not None: currency = self.currency(code) request['coin'] = currency['id'] if since is not None: request['start_date'] = self.ymd(since) if limit is not None: request['limit'] = limit response = await self.v2PrivateGetWalletFundRecords(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "data": [ # { # "id": 234467, # "user_id": 1, # "coin": "BTC", # "wallet_id": 27913, # "type": "Realized P&L", # "amount": "-0.00000006", # "tx_id": "", # "address": "BTCUSD", # "wallet_balance": "0.03000330", # "exec_time": "2019-12-09T00:00:25.000Z", # "cross_seq": 0 # } # ] # }, # "ext_info": null, # "time_now": "1577481867.115552", # "rate_limit_status": 119, # "rate_limit_reset_ms": 1577481867122, # "rate_limit": 120 # } # result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_transactions(data, currency, since, limit) async def fetch_withdrawals(self, code=None, since=None, limit=None, params={}): await self.load_markets() request = { # 'coin': currency['id'], # 'start_date': self.iso8601(since), # 'end_date': self.iso8601(till), # 'status': 'Pending', # ToBeConfirmed, UnderReview, Pending, Success, CancelByUser, Reject, Expire # 'page': 1, # 'limit': 20, # max 50 } currency = None if code is not None: currency = self.currency(code) request['coin'] = currency['id'] if since is not None: request['start_date'] = self.ymd(since) if limit is not None: request['limit'] = limit response = await self.v2PrivateGetWalletWithdrawList(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "data": [ # { # "id": 137, # "user_id": 1, # "coin": "XRP", # Coin Enum # "status": "Pending", # Withdraw Status Enum # "amount": "20.00000000", # "fee": "0.25000000", # "address": "rH7H595XYEVTEHU2FySYsWnmfACBnZS9zM", # "tx_id": "", # "submited_at": "2019-06-11T02:20:24.000Z", # "updated_at": "2019-06-11T02:20:24.000Z" # }, # ], # "current_page": 1, # "last_page": 1 # }, # "ext_info": null, # "time_now": "1577482295.125488", # "rate_limit_status": 119, # "rate_limit_reset_ms": 1577482295132, # "rate_limit": 120 # } # result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_transactions(data, currency, since, limit, params) def parse_transaction_status(self, status): statuses = { 'ToBeConfirmed': 'pending', 'UnderReview': 'pending', 'Pending': 'pending', 'Success': 'ok', 'CancelByUser': 'canceled', 'Reject': 'rejected', 'Expire': 'expired', } return self.safe_string(statuses, status, status) def parse_transaction(self, transaction, currency=None): # # fetchWithdrawals # # { # "id": 137, # "user_id": 1, # "coin": "XRP", # Coin Enum # "status": "Pending", # Withdraw Status Enum # "amount": "20.00000000", # "fee": "0.25000000", # "address": "rH7H595XYEVTEHU2FySYsWnmfACBnZS9zM", # "tx_id": "", # "submited_at": "2019-06-11T02:20:24.000Z", # "updated_at": "2019-06-11T02:20:24.000Z" # } # # fetchDeposits ledger entries # # { # "id": 234467, # "user_id": 1, # "coin": "BTC", # "wallet_id": 27913, # "type": "Realized P&L", # "amount": "-0.00000006", # "tx_id": "", # "address": "BTCUSD", # "wallet_balance": "0.03000330", # "exec_time": "2019-12-09T00:00:25.000Z", # "cross_seq": 0 # } # currencyId = self.safe_string(transaction, 'coin') code = self.safe_currency_code(currencyId, currency) timestamp = self.parse8601(self.safe_string_2(transaction, 'submited_at', 'exec_time')) updated = self.parse8601(self.safe_string(transaction, 'updated_at')) status = self.parse_transaction_status(self.safe_string(transaction, 'status')) address = self.safe_string(transaction, 'address') feeCost = self.safe_number(transaction, 'fee') type = self.safe_string_lower(transaction, 'type') fee = None if feeCost is not None: fee = { 'cost': feeCost, 'currency': code, } return { 'info': transaction, 'id': self.safe_string(transaction, 'id'), 'txid': self.safe_string(transaction, 'tx_id'), 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'address': address, 'addressTo': None, 'addressFrom': None, 'tag': None, 'tagTo': None, 'tagFrom': None, 'type': type, 'amount': self.safe_number(transaction, 'amount'), 'currency': code, 'status': status, 'updated': updated, 'fee': fee, } async def fetch_ledger(self, code=None, since=None, limit=None, params={}): await self.load_markets() request = { # 'coin': currency['id'], # 'currency': currency['id'], # alias # 'start_date': self.iso8601(since), # 'end_date': self.iso8601(till), # 'wallet_fund_type': 'Deposit', # Withdraw, RealisedPNL, Commission, Refund, Prize, ExchangeOrderWithdraw, ExchangeOrderDeposit # 'page': 1, # 'limit': 20, # max 50 } currency = None if code is not None: currency = self.currency(code) request['coin'] = currency['id'] if since is not None: request['start_date'] = self.ymd(since) if limit is not None: request['limit'] = limit response = await self.v2PrivateGetWalletFundRecords(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "data": [ # { # "id": 234467, # "user_id": 1, # "coin": "BTC", # "wallet_id": 27913, # "type": "Realized P&L", # "amount": "-0.00000006", # "tx_id": "", # "address": "BTCUSD", # "wallet_balance": "0.03000330", # "exec_time": "2019-12-09T00:00:25.000Z", # "cross_seq": 0 # } # ] # }, # "ext_info": null, # "time_now": "1577481867.115552", # "rate_limit_status": 119, # "rate_limit_reset_ms": 1577481867122, # "rate_limit": 120 # } # result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_ledger(data, currency, since, limit) def parse_ledger_entry(self, item, currency=None): # # { # "id": 234467, # "user_id": 1, # "coin": "BTC", # "wallet_id": 27913, # "type": "Realized P&L", # "amount": "-0.00000006", # "tx_id": "", # "address": "BTCUSD", # "wallet_balance": "0.03000330", # "exec_time": "2019-12-09T00:00:25.000Z", # "cross_seq": 0 # } # currencyId = self.safe_string(item, 'coin') code = self.safe_currency_code(currencyId, currency) amount = self.safe_number(item, 'amount') after = self.safe_number(item, 'wallet_balance') direction = 'out' if (amount < 0) else 'in' before = None if after is not None and amount is not None: difference = amount if (direction == 'out') else -amount before = self.sum(after, difference) timestamp = self.parse8601(self.safe_string(item, 'exec_time')) type = self.parse_ledger_entry_type(self.safe_string(item, 'type')) id = self.safe_string(item, 'id') referenceId = self.safe_string(item, 'tx_id') return { 'id': id, 'currency': code, 'account': self.safe_string(item, 'wallet_id'), 'referenceAccount': None, 'referenceId': referenceId, 'status': None, 'amount': amount, 'before': before, 'after': after, 'fee': None, 'direction': direction, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'type': type, 'info': item, } def parse_ledger_entry_type(self, type): types = { 'Deposit': 'transaction', 'Withdraw': 'transaction', 'RealisedPNL': 'trade', 'Commission': 'fee', 'Refund': 'cashback', 'Prize': 'prize', # ? 'ExchangeOrderWithdraw': 'transaction', 'ExchangeOrderDeposit': 'transaction', } return self.safe_string(types, type, type) def sign(self, path, api='public', method='GET', params={}, headers=None, body=None): url = self.implode_params(self.urls['api'], {'hostname': self.hostname}) type = self.safe_string(api, 0) section = self.safe_string(api, 1) request = '/' + type + '/' + section + '/' + path # public v2 if section == 'public': if params: request += '?' + self.rawencode(params) elif type == 'public': if params: request += '?' + self.rawencode(params) else: self.check_required_credentials() timestamp = self.nonce() query = self.extend(params, { 'api_key': self.apiKey, 'recv_window': self.options['recvWindow'], 'timestamp': timestamp, }) sortedQuery = self.keysort(query) auth = self.rawencode(sortedQuery) signature = self.hmac(self.encode(auth), self.encode(self.secret)) if method == 'POST': body = self.json(self.extend(query, { 'sign': signature, })) headers = { 'Content-Type': 'application/json', } else: request += '?' + self.urlencode(sortedQuery) + '&sign=' + signature url += request return {'url': url, 'method': method, 'body': body, 'headers': headers} def handle_errors(self, httpCode, reason, url, method, headers, body, response, requestHeaders, requestBody): if not response: return # fallback to default error handler # # { # ret_code: 10001, # ret_msg: 'ReadMapCB: expect {or n, but found \u0000, error ' + # 'found in #0 byte of ...||..., bigger context ' + # '...||...', # ext_code: '', # ext_info: '', # result: null, # time_now: '1583934106.590436' # } # errorCode = self.safe_string(response, 'ret_code') if errorCode != '0': feedback = self.id + ' ' + body self.throw_exactly_matched_exception(self.exceptions['exact'], errorCode, feedback) self.throw_broadly_matched_exception(self.exceptions['broad'], body, feedback) raise ExchangeError(feedback) # unknown message async def fetch_positions(self, symbols=None, params={}): await self.load_markets() request = {} if isinstance(symbols, list): length = len(symbols) if length != 1: raise ArgumentsRequired(self.id + ' fetchPositions takes exactly one symbol') request['symbol'] = self.market_id(symbols[0]) defaultType = self.safe_string(self.options, 'defaultType', 'linear') type = self.safe_string(params, 'type', defaultType) params = self.omit(params, 'type') response = None if type == 'linear': response = await self.privateLinearGetPositionList(self.extend(request, params)) elif type == 'inverse': response = await self.v2PrivateGetPositionList(self.extend(request, params)) elif type == 'inverseFuture': response = await self.futuresPrivateGetPositionList(self.extend(request, params)) # { # ret_code: 0, # ret_msg: 'OK', # ext_code: '', # ext_info: '', # result: [] or {} depending on the request # } return self.safe_value(response, 'result')
44.128885
253
0.461514
rt.base.exchange import Exchange from ccxt.base.errors import ExchangeError from ccxt.base.errors import AuthenticationError from ccxt.base.errors import PermissionDenied from ccxt.base.errors import ArgumentsRequired from ccxt.base.errors import BadRequest from ccxt.base.errors import InsufficientFunds from ccxt.base.errors import InvalidOrder from ccxt.base.errors import OrderNotFound from ccxt.base.errors import RateLimitExceeded from ccxt.base.errors import InvalidNonce from ccxt.base.decimal_to_precision import TICK_SIZE from ccxt.base.precise import Precise class bybit(Exchange): def describe(self): return self.deep_extend(super(bybit, self).describe(), { 'id': 'bybit', 'name': 'Bybit', 'countries': ['VG'], 'version': 'v2', 'userAgent': None, 'rateLimit': 100, 'hostname': 'bybit.com', 'has': { 'cancelOrder': True, 'CORS': True, 'cancelAllOrders': True, 'createOrder': True, 'editOrder': True, 'fetchBalance': True, 'fetchClosedOrders': True, 'fetchDeposits': True, 'fetchLedger': True, 'fetchMarkets': True, 'fetchMyTrades': True, 'fetchOHLCV': True, 'fetchOpenOrders': True, 'fetchOrder': True, 'fetchOrderBook': True, 'fetchOrders': True, 'fetchOrderTrades': True, 'fetchTicker': True, 'fetchTickers': True, 'fetchTime': True, 'fetchTrades': True, 'fetchTransactions': False, 'fetchWithdrawals': True, 'fetchPositions': True, }, 'timeframes': { '1m': '1', '3m': '3', '5m': '5', '15m': '15', '30m': '30', '1h': '60', '2h': '120', '4h': '240', '6h': '360', '12h': '720', '1d': 'D', '1w': 'W', '1M': 'M', '1y': 'Y', }, 'urls': { 'test': 'https://api-testnet.{hostname}', 'logo': 'https://user-images.githubusercontent.com/51840849/76547799-daff5b80-649e-11ea-87fb-3be9bac08954.jpg', 'api': 'https://api.{hostname}', 'www': 'https://www.bybit.com', 'doc': [ 'https://bybit-exchange.github.io/docs/inverse/', 'https://bybit-exchange.github.io/docs/linear/', 'https://github.com/bybit-exchange', ], 'fees': 'https://help.bybit.com/hc/en-us/articles/360039261154', 'referral': 'https://www.bybit.com/app/register?ref=X7Prm', }, 'api': { 'futures': { 'private': { 'get': [ 'position/list', 'order/list', 'order', 'stop-order/list', 'stop-order', 'execution/list', 'trade/closed-pnl/list', ], 'post': [ 'order/create', 'order/cancel', 'order/cancelAll', 'order/replace', 'stop-order/create', 'stop-order/cancel', 'stop-order/cancelAll', 'stop-order/replace', 'position/change-position-margin', 'position/trading-stop', 'position/leverage/save', 'position/switch-mode', 'position/switch-isolated', ], }, }, 'v2': { 'public': { 'get': [ 'orderBook/L2', 'kline/list', 'tickers', 'trading-records', 'symbols', 'liq-records', 'mark-price-kline', 'index-price-kline', 'premium-index-kline', 'open-interest', 'big-deal', 'account-ratio', 'time', 'announcement', ], }, 'private': { 'get': [ 'order/list', 'order', 'stop-order/list', 'stop-order', 'position/list', 'execution/list', 'trade/closed-pnl/list', 'funding/prev-funding-rate', 'funding/prev-funding', 'funding/predicted-funding', 'account/api-key', 'account/lcp', 'wallet/balance', 'wallet/fund/records', 'wallet/withdraw/list', 'exchange-order/list', ], 'post': [ 'order/create', 'order/cancel', 'order/cancelAll', 'order/replace', 'stop-order/create', 'stop-order/cancel', 'stop-order/cancelAll', 'stop-order/replace', 'position/change-position-margin', 'position/trading-stop', 'position/leverage/save', ], }, }, 'public': { 'linear': { 'get': [ 'kline', 'recent-trading-records', 'funding/prev-funding-rate', 'mark-price-kline', 'index-price-kline', 'premium-index-kline', 'risk-limit', ], }, }, 'private': { 'linear': { 'get': [ 'order/list', 'order/search', 'stop-order/list', 'stop-order/search', 'position/list', 'trade/execution/list', 'trade/closed-pnl/list', 'funding/predicted-funding', 'funding/prev-funding', ], 'post': [ 'order/create', 'order/cancel', 'order/cancel-all', 'order/replace', 'stop-order/create', 'stop-order/cancel', 'stop-order/cancel-all', 'stop-order/replace', 'position/set-auto-add-margin', 'position/switch-isolated', 'tpsl/switch-mode', 'position/add-margin', 'position/set-leverage', 'position/trading-stop', ], }, }, 'openapi': { 'wallet': { 'get': [ 'risk-limit/list', ], 'post': [ 'risk-limit', ], }, }, }, 'httpExceptions': { '403': RateLimitExceeded, }, 'exceptions': { 'exact': { '10001': BadRequest, '10002': InvalidNonce, '10003': AuthenticationError, '10004': AuthenticationError, '10005': PermissionDenied, '10006': RateLimitExceeded, '10007': AuthenticationError, '10010': PermissionDenied, '10017': BadRequest, '20001': OrderNotFound, '20003': InvalidOrder, '20004': InvalidOrder, '20005': InvalidOrder, '20006': InvalidOrder, '20007': InvalidOrder, '20008': InvalidOrder, '20009': InvalidOrder, '20010': InvalidOrder, '20011': InvalidOrder, '20012': InvalidOrder, '20013': InvalidOrder, '20014': InvalidOrder, '20015': InvalidOrder, '20016': InvalidOrder, '20017': InvalidOrder, '20018': InvalidOrder, '20019': InvalidOrder, '20020': InvalidOrder, '20021': InvalidOrder, '20022': BadRequest, '20023': BadRequest, '20031': BadRequest, '20070': BadRequest, '20071': BadRequest, '20084': BadRequest, '30001': BadRequest, '30003': InvalidOrder, '30004': InvalidOrder, '30005': InvalidOrder, '30007': InvalidOrder, '30008': InvalidOrder, '30009': ExchangeError, '30010': InsufficientFunds, '30011': PermissionDenied, '30012': PermissionDenied, '30013': PermissionDenied, '30014': InvalidOrder, '30015': InvalidOrder, '30016': ExchangeError, '30017': InvalidOrder, '30018': InvalidOrder, '30019': InvalidOrder, '30020': InvalidOrder, '30021': InvalidOrder, '30022': InvalidOrder, '30023': InvalidOrder, '30024': InvalidOrder, '30025': InvalidOrder, '30026': InvalidOrder, '30027': InvalidOrder, '30028': InvalidOrder, '30029': InvalidOrder, '30030': InvalidOrder, '30031': InsufficientFunds, '30032': InvalidOrder, '30033': RateLimitExceeded, '30034': OrderNotFound, '30035': RateLimitExceeded, '30036': ExchangeError, '30037': InvalidOrder, '30041': ExchangeError, '30042': InsufficientFunds, '30043': PermissionDenied, '30044': PermissionDenied, '30045': PermissionDenied, '30049': InsufficientFunds, '30050': ExchangeError, '30051': ExchangeError, '30052': ExchangeError, '30054': ExchangeError, '30057': ExchangeError, '30063': ExchangeError, '30067': InsufficientFunds, '30068': ExchangeError, '34026': ExchangeError, }, 'broad': { 'unknown orderInfo': OrderNotFound, 'invalid api_key': AuthenticationError, }, }, 'precisionMode': TICK_SIZE, 'options': { 'marketTypes': { 'BTC/USDT': 'linear', 'BCH/USDT': 'linear', 'ETH/USDT': 'linear', 'LTC/USDT': 'linear', 'XTZ/USDT': 'linear', 'LINK/USDT': 'linear', 'ADA/USDT': 'linear', 'DOT/USDT': 'linear', 'UNI/USDT': 'linear', }, 'defaultType': 'linear', 'code': 'BTC', 'cancelAllOrders': { 'recvWindow': 5 * 1000, 'timeDifference': 0, 'adjustForTimeDifference': False, }, 'fees': { 'trading': { 'tierBased': False, 'percentage': True, 'taker': 0.00075, 'maker': -0.00025, }, 'funding': { 'tierBased': False, 'percentage': False, 'withdraw': {}, 'deposit': {}, }, }, }) def nonce(self): return self.milliseconds() - self.options['timeDifference'] async def load_time_difference(self, params={}): serverTime = await self.fetch_time(params) after = self.milliseconds() self.options['timeDifference'] = after - serverTime return self.options['timeDifference'] async def fetch_time(self, params={}): response = await self.v2PublicGetTime(params) return self.safe_timestamp(response, 'time_now') async def fetch_markets(self, params={}): if self.options['adjustForTimeDifference']: await self.load_time_difference() response = await self.v2PublicGetSymbols(params) markets = self.safe_value(response, 'result', []) options = self.safe_value(self.options, 'fetchMarkets', {}) linearQuoteCurrencies = self.safe_value(options, 'linear', {'USDT': True}) result = [] for i in range(0, len(markets)): market = markets[i] id = self.safe_string_2(market, 'name', 'symbol') baseId = self.safe_string(market, 'base_currency') quoteId = self.safe_string(market, 'quote_currency') base = self.safe_currency_code(baseId) quote = self.safe_currency_code(quoteId) linear = (quote in linearQuoteCurrencies) inverse = not linear symbol = base + '/' + quote baseQuote = base + quote if baseQuote != id: symbol = id lotSizeFilter = self.safe_value(market, 'lot_size_filter', {}) priceFilter = self.safe_value(market, 'price_filter', {}) precision = { 'amount': self.safe_number(lotSizeFilter, 'qty_step'), 'price': self.safe_number(priceFilter, 'tick_size'), } status = self.safe_string(market, 'status') active = None if status is not None: active = (status == 'Trading') result.append({ 'id': id, 'symbol': symbol, 'base': base, 'quote': quote, 'active': active, 'precision': precision, 'taker': self.safe_number(market, 'taker_fee'), 'maker': self.safe_number(market, 'maker_fee'), 'type': 'future', 'spot': False, 'future': True, 'option': False, 'linear': linear, 'inverse': inverse, 'limits': { 'amount': { 'min': self.safe_number(lotSizeFilter, 'min_trading_qty'), 'max': self.safe_number(lotSizeFilter, 'max_trading_qty'), }, 'price': { 'min': self.safe_number(priceFilter, 'min_price'), 'max': self.safe_number(priceFilter, 'max_price'), }, 'cost': { 'min': None, 'max': None, }, }, 'info': market, }) return result def parse_ticker(self, ticker, market=None): timestamp = None marketId = self.safe_string(ticker, 'symbol') symbol = self.safe_symbol(marketId, market) last = self.safe_number(ticker, 'last_price') open = self.safe_number(ticker, 'prev_price_24h') percentage = self.safe_number(ticker, 'price_24h_pcnt') if percentage is not None: percentage *= 100 change = None average = None if (last is not None) and (open is not None): change = last - open average = self.sum(open, last) / 2 baseVolume = self.safe_number(ticker, 'turnover_24h') quoteVolume = self.safe_number(ticker, 'volume_24h') vwap = self.vwap(baseVolume, quoteVolume) return { 'symbol': symbol, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'high': self.safe_number(ticker, 'high_price_24h'), 'low': self.safe_number(ticker, 'low_price_24h'), 'bid': self.safe_number(ticker, 'bid_price'), 'bidVolume': None, 'ask': self.safe_number(ticker, 'ask_price'), 'askVolume': None, 'vwap': vwap, 'open': open, 'close': last, 'last': last, 'previousClose': None, 'change': change, 'percentage': percentage, 'average': average, 'baseVolume': baseVolume, 'quoteVolume': quoteVolume, 'info': ticker, } async def fetch_ticker(self, symbol, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], } response = await self.v2PublicGetTickers(self.extend(request, params)) result = self.safe_value(response, 'result', []) first = self.safe_value(result, 0) timestamp = self.safe_timestamp(response, 'time_now') ticker = self.parse_ticker(first, market) ticker['timestamp'] = timestamp ticker['datetime'] = self.iso8601(timestamp) return ticker async def fetch_tickers(self, symbols=None, params={}): await self.load_markets() response = await self.v2PublicGetTickers(params) result = self.safe_value(response, 'result', []) tickers = {} for i in range(0, len(result)): ticker = self.parse_ticker(result[i]) symbol = ticker['symbol'] tickers[symbol] = ticker return self.filter_by_array(tickers, 'symbol', symbols) def parse_ohlcv(self, ohlcv, market=None): return [ self.safe_timestamp_2(ohlcv, 'open_time', 'start_at'), self.safe_number(ohlcv, 'open'), self.safe_number(ohlcv, 'high'), self.safe_number(ohlcv, 'low'), self.safe_number(ohlcv, 'close'), self.safe_number_2(ohlcv, 'turnover', 'volume'), ] async def fetch_ohlcv(self, symbol, timeframe='1m', since=None, limit=None, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], 'interval': self.timeframes[timeframe], } duration = self.parse_timeframe(timeframe) now = self.seconds() if since is None: if limit is None: raise ArgumentsRequired(self.id + ' fetchOHLCV() requires a since argument or a limit argument') else: request['from'] = now - limit * duration else: request['from'] = int(since / 1000) if limit is not None: request['limit'] = limit marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'publicLinearGetKline' if (marketType == 'linear') else 'v2PublicGetKlineList' response = await getattr(self, method)(self.extend(request, params)) result = self.safe_value(response, 'result', {}) return self.parse_ohlcvs(result, market, timeframe, since, limit) def parse_trade(self, trade, market=None): id = self.safe_string_2(trade, 'id', 'exec_id') marketId = self.safe_string(trade, 'symbol') market = self.safe_market(marketId, market) symbol = market['symbol'] amountString = self.safe_string_2(trade, 'qty', 'exec_qty') priceString = self.safe_string_2(trade, 'exec_price', 'price') cost = self.safe_number(trade, 'exec_value') amount = self.parse_number(amountString) price = self.parse_number(priceString) if cost is None: cost = self.parse_number(Precise.string_mul(priceString, amountString)) timestamp = self.parse8601(self.safe_string(trade, 'time')) if timestamp is None: timestamp = self.safe_integer(trade, 'trade_time_ms') side = self.safe_string_lower(trade, 'side') lastLiquidityInd = self.safe_string(trade, 'last_liquidity_ind') takerOrMaker = 'maker' if (lastLiquidityInd == 'AddedLiquidity') else 'taker' feeCost = self.safe_number(trade, 'exec_fee') fee = None if feeCost is not None: feeCurrencyCode = market['base'] if market['inverse'] else market['quote'] fee = { 'cost': feeCost, 'currency': feeCurrencyCode, 'rate': self.safe_number(trade, 'fee_rate'), } return { 'id': id, 'info': trade, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'symbol': symbol, 'order': self.safe_string(trade, 'order_id'), 'type': self.safe_string_lower(trade, 'order_type'), 'side': side, 'takerOrMaker': takerOrMaker, 'price': price, 'amount': amount, 'cost': cost, 'fee': fee, } async def fetch_trades(self, symbol, since=None, limit=None, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], } if limit is not None: request['count'] = limit marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'publicLinearGetRecentTradingRecords' if (marketType == 'linear') else 'v2PublicGetTradingRecords' response = await getattr(self, method)(self.extend(request, params)) result = self.safe_value(response, 'result', {}) return self.parse_trades(result, market, since, limit) def parse_order_book(self, orderbook, timestamp=None, bidsKey='Buy', asksKey='Sell', priceKey='price', amountKey='size'): bids = [] asks = [] for i in range(0, len(orderbook)): bidask = orderbook[i] side = self.safe_string(bidask, 'side') if side == 'Buy': bids.append(self.parse_bid_ask(bidask, priceKey, amountKey)) elif side == 'Sell': asks.append(self.parse_bid_ask(bidask, priceKey, amountKey)) else: raise ExchangeError(self.id + ' parseOrderBook encountered an unrecognized bidask format: ' + self.json(bidask)) return { 'bids': self.sort_by(bids, 0, True), 'asks': self.sort_by(asks, 0), 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'nonce': None, } async def fetch_order_book(self, symbol, limit=None, params={}): await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], } response = await self.v2PublicGetOrderBookL2(self.extend(request, params)) result = self.safe_value(response, 'result', []) timestamp = self.safe_timestamp(response, 'time_now') return self.parse_order_book(result, timestamp, 'Buy', 'Sell', 'price', 'size') async def fetch_balance(self, params={}): await self.load_markets() request = {} coin = self.safe_string(params, 'coin') code = self.safe_string(params, 'code') if coin is not None: request['coin'] = coin elif code is not None: currency = self.currency(code) request['coin'] = currency['id'] response = await self.v2PrivateGetWalletBalance(self.extend(request, params)) result = { 'info': response, } balances = self.safe_value(response, 'result', {}) currencyIds = list(balances.keys()) for i in range(0, len(currencyIds)): currencyId = currencyIds[i] balance = balances[currencyId] code = self.safe_currency_code(currencyId) account = self.account() account['free'] = self.safe_string(balance, 'available_balance') account['used'] = self.safe_string(balance, 'used_margin') account['total'] = self.safe_string(balance, 'equity') result[code] = account return self.parse_balance(result, False) def parse_order_status(self, status): statuses = { 'Created': 'open', 'Rejected': 'rejected', 'New': 'open', 'PartiallyFilled': 'open', 'Filled': 'closed', 'Cancelled': 'canceled', 'PendingCancel': 'canceling', 'Active': 'open', 'Untriggered': 'open', 'Triggered': 'closed', } return self.safe_string(statuses, status, status) def parse_time_in_force(self, timeInForce): timeInForces = { 'GoodTillCancel': 'GTC', 'ImmediateOrCancel': 'IOC', 'FillOrKill': 'FOK', 'PostOnly': 'PO', } return self.safe_string(timeInForces, timeInForce, timeInForce) def parse_order(self, order, market=None): reated_at": "2019-11-30T11:03:43.452Z", # "updated_at": "2019-11-30T11:03:43.455Z" # } # # fetchOrder # # { # "user_id" : 599946, # "symbol" : "BTCUSD", # "side" : "Buy", # "order_type" : "Limit", # "price" : "7948", # "qty" : 10, # "time_in_force" : "GoodTillCancel", # "order_status" : "Filled", # "ext_fields" : { # "o_req_num" : -1600687220498, # "xreq_type" : "x_create" # }, # "last_exec_time" : "1588150113.968422", # "last_exec_price" : "7948", # "leaves_qty" : 0, # "leaves_value" : "0", # "cum_exec_qty" : 10, # "cum_exec_value" : "0.00125817", # "cum_exec_fee" : "-0.00000031", # "reject_reason" : "", # "cancel_type" : "", # "order_link_id" : "", # "created_at" : "2020-04-29T08:45:24.399146Z", # "updated_at" : "2020-04-29T08:48:33.968422Z", # "order_id" : "dd2504b9-0157-406a-99e1-efa522373944" # } # # conditional order # # { # "user_id":##, # "symbol":"BTCUSD", # "side":"Buy", # "order_type":"Market", # "price":0, # "qty":10, # "time_in_force":"GoodTillCancel", # "stop_order_type":"Stop", # "trigger_by":"LastPrice", # "base_price":11833, # "order_status":"Untriggered", # "ext_fields":{ # "stop_order_type":"Stop", # "trigger_by":"LastPrice", # "base_price":11833, # "expected_direction":"Rising", # "trigger_price":12400, # "close_on_trigger":true, # "op_from":"api", # "remark":"145.53.159.48", # "o_req_num":0 # }, # "leaves_qty":10, # "leaves_value":0.00080645, # "reject_reason":null, # "cross_seq":-1, # "created_at":"2020-08-21T09:18:48.000Z", # "updated_at":"2020-08-21T09:18:48.000Z", # "stop_px":12400, # "stop_order_id":"3f3b54b1-3379-42c7-8510-44f4d9915be0" # } # marketId = self.safe_string(order, 'symbol') market = self.safe_market(marketId, market) symbol = market['symbol'] feeCurrency = None timestamp = self.parse8601(self.safe_string(order, 'created_at')) id = self.safe_string_2(order, 'order_id', 'stop_order_id') type = self.safe_string_lower(order, 'order_type') price = self.safe_number(order, 'price') if price == 0.0: price = None average = self.safe_number(order, 'average_price') amount = self.safe_number(order, 'qty') cost = self.safe_number(order, 'cum_exec_value') filled = self.safe_number(order, 'cum_exec_qty') remaining = self.safe_number(order, 'leaves_qty') marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) if market is not None: if marketType == 'linear': feeCurrency = market['quote'] else: feeCurrency = market['base'] lastTradeTimestamp = self.safe_timestamp(order, 'last_exec_time') if lastTradeTimestamp == 0: lastTradeTimestamp = None status = self.parse_order_status(self.safe_string_2(order, 'order_status', 'stop_order_status')) side = self.safe_string_lower(order, 'side') feeCost = self.safe_number(order, 'cum_exec_fee') fee = None if feeCost is not None: feeCost = abs(feeCost) fee = { 'cost': feeCost, 'currency': feeCurrency, } clientOrderId = self.safe_string(order, 'order_link_id') if (clientOrderId is not None) and (len(clientOrderId) < 1): clientOrderId = None timeInForce = self.parse_time_in_force(self.safe_string(order, 'time_in_force')) stopPrice = self.safe_number(order, 'stop_px') postOnly = (timeInForce == 'PO') return self.safe_order({ 'info': order, 'id': id, 'clientOrderId': clientOrderId, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'lastTradeTimestamp': lastTradeTimestamp, 'symbol': symbol, 'type': type, 'timeInForce': timeInForce, 'postOnly': postOnly, 'side': side, 'price': price, 'stopPrice': stopPrice, 'amount': amount, 'cost': cost, 'average': average, 'filled': filled, 'remaining': remaining, 'status': status, 'fee': fee, 'trades': None, }) async def fetch_order(self, id, symbol=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' fetchOrder() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], # 'order_link_id': 'string', # one of order_id, stop_order_id or order_link_id is required # regular orders --------------------------------------------- # 'order_id': id, # one of order_id or order_link_id is required for regular orders # conditional orders --------------------------------------------- # 'stop_order_id': id, # one of stop_order_id or order_link_id is required for conditional orders } marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'privateLinearGetOrderSearch' if (marketType == 'linear') else 'v2PrivateGetOrder' stopOrderId = self.safe_string(params, 'stop_order_id') if stopOrderId is None: orderLinkId = self.safe_string(params, 'order_link_id') if orderLinkId is None: request['order_id'] = id else: method = 'privateLinearGetStopOrderSearch' if (marketType == 'linear') else 'v2PrivateGetStopOrder' response = await getattr(self, method)(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "OK", # "ext_code": "", # "ext_info": "", # "result": { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Sell", # "order_type": "Limit", # "price": "8083", # "qty": 10, # "time_in_force": "GoodTillCancel", # "order_status": "New", # "ext_fields": {"o_req_num": -308787, "xreq_type": "x_create", "xreq_offset": 4154640}, # "leaves_qty": 10, # "leaves_value": "0.00123716", # "cum_exec_qty": 0, # "reject_reason": "", # "order_link_id": "", # "created_at": "2019-10-21T07:28:19.396246Z", # "updated_at": "2019-10-21T07:28:19.396246Z", # "order_id": "efa44157-c355-4a98-b6d6-1d846a936b93" # }, # "time_now": "1571651135.291930", # "rate_limit_status": 99, # The remaining number of accesses in one minute # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "OK", # "ext_code": "", # "ext_info": "", # "result": { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": "8000", # "qty": 1, # "time_in_force": "GoodTillCancel", # "order_status": "Untriggered", # "ext_fields": {}, # "leaves_qty": 1, # "leaves_value": "0.00013333", # "cum_exec_qty": 0, # "cum_exec_value": null, # "cum_exec_fee": null, # "reject_reason": "", # "order_link_id": "", # "created_at": "2019-12-27T19:56:24.052194Z", # "updated_at": "2019-12-27T19:56:24.052194Z", # "order_id": "378a1bbc-a93a-4e75-87f4-502ea754ba36" # }, # "time_now": "1577476584.386958", # "rate_limit_status": 99, # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # result = self.safe_value(response, 'result') return self.parse_order(result, market) async def create_order(self, symbol, type, side, amount, price=None, params={}): await self.load_markets() market = self.market(symbol) qty = self.amount_to_precision(symbol, amount) if market['inverse']: qty = int(qty) else: qty = float(qty) request = { # orders --------------------------------------------------------- 'side': self.capitalize(side), 'symbol': market['id'], 'order_type': self.capitalize(type), 'qty': qty, # order quantity in USD, integer only # 'price': float(self.price_to_precision(symbol, price)), # required for limit orders 'time_in_force': 'GoodTillCancel', # ImmediateOrCancel, FillOrKill, PostOnly # 'take_profit': 123.45, # take profit price, only take effect upon opening the position # 'stop_loss': 123.45, # stop loss price, only take effect upon opening the position # 'reduce_only': False, # reduce only, required for linear orders # when creating a closing order, bybit recommends a True value for # close_on_trigger to avoid failing due to insufficient available margin # 'close_on_trigger': False, required for linear orders # 'order_link_id': 'string', # unique client order id, max 36 characters # conditional orders --------------------------------------------- # base_price is used to compare with the value of stop_px, to decide # whether your conditional order will be triggered by crossing trigger # price from upper side or lower side, mainly used to identify the # expected direction of the current conditional order # 'base_price': 123.45, # required for conditional orders # 'stop_px': 123.45, # trigger price, required for conditional orders # 'trigger_by': 'LastPrice', # IndexPrice, MarkPrice } priceIsRequired = False if type == 'limit': priceIsRequired = True if priceIsRequired: if price is not None: request['price'] = float(self.price_to_precision(symbol, price)) else: raise ArgumentsRequired(self.id + ' createOrder() requires a price argument for a ' + type + ' order') clientOrderId = self.safe_string_2(params, 'order_link_id', 'clientOrderId') if clientOrderId is not None: request['order_link_id'] = clientOrderId params = self.omit(params, ['order_link_id', 'clientOrderId']) stopPx = self.safe_value_2(params, 'stop_px', 'stopPrice') basePrice = self.safe_value(params, 'base_price') marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'privateLinearPostOrderCreate' if (marketType == 'linear') else 'v2PrivatePostOrderCreate' if marketType == 'linear': method = 'privateLinearPostOrderCreate' request['reduce_only'] = False request['close_on_trigger'] = False if stopPx is not None: if basePrice is None: raise ArgumentsRequired(self.id + ' createOrder() requires both the stop_px and base_price params for a conditional ' + type + ' order') else: method = 'privateLinearPostStopOrderCreate' if (marketType == 'linear') else 'v2PrivatePostStopOrderCreate' request['stop_px'] = float(self.price_to_precision(symbol, stopPx)) request['base_price'] = float(self.price_to_precision(symbol, basePrice)) params = self.omit(params, ['stop_px', 'stopPrice', 'base_price']) elif basePrice is not None: raise ArgumentsRequired(self.id + ' createOrder() requires both the stop_px and base_price params for a conditional ' + type + ' order') response = await getattr(self, method)(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "OK", # "ext_code": "", # "ext_info": "", # "result": { # "user_id": 1, # "order_id": "335fd977-e5a5-4781-b6d0-c772d5bfb95b", # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": 8800, # "qty": 1, # "time_in_force": "GoodTillCancel", # "order_status": "Created", # "last_exec_time": 0, # "last_exec_price": 0, # "leaves_qty": 1, # "cum_exec_qty": 0, # "cum_exec_value": 0, # "cum_exec_fee": 0, # "reject_reason": "", # "order_link_id": "", # "created_at": "2019-11-30T11:03:43.452Z", # "updated_at": "2019-11-30T11:03:43.455Z" # }, # "time_now": "1575111823.458705", # "rate_limit_status": 98, # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": 8000, # "qty": 1, # "time_in_force": "GoodTillCancel", # "stop_order_type": "Stop", # "trigger_by": "LastPrice", # "base_price": 7000, # "order_status": "Untriggered", # "ext_fields": { # "stop_order_type": "Stop", # "trigger_by": "LastPrice", # "base_price": 7000, # "expected_direction": "Rising", # "trigger_price": 7500, # "op_from": "api", # "remark": "127.0.01", # "o_req_num": 0 # }, # "leaves_qty": 1, # "leaves_value": 0.00013333, # "reject_reason": null, # "cross_seq": -1, # "created_at": "2019-12-27T12:48:24.000Z", # "updated_at": "2019-12-27T12:48:24.000Z", # "stop_px": 7500, # "stop_order_id": "a85cd1c0-a9a4-49d3-a1bd-bab5ebe946d5" # }, # "ext_info": null, # "time_now": "1577450904.327654", # "rate_limit_status": 99, # "rate_limit_reset_ms": 1577450904335, # "rate_limit": "100" # } # result = self.safe_value(response, 'result') return self.parse_order(result, market) async def edit_order(self, id, symbol, type, side, amount=None, price=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' editOrder() requires an symbol argument') marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) await self.load_markets() market = self.market(symbol) request = { # 'order_id': id, # only for non-conditional orders 'symbol': market['id'], # 'p_r_qty': self.amount_to_precision(symbol, amount), # new order quantity, optional # 'p_r_price' self.priceToprecision(symbol, price), # new order price, optional # ---------------------------------------------------------------- # conditional orders # 'stop_order_id': id, # only for conditional orders # 'p_r_trigger_price': 123.45, # new trigger price also known as stop_px } method = 'privateLinearPostOrderReplace' if (marketType == 'linear') else 'v2PrivatePostOrderReplace' stopOrderId = self.safe_string(params, 'stop_order_id') if stopOrderId is not None: method = 'privateLinearPostStopOrderReplace' if (marketType == 'linear') else 'v2PrivatePostStopOrderReplace' request['stop_order_id'] = stopOrderId params = self.omit(params, ['stop_order_id']) else: request['order_id'] = id if amount is not None: qty = self.amount_to_precision(symbol, amount) if market['inverse']: qty = int(qty) else: qty = float(qty) request['p_r_qty'] = qty if price is not None: request['p_r_price'] = float(self.price_to_precision(symbol, price)) response = await getattr(self, method)(self.extend(request, params)) # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": {"order_id": "efa44157-c355-4a98-b6d6-1d846a936b93"}, # "time_now": "1539778407.210858", # "rate_limit_status": 99, # remaining number of accesses in one minute # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": {"stop_order_id": "378a1bbc-a93a-4e75-87f4-502ea754ba36"}, # "ext_info": null, # "time_now": "1577475760.604942", # "rate_limit_status": 96, # "rate_limit_reset_ms": 1577475760612, # "rate_limit": "100" # } # result = self.safe_value(response, 'result', {}) return { 'info': response, 'id': self.safe_string_2(result, 'order_id', 'stop_order_id'), 'order_id': self.safe_string(result, 'order_id'), 'stop_order_id': self.safe_string(result, 'stop_order_id'), } async def cancel_order(self, id, symbol=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' cancelOrder() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], # 'order_link_id': 'string', # one of order_id, stop_order_id or order_link_id is required # regular orders --------------------------------------------- # 'order_id': id, # one of order_id or order_link_id is required for regular orders # conditional orders --------------------------------------------- # 'stop_order_id': id, # one of stop_order_id or order_link_id is required for conditional orders } marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_value(marketTypes, symbol) method = 'privateLinearPostOrderCancel' if (marketType == 'linear') else 'v2PrivatePostOrderCancel' stopOrderId = self.safe_string(params, 'stop_order_id') if stopOrderId is None: orderLinkId = self.safe_string(params, 'order_link_id') if orderLinkId is None: request['order_id'] = id else: method = 'privateLinearPostStopOrderCancel' if (marketType == 'linear') else 'v2PrivatePostStopOrderCancel' response = await getattr(self, method)(self.extend(request, params)) result = self.safe_value(response, 'result', {}) return self.parse_order(result, market) async def cancel_all_orders(self, symbol=None, params={}): if symbol is None: raise ArgumentsRequired(self.id + ' cancelAllOrders() requires a symbol argument') await self.load_markets() market = self.market(symbol) request = { 'symbol': market['id'], } options = self.safe_value(self.options, 'cancelAllOrders', {}) marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) defaultMethod = 'privateLinearPostOrderCancelAll' if (marketType == 'linear') else 'v2PrivatePostOrderCancelAll' method = self.safe_string(options, 'method', defaultMethod) response = await getattr(self, method)(self.extend(request, params)) result = self.safe_value(response, 'result', []) return self.parse_orders(result, market) async def fetch_orders(self, symbol=None, since=None, limit=None, params={}): await self.load_markets() request = { # 'order_id': 'string' # 'order_link_id': 'string', # unique client order id, max 36 characters # 'symbol': market['id'], # default BTCUSD # 'order': 'desc', # asc # 'page': 1, # 'limit': 20, # max 50 # 'order_status': 'Created,New' # conditional orders --------------------------------------------- # 'stop_order_id': 'string', # 'stop_order_status': 'Untriggered', } market = None if symbol is not None: market = self.market(symbol) request['symbol'] = market['id'] if limit is not None: request['limit'] = limit options = self.safe_value(self.options, 'fetchOrders', {}) marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) defaultMethod = 'privateLinearGetOrderList' if (marketType == 'linear') else 'v2PrivateGetOrderList' query = params if ('stop_order_id' in params) or ('stop_order_status' in params): stopOrderStatus = self.safe_value(params, 'stopOrderStatus') if stopOrderStatus is not None: if isinstance(stopOrderStatus, list): stopOrderStatus = ','.join(stopOrderStatus) request['stop_order_status'] = stopOrderStatus query = self.omit(params, 'stop_order_status') defaultMethod = 'privateLinearGetStopOrderList' if (marketType == 'linear') else 'v2PrivateGetStopOrderList' method = self.safe_string(options, 'method', defaultMethod) response = await getattr(self, method)(self.extend(request, query)) # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "current_page": 1, # "last_page": 6, # "data": [ # { # "user_id": 1, # "symbol": "BTCUSD", # "side": "Sell", # "order_type": "Market", # "price": 7074, # "qty": 2, # "time_in_force": "ImmediateOrCancel", # "order_status": "Filled", # "ext_fields": { # "close_on_trigger": True, # "orig_order_type": "BLimit", # "prior_x_req_price": 5898.5, # "op_from": "pc", # "remark": "127.0.0.1", # "o_req_num": -34799032763, # "xreq_type": "x_create" # }, # "last_exec_time": "1577448481.696421", # "last_exec_price": 7070.5, # "leaves_qty": 0, # "leaves_value": 0, # "cum_exec_qty": 2, # "cum_exec_value": 0.00028283, # "cum_exec_fee": 0.00002, # "reject_reason": "NoError", # "order_link_id": "", # "created_at": "2019-12-27T12:08:01.000Z", # "updated_at": "2019-12-27T12:08:01.000Z", # "order_id": "f185806b-b801-40ff-adec-52289370ed62" # } # ] # }, # "ext_info": null, # "time_now": "1577448922.437871", # "rate_limit_status": 98, # "rate_limit_reset_ms": 1580885703683, # "rate_limit": 100 # } # # conditional orders # # { # "ret_code": 0, # "ret_msg": "ok", # "ext_code": "", # "result": { # "current_page": 1, # "last_page": 1, # "data": [ # { # "user_id": 1, # "stop_order_status": "Untriggered", # "symbol": "BTCUSD", # "side": "Buy", # "order_type": "Limit", # "price": 8000, # "qty": 1, # "time_in_force": "GoodTillCancel", # "stop_order_type": "Stop", # "trigger_by": "LastPrice", # "base_price": 7000, # "order_link_id": "", # "created_at": "2019-12-27T12:48:24.000Z", # "updated_at": "2019-12-27T12:48:24.000Z", # "stop_px": 7500, # "stop_order_id": "a85cd1c0-a9a4-49d3-a1bd-bab5ebe946d5" # }, # ] # }, # "ext_info": null, # "time_now": "1577451658.755468", # "rate_limit_status": 599, # "rate_limit_reset_ms": 1577451658762, # "rate_limit": 600 # } # result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_orders(data, market, since, limit) async def fetch_closed_orders(self, symbol=None, since=None, limit=None, params={}): defaultStatuses = [ 'Rejected', 'Filled', 'Cancelled', # conditional orders # 'Active', # 'Triggered', # 'Cancelled', # 'Rejected', # 'Deactivated', ] options = self.safe_value(self.options, 'fetchClosedOrders', {}) status = self.safe_value(options, 'order_status', defaultStatuses) if isinstance(status, list): status = ','.join(status) request = {} stopOrderStatus = self.safe_value(params, 'stop_order_status') if stopOrderStatus is None: request['order_status'] = status else: request['stop_order_status'] = stopOrderStatus return await self.fetch_orders(symbol, since, limit, self.extend(request, params)) async def fetch_open_orders(self, symbol=None, since=None, limit=None, params={}): defaultStatuses = [ 'Created', 'New', 'PartiallyFilled', 'PendingCancel', # conditional orders # 'Untriggered', ] options = self.safe_value(self.options, 'fetchOpenOrders', {}) status = self.safe_value(options, 'order_status', defaultStatuses) if isinstance(status, list): status = ','.join(status) request = {} stopOrderStatus = self.safe_value(params, 'stop_order_status') if stopOrderStatus is None: request['order_status'] = status else: request['stop_order_status'] = stopOrderStatus return await self.fetch_orders(symbol, since, limit, self.extend(request, params)) async def fetch_order_trades(self, id, symbol=None, since=None, limit=None, params={}): request = { 'order_id': id, } return await self.fetch_my_trades(symbol, since, limit, self.extend(request, params)) async def fetch_my_trades(self, symbol=None, since=None, limit=None, params={}): await self.load_markets() request = { # 'order_id': 'f185806b-b801-40ff-adec-52289370ed62', # if not provided will return user's trading records } market = None if symbol is None: orderId = self.safe_string(params, 'order_id') if orderId is None: raise ArgumentsRequired(self.id + ' fetchMyTrades() requires a symbol argument or an order_id param') else: request['order_id'] = orderId params = self.omit(params, 'order_id') else: market = self.market(symbol) request['symbol'] = market['id'] if since is not None: request['start_time'] = since if limit is not None: request['limit'] = limit marketTypes = self.safe_value(self.options, 'marketTypes', {}) marketType = self.safe_string(marketTypes, symbol) method = 'privateLinearGetTradeExecutionList' if (marketType == 'linear') else 'v2PrivateGetExecutionList' response = await getattr(self, method)(self.extend(request, params)) result = self.safe_value(response, 'result', {}) trades = self.safe_value_2(result, 'trade_list', 'data', []) return self.parse_trades(trades, market, since, limit) async def fetch_deposits(self, code=None, since=None, limit=None, params={}): await self.load_markets() request = { 'wallet_fund_type': 'Deposit', } currency = None if code is not None: currency = self.currency(code) request['coin'] = currency['id'] if since is not None: request['start_date'] = self.ymd(since) if limit is not None: request['limit'] = limit response = await self.v2PrivateGetWalletFundRecords(self.extend(request, params)) result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_transactions(data, currency, since, limit) async def fetch_withdrawals(self, code=None, since=None, limit=None, params={}): await self.load_markets() request = { None: currency = self.currency(code) request['coin'] = currency['id'] if since is not None: request['start_date'] = self.ymd(since) if limit is not None: request['limit'] = limit response = await self.v2PrivateGetWalletWithdrawList(self.extend(request, params)) result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_transactions(data, currency, since, limit, params) def parse_transaction_status(self, status): statuses = { 'ToBeConfirmed': 'pending', 'UnderReview': 'pending', 'Pending': 'pending', 'Success': 'ok', 'CancelByUser': 'canceled', 'Reject': 'rejected', 'Expire': 'expired', } return self.safe_string(statuses, status, status) def parse_transaction(self, transaction, currency=None): currencyId = self.safe_string(transaction, 'coin') code = self.safe_currency_code(currencyId, currency) timestamp = self.parse8601(self.safe_string_2(transaction, 'submited_at', 'exec_time')) updated = self.parse8601(self.safe_string(transaction, 'updated_at')) status = self.parse_transaction_status(self.safe_string(transaction, 'status')) address = self.safe_string(transaction, 'address') feeCost = self.safe_number(transaction, 'fee') type = self.safe_string_lower(transaction, 'type') fee = None if feeCost is not None: fee = { 'cost': feeCost, 'currency': code, } return { 'info': transaction, 'id': self.safe_string(transaction, 'id'), 'txid': self.safe_string(transaction, 'tx_id'), 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'address': address, 'addressTo': None, 'addressFrom': None, 'tag': None, 'tagTo': None, 'tagFrom': None, 'type': type, 'amount': self.safe_number(transaction, 'amount'), 'currency': code, 'status': status, 'updated': updated, 'fee': fee, } async def fetch_ledger(self, code=None, since=None, limit=None, params={}): await self.load_markets() request = { urrency = self.currency(code) request['coin'] = currency['id'] if since is not None: request['start_date'] = self.ymd(since) if limit is not None: request['limit'] = limit response = await self.v2PrivateGetWalletFundRecords(self.extend(request, params)) result = self.safe_value(response, 'result', {}) data = self.safe_value(result, 'data', []) return self.parse_ledger(data, currency, since, limit) def parse_ledger_entry(self, item, currency=None): currencyId = self.safe_string(item, 'coin') code = self.safe_currency_code(currencyId, currency) amount = self.safe_number(item, 'amount') after = self.safe_number(item, 'wallet_balance') direction = 'out' if (amount < 0) else 'in' before = None if after is not None and amount is not None: difference = amount if (direction == 'out') else -amount before = self.sum(after, difference) timestamp = self.parse8601(self.safe_string(item, 'exec_time')) type = self.parse_ledger_entry_type(self.safe_string(item, 'type')) id = self.safe_string(item, 'id') referenceId = self.safe_string(item, 'tx_id') return { 'id': id, 'currency': code, 'account': self.safe_string(item, 'wallet_id'), 'referenceAccount': None, 'referenceId': referenceId, 'status': None, 'amount': amount, 'before': before, 'after': after, 'fee': None, 'direction': direction, 'timestamp': timestamp, 'datetime': self.iso8601(timestamp), 'type': type, 'info': item, } def parse_ledger_entry_type(self, type): types = { 'Deposit': 'transaction', 'Withdraw': 'transaction', 'RealisedPNL': 'trade', 'Commission': 'fee', 'Refund': 'cashback', 'Prize': 'prize', 'ExchangeOrderWithdraw': 'transaction', 'ExchangeOrderDeposit': 'transaction', } return self.safe_string(types, type, type) def sign(self, path, api='public', method='GET', params={}, headers=None, body=None): url = self.implode_params(self.urls['api'], {'hostname': self.hostname}) type = self.safe_string(api, 0) section = self.safe_string(api, 1) request = '/' + type + '/' + section + '/' + path if section == 'public': if params: request += '?' + self.rawencode(params) elif type == 'public': if params: request += '?' + self.rawencode(params) else: self.check_required_credentials() timestamp = self.nonce() query = self.extend(params, { 'api_key': self.apiKey, 'recv_window': self.options['recvWindow'], 'timestamp': timestamp, }) sortedQuery = self.keysort(query) auth = self.rawencode(sortedQuery) signature = self.hmac(self.encode(auth), self.encode(self.secret)) if method == 'POST': body = self.json(self.extend(query, { 'sign': signature, })) headers = { 'Content-Type': 'application/json', } else: request += '?' + self.urlencode(sortedQuery) + '&sign=' + signature url += request return {'url': url, 'method': method, 'body': body, 'headers': headers} def handle_errors(self, httpCode, reason, url, method, headers, body, response, requestHeaders, requestBody): if not response: return errorCode = self.safe_string(response, 'ret_code') if errorCode != '0': feedback = self.id + ' ' + body self.throw_exactly_matched_exception(self.exceptions['exact'], errorCode, feedback) self.throw_broadly_matched_exception(self.exceptions['broad'], body, feedback) raise ExchangeError(feedback) async def fetch_positions(self, symbols=None, params={}): await self.load_markets() request = {} if isinstance(symbols, list): length = len(symbols) if length != 1: raise ArgumentsRequired(self.id + ' fetchPositions takes exactly one symbol') request['symbol'] = self.market_id(symbols[0]) defaultType = self.safe_string(self.options, 'defaultType', 'linear') type = self.safe_string(params, 'type', defaultType) params = self.omit(params, 'type') response = None if type == 'linear': response = await self.privateLinearGetPositionList(self.extend(request, params)) elif type == 'inverse': response = await self.v2PrivateGetPositionList(self.extend(request, params)) elif type == 'inverseFuture': response = await self.futuresPrivateGetPositionList(self.extend(request, params)) return self.safe_value(response, 'result')
true
true
1c45498823d147eda5f301807dd3845f13b71b1d
5,632
py
Python
tests/python/relax/test_expr.py
psrivas2/relax
4329af78eb1dc4c4ff8a61d3bf39aa4034e9cb2a
[ "Apache-2.0" ]
90
2021-11-30T11:58:10.000Z
2022-03-31T02:24:04.000Z
tests/python/relax/test_expr.py
psrivas2/relax
4329af78eb1dc4c4ff8a61d3bf39aa4034e9cb2a
[ "Apache-2.0" ]
64
2021-11-22T23:58:23.000Z
2022-03-31T03:19:22.000Z
tests/python/relax/test_expr.py
psrivas2/relax
4329af78eb1dc4c4ff8a61d3bf39aa4034e9cb2a
[ "Apache-2.0" ]
27
2021-12-09T22:39:27.000Z
2022-03-24T23:21:48.000Z
# Licensed to the Apache Software Foundation (ASF) under one # or more contributor license agreements. See the NOTICE file # distributed with this work for additional information # regarding copyright ownership. The ASF licenses this file # to you under the Apache License, Version 2.0 (the # "License"); you may not use this file except in compliance # with the License. You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, # software distributed under the License is distributed on an # "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY # KIND, either express or implied. See the License for the # specific language governing permissions and limitations # under the License. import pytest import tvm from tvm import tir from tvm import relax as rx import numpy as np def test_var() -> None: v0 = rx.Var("v0") assert v0.name_hint == "v0" assert v0.shape_ is None assert v0._checked_type_ is None shape_anno = [54, 96] type_anno = rx.DynTensorType(2, "float32") v1 = rx.Var("v1", shape_anno, type_anno) assert v1.name_hint == "v1" for s0, s1 in zip(v1.shape_, shape_anno): assert s0 == s1 assert v1._checked_type_ == type_anno def test_dataflow_var() -> None: v0 = rx.DataflowVar("v0") assert v0.name_hint == "v0" assert v0.shape_ is None assert v0._checked_type_ is None shape_anno = [54, 96] type_anno = rx.DynTensorType(2, "float16") v1 = rx.DataflowVar("v1", shape_anno, type_anno) assert v1.name_hint == "v1" for s0, s1 in zip(v1.shape_, shape_anno): assert s0 == s1 assert v1._checked_type_ == type_anno assert isinstance(v1, rx.DataflowVar) def test_match_shape() -> None: # match_shape([16, 8], [m, n]) m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") shape = rx.const([16, 8], "int32") var = rx.Var("v0", type_annotation=rx.ShapeType()) b0 = rx.MatchShape(shape, [m, n], var) assert b0.value == shape assert b0.pattern[0] == m assert b0.pattern[1] == n assert b0.var is not None assert b0.var.checked_type == rx.ShapeType() # var1: Tensor((m, n), "float32") = # match_shape(var0: Tensor(_, "float32"), [m, n]) type_anno0 = rx.DynTensorType(-1, "float32") value = rx.Var("value", type_annotation=type_anno0) shape_anno = [m, n] type_anno = rx.DynTensorType(2, "float32") var = rx.Var("v1", shape_anno, type_anno) b1 = rx.MatchShape(value, [m, n], var) assert b1.value == value assert b1.pattern[0] == m assert b1.pattern[1] == n assert b1.var is not None for s0, s1 in zip(b1.var.shape, [m, n]): assert s0 == s1 assert b1.var.checked_type == rx.DynTensorType(2, "float32") def test_var_binding() -> None: v0 = rx.Var("v0") val = rx.const(np.random.rand(24, 56)) b0 = rx.VarBinding(v0, val) assert b0.var.name_hint == "v0" assert b0.value == val def test_binding_block() -> None: m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") shape = rx.const([16, 8], "int32") b0 = rx.MatchShape(shape, [m, n], rx.Var("v0")) v0 = rx.Var("v0") val = rx.const(np.random.rand(24, 56)) b1 = rx.VarBinding(v0, val) block0 = rx.BindingBlock([b0, b1]) assert block0.bindings[0] == b0 assert block0.bindings[1] == b1 def test_dataflow_block() -> None: m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") shape = rx.const([16, 8], "int32") b0 = rx.MatchShape(shape, [m, n], rx.Var("v0")) v0 = rx.Var("v0") val = rx.const(np.random.rand(24, 56)) b1 = rx.VarBinding(v0, val) block0 = rx.DataflowBlock([b0, b1]) assert block0.bindings[0] == b0 assert block0.bindings[1] == b1 assert isinstance(block0, rx.DataflowBlock) def test_seq_expr() -> None: x = rx.Var("foo") bindings = [rx.VarBinding(x, rx.const(1))] blocks = [rx.BindingBlock(bindings)] seqe = rx.SeqExpr(blocks, x) assert seqe.blocks[0] == blocks[0] assert seqe.body == x def test_shape_expr() -> None: m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") s = rx.ShapeExpr([m, n]) assert s.values[0] == m assert s.values[1] == n def test_func(): type_anno = rx.DynTensorType(2, "float32") x = rx.Var("foo", type_annotation=type_anno) bindings = [rx.VarBinding(x, rx.const(1))] blocks = [rx.BindingBlock(bindings)] seqe = rx.SeqExpr(blocks, x) ret_type = rx.DynTensorType(-1, "float32") func = rx.Function([x], seqe, ret_type) func = func.with_attr("global_symbol", "func") assert func.params[0] == x assert func.body == seqe assert func.ret_type == ret_type assert func.attrs["global_symbol"] == "func" def test_shape_of(): v0 = rx.Var("v0") s0 = v0.shape assert isinstance(s0, tvm.relay.Call) assert s0.op.name == "relax.shape_of" shape_anno = [96, 54] v1 = rx.Var("v1", shape_anno) s1 = v1.shape for x, y in zip(shape_anno, s1): assert x == y def test_shape_expr(): shape_expr = rx.ShapeExpr([10, 20]) assert shape_expr.values[0] == 10 assert shape_expr.values[1] == 20 assert shape_expr.checked_type == rx.ShapeType() assert shape_expr.shape_ is None x = rx.Var("v0", (10, 20), rx.DynTensorType(2, "float32")) assert x.shape_.values[0] == 10 assert x.shape_.values[1] == 20 assert x.shape_.checked_type == rx.ShapeType() assert x.shape_.shape_ is None if __name__ == "__main__": pytest.main([__file__])
30.608696
64
0.636719
import pytest import tvm from tvm import tir from tvm import relax as rx import numpy as np def test_var() -> None: v0 = rx.Var("v0") assert v0.name_hint == "v0" assert v0.shape_ is None assert v0._checked_type_ is None shape_anno = [54, 96] type_anno = rx.DynTensorType(2, "float32") v1 = rx.Var("v1", shape_anno, type_anno) assert v1.name_hint == "v1" for s0, s1 in zip(v1.shape_, shape_anno): assert s0 == s1 assert v1._checked_type_ == type_anno def test_dataflow_var() -> None: v0 = rx.DataflowVar("v0") assert v0.name_hint == "v0" assert v0.shape_ is None assert v0._checked_type_ is None shape_anno = [54, 96] type_anno = rx.DynTensorType(2, "float16") v1 = rx.DataflowVar("v1", shape_anno, type_anno) assert v1.name_hint == "v1" for s0, s1 in zip(v1.shape_, shape_anno): assert s0 == s1 assert v1._checked_type_ == type_anno assert isinstance(v1, rx.DataflowVar) def test_match_shape() -> None: m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") shape = rx.const([16, 8], "int32") var = rx.Var("v0", type_annotation=rx.ShapeType()) b0 = rx.MatchShape(shape, [m, n], var) assert b0.value == shape assert b0.pattern[0] == m assert b0.pattern[1] == n assert b0.var is not None assert b0.var.checked_type == rx.ShapeType() type_anno0 = rx.DynTensorType(-1, "float32") value = rx.Var("value", type_annotation=type_anno0) shape_anno = [m, n] type_anno = rx.DynTensorType(2, "float32") var = rx.Var("v1", shape_anno, type_anno) b1 = rx.MatchShape(value, [m, n], var) assert b1.value == value assert b1.pattern[0] == m assert b1.pattern[1] == n assert b1.var is not None for s0, s1 in zip(b1.var.shape, [m, n]): assert s0 == s1 assert b1.var.checked_type == rx.DynTensorType(2, "float32") def test_var_binding() -> None: v0 = rx.Var("v0") val = rx.const(np.random.rand(24, 56)) b0 = rx.VarBinding(v0, val) assert b0.var.name_hint == "v0" assert b0.value == val def test_binding_block() -> None: m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") shape = rx.const([16, 8], "int32") b0 = rx.MatchShape(shape, [m, n], rx.Var("v0")) v0 = rx.Var("v0") val = rx.const(np.random.rand(24, 56)) b1 = rx.VarBinding(v0, val) block0 = rx.BindingBlock([b0, b1]) assert block0.bindings[0] == b0 assert block0.bindings[1] == b1 def test_dataflow_block() -> None: m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") shape = rx.const([16, 8], "int32") b0 = rx.MatchShape(shape, [m, n], rx.Var("v0")) v0 = rx.Var("v0") val = rx.const(np.random.rand(24, 56)) b1 = rx.VarBinding(v0, val) block0 = rx.DataflowBlock([b0, b1]) assert block0.bindings[0] == b0 assert block0.bindings[1] == b1 assert isinstance(block0, rx.DataflowBlock) def test_seq_expr() -> None: x = rx.Var("foo") bindings = [rx.VarBinding(x, rx.const(1))] blocks = [rx.BindingBlock(bindings)] seqe = rx.SeqExpr(blocks, x) assert seqe.blocks[0] == blocks[0] assert seqe.body == x def test_shape_expr() -> None: m = tir.Var("m", dtype="int32") n = tir.Var("n", dtype="int32") s = rx.ShapeExpr([m, n]) assert s.values[0] == m assert s.values[1] == n def test_func(): type_anno = rx.DynTensorType(2, "float32") x = rx.Var("foo", type_annotation=type_anno) bindings = [rx.VarBinding(x, rx.const(1))] blocks = [rx.BindingBlock(bindings)] seqe = rx.SeqExpr(blocks, x) ret_type = rx.DynTensorType(-1, "float32") func = rx.Function([x], seqe, ret_type) func = func.with_attr("global_symbol", "func") assert func.params[0] == x assert func.body == seqe assert func.ret_type == ret_type assert func.attrs["global_symbol"] == "func" def test_shape_of(): v0 = rx.Var("v0") s0 = v0.shape assert isinstance(s0, tvm.relay.Call) assert s0.op.name == "relax.shape_of" shape_anno = [96, 54] v1 = rx.Var("v1", shape_anno) s1 = v1.shape for x, y in zip(shape_anno, s1): assert x == y def test_shape_expr(): shape_expr = rx.ShapeExpr([10, 20]) assert shape_expr.values[0] == 10 assert shape_expr.values[1] == 20 assert shape_expr.checked_type == rx.ShapeType() assert shape_expr.shape_ is None x = rx.Var("v0", (10, 20), rx.DynTensorType(2, "float32")) assert x.shape_.values[0] == 10 assert x.shape_.values[1] == 20 assert x.shape_.checked_type == rx.ShapeType() assert x.shape_.shape_ is None if __name__ == "__main__": pytest.main([__file__])
true
true
1c454a4e8e42c6d6b32f7a64da00659348fb0aba
14,119
py
Python
cvat/apps/authentication/auth.py
adasdevops/ADAS_UPDATE_STABLE
306202b4e291b5876e3dd4fdd201c761e9d182f0
[ "Intel", "MIT" ]
null
null
null
cvat/apps/authentication/auth.py
adasdevops/ADAS_UPDATE_STABLE
306202b4e291b5876e3dd4fdd201c761e9d182f0
[ "Intel", "MIT" ]
null
null
null
cvat/apps/authentication/auth.py
adasdevops/ADAS_UPDATE_STABLE
306202b4e291b5876e3dd4fdd201c761e9d182f0
[ "Intel", "MIT" ]
1
2022-03-04T09:18:30.000Z
2022-03-04T09:18:30.000Z
# Copyright (C) 2018 Intel Corporation # # SPDX-License-Identifier: MIT from django.conf import settings from django.db.models import Q import rules from . import AUTH_ROLE from . import signature from rest_framework.permissions import BasePermission from django.core import signing from rest_framework import authentication, exceptions from rest_framework.authentication import TokenAuthentication as _TokenAuthentication from django.contrib.auth import login # Even with token authorization it is very important to have a valid session id # in cookies because in some cases we cannot use token authorization (e.g. when # we redirect to the server in UI using just URL). To overkill that we override # the class to call `login` method which restores the session id in cookies. class TokenAuthentication(_TokenAuthentication): def authenticate(self, request): auth = super().authenticate(request) session = getattr(request, 'session') if auth is not None and session.session_key is None: login(request, auth[0], 'django.contrib.auth.backends.ModelBackend') return auth def register_signals(): from django.db.models.signals import post_migrate, post_save from django.contrib.auth.models import User, Group def create_groups(sender, **kwargs): for role in AUTH_ROLE: db_group, _ = Group.objects.get_or_create(name=role) db_group.save() post_migrate.connect(create_groups, weak=False) if settings.IAM_TYPE == 'BASIC': from .auth_basic import create_user post_save.connect(create_user, sender=User) elif settings.DJANGO_AUTH_TYPE == 'LDAP': import django_auth_ldap.backend from .auth_ldap import create_user django_auth_ldap.backend.populate_user.connect(create_user) class SignatureAuthentication(authentication.BaseAuthentication): """ Authentication backend for signed URLs. """ def authenticate(self, request): """ Returns authenticated user if URL signature is valid. """ signer = signature.Signer() sign = request.query_params.get(signature.QUERY_PARAM) if not sign: return try: user = signer.unsign(sign, request.build_absolute_uri()) except signing.SignatureExpired: raise exceptions.AuthenticationFailed('This URL has expired.') except signing.BadSignature: raise exceptions.AuthenticationFailed('Invalid signature.') if not user.is_active: raise exceptions.AuthenticationFailed('User inactive or deleted.') return (user, None) # AUTH PREDICATES has_admin_role = rules.is_group_member(str(AUTH_ROLE.ADMIN)) has_user_role = rules.is_group_member(str(AUTH_ROLE.USER)) has_annotator_role = rules.is_group_member(str(AUTH_ROLE.ANNOTATOR)) has_observer_role = rules.is_group_member(str(AUTH_ROLE.OBSERVER)) @rules.predicate def is_project_owner(db_user, db_project): # If owner is None (null) the task can be accessed/changed/deleted # only by admin. At the moment each task has an owner. return db_project is not None and db_project.owner == db_user @rules.predicate def is_project_assignee(db_user, db_project): return db_project is not None and db_project.assignee == db_user @rules.predicate def is_project_annotator(db_user, db_project): db_tasks = list(db_project.tasks.prefetch_related('segment_set').all()) return any([is_task_annotator(db_user, db_task) for db_task in db_tasks]) @rules.predicate def is_project_reviewer(db_user, db_project): db_tasks = list(db_project.tasks.prefetch_related('segment_set').all()) return any([is_task_reviewer(db_user, db_task) for db_task in db_tasks]) @rules.predicate def is_task_owner(db_user, db_task): # If owner is None (null) the task can be accessed/changed/deleted # only by admin. At the moment each task has an owner. return db_task.owner == db_user or is_project_owner(db_user, db_task.project) @rules.predicate def is_task_assignee(db_user, db_task): return db_task.assignee == db_user or is_project_assignee(db_user, db_task.project) @rules.predicate def is_task_reviewer(db_user, db_task): db_segments = list(db_task.segment_set.prefetch_related('job_set__assignee').all()) return any([is_job_reviewer(db_user, db_job) for db_segment in db_segments for db_job in db_segment.job_set.all()]) @rules.predicate def is_task_annotator(db_user, db_task): db_segments = list(db_task.segment_set.prefetch_related('job_set__assignee').all()) return any([is_job_annotator(db_user, db_job) for db_segment in db_segments for db_job in db_segment.job_set.all()]) @rules.predicate def is_job_owner(db_user, db_job): return is_task_owner(db_user, db_job.segment.task) @rules.predicate def is_job_annotator(db_user, db_job): db_task = db_job.segment.task # A job can be annotated by any user if the task's assignee is None. has_rights = (db_task.assignee is None and not settings.RESTRICTIONS['reduce_task_visibility']) or is_task_assignee(db_user, db_task) if db_job.assignee is not None: has_rights |= (db_user == db_job.assignee) return has_rights @rules.predicate def has_change_permissions(db_user, db_job): db_task = db_job.segment.task # A job can be annotated by any user if the task's assignee is None. has_rights = (db_task.assignee is None and not settings.RESTRICTIONS['reduce_task_visibility']) or is_task_assignee(db_user, db_task) if db_job.assignee is not None: has_rights |= (db_user == db_job.assignee) and (db_job.status == 'annotation') if db_job.reviewer is not None: has_rights |= (db_user == db_job.reviewer) and (db_job.status == 'validation') return has_rights @rules.predicate def is_job_reviewer(db_user, db_job): has_rights = db_job.reviewer == db_user return has_rights @rules.predicate def is_issue_owner(db_user, db_issue): has_rights = db_issue.owner == db_user return has_rights @rules.predicate def is_comment_author(db_user, db_comment): has_rights = (db_comment.author == db_user) return has_rights @rules.predicate def is_cloud_storage_owner(db_user, db_storage): return db_storage.owner == db_user # AUTH PERMISSIONS RULES rules.add_perm('engine.role.user', has_user_role) rules.add_perm('engine.role.admin', has_admin_role) rules.add_perm('engine.role.annotator', has_annotator_role) rules.add_perm('engine.role.observer', has_observer_role) rules.add_perm('engine.project.create', has_admin_role | has_user_role) rules.add_perm('engine.project.access', has_admin_role | has_observer_role | is_project_owner | is_project_annotator) rules.add_perm('engine.project.change', has_admin_role | is_project_owner | is_project_assignee) rules.add_perm('engine.project.delete', has_admin_role | is_project_owner) rules.add_perm('engine.task.create', has_admin_role | has_user_role) rules.add_perm('engine.task.access', has_admin_role | has_observer_role | is_task_owner | is_task_annotator | is_task_reviewer) rules.add_perm('engine.task.change', has_admin_role | is_task_owner | is_task_assignee) rules.add_perm('engine.task.delete', has_admin_role | is_task_owner) rules.add_perm('engine.job.access', has_admin_role | has_observer_role | is_job_owner | is_job_annotator | is_job_reviewer) rules.add_perm('engine.job.change', has_admin_role | is_job_owner | has_change_permissions) rules.add_perm('engine.job.review', has_admin_role | (is_job_reviewer & has_change_permissions)) rules.add_perm('engine.issue.change', has_admin_role | is_issue_owner) rules.add_perm('engine.issue.destroy', has_admin_role | is_issue_owner) rules.add_perm('engine.comment.change', has_admin_role | is_comment_author) rules.add_perm('engine.cloudstorage.create', has_admin_role | has_user_role) rules.add_perm('engine.cloudstorage.change', has_admin_role | is_cloud_storage_owner) class AdminRolePermission(BasePermission): # pylint: disable=no-self-use def has_permission(self, request, view): return request.user.has_perm('engine.role.admin') class UserRolePermission(BasePermission): # pylint: disable=no-self-use def has_permission(self, request, view): return request.user.has_perm('engine.role.user') class AnnotatorRolePermission(BasePermission): # pylint: disable=no-self-use def has_permission(self, request, view): return request.user.has_perm('engine.role.annotator') class ObserverRolePermission(BasePermission): # pylint: disable=no-self-use def has_permission(self, request, view): return request.user.has_perm('engine.role.observer') class ProjectCreatePermission(BasePermission): # pylint: disable=no-self-use def has_permission(self, request, view): return request.user.has_perm('engine.project.create') class ProjectAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.project.access', obj) class ProjectChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.project.change', obj) class ProjectDeletePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.project.delete', obj) class TaskCreatePermission(BasePermission): # pylint: disable=no-self-use def has_permission(self, request, view): return request.user.has_perm('engine.task.create') class TaskAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.task.access', obj) class ProjectGetQuerySetMixin(object): def get_queryset(self): queryset = super().get_queryset() user = self.request.user # Don't filter queryset for admin, observer and detail methods if has_admin_role(user) or has_observer_role(user) or self.detail: return queryset else: return queryset.filter(Q(owner=user) | Q(assignee=user) | Q(task__owner=user) | Q(task__assignee=user) | Q(task__segment__job__assignee=user) | Q(task__segment__job__reviewer=user)).distinct() def filter_task_queryset(queryset, user): # Don't filter queryset for admin, observer if has_admin_role(user) or has_observer_role(user): return queryset query_filter = Q(owner=user) | Q(assignee=user) | \ Q(segment__job__assignee=user) | Q(segment__job__reviewer=user) if not settings.RESTRICTIONS['reduce_task_visibility']: query_filter |= Q(assignee=None) return queryset.filter(query_filter).distinct() class TaskGetQuerySetMixin(object): def get_queryset(self): queryset = super().get_queryset() user = self.request.user # Don't filter queryset for detail methods if self.detail: return queryset else: return filter_task_queryset(queryset, user) class TaskChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.task.change', obj) class TaskDeletePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.task.delete', obj) class JobAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.job.access', obj) class JobChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.job.change', obj) class JobReviewPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.job.review', obj) class IssueAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): db_job = obj.job return request.user.has_perm('engine.job.access', db_job) class IssueDestroyPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.issue.destroy', obj) class IssueChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): db_job = obj.job return (request.user.has_perm('engine.job.change', db_job) or request.user.has_perm('engine.issue.change', obj)) class CommentCreatePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): # obj is db_job return request.user.has_perm('engine.job.access', obj) class CommentChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.comment.change', obj) class CloudStorageAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm("engine.cloudstorage.change", obj) class CloudStorageChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm("engine.cloudstorage.change", obj) class CloudStorageGetQuerySetMixin(object): def get_queryset(self): queryset = super().get_queryset() user = self.request.user if has_admin_role(user) or self.detail: return queryset else: return queryset.filter(owner=user)
39.54902
137
0.738154
from django.conf import settings from django.db.models import Q import rules from . import AUTH_ROLE from . import signature from rest_framework.permissions import BasePermission from django.core import signing from rest_framework import authentication, exceptions from rest_framework.authentication import TokenAuthentication as _TokenAuthentication from django.contrib.auth import login class TokenAuthentication(_TokenAuthentication): def authenticate(self, request): auth = super().authenticate(request) session = getattr(request, 'session') if auth is not None and session.session_key is None: login(request, auth[0], 'django.contrib.auth.backends.ModelBackend') return auth def register_signals(): from django.db.models.signals import post_migrate, post_save from django.contrib.auth.models import User, Group def create_groups(sender, **kwargs): for role in AUTH_ROLE: db_group, _ = Group.objects.get_or_create(name=role) db_group.save() post_migrate.connect(create_groups, weak=False) if settings.IAM_TYPE == 'BASIC': from .auth_basic import create_user post_save.connect(create_user, sender=User) elif settings.DJANGO_AUTH_TYPE == 'LDAP': import django_auth_ldap.backend from .auth_ldap import create_user django_auth_ldap.backend.populate_user.connect(create_user) class SignatureAuthentication(authentication.BaseAuthentication): def authenticate(self, request): signer = signature.Signer() sign = request.query_params.get(signature.QUERY_PARAM) if not sign: return try: user = signer.unsign(sign, request.build_absolute_uri()) except signing.SignatureExpired: raise exceptions.AuthenticationFailed('This URL has expired.') except signing.BadSignature: raise exceptions.AuthenticationFailed('Invalid signature.') if not user.is_active: raise exceptions.AuthenticationFailed('User inactive or deleted.') return (user, None) has_admin_role = rules.is_group_member(str(AUTH_ROLE.ADMIN)) has_user_role = rules.is_group_member(str(AUTH_ROLE.USER)) has_annotator_role = rules.is_group_member(str(AUTH_ROLE.ANNOTATOR)) has_observer_role = rules.is_group_member(str(AUTH_ROLE.OBSERVER)) @rules.predicate def is_project_owner(db_user, db_project): return db_project is not None and db_project.owner == db_user @rules.predicate def is_project_assignee(db_user, db_project): return db_project is not None and db_project.assignee == db_user @rules.predicate def is_project_annotator(db_user, db_project): db_tasks = list(db_project.tasks.prefetch_related('segment_set').all()) return any([is_task_annotator(db_user, db_task) for db_task in db_tasks]) @rules.predicate def is_project_reviewer(db_user, db_project): db_tasks = list(db_project.tasks.prefetch_related('segment_set').all()) return any([is_task_reviewer(db_user, db_task) for db_task in db_tasks]) @rules.predicate def is_task_owner(db_user, db_task): return db_task.owner == db_user or is_project_owner(db_user, db_task.project) @rules.predicate def is_task_assignee(db_user, db_task): return db_task.assignee == db_user or is_project_assignee(db_user, db_task.project) @rules.predicate def is_task_reviewer(db_user, db_task): db_segments = list(db_task.segment_set.prefetch_related('job_set__assignee').all()) return any([is_job_reviewer(db_user, db_job) for db_segment in db_segments for db_job in db_segment.job_set.all()]) @rules.predicate def is_task_annotator(db_user, db_task): db_segments = list(db_task.segment_set.prefetch_related('job_set__assignee').all()) return any([is_job_annotator(db_user, db_job) for db_segment in db_segments for db_job in db_segment.job_set.all()]) @rules.predicate def is_job_owner(db_user, db_job): return is_task_owner(db_user, db_job.segment.task) @rules.predicate def is_job_annotator(db_user, db_job): db_task = db_job.segment.task has_rights = (db_task.assignee is None and not settings.RESTRICTIONS['reduce_task_visibility']) or is_task_assignee(db_user, db_task) if db_job.assignee is not None: has_rights |= (db_user == db_job.assignee) return has_rights @rules.predicate def has_change_permissions(db_user, db_job): db_task = db_job.segment.task # A job can be annotated by any user if the task's assignee is None. has_rights = (db_task.assignee is None and not settings.RESTRICTIONS['reduce_task_visibility']) or is_task_assignee(db_user, db_task) if db_job.assignee is not None: has_rights |= (db_user == db_job.assignee) and (db_job.status == 'annotation') if db_job.reviewer is not None: has_rights |= (db_user == db_job.reviewer) and (db_job.status == 'validation') return has_rights @rules.predicate def is_job_reviewer(db_user, db_job): has_rights = db_job.reviewer == db_user return has_rights @rules.predicate def is_issue_owner(db_user, db_issue): has_rights = db_issue.owner == db_user return has_rights @rules.predicate def is_comment_author(db_user, db_comment): has_rights = (db_comment.author == db_user) return has_rights @rules.predicate def is_cloud_storage_owner(db_user, db_storage): return db_storage.owner == db_user rules.add_perm('engine.role.user', has_user_role) rules.add_perm('engine.role.admin', has_admin_role) rules.add_perm('engine.role.annotator', has_annotator_role) rules.add_perm('engine.role.observer', has_observer_role) rules.add_perm('engine.project.create', has_admin_role | has_user_role) rules.add_perm('engine.project.access', has_admin_role | has_observer_role | is_project_owner | is_project_annotator) rules.add_perm('engine.project.change', has_admin_role | is_project_owner | is_project_assignee) rules.add_perm('engine.project.delete', has_admin_role | is_project_owner) rules.add_perm('engine.task.create', has_admin_role | has_user_role) rules.add_perm('engine.task.access', has_admin_role | has_observer_role | is_task_owner | is_task_annotator | is_task_reviewer) rules.add_perm('engine.task.change', has_admin_role | is_task_owner | is_task_assignee) rules.add_perm('engine.task.delete', has_admin_role | is_task_owner) rules.add_perm('engine.job.access', has_admin_role | has_observer_role | is_job_owner | is_job_annotator | is_job_reviewer) rules.add_perm('engine.job.change', has_admin_role | is_job_owner | has_change_permissions) rules.add_perm('engine.job.review', has_admin_role | (is_job_reviewer & has_change_permissions)) rules.add_perm('engine.issue.change', has_admin_role | is_issue_owner) rules.add_perm('engine.issue.destroy', has_admin_role | is_issue_owner) rules.add_perm('engine.comment.change', has_admin_role | is_comment_author) rules.add_perm('engine.cloudstorage.create', has_admin_role | has_user_role) rules.add_perm('engine.cloudstorage.change', has_admin_role | is_cloud_storage_owner) class AdminRolePermission(BasePermission): def has_permission(self, request, view): return request.user.has_perm('engine.role.admin') class UserRolePermission(BasePermission): def has_permission(self, request, view): return request.user.has_perm('engine.role.user') class AnnotatorRolePermission(BasePermission): def has_permission(self, request, view): return request.user.has_perm('engine.role.annotator') class ObserverRolePermission(BasePermission): def has_permission(self, request, view): return request.user.has_perm('engine.role.observer') class ProjectCreatePermission(BasePermission): def has_permission(self, request, view): return request.user.has_perm('engine.project.create') class ProjectAccessPermission(BasePermission): def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.project.access', obj) class ProjectChangePermission(BasePermission): def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.project.change', obj) class ProjectDeletePermission(BasePermission): def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.project.delete', obj) class TaskCreatePermission(BasePermission): def has_permission(self, request, view): return request.user.has_perm('engine.task.create') class TaskAccessPermission(BasePermission): def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.task.access', obj) class ProjectGetQuerySetMixin(object): def get_queryset(self): queryset = super().get_queryset() user = self.request.user if has_admin_role(user) or has_observer_role(user) or self.detail: return queryset else: return queryset.filter(Q(owner=user) | Q(assignee=user) | Q(task__owner=user) | Q(task__assignee=user) | Q(task__segment__job__assignee=user) | Q(task__segment__job__reviewer=user)).distinct() def filter_task_queryset(queryset, user): # Don't filter queryset for admin, observer if has_admin_role(user) or has_observer_role(user): return queryset query_filter = Q(owner=user) | Q(assignee=user) | \ Q(segment__job__assignee=user) | Q(segment__job__reviewer=user) if not settings.RESTRICTIONS['reduce_task_visibility']: query_filter |= Q(assignee=None) return queryset.filter(query_filter).distinct() class TaskGetQuerySetMixin(object): def get_queryset(self): queryset = super().get_queryset() user = self.request.user if self.detail: return queryset else: return filter_task_queryset(queryset, user) class TaskChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.task.change', obj) class TaskDeletePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.task.delete', obj) class JobAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.job.access', obj) class JobChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.job.change', obj) class JobReviewPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.job.review', obj) class IssueAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): db_job = obj.job return request.user.has_perm('engine.job.access', db_job) class IssueDestroyPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.issue.destroy', obj) class IssueChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): db_job = obj.job return (request.user.has_perm('engine.job.change', db_job) or request.user.has_perm('engine.issue.change', obj)) class CommentCreatePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): # obj is db_job return request.user.has_perm('engine.job.access', obj) class CommentChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm('engine.comment.change', obj) class CloudStorageAccessPermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm("engine.cloudstorage.change", obj) class CloudStorageChangePermission(BasePermission): # pylint: disable=no-self-use def has_object_permission(self, request, view, obj): return request.user.has_perm("engine.cloudstorage.change", obj) class CloudStorageGetQuerySetMixin(object): def get_queryset(self): queryset = super().get_queryset() user = self.request.user if has_admin_role(user) or self.detail: return queryset else: return queryset.filter(owner=user)
true
true
1c454b16a8c78878e2eced338b13aad8690829d4
3,793
py
Python
modelzoo/hnn.py
ml-jku/mc-lstm
8bbaece3ecb4187a76c6318d4c6e40c1dcc71303
[ "MIT" ]
18
2021-03-27T06:31:59.000Z
2022-02-24T09:48:57.000Z
modelzoo/hnn.py
ml-jku/mc-lstm
8bbaece3ecb4187a76c6318d4c6e40c1dcc71303
[ "MIT" ]
null
null
null
modelzoo/hnn.py
ml-jku/mc-lstm
8bbaece3ecb4187a76c6318d4c6e40c1dcc71303
[ "MIT" ]
7
2021-03-27T21:01:23.000Z
2021-09-21T14:27:59.000Z
import torch from torch import nn class HNN(nn.Module): '''Learn arbitrary vector fields that are sums of conservative and solenoidal fields''' def __init__(self, input_dim, differentiable_model, field_type='solenoidal', baseline=False, assume_canonical_coords=True): super(HNN, self).__init__() self.baseline = baseline self.differentiable_model = differentiable_model self.assume_canonical_coords = assume_canonical_coords self.M = self.permutation_tensor(input_dim) # Levi-Civita permutation tensor self.field_type = field_type def forward(self, x): # traditional forward pass if self.baseline: return self.differentiable_model(x) y = self.differentiable_model(x) assert y.dim() == 2 and y.shape[1] == 2, "Output tensor should have shape [batch_size, 2]" return y.split(1, 1) def time_derivative(self, x, t=None, separate_fields=False): '''NEURAL ODE-STLE VECTOR FIELD''' if self.baseline: return self.differentiable_model(x) '''NEURAL HAMILTONIAN-STLE VECTOR FIELD''' F1, F2 = self.forward(x) # traditional forward pass conservative_field = torch.zeros_like(x) # start out with both components set to 0 solenoidal_field = torch.zeros_like(x) if self.field_type != 'solenoidal': dF1 = torch.autograd.grad(F1.sum(), x, create_graph=True)[0] # gradients for conservative field conservative_field = dF1 @ torch.eye(*self.M.shape) if self.field_type != 'conservative': dF2 = torch.autograd.grad(F2.sum(), x, create_graph=True)[0] # gradients for solenoidal field solenoidal_field = dF2 @ self.M.t() if separate_fields: return [conservative_field, solenoidal_field] return conservative_field + solenoidal_field def permutation_tensor(self, n): M = None if self.assume_canonical_coords: M = torch.eye(n) M = torch.cat([M[n // 2:], -M[:n // 2]]) else: '''Constructs the Levi-Civita permutation tensor''' M = torch.ones(n, n) # matrix of ones M *= 1 - torch.eye(n) # clear diagonals M[::2] *= -1 # pattern of signs M[:, ::2] *= -1 for i in range(n): # make asymmetric for j in range(i + 1, n): M[i, j] *= -1 return M class MLP(nn.Module): '''Just a salt-of-the-earth MLP''' def __init__(self, input_dim, hidden_dim, output_dim, nonlinearity='tanh'): super(MLP, self).__init__() self.linear1 = torch.nn.Linear(input_dim, hidden_dim) self.linear2 = torch.nn.Linear(hidden_dim, hidden_dim) self.linear3 = torch.nn.Linear(hidden_dim, output_dim, bias=None) for l in [self.linear1, self.linear2, self.linear3]: torch.nn.init.orthogonal_(l.weight) # use a principled initialization self.nonlinearity = choose_nonlinearity(nonlinearity) def forward(self, x, separate_fields=False): h = self.nonlinearity(self.linear1(x)) h = self.nonlinearity(self.linear2(h)) return self.linear3(h) def choose_nonlinearity(name): nl = None if name == 'tanh': nl = torch.tanh elif name == 'relu': nl = torch.relu elif name == 'sigmoid': nl = torch.sigmoid elif name == 'softplus': nl = torch.nn.functional.softplus elif name == 'selu': nl = torch.nn.functional.selu elif name == 'elu': nl = torch.nn.functional.elu elif name == 'swish': nl = lambda x: x * torch.sigmoid(x) else: raise ValueError("nonlinearity not recognized") return nl
35.448598
108
0.613499
import torch from torch import nn class HNN(nn.Module): def __init__(self, input_dim, differentiable_model, field_type='solenoidal', baseline=False, assume_canonical_coords=True): super(HNN, self).__init__() self.baseline = baseline self.differentiable_model = differentiable_model self.assume_canonical_coords = assume_canonical_coords self.M = self.permutation_tensor(input_dim) self.field_type = field_type def forward(self, x): if self.baseline: return self.differentiable_model(x) y = self.differentiable_model(x) assert y.dim() == 2 and y.shape[1] == 2, "Output tensor should have shape [batch_size, 2]" return y.split(1, 1) def time_derivative(self, x, t=None, separate_fields=False): if self.baseline: return self.differentiable_model(x) F1, F2 = self.forward(x) conservative_field = torch.zeros_like(x) solenoidal_field = torch.zeros_like(x) if self.field_type != 'solenoidal': dF1 = torch.autograd.grad(F1.sum(), x, create_graph=True)[0] conservative_field = dF1 @ torch.eye(*self.M.shape) if self.field_type != 'conservative': dF2 = torch.autograd.grad(F2.sum(), x, create_graph=True)[0] solenoidal_field = dF2 @ self.M.t() if separate_fields: return [conservative_field, solenoidal_field] return conservative_field + solenoidal_field def permutation_tensor(self, n): M = None if self.assume_canonical_coords: M = torch.eye(n) M = torch.cat([M[n // 2:], -M[:n // 2]]) else: '''Constructs the Levi-Civita permutation tensor''' M = torch.ones(n, n) M *= 1 - torch.eye(n) M[::2] *= -1 M[:, ::2] *= -1 for i in range(n): for j in range(i + 1, n): M[i, j] *= -1 return M class MLP(nn.Module): def __init__(self, input_dim, hidden_dim, output_dim, nonlinearity='tanh'): super(MLP, self).__init__() self.linear1 = torch.nn.Linear(input_dim, hidden_dim) self.linear2 = torch.nn.Linear(hidden_dim, hidden_dim) self.linear3 = torch.nn.Linear(hidden_dim, output_dim, bias=None) for l in [self.linear1, self.linear2, self.linear3]: torch.nn.init.orthogonal_(l.weight) self.nonlinearity = choose_nonlinearity(nonlinearity) def forward(self, x, separate_fields=False): h = self.nonlinearity(self.linear1(x)) h = self.nonlinearity(self.linear2(h)) return self.linear3(h) def choose_nonlinearity(name): nl = None if name == 'tanh': nl = torch.tanh elif name == 'relu': nl = torch.relu elif name == 'sigmoid': nl = torch.sigmoid elif name == 'softplus': nl = torch.nn.functional.softplus elif name == 'selu': nl = torch.nn.functional.selu elif name == 'elu': nl = torch.nn.functional.elu elif name == 'swish': nl = lambda x: x * torch.sigmoid(x) else: raise ValueError("nonlinearity not recognized") return nl
true
true
1c454b8c0ca00f4367578dddf2f1c44be75fbd3e
4,182
py
Python
share/seeds/generate-seeds.py
enixt/enixt
6bc063558ccb1a66e28d26bd6e2903c2d4346633
[ "MIT" ]
1
2019-01-15T18:37:03.000Z
2019-01-15T18:37:03.000Z
share/seeds/generate-seeds.py
enixt/enixt
6bc063558ccb1a66e28d26bd6e2903c2d4346633
[ "MIT" ]
null
null
null
share/seeds/generate-seeds.py
enixt/enixt
6bc063558ccb1a66e28d26bd6e2903c2d4346633
[ "MIT" ]
2
2018-03-10T19:32:49.000Z
2019-12-20T01:32:03.000Z
#!/usr/bin/python # Copyright (c) 2014 Wladmir J. van der Laan # Distributed under the MIT/X11 software license, see the accompanying # file COPYING or http://www.opensource.org/licenses/mit-license.php. ''' Script to generate list of seed nodes for chainparams.cpp. This script expects two text files in the directory that is passed as an argument: nodes_main.txt nodes_test.txt These files must consist of lines in the format <ip> <ip>:<port> [<ipv6>] [<ipv6>]:<port> <onion>.onion 0xDDBBCCAA (IPv4 little-endian old pnSeeds format) The output will be two data structures with the peers in binary format: static SeedSpec6 pnSeed6_main[]={ ... } static SeedSpec6 pnSeed6_test[]={ ... } These should be pasted into `src/chainparamsseeds.h`. ''' from __future__ import print_function, division from base64 import b32decode from binascii import a2b_hex import sys, os import re # ipv4 in ipv6 prefix pchIPv4 = bytearray([0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0xff, 0xff]) # tor-specific ipv6 prefix pchOnionCat = bytearray([0xFD,0x87,0xD8,0x7E,0xEB,0x43]) def name_to_ipv6(addr): if len(addr)>6 and addr.endswith('.onion'): vchAddr = b32decode(addr[0:-6], True) if len(vchAddr) != 16-len(pchOnionCat): raise ValueError('Invalid onion %s' % s) return pchOnionCat + vchAddr elif '.' in addr: # IPv4 return pchIPv4 + bytearray((int(x) for x in addr.split('.'))) elif ':' in addr: # IPv6 sub = [[], []] # prefix, suffix x = 0 addr = addr.split(':') for i,comp in enumerate(addr): if comp == '': if i == 0 or i == (len(addr)-1): # skip empty component at beginning or end continue x += 1 # :: skips to suffix assert(x < 2) else: # two bytes per component val = int(comp, 16) sub[x].append(val >> 8) sub[x].append(val & 0xff) nullbytes = 16 - len(sub[0]) - len(sub[1]) assert((x == 0 and nullbytes == 0) or (x == 1 and nullbytes > 0)) return bytearray(sub[0] + ([0] * nullbytes) + sub[1]) elif addr.startswith('0x'): # IPv4-in-little-endian return pchIPv4 + bytearray(reversed(a2b_hex(addr[2:]))) else: raise ValueError('Could not parse address %s' % addr) def parse_spec(s, defaultport): match = re.match('\[([0-9a-fA-F:]+)\](?::([0-9]+))?$', s) if match: # ipv6 host = match.group(1) port = match.group(2) else: (host,_,port) = s.partition(':') if not port: port = defaultport else: port = int(port) host = name_to_ipv6(host) return (host,port) def process_nodes(g, f, structname, defaultport): g.write('static SeedSpec6 %s[] = {\n' % structname) first = True for line in f: comment = line.find('#') if comment != -1: line = line[0:comment] line = line.strip() if not line: continue if not first: g.write(',\n') first = False (host,port) = parse_spec(line, defaultport) hoststr = ','.join(('0x%02x' % b) for b in host) g.write(' {{%s}, %i}' % (hoststr, port)) g.write('\n};\n') def main(): if len(sys.argv)<2: print(('Usage: %s <path_to_nodes_txt>' % sys.argv[0]), file=sys.stderr) exit(1) g = sys.stdout indir = sys.argv[1] g.write('#ifndef H_CHAINPARAMSSEEDS\n') g.write('#define H_CHAINPARAMSSEEDS\n') g.write('// List of fixed seed nodes for the bitcoin network\n') g.write('// AUTOGENERATED by share/seeds/generate-seeds.py\n\n') g.write('// Each line contains a 16-byte IPv6 address and a port.\n') g.write('// IPv4 as well as onion addresses are wrapped inside a IPv6 address accordingly.\n') with open(os.path.join(indir,'nodes_main.txt'),'r') as f: process_nodes(g, f, 'pnSeed6_main', 15111) g.write('\n') with open(os.path.join(indir,'nodes_test.txt'),'r') as f: process_nodes(g, f, 'pnSeed6_test', 25111) g.write('#endif\n') if __name__ == '__main__': main()
31.681818
98
0.587996
from __future__ import print_function, division from base64 import b32decode from binascii import a2b_hex import sys, os import re pchIPv4 = bytearray([0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0xff, 0xff]) pchOnionCat = bytearray([0xFD,0x87,0xD8,0x7E,0xEB,0x43]) def name_to_ipv6(addr): if len(addr)>6 and addr.endswith('.onion'): vchAddr = b32decode(addr[0:-6], True) if len(vchAddr) != 16-len(pchOnionCat): raise ValueError('Invalid onion %s' % s) return pchOnionCat + vchAddr elif '.' in addr: return pchIPv4 + bytearray((int(x) for x in addr.split('.'))) elif ':' in addr: sub = [[], []] x = 0 addr = addr.split(':') for i,comp in enumerate(addr): if comp == '': if i == 0 or i == (len(addr)-1): continue x += 1 assert(x < 2) else: val = int(comp, 16) sub[x].append(val >> 8) sub[x].append(val & 0xff) nullbytes = 16 - len(sub[0]) - len(sub[1]) assert((x == 0 and nullbytes == 0) or (x == 1 and nullbytes > 0)) return bytearray(sub[0] + ([0] * nullbytes) + sub[1]) elif addr.startswith('0x'): return pchIPv4 + bytearray(reversed(a2b_hex(addr[2:]))) else: raise ValueError('Could not parse address %s' % addr) def parse_spec(s, defaultport): match = re.match('\[([0-9a-fA-F:]+)\](?::([0-9]+))?$', s) if match: host = match.group(1) port = match.group(2) else: (host,_,port) = s.partition(':') if not port: port = defaultport else: port = int(port) host = name_to_ipv6(host) return (host,port) def process_nodes(g, f, structname, defaultport): g.write('static SeedSpec6 %s[] = {\n' % structname) first = True for line in f: comment = line.find('#') if comment != -1: line = line[0:comment] line = line.strip() if not line: continue if not first: g.write(',\n') first = False (host,port) = parse_spec(line, defaultport) hoststr = ','.join(('0x%02x' % b) for b in host) g.write(' {{%s}, %i}' % (hoststr, port)) g.write('\n};\n') def main(): if len(sys.argv)<2: print(('Usage: %s <path_to_nodes_txt>' % sys.argv[0]), file=sys.stderr) exit(1) g = sys.stdout indir = sys.argv[1] g.write('#ifndef H_CHAINPARAMSSEEDS\n') g.write('#define H_CHAINPARAMSSEEDS\n') g.write('// List of fixed seed nodes for the bitcoin network\n') g.write('// AUTOGENERATED by share/seeds/generate-seeds.py\n\n') g.write('// Each line contains a 16-byte IPv6 address and a port.\n') g.write('// IPv4 as well as onion addresses are wrapped inside a IPv6 address accordingly.\n') with open(os.path.join(indir,'nodes_main.txt'),'r') as f: process_nodes(g, f, 'pnSeed6_main', 15111) g.write('\n') with open(os.path.join(indir,'nodes_test.txt'),'r') as f: process_nodes(g, f, 'pnSeed6_test', 25111) g.write('#endif\n') if __name__ == '__main__': main()
true
true
1c454f649b1049f927a2a7419ab2e09e87c4ce45
3,531
py
Python
widgets.py/migrations/0001_initial.py
deejungx/goalza
c9ec93aad13228bccd9f185cfac6ff9e1fc1994a
[ "MIT" ]
1
2019-05-04T11:26:14.000Z
2019-05-04T11:26:14.000Z
widgets.py/migrations/0001_initial.py
deejungx/goalza
c9ec93aad13228bccd9f185cfac6ff9e1fc1994a
[ "MIT" ]
null
null
null
widgets.py/migrations/0001_initial.py
deejungx/goalza
c9ec93aad13228bccd9f185cfac6ff9e1fc1994a
[ "MIT" ]
null
null
null
# Generated by Django 2.2 on 2019-05-02 11:46 import datetime from django.db import migrations, models import django.db.models.deletion import pages.models import pages.myFields class Migration(migrations.Migration): initial = True dependencies = [ ] operations = [ migrations.CreateModel( name='FutsalCompany', fields=[ ('futsal_id', models.AutoField(primary_key=True, serialize=False)), ('futsal_name', models.CharField(max_length=155)), ('opening_time', models.TimeField(default=pages.models.getDefaultOpeningTime)), ('closing_time', models.TimeField(default=pages.models.getDefaultClosingTime)), ], options={ 'verbose_name_plural': 'futsal companies', 'ordering': ['futsal_name'], }, ), migrations.CreateModel( name='Ground', fields=[ ('ground_id', models.AutoField(primary_key=True, serialize=False)), ('ground_number', models.IntegerField(unique=True)), ('ground_name', models.CharField(max_length=155, unique=True)), ('futsalCompany', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.FutsalCompany')), ], ), migrations.CreateModel( name='Player', fields=[ ('player_id', models.AutoField(primary_key=True, serialize=False)), ('player_name', models.CharField(max_length=155)), ('player_address', models.CharField(blank=True, max_length=220, null=True)), ('player_email', models.EmailField(blank=True, max_length=254, null=True, unique=True)), ('phone_number', models.CharField(max_length=12, unique=True)), ], ), migrations.CreateModel( name='GroundPrice', fields=[ ('price_segment_id', models.AutoField(primary_key=True, serialize=False)), ('day_of_week', pages.myFields.DayOfTheWeekField(choices=[('1', 'Monday'), ('2', 'Tuesday'), ('3', 'Wednesday'), ('4', 'Thursday'), ('5', 'Friday'), ('6', 'Saturday'), ('7', 'Sunday')], max_length=1)), ('start_time', models.TimeField()), ('end_time', models.TimeField()), ('price', models.DecimalField(decimal_places=2, max_digits=8)), ('ground', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.Ground')), ], ), migrations.CreateModel( name='Booking', fields=[ ('booking_id', models.AutoField(primary_key=True, serialize=False)), ('booking_date', models.DateField()), ('start_time', models.TimeField()), ('duration', models.DurationField(default=datetime.timedelta(seconds=3600))), ('booking_status', models.CharField(choices=[('CONFIRMED', 'CONFIRMED'), ('PLAYING', 'PLAYING'), ('COMPLETE', 'COMPLETE'), ('CANCELED', 'CANCELED')], max_length=50)), ('payment_status', models.CharField(choices=[('PENDING', 'PENDING'), ('COMPLETED', 'COMPLETED')], max_length=50)), ('ground', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.Ground')), ('player', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.Player')), ], ), ]
47.08
217
0.57859
import datetime from django.db import migrations, models import django.db.models.deletion import pages.models import pages.myFields class Migration(migrations.Migration): initial = True dependencies = [ ] operations = [ migrations.CreateModel( name='FutsalCompany', fields=[ ('futsal_id', models.AutoField(primary_key=True, serialize=False)), ('futsal_name', models.CharField(max_length=155)), ('opening_time', models.TimeField(default=pages.models.getDefaultOpeningTime)), ('closing_time', models.TimeField(default=pages.models.getDefaultClosingTime)), ], options={ 'verbose_name_plural': 'futsal companies', 'ordering': ['futsal_name'], }, ), migrations.CreateModel( name='Ground', fields=[ ('ground_id', models.AutoField(primary_key=True, serialize=False)), ('ground_number', models.IntegerField(unique=True)), ('ground_name', models.CharField(max_length=155, unique=True)), ('futsalCompany', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.FutsalCompany')), ], ), migrations.CreateModel( name='Player', fields=[ ('player_id', models.AutoField(primary_key=True, serialize=False)), ('player_name', models.CharField(max_length=155)), ('player_address', models.CharField(blank=True, max_length=220, null=True)), ('player_email', models.EmailField(blank=True, max_length=254, null=True, unique=True)), ('phone_number', models.CharField(max_length=12, unique=True)), ], ), migrations.CreateModel( name='GroundPrice', fields=[ ('price_segment_id', models.AutoField(primary_key=True, serialize=False)), ('day_of_week', pages.myFields.DayOfTheWeekField(choices=[('1', 'Monday'), ('2', 'Tuesday'), ('3', 'Wednesday'), ('4', 'Thursday'), ('5', 'Friday'), ('6', 'Saturday'), ('7', 'Sunday')], max_length=1)), ('start_time', models.TimeField()), ('end_time', models.TimeField()), ('price', models.DecimalField(decimal_places=2, max_digits=8)), ('ground', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.Ground')), ], ), migrations.CreateModel( name='Booking', fields=[ ('booking_id', models.AutoField(primary_key=True, serialize=False)), ('booking_date', models.DateField()), ('start_time', models.TimeField()), ('duration', models.DurationField(default=datetime.timedelta(seconds=3600))), ('booking_status', models.CharField(choices=[('CONFIRMED', 'CONFIRMED'), ('PLAYING', 'PLAYING'), ('COMPLETE', 'COMPLETE'), ('CANCELED', 'CANCELED')], max_length=50)), ('payment_status', models.CharField(choices=[('PENDING', 'PENDING'), ('COMPLETED', 'COMPLETED')], max_length=50)), ('ground', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.Ground')), ('player', models.ForeignKey(on_delete=django.db.models.deletion.CASCADE, to='pages.Player')), ], ), ]
true
true
1c454f9b0ae3d0e44d374d4620851100121f28e8
70,561
py
Python
django/db/models/base.py
yswai/django
90c706e44fa1e640245ad4626f0e3ecb176acce2
[ "PSF-2.0", "BSD-3-Clause" ]
null
null
null
django/db/models/base.py
yswai/django
90c706e44fa1e640245ad4626f0e3ecb176acce2
[ "PSF-2.0", "BSD-3-Clause" ]
null
null
null
django/db/models/base.py
yswai/django
90c706e44fa1e640245ad4626f0e3ecb176acce2
[ "PSF-2.0", "BSD-3-Clause" ]
null
null
null
from __future__ import unicode_literals import copy import inspect import warnings from itertools import chain from django.apps import apps from django.conf import settings from django.core import checks from django.core.exceptions import ( NON_FIELD_ERRORS, FieldDoesNotExist, FieldError, MultipleObjectsReturned, ObjectDoesNotExist, ValidationError, ) from django.db import ( DEFAULT_DB_ALIAS, DJANGO_VERSION_PICKLE_KEY, DatabaseError, connections, router, transaction, ) from django.db.models import signals from django.db.models.constants import LOOKUP_SEP from django.db.models.deletion import CASCADE, Collector from django.db.models.fields import AutoField from django.db.models.fields.related import ( ForeignObjectRel, ManyToOneRel, OneToOneField, lazy_related_operation, resolve_relation, ) from django.db.models.manager import ensure_default_manager from django.db.models.options import Options from django.db.models.query import Q from django.db.models.query_utils import ( DeferredAttribute, deferred_class_factory, ) from django.db.models.utils import make_model_tuple from django.utils import six from django.utils.encoding import force_str, force_text from django.utils.functional import curry from django.utils.six.moves import zip from django.utils.text import capfirst, get_text_list from django.utils.translation import ugettext_lazy as _ from django.utils.version import get_version def subclass_exception(name, parents, module, attached_to=None): """ Create exception subclass. Used by ModelBase below. If 'attached_to' is supplied, the exception will be created in a way that allows it to be pickled, assuming the returned exception class will be added as an attribute to the 'attached_to' class. """ class_dict = {'__module__': module} if attached_to is not None: def __reduce__(self): # Exceptions are special - they've got state that isn't # in self.__dict__. We assume it is all in self.args. return (unpickle_inner_exception, (attached_to, name), self.args) def __setstate__(self, args): self.args = args class_dict['__reduce__'] = __reduce__ class_dict['__setstate__'] = __setstate__ return type(name, parents, class_dict) class ModelBase(type): """ Metaclass for all models. """ def __new__(cls, name, bases, attrs): super_new = super(ModelBase, cls).__new__ # Also ensure initialization is only performed for subclasses of Model # (excluding Model class itself). parents = [b for b in bases if isinstance(b, ModelBase)] if not parents: return super_new(cls, name, bases, attrs) # Create the class. module = attrs.pop('__module__') new_class = super_new(cls, name, bases, {'__module__': module}) attr_meta = attrs.pop('Meta', None) abstract = getattr(attr_meta, 'abstract', False) if not attr_meta: meta = getattr(new_class, 'Meta', None) else: meta = attr_meta base_meta = getattr(new_class, '_meta', None) app_label = None # Look for an application configuration to attach the model to. app_config = apps.get_containing_app_config(module) if getattr(meta, 'app_label', None) is None: if app_config is None: if not abstract: raise RuntimeError( "Model class %s.%s doesn't declare an explicit " "app_label and isn't in an application in " "INSTALLED_APPS." % (module, name) ) else: app_label = app_config.label new_class.add_to_class('_meta', Options(meta, app_label)) if not abstract: new_class.add_to_class( 'DoesNotExist', subclass_exception( str('DoesNotExist'), tuple( x.DoesNotExist for x in parents if hasattr(x, '_meta') and not x._meta.abstract ) or (ObjectDoesNotExist,), module, attached_to=new_class)) new_class.add_to_class( 'MultipleObjectsReturned', subclass_exception( str('MultipleObjectsReturned'), tuple( x.MultipleObjectsReturned for x in parents if hasattr(x, '_meta') and not x._meta.abstract ) or (MultipleObjectsReturned,), module, attached_to=new_class)) if base_meta and not base_meta.abstract: # Non-abstract child classes inherit some attributes from their # non-abstract parent (unless an ABC comes before it in the # method resolution order). if not hasattr(meta, 'ordering'): new_class._meta.ordering = base_meta.ordering if not hasattr(meta, 'get_latest_by'): new_class._meta.get_latest_by = base_meta.get_latest_by is_proxy = new_class._meta.proxy # If the model is a proxy, ensure that the base class # hasn't been swapped out. if is_proxy and base_meta and base_meta.swapped: raise TypeError("%s cannot proxy the swapped model '%s'." % (name, base_meta.swapped)) if getattr(new_class, '_default_manager', None): if not is_proxy: # Multi-table inheritance doesn't inherit default manager from # parents. new_class._default_manager = None new_class._base_manager = None else: # Proxy classes do inherit parent's default manager, if none is # set explicitly. new_class._default_manager = new_class._default_manager._copy_to_model(new_class) new_class._base_manager = new_class._base_manager._copy_to_model(new_class) # Add all attributes to the class. for obj_name, obj in attrs.items(): new_class.add_to_class(obj_name, obj) # All the fields of any type declared on this model new_fields = chain( new_class._meta.local_fields, new_class._meta.local_many_to_many, new_class._meta.private_fields ) field_names = {f.name for f in new_fields} # Basic setup for proxy models. if is_proxy: base = None for parent in [kls for kls in parents if hasattr(kls, '_meta')]: if parent._meta.abstract: if parent._meta.fields: raise TypeError( "Abstract base class containing model fields not " "permitted for proxy model '%s'." % name ) else: continue if base is None: base = parent elif parent._meta.concrete_model is not base._meta.concrete_model: raise TypeError("Proxy model '%s' has more than one non-abstract model base class." % name) if base is None: raise TypeError("Proxy model '%s' has no non-abstract model base class." % name) new_class._meta.setup_proxy(base) new_class._meta.concrete_model = base._meta.concrete_model else: new_class._meta.concrete_model = new_class # Collect the parent links for multi-table inheritance. parent_links = {} for base in reversed([new_class] + parents): # Conceptually equivalent to `if base is Model`. if not hasattr(base, '_meta'): continue # Skip concrete parent classes. if base != new_class and not base._meta.abstract: continue # Locate OneToOneField instances. for field in base._meta.local_fields: if isinstance(field, OneToOneField): related = resolve_relation(new_class, field.remote_field.model) parent_links[make_model_tuple(related)] = field # Do the appropriate setup for any model parents. for base in parents: original_base = base if not hasattr(base, '_meta'): # Things without _meta aren't functional models, so they're # uninteresting parents. continue parent_fields = base._meta.local_fields + base._meta.local_many_to_many # Check for clashes between locally declared fields and those # on the base classes (we cannot handle shadowed fields at the # moment). for field in parent_fields: if field.name in field_names: raise FieldError( 'Local field %r in class %r clashes ' 'with field of similar name from ' 'base class %r' % (field.name, name, base.__name__) ) if not base._meta.abstract: # Concrete classes... base = base._meta.concrete_model base_key = make_model_tuple(base) if base_key in parent_links: field = parent_links[base_key] elif not is_proxy: attr_name = '%s_ptr' % base._meta.model_name field = OneToOneField( base, on_delete=CASCADE, name=attr_name, auto_created=True, parent_link=True, ) # Only add the ptr field if it's not already present; # e.g. migrations will already have it specified if not hasattr(new_class, attr_name): new_class.add_to_class(attr_name, field) else: field = None new_class._meta.parents[base] = field else: base_parents = base._meta.parents.copy() # .. and abstract ones. for field in parent_fields: new_field = copy.deepcopy(field) new_class.add_to_class(field.name, new_field) # Replace parent links defined on this base by the new # field as it will be appropriately resolved if required. if field.one_to_one: for parent, parent_link in base_parents.items(): if field == parent_link: base_parents[parent] = new_field # Pass any non-abstract parent classes onto child. new_class._meta.parents.update(base_parents) # Inherit managers from the abstract base classes. new_class.copy_managers(base._meta.abstract_managers) # Proxy models inherit the non-abstract managers from their base, # unless they have redefined any of them. if is_proxy: new_class.copy_managers(original_base._meta.concrete_managers) # Inherit private fields (like GenericForeignKey) from the parent # class for field in base._meta.private_fields: if base._meta.abstract and field.name in field_names: raise FieldError( 'Local field %r in class %r clashes ' 'with field of similar name from ' 'abstract base class %r' % (field.name, name, base.__name__) ) new_class.add_to_class(field.name, copy.deepcopy(field)) if abstract: # Abstract base models can't be instantiated and don't appear in # the list of models for an app. We do the final setup for them a # little differently from normal models. attr_meta.abstract = False new_class.Meta = attr_meta return new_class new_class._prepare() new_class._meta.apps.register_model(new_class._meta.app_label, new_class) return new_class def copy_managers(cls, base_managers): # This is in-place sorting of an Options attribute, but that's fine. base_managers.sort() for _, mgr_name, manager in base_managers: # NOQA (redefinition of _) val = getattr(cls, mgr_name, None) if not val or val is manager: new_manager = manager._copy_to_model(cls) cls.add_to_class(mgr_name, new_manager) def add_to_class(cls, name, value): # We should call the contribute_to_class method only if it's bound if not inspect.isclass(value) and hasattr(value, 'contribute_to_class'): value.contribute_to_class(cls, name) else: setattr(cls, name, value) def _prepare(cls): """ Creates some methods once self._meta has been populated. """ opts = cls._meta opts._prepare(cls) if opts.order_with_respect_to: cls.get_next_in_order = curry(cls._get_next_or_previous_in_order, is_next=True) cls.get_previous_in_order = curry(cls._get_next_or_previous_in_order, is_next=False) # Defer creating accessors on the foreign class until it has been # created and registered. If remote_field is None, we're ordering # with respect to a GenericForeignKey and don't know what the # foreign class is - we'll add those accessors later in # contribute_to_class(). if opts.order_with_respect_to.remote_field: wrt = opts.order_with_respect_to remote = wrt.remote_field.model lazy_related_operation(make_foreign_order_accessors, cls, remote) # Give the class a docstring -- its definition. if cls.__doc__ is None: cls.__doc__ = "%s(%s)" % (cls.__name__, ", ".join(f.name for f in opts.fields)) get_absolute_url_override = settings.ABSOLUTE_URL_OVERRIDES.get(opts.label_lower) if get_absolute_url_override: setattr(cls, 'get_absolute_url', get_absolute_url_override) ensure_default_manager(cls) signals.class_prepared.send(sender=cls) class ModelState(object): """ A class for storing instance state """ def __init__(self, db=None): self.db = db # If true, uniqueness validation checks will consider this a new, as-yet-unsaved object. # Necessary for correct validation of new instances of objects with explicit (non-auto) PKs. # This impacts validation only; it has no effect on the actual save. self.adding = True class Model(six.with_metaclass(ModelBase)): _deferred = False def __init__(self, *args, **kwargs): signals.pre_init.send(sender=self.__class__, args=args, kwargs=kwargs) # Set up the storage for instance state self._state = ModelState() # There is a rather weird disparity here; if kwargs, it's set, then args # overrides it. It should be one or the other; don't duplicate the work # The reason for the kwargs check is that standard iterator passes in by # args, and instantiation for iteration is 33% faster. args_len = len(args) if args_len > len(self._meta.concrete_fields): # Daft, but matches old exception sans the err msg. raise IndexError("Number of args exceeds number of fields") if not kwargs: fields_iter = iter(self._meta.concrete_fields) # The ordering of the zip calls matter - zip throws StopIteration # when an iter throws it. So if the first iter throws it, the second # is *not* consumed. We rely on this, so don't change the order # without changing the logic. for val, field in zip(args, fields_iter): setattr(self, field.attname, val) else: # Slower, kwargs-ready version. fields_iter = iter(self._meta.fields) for val, field in zip(args, fields_iter): setattr(self, field.attname, val) kwargs.pop(field.name, None) # Maintain compatibility with existing calls. if isinstance(field.remote_field, ManyToOneRel): kwargs.pop(field.attname, None) # Now we're left with the unprocessed fields that *must* come from # keywords, or default. for field in fields_iter: is_related_object = False # This slightly odd construct is so that we can access any # data-descriptor object (DeferredAttribute) without triggering its # __get__ method. if (field.attname not in kwargs and (isinstance(self.__class__.__dict__.get(field.attname), DeferredAttribute) or field.column is None)): # This field will be populated on request. continue if kwargs: if isinstance(field.remote_field, ForeignObjectRel): try: # Assume object instance was passed in. rel_obj = kwargs.pop(field.name) is_related_object = True except KeyError: try: # Object instance wasn't passed in -- must be an ID. val = kwargs.pop(field.attname) except KeyError: val = field.get_default() else: # Object instance was passed in. Special case: You can # pass in "None" for related objects if it's allowed. if rel_obj is None and field.null: val = None else: try: val = kwargs.pop(field.attname) except KeyError: # This is done with an exception rather than the # default argument on pop because we don't want # get_default() to be evaluated, and then not used. # Refs #12057. val = field.get_default() else: val = field.get_default() if is_related_object: # If we are passed a related instance, set it using the # field.name instead of field.attname (e.g. "user" instead of # "user_id") so that the object gets properly cached (and type # checked) by the RelatedObjectDescriptor. setattr(self, field.name, rel_obj) else: setattr(self, field.attname, val) if kwargs: for prop in list(kwargs): try: if isinstance(getattr(self.__class__, prop), property): setattr(self, prop, kwargs[prop]) del kwargs[prop] except AttributeError: pass if kwargs: raise TypeError("'%s' is an invalid keyword argument for this function" % list(kwargs)[0]) super(Model, self).__init__() signals.post_init.send(sender=self.__class__, instance=self) @classmethod def from_db(cls, db, field_names, values): if cls._deferred: new = cls(**dict(zip(field_names, values))) else: new = cls(*values) new._state.adding = False new._state.db = db return new def __repr__(self): try: u = six.text_type(self) except (UnicodeEncodeError, UnicodeDecodeError): u = '[Bad Unicode data]' return force_str('<%s: %s>' % (self.__class__.__name__, u)) def __str__(self): if six.PY2 and hasattr(self, '__unicode__'): return force_text(self).encode('utf-8') return str('%s object' % self.__class__.__name__) def __eq__(self, other): if not isinstance(other, Model): return False if self._meta.concrete_model != other._meta.concrete_model: return False my_pk = self._get_pk_val() if my_pk is None: return self is other return my_pk == other._get_pk_val() def __ne__(self, other): return not self.__eq__(other) def __hash__(self): if self._get_pk_val() is None: raise TypeError("Model instances without primary key value are unhashable") return hash(self._get_pk_val()) def __reduce__(self): """ Provides pickling support. Normally, this just dispatches to Python's standard handling. However, for models with deferred field loading, we need to do things manually, as they're dynamically created classes and only module-level classes can be pickled by the default path. """ data = self.__dict__ data[DJANGO_VERSION_PICKLE_KEY] = get_version() if not self._deferred: class_id = self._meta.app_label, self._meta.object_name return model_unpickle, (class_id, [], simple_class_factory), data defers = [] for field in self._meta.fields: if isinstance(self.__class__.__dict__.get(field.attname), DeferredAttribute): defers.append(field.attname) model = self._meta.proxy_for_model class_id = model._meta.app_label, model._meta.object_name return (model_unpickle, (class_id, defers, deferred_class_factory), data) def __setstate__(self, state): msg = None pickled_version = state.get(DJANGO_VERSION_PICKLE_KEY) if pickled_version: current_version = get_version() if current_version != pickled_version: msg = ( "Pickled model instance's Django version %s does not match " "the current version %s." % (pickled_version, current_version) ) else: msg = "Pickled model instance's Django version is not specified." if msg: warnings.warn(msg, RuntimeWarning, stacklevel=2) self.__dict__.update(state) def _get_pk_val(self, meta=None): if not meta: meta = self._meta return getattr(self, meta.pk.attname) def _set_pk_val(self, value): return setattr(self, self._meta.pk.attname, value) pk = property(_get_pk_val, _set_pk_val) def get_deferred_fields(self): """ Returns a set containing names of deferred fields for this instance. """ return { f.attname for f in self._meta.concrete_fields if isinstance(self.__class__.__dict__.get(f.attname), DeferredAttribute) } def refresh_from_db(self, using=None, fields=None, **kwargs): """ Reloads field values from the database. By default, the reloading happens from the database this instance was loaded from, or by the read router if this instance wasn't loaded from any database. The using parameter will override the default. Fields can be used to specify which fields to reload. The fields should be an iterable of field attnames. If fields is None, then all non-deferred fields are reloaded. When accessing deferred fields of an instance, the deferred loading of the field will call this method. """ if fields is not None: if len(fields) == 0: return if any(LOOKUP_SEP in f for f in fields): raise ValueError( 'Found "%s" in fields argument. Relations and transforms ' 'are not allowed in fields.' % LOOKUP_SEP) db = using if using is not None else self._state.db if self._deferred: non_deferred_model = self._meta.proxy_for_model else: non_deferred_model = self.__class__ db_instance_qs = non_deferred_model._default_manager.using(db).filter(pk=self.pk) # Use provided fields, if not set then reload all non-deferred fields. if fields is not None: fields = list(fields) db_instance_qs = db_instance_qs.only(*fields) elif self._deferred: deferred_fields = self.get_deferred_fields() fields = [f.attname for f in self._meta.concrete_fields if f.attname not in deferred_fields] db_instance_qs = db_instance_qs.only(*fields) db_instance = db_instance_qs.get() non_loaded_fields = db_instance.get_deferred_fields() for field in self._meta.concrete_fields: if field.attname in non_loaded_fields: # This field wasn't refreshed - skip ahead. continue setattr(self, field.attname, getattr(db_instance, field.attname)) # Throw away stale foreign key references. if field.is_relation and field.get_cache_name() in self.__dict__: rel_instance = getattr(self, field.get_cache_name()) local_val = getattr(db_instance, field.attname) related_val = None if rel_instance is None else getattr(rel_instance, field.target_field.attname) if local_val != related_val or (local_val is None and related_val is None): del self.__dict__[field.get_cache_name()] self._state.db = db_instance._state.db def serializable_value(self, field_name): """ Returns the value of the field name for this instance. If the field is a foreign key, returns the id value, instead of the object. If there's no Field object with this name on the model, the model attribute's value is returned directly. Used to serialize a field's value (in the serializer, or form output, for example). Normally, you would just access the attribute directly and not use this method. """ try: field = self._meta.get_field(field_name) except FieldDoesNotExist: return getattr(self, field_name) return getattr(self, field.attname) def save(self, force_insert=False, force_update=False, using=None, update_fields=None): """ Saves the current instance. Override this in a subclass if you want to control the saving process. The 'force_insert' and 'force_update' parameters can be used to insist that the "save" must be an SQL insert or update (or equivalent for non-SQL backends), respectively. Normally, they should not be set. """ # Ensure that a model instance without a PK hasn't been assigned to # a ForeignKey or OneToOneField on this model. If the field is # nullable, allowing the save() would result in silent data loss. for field in self._meta.concrete_fields: if field.is_relation: # If the related field isn't cached, then an instance hasn't # been assigned and there's no need to worry about this check. try: getattr(self, field.get_cache_name()) except AttributeError: continue obj = getattr(self, field.name, None) # A pk may have been assigned manually to a model instance not # saved to the database (or auto-generated in a case like # UUIDField), but we allow the save to proceed and rely on the # database to raise an IntegrityError if applicable. If # constraints aren't supported by the database, there's the # unavoidable risk of data corruption. if obj and obj.pk is None: # Remove the object from a related instance cache. if not field.remote_field.multiple: delattr(obj, field.remote_field.get_cache_name()) raise ValueError( "save() prohibited to prevent data loss due to " "unsaved related object '%s'." % field.name ) using = using or router.db_for_write(self.__class__, instance=self) if force_insert and (force_update or update_fields): raise ValueError("Cannot force both insert and updating in model saving.") if update_fields is not None: # If update_fields is empty, skip the save. We do also check for # no-op saves later on for inheritance cases. This bailout is # still needed for skipping signal sending. if len(update_fields) == 0: return update_fields = frozenset(update_fields) field_names = set() for field in self._meta.fields: if not field.primary_key: field_names.add(field.name) if field.name != field.attname: field_names.add(field.attname) non_model_fields = update_fields.difference(field_names) if non_model_fields: raise ValueError("The following fields do not exist in this " "model or are m2m fields: %s" % ', '.join(non_model_fields)) # If saving to the same database, and this model is deferred, then # automatically do a "update_fields" save on the loaded fields. elif not force_insert and self._deferred and using == self._state.db: field_names = set() for field in self._meta.concrete_fields: if not field.primary_key and not hasattr(field, 'through'): field_names.add(field.attname) deferred_fields = [ f.attname for f in self._meta.fields if (f.attname not in self.__dict__ and isinstance(self.__class__.__dict__[f.attname], DeferredAttribute)) ] loaded_fields = field_names.difference(deferred_fields) if loaded_fields: update_fields = frozenset(loaded_fields) self.save_base(using=using, force_insert=force_insert, force_update=force_update, update_fields=update_fields) save.alters_data = True def save_base(self, raw=False, force_insert=False, force_update=False, using=None, update_fields=None): """ Handles the parts of saving which should be done only once per save, yet need to be done in raw saves, too. This includes some sanity checks and signal sending. The 'raw' argument is telling save_base not to save any parent models and not to do any changes to the values before save. This is used by fixture loading. """ using = using or router.db_for_write(self.__class__, instance=self) assert not (force_insert and (force_update or update_fields)) assert update_fields is None or len(update_fields) > 0 cls = origin = self.__class__ # Skip proxies, but keep the origin as the proxy model. if cls._meta.proxy: cls = cls._meta.concrete_model meta = cls._meta if not meta.auto_created: signals.pre_save.send(sender=origin, instance=self, raw=raw, using=using, update_fields=update_fields) with transaction.atomic(using=using, savepoint=False): if not raw: self._save_parents(cls, using, update_fields) updated = self._save_table(raw, cls, force_insert, force_update, using, update_fields) # Store the database on which the object was saved self._state.db = using # Once saved, this is no longer a to-be-added instance. self._state.adding = False # Signal that the save is complete if not meta.auto_created: signals.post_save.send(sender=origin, instance=self, created=(not updated), update_fields=update_fields, raw=raw, using=using) save_base.alters_data = True def _save_parents(self, cls, using, update_fields): """ Saves all the parents of cls using values from self. """ meta = cls._meta for parent, field in meta.parents.items(): # Make sure the link fields are synced between parent and self. if (field and getattr(self, parent._meta.pk.attname) is None and getattr(self, field.attname) is not None): setattr(self, parent._meta.pk.attname, getattr(self, field.attname)) self._save_parents(cls=parent, using=using, update_fields=update_fields) self._save_table(cls=parent, using=using, update_fields=update_fields) # Set the parent's PK value to self. if field: setattr(self, field.attname, self._get_pk_val(parent._meta)) # Since we didn't have an instance of the parent handy set # attname directly, bypassing the descriptor. Invalidate # the related object cache, in case it's been accidentally # populated. A fresh instance will be re-built from the # database if necessary. cache_name = field.get_cache_name() if hasattr(self, cache_name): delattr(self, cache_name) def _save_table(self, raw=False, cls=None, force_insert=False, force_update=False, using=None, update_fields=None): """ Does the heavy-lifting involved in saving. Updates or inserts the data for a single table. """ meta = cls._meta non_pks = [f for f in meta.local_concrete_fields if not f.primary_key] if update_fields: non_pks = [f for f in non_pks if f.name in update_fields or f.attname in update_fields] pk_val = self._get_pk_val(meta) if pk_val is None: pk_val = meta.pk.get_pk_value_on_save(self) setattr(self, meta.pk.attname, pk_val) pk_set = pk_val is not None if not pk_set and (force_update or update_fields): raise ValueError("Cannot force an update in save() with no primary key.") updated = False # If possible, try an UPDATE. If that doesn't update anything, do an INSERT. if pk_set and not force_insert: base_qs = cls._base_manager.using(using) values = [(f, None, (getattr(self, f.attname) if raw else f.pre_save(self, False))) for f in non_pks] forced_update = update_fields or force_update updated = self._do_update(base_qs, using, pk_val, values, update_fields, forced_update) if force_update and not updated: raise DatabaseError("Forced update did not affect any rows.") if update_fields and not updated: raise DatabaseError("Save with update_fields did not affect any rows.") if not updated: if meta.order_with_respect_to: # If this is a model with an order_with_respect_to # autopopulate the _order field field = meta.order_with_respect_to filter_args = field.get_filter_kwargs_for_object(self) order_value = cls._base_manager.using(using).filter(**filter_args).count() self._order = order_value fields = meta.local_concrete_fields if not pk_set: fields = [f for f in fields if not isinstance(f, AutoField)] update_pk = bool(meta.has_auto_field and not pk_set) result = self._do_insert(cls._base_manager, using, fields, update_pk, raw) if update_pk: setattr(self, meta.pk.attname, result) return updated def _do_update(self, base_qs, using, pk_val, values, update_fields, forced_update): """ This method will try to update the model. If the model was updated (in the sense that an update query was done and a matching row was found from the DB) the method will return True. """ filtered = base_qs.filter(pk=pk_val) if not values: # We can end up here when saving a model in inheritance chain where # update_fields doesn't target any field in current model. In that # case we just say the update succeeded. Another case ending up here # is a model with just PK - in that case check that the PK still # exists. return update_fields is not None or filtered.exists() if self._meta.select_on_save and not forced_update: if filtered.exists(): # It may happen that the object is deleted from the DB right after # this check, causing the subsequent UPDATE to return zero matching # rows. The same result can occur in some rare cases when the # database returns zero despite the UPDATE being executed # successfully (a row is matched and updated). In order to # distinguish these two cases, the object's existence in the # database is again checked for if the UPDATE query returns 0. return filtered._update(values) > 0 or filtered.exists() else: return False return filtered._update(values) > 0 def _do_insert(self, manager, using, fields, update_pk, raw): """ Do an INSERT. If update_pk is defined then this method should return the new pk for the model. """ return manager._insert([self], fields=fields, return_id=update_pk, using=using, raw=raw) def delete(self, using=None, keep_parents=False): using = using or router.db_for_write(self.__class__, instance=self) assert self._get_pk_val() is not None, ( "%s object can't be deleted because its %s attribute is set to None." % (self._meta.object_name, self._meta.pk.attname) ) collector = Collector(using=using) collector.collect([self], keep_parents=keep_parents) return collector.delete() delete.alters_data = True def _get_FIELD_display(self, field): value = getattr(self, field.attname) return force_text(dict(field.flatchoices).get(value, value), strings_only=True) def _get_next_or_previous_by_FIELD(self, field, is_next, **kwargs): if not self.pk: raise ValueError("get_next/get_previous cannot be used on unsaved objects.") op = 'gt' if is_next else 'lt' order = '' if is_next else '-' param = force_text(getattr(self, field.attname)) q = Q(**{'%s__%s' % (field.name, op): param}) q = q | Q(**{field.name: param, 'pk__%s' % op: self.pk}) qs = self.__class__._default_manager.using(self._state.db).filter(**kwargs).filter(q).order_by( '%s%s' % (order, field.name), '%spk' % order ) try: return qs[0] except IndexError: raise self.DoesNotExist("%s matching query does not exist." % self.__class__._meta.object_name) def _get_next_or_previous_in_order(self, is_next): cachename = "__%s_order_cache" % is_next if not hasattr(self, cachename): op = 'gt' if is_next else 'lt' order = '_order' if is_next else '-_order' order_field = self._meta.order_with_respect_to filter_args = order_field.get_filter_kwargs_for_object(self) obj = self._default_manager.filter(**filter_args).filter(**{ '_order__%s' % op: self._default_manager.values('_order').filter(**{ self._meta.pk.name: self.pk }) }).order_by(order)[:1].get() setattr(self, cachename, obj) return getattr(self, cachename) def prepare_database_save(self, field): if self.pk is None: raise ValueError("Unsaved model instance %r cannot be used in an ORM query." % self) return getattr(self, field.remote_field.get_related_field().attname) def clean(self): """ Hook for doing any extra model-wide validation after clean() has been called on every field by self.clean_fields. Any ValidationError raised by this method will not be associated with a particular field; it will have a special-case association with the field defined by NON_FIELD_ERRORS. """ pass def validate_unique(self, exclude=None): """ Checks unique constraints on the model and raises ``ValidationError`` if any failed. """ unique_checks, date_checks = self._get_unique_checks(exclude=exclude) errors = self._perform_unique_checks(unique_checks) date_errors = self._perform_date_checks(date_checks) for k, v in date_errors.items(): errors.setdefault(k, []).extend(v) if errors: raise ValidationError(errors) def _get_unique_checks(self, exclude=None): """ Gather a list of checks to perform. Since validate_unique could be called from a ModelForm, some fields may have been excluded; we can't perform a unique check on a model that is missing fields involved in that check. Fields that did not validate should also be excluded, but they need to be passed in via the exclude argument. """ if exclude is None: exclude = [] unique_checks = [] unique_togethers = [(self.__class__, self._meta.unique_together)] for parent_class in self._meta.get_parent_list(): if parent_class._meta.unique_together: unique_togethers.append((parent_class, parent_class._meta.unique_together)) for model_class, unique_together in unique_togethers: for check in unique_together: for name in check: # If this is an excluded field, don't add this check. if name in exclude: break else: unique_checks.append((model_class, tuple(check))) # These are checks for the unique_for_<date/year/month>. date_checks = [] # Gather a list of checks for fields declared as unique and add them to # the list of checks. fields_with_class = [(self.__class__, self._meta.local_fields)] for parent_class in self._meta.get_parent_list(): fields_with_class.append((parent_class, parent_class._meta.local_fields)) for model_class, fields in fields_with_class: for f in fields: name = f.name if name in exclude: continue if f.unique: unique_checks.append((model_class, (name,))) if f.unique_for_date and f.unique_for_date not in exclude: date_checks.append((model_class, 'date', name, f.unique_for_date)) if f.unique_for_year and f.unique_for_year not in exclude: date_checks.append((model_class, 'year', name, f.unique_for_year)) if f.unique_for_month and f.unique_for_month not in exclude: date_checks.append((model_class, 'month', name, f.unique_for_month)) return unique_checks, date_checks def _perform_unique_checks(self, unique_checks): errors = {} for model_class, unique_check in unique_checks: # Try to look up an existing object with the same values as this # object's values for all the unique field. lookup_kwargs = {} for field_name in unique_check: f = self._meta.get_field(field_name) lookup_value = getattr(self, f.attname) if lookup_value is None: # no value, skip the lookup continue if f.primary_key and not self._state.adding: # no need to check for unique primary key when editing continue lookup_kwargs[str(field_name)] = lookup_value # some fields were skipped, no reason to do the check if len(unique_check) != len(lookup_kwargs): continue qs = model_class._default_manager.filter(**lookup_kwargs) # Exclude the current object from the query if we are editing an # instance (as opposed to creating a new one) # Note that we need to use the pk as defined by model_class, not # self.pk. These can be different fields because model inheritance # allows single model to have effectively multiple primary keys. # Refs #17615. model_class_pk = self._get_pk_val(model_class._meta) if not self._state.adding and model_class_pk is not None: qs = qs.exclude(pk=model_class_pk) if qs.exists(): if len(unique_check) == 1: key = unique_check[0] else: key = NON_FIELD_ERRORS errors.setdefault(key, []).append(self.unique_error_message(model_class, unique_check)) return errors def _perform_date_checks(self, date_checks): errors = {} for model_class, lookup_type, field, unique_for in date_checks: lookup_kwargs = {} # there's a ticket to add a date lookup, we can remove this special # case if that makes it's way in date = getattr(self, unique_for) if date is None: continue if lookup_type == 'date': lookup_kwargs['%s__day' % unique_for] = date.day lookup_kwargs['%s__month' % unique_for] = date.month lookup_kwargs['%s__year' % unique_for] = date.year else: lookup_kwargs['%s__%s' % (unique_for, lookup_type)] = getattr(date, lookup_type) lookup_kwargs[field] = getattr(self, field) qs = model_class._default_manager.filter(**lookup_kwargs) # Exclude the current object from the query if we are editing an # instance (as opposed to creating a new one) if not self._state.adding and self.pk is not None: qs = qs.exclude(pk=self.pk) if qs.exists(): errors.setdefault(field, []).append( self.date_error_message(lookup_type, field, unique_for) ) return errors def date_error_message(self, lookup_type, field_name, unique_for): opts = self._meta field = opts.get_field(field_name) return ValidationError( message=field.error_messages['unique_for_date'], code='unique_for_date', params={ 'model': self, 'model_name': six.text_type(capfirst(opts.verbose_name)), 'lookup_type': lookup_type, 'field': field_name, 'field_label': six.text_type(capfirst(field.verbose_name)), 'date_field': unique_for, 'date_field_label': six.text_type(capfirst(opts.get_field(unique_for).verbose_name)), } ) def unique_error_message(self, model_class, unique_check): opts = model_class._meta params = { 'model': self, 'model_class': model_class, 'model_name': six.text_type(capfirst(opts.verbose_name)), 'unique_check': unique_check, } # A unique field if len(unique_check) == 1: field = opts.get_field(unique_check[0]) params['field_label'] = six.text_type(capfirst(field.verbose_name)) return ValidationError( message=field.error_messages['unique'], code='unique', params=params, ) # unique_together else: field_labels = [capfirst(opts.get_field(f).verbose_name) for f in unique_check] params['field_labels'] = six.text_type(get_text_list(field_labels, _('and'))) return ValidationError( message=_("%(model_name)s with this %(field_labels)s already exists."), code='unique_together', params=params, ) def full_clean(self, exclude=None, validate_unique=True): """ Calls clean_fields, clean, and validate_unique, on the model, and raises a ``ValidationError`` for any errors that occurred. """ errors = {} if exclude is None: exclude = [] else: exclude = list(exclude) try: self.clean_fields(exclude=exclude) except ValidationError as e: errors = e.update_error_dict(errors) # Form.clean() is run even if other validation fails, so do the # same with Model.clean() for consistency. try: self.clean() except ValidationError as e: errors = e.update_error_dict(errors) # Run unique checks, but only for fields that passed validation. if validate_unique: for name in errors.keys(): if name != NON_FIELD_ERRORS and name not in exclude: exclude.append(name) try: self.validate_unique(exclude=exclude) except ValidationError as e: errors = e.update_error_dict(errors) if errors: raise ValidationError(errors) def clean_fields(self, exclude=None): """ Cleans all fields and raises a ValidationError containing a dict of all validation errors if any occur. """ if exclude is None: exclude = [] errors = {} for f in self._meta.fields: if f.name in exclude: continue # Skip validation for empty fields with blank=True. The developer # is responsible for making sure they have a valid value. raw_value = getattr(self, f.attname) if f.blank and raw_value in f.empty_values: continue try: setattr(self, f.attname, f.clean(raw_value, self)) except ValidationError as e: errors[f.name] = e.error_list if errors: raise ValidationError(errors) @classmethod def check(cls, **kwargs): errors = [] errors.extend(cls._check_swappable()) errors.extend(cls._check_model()) errors.extend(cls._check_managers(**kwargs)) if not cls._meta.swapped: errors.extend(cls._check_fields(**kwargs)) errors.extend(cls._check_m2m_through_same_relationship()) errors.extend(cls._check_long_column_names()) clash_errors = cls._check_id_field() + cls._check_field_name_clashes() errors.extend(clash_errors) # If there are field name clashes, hide consequent column name # clashes. if not clash_errors: errors.extend(cls._check_column_name_clashes()) errors.extend(cls._check_index_together()) errors.extend(cls._check_unique_together()) errors.extend(cls._check_ordering()) return errors @classmethod def _check_swappable(cls): """ Check if the swapped model exists. """ errors = [] if cls._meta.swapped: try: apps.get_model(cls._meta.swapped) except ValueError: errors.append( checks.Error( "'%s' is not of the form 'app_label.app_name'." % cls._meta.swappable, id='models.E001', ) ) except LookupError: app_label, model_name = cls._meta.swapped.split('.') errors.append( checks.Error( "'%s' references '%s.%s', which has not been " "installed, or is abstract." % ( cls._meta.swappable, app_label, model_name ), id='models.E002', ) ) return errors @classmethod def _check_model(cls): errors = [] if cls._meta.proxy: if cls._meta.local_fields or cls._meta.local_many_to_many: errors.append( checks.Error( "Proxy model '%s' contains model fields." % cls.__name__, id='models.E017', ) ) return errors @classmethod def _check_managers(cls, **kwargs): """ Perform all manager checks. """ errors = [] for __, manager, __ in cls._meta.managers: errors.extend(manager.check(**kwargs)) return errors @classmethod def _check_fields(cls, **kwargs): """ Perform all field checks. """ errors = [] for field in cls._meta.local_fields: errors.extend(field.check(**kwargs)) for field in cls._meta.local_many_to_many: errors.extend(field.check(from_model=cls, **kwargs)) return errors @classmethod def _check_m2m_through_same_relationship(cls): """ Check if no relationship model is used by more than one m2m field. """ errors = [] seen_intermediary_signatures = [] fields = cls._meta.local_many_to_many # Skip when the target model wasn't found. fields = (f for f in fields if isinstance(f.remote_field.model, ModelBase)) # Skip when the relationship model wasn't found. fields = (f for f in fields if isinstance(f.remote_field.through, ModelBase)) for f in fields: signature = (f.remote_field.model, cls, f.remote_field.through) if signature in seen_intermediary_signatures: errors.append( checks.Error( "The model has two many-to-many relations through " "the intermediate model '%s'." % f.remote_field.through._meta.label, obj=cls, id='models.E003', ) ) else: seen_intermediary_signatures.append(signature) return errors @classmethod def _check_id_field(cls): """ Check if `id` field is a primary key. """ fields = list(f for f in cls._meta.local_fields if f.name == 'id' and f != cls._meta.pk) # fields is empty or consists of the invalid "id" field if fields and not fields[0].primary_key and cls._meta.pk.name == 'id': return [ checks.Error( "'id' can only be used as a field name if the field also " "sets 'primary_key=True'.", obj=cls, id='models.E004', ) ] else: return [] @classmethod def _check_field_name_clashes(cls): """ Ref #17673. """ errors = [] used_fields = {} # name or attname -> field # Check that multi-inheritance doesn't cause field name shadowing. for parent in cls._meta.get_parent_list(): for f in parent._meta.local_fields: clash = used_fields.get(f.name) or used_fields.get(f.attname) or None if clash: errors.append( checks.Error( "The field '%s' from parent model " "'%s' clashes with the field '%s' " "from parent model '%s'." % ( clash.name, clash.model._meta, f.name, f.model._meta ), obj=cls, id='models.E005', ) ) used_fields[f.name] = f used_fields[f.attname] = f # Check that fields defined in the model don't clash with fields from # parents, including auto-generated fields like multi-table inheritance # child accessors. for parent in cls._meta.get_parent_list(): for f in parent._meta.get_fields(): if f not in used_fields: used_fields[f.name] = f for f in cls._meta.local_fields: clash = used_fields.get(f.name) or used_fields.get(f.attname) or None # Note that we may detect clash between user-defined non-unique # field "id" and automatically added unique field "id", both # defined at the same model. This special case is considered in # _check_id_field and here we ignore it. id_conflict = f.name == "id" and clash and clash.name == "id" and clash.model == cls if clash and not id_conflict: errors.append( checks.Error( "The field '%s' clashes with the field '%s' " "from model '%s'." % ( f.name, clash.name, clash.model._meta ), obj=f, id='models.E006', ) ) used_fields[f.name] = f used_fields[f.attname] = f return errors @classmethod def _check_column_name_clashes(cls): # Store a list of column names which have already been used by other fields. used_column_names = [] errors = [] for f in cls._meta.local_fields: _, column_name = f.get_attname_column() # Ensure the column name is not already in use. if column_name and column_name in used_column_names: errors.append( checks.Error( "Field '%s' has column name '%s' that is used by " "another field." % (f.name, column_name), hint="Specify a 'db_column' for the field.", obj=cls, id='models.E007' ) ) else: used_column_names.append(column_name) return errors @classmethod def _check_index_together(cls): """ Check the value of "index_together" option. """ if not isinstance(cls._meta.index_together, (tuple, list)): return [ checks.Error( "'index_together' must be a list or tuple.", obj=cls, id='models.E008', ) ] elif any(not isinstance(fields, (tuple, list)) for fields in cls._meta.index_together): return [ checks.Error( "All 'index_together' elements must be lists or tuples.", obj=cls, id='models.E009', ) ] else: errors = [] for fields in cls._meta.index_together: errors.extend(cls._check_local_fields(fields, "index_together")) return errors @classmethod def _check_unique_together(cls): """ Check the value of "unique_together" option. """ if not isinstance(cls._meta.unique_together, (tuple, list)): return [ checks.Error( "'unique_together' must be a list or tuple.", obj=cls, id='models.E010', ) ] elif any(not isinstance(fields, (tuple, list)) for fields in cls._meta.unique_together): return [ checks.Error( "All 'unique_together' elements must be lists or tuples.", obj=cls, id='models.E011', ) ] else: errors = [] for fields in cls._meta.unique_together: errors.extend(cls._check_local_fields(fields, "unique_together")) return errors @classmethod def _check_local_fields(cls, fields, option): from django.db import models # In order to avoid hitting the relation tree prematurely, we use our # own fields_map instead of using get_field() forward_fields_map = { field.name: field for field in cls._meta._get_fields(reverse=False) } errors = [] for field_name in fields: try: field = forward_fields_map[field_name] except KeyError: errors.append( checks.Error( "'%s' refers to the non-existent field '%s'." % ( option, field_name, ), obj=cls, id='models.E012', ) ) else: if isinstance(field.remote_field, models.ManyToManyRel): errors.append( checks.Error( "'%s' refers to a ManyToManyField '%s', but " "ManyToManyFields are not permitted in '%s'." % ( option, field_name, option, ), obj=cls, id='models.E013', ) ) elif field not in cls._meta.local_fields: errors.append( checks.Error( "'%s' refers to field '%s' which is not local to model '%s'." % (option, field_name, cls._meta.object_name), hint="This issue may be caused by multi-table inheritance.", obj=cls, id='models.E016', ) ) return errors @classmethod def _check_ordering(cls): """ Check "ordering" option -- is it a list of strings and do all fields exist? """ if cls._meta._ordering_clash: return [ checks.Error( "'ordering' and 'order_with_respect_to' cannot be used together.", obj=cls, id='models.E021', ), ] if cls._meta.order_with_respect_to or not cls._meta.ordering: return [] if not isinstance(cls._meta.ordering, (list, tuple)): return [ checks.Error( "'ordering' must be a tuple or list (even if you want to order by only one field).", obj=cls, id='models.E014', ) ] errors = [] fields = cls._meta.ordering # Skip '?' fields. fields = (f for f in fields if f != '?') # Convert "-field" to "field". fields = ((f[1:] if f.startswith('-') else f) for f in fields) # Skip ordering in the format field1__field2 (FIXME: checking # this format would be nice, but it's a little fiddly). fields = (f for f in fields if '__' not in f) # Skip ordering on pk. This is always a valid order_by field # but is an alias and therefore won't be found by opts.get_field. fields = {f for f in fields if f != 'pk'} # Check for invalid or non-existent fields in ordering. invalid_fields = [] # Any field name that is not present in field_names does not exist. # Also, ordering by m2m fields is not allowed. opts = cls._meta valid_fields = set(chain.from_iterable( (f.name, f.attname) if not (f.auto_created and not f.concrete) else (f.field.related_query_name(),) for f in chain(opts.fields, opts.related_objects) )) invalid_fields.extend(fields - valid_fields) for invalid_field in invalid_fields: errors.append( checks.Error( "'ordering' refers to the non-existent field '%s'." % invalid_field, obj=cls, id='models.E015', ) ) return errors @classmethod def _check_long_column_names(cls): """ Check that any auto-generated column names are shorter than the limits for each database in which the model will be created. """ errors = [] allowed_len = None db_alias = None # Find the minimum max allowed length among all specified db_aliases. for db in settings.DATABASES.keys(): # skip databases where the model won't be created if not router.allow_migrate_model(db, cls): continue connection = connections[db] max_name_length = connection.ops.max_name_length() if max_name_length is None or connection.features.truncates_names: continue else: if allowed_len is None: allowed_len = max_name_length db_alias = db elif max_name_length < allowed_len: allowed_len = max_name_length db_alias = db if allowed_len is None: return errors for f in cls._meta.local_fields: _, column_name = f.get_attname_column() # Check if auto-generated name for the field is too long # for the database. if f.db_column is None and column_name is not None and len(column_name) > allowed_len: errors.append( checks.Error( 'Autogenerated column name too long for field "%s". ' 'Maximum length is "%s" for database "%s".' % (column_name, allowed_len, db_alias), hint="Set the column name manually using 'db_column'.", obj=cls, id='models.E018', ) ) for f in cls._meta.local_many_to_many: # Check if auto-generated name for the M2M field is too long # for the database. for m2m in f.remote_field.through._meta.local_fields: _, rel_name = m2m.get_attname_column() if m2m.db_column is None and rel_name is not None and len(rel_name) > allowed_len: errors.append( checks.Error( 'Autogenerated column name too long for M2M field ' '"%s". Maximum length is "%s" for database "%s".' % (rel_name, allowed_len, db_alias), hint=( "Use 'through' to create a separate model for " "M2M and then set column_name using 'db_column'." ), obj=cls, id='models.E019', ) ) return errors ############################################ # HELPER FUNCTIONS (CURRIED MODEL METHODS) # ############################################ # ORDERING METHODS ######################### def method_set_order(ordered_obj, self, id_list, using=None): if using is None: using = DEFAULT_DB_ALIAS order_wrt = ordered_obj._meta.order_with_respect_to filter_args = order_wrt.get_forward_related_filter(self) # FIXME: It would be nice if there was an "update many" version of update # for situations like this. with transaction.atomic(using=using, savepoint=False): for i, j in enumerate(id_list): ordered_obj.objects.filter(pk=j, **filter_args).update(_order=i) def method_get_order(ordered_obj, self): order_wrt = ordered_obj._meta.order_with_respect_to filter_args = order_wrt.get_forward_related_filter(self) pk_name = ordered_obj._meta.pk.name return ordered_obj.objects.filter(**filter_args).values_list(pk_name, flat=True) def make_foreign_order_accessors(model, related_model): setattr( related_model, 'get_%s_order' % model.__name__.lower(), curry(method_get_order, model) ) setattr( related_model, 'set_%s_order' % model.__name__.lower(), curry(method_set_order, model) ) ######## # MISC # ######## def simple_class_factory(model, attrs): """ Needed for dynamic classes. """ return model def model_unpickle(model_id, attrs, factory): """ Used to unpickle Model subclasses with deferred fields. """ if isinstance(model_id, tuple): model = apps.get_model(*model_id) else: # Backwards compat - the model was cached directly in earlier versions. model = model_id cls = factory(model, attrs) return cls.__new__(cls) model_unpickle.__safe_for_unpickle__ = True def unpickle_inner_exception(klass, exception_name): # Get the exception class from the class it is attached to: exception = getattr(klass, exception_name) return exception.__new__(exception)
41.752071
114
0.572639
from __future__ import unicode_literals import copy import inspect import warnings from itertools import chain from django.apps import apps from django.conf import settings from django.core import checks from django.core.exceptions import ( NON_FIELD_ERRORS, FieldDoesNotExist, FieldError, MultipleObjectsReturned, ObjectDoesNotExist, ValidationError, ) from django.db import ( DEFAULT_DB_ALIAS, DJANGO_VERSION_PICKLE_KEY, DatabaseError, connections, router, transaction, ) from django.db.models import signals from django.db.models.constants import LOOKUP_SEP from django.db.models.deletion import CASCADE, Collector from django.db.models.fields import AutoField from django.db.models.fields.related import ( ForeignObjectRel, ManyToOneRel, OneToOneField, lazy_related_operation, resolve_relation, ) from django.db.models.manager import ensure_default_manager from django.db.models.options import Options from django.db.models.query import Q from django.db.models.query_utils import ( DeferredAttribute, deferred_class_factory, ) from django.db.models.utils import make_model_tuple from django.utils import six from django.utils.encoding import force_str, force_text from django.utils.functional import curry from django.utils.six.moves import zip from django.utils.text import capfirst, get_text_list from django.utils.translation import ugettext_lazy as _ from django.utils.version import get_version def subclass_exception(name, parents, module, attached_to=None): class_dict = {'__module__': module} if attached_to is not None: def __reduce__(self): return (unpickle_inner_exception, (attached_to, name), self.args) def __setstate__(self, args): self.args = args class_dict['__reduce__'] = __reduce__ class_dict['__setstate__'] = __setstate__ return type(name, parents, class_dict) class ModelBase(type): def __new__(cls, name, bases, attrs): super_new = super(ModelBase, cls).__new__ parents = [b for b in bases if isinstance(b, ModelBase)] if not parents: return super_new(cls, name, bases, attrs) module = attrs.pop('__module__') new_class = super_new(cls, name, bases, {'__module__': module}) attr_meta = attrs.pop('Meta', None) abstract = getattr(attr_meta, 'abstract', False) if not attr_meta: meta = getattr(new_class, 'Meta', None) else: meta = attr_meta base_meta = getattr(new_class, '_meta', None) app_label = None app_config = apps.get_containing_app_config(module) if getattr(meta, 'app_label', None) is None: if app_config is None: if not abstract: raise RuntimeError( "Model class %s.%s doesn't declare an explicit " "app_label and isn't in an application in " "INSTALLED_APPS." % (module, name) ) else: app_label = app_config.label new_class.add_to_class('_meta', Options(meta, app_label)) if not abstract: new_class.add_to_class( 'DoesNotExist', subclass_exception( str('DoesNotExist'), tuple( x.DoesNotExist for x in parents if hasattr(x, '_meta') and not x._meta.abstract ) or (ObjectDoesNotExist,), module, attached_to=new_class)) new_class.add_to_class( 'MultipleObjectsReturned', subclass_exception( str('MultipleObjectsReturned'), tuple( x.MultipleObjectsReturned for x in parents if hasattr(x, '_meta') and not x._meta.abstract ) or (MultipleObjectsReturned,), module, attached_to=new_class)) if base_meta and not base_meta.abstract: if not hasattr(meta, 'ordering'): new_class._meta.ordering = base_meta.ordering if not hasattr(meta, 'get_latest_by'): new_class._meta.get_latest_by = base_meta.get_latest_by is_proxy = new_class._meta.proxy if is_proxy and base_meta and base_meta.swapped: raise TypeError("%s cannot proxy the swapped model '%s'." % (name, base_meta.swapped)) if getattr(new_class, '_default_manager', None): if not is_proxy: # Multi-table inheritance doesn't inherit default manager from new_class._default_manager = None new_class._base_manager = None else: # set explicitly. new_class._default_manager = new_class._default_manager._copy_to_model(new_class) new_class._base_manager = new_class._base_manager._copy_to_model(new_class) # Add all attributes to the class. for obj_name, obj in attrs.items(): new_class.add_to_class(obj_name, obj) # All the fields of any type declared on this model new_fields = chain( new_class._meta.local_fields, new_class._meta.local_many_to_many, new_class._meta.private_fields ) field_names = {f.name for f in new_fields} # Basic setup for proxy models. if is_proxy: base = None for parent in [kls for kls in parents if hasattr(kls, '_meta')]: if parent._meta.abstract: if parent._meta.fields: raise TypeError( "Abstract base class containing model fields not " "permitted for proxy model '%s'." % name ) else: continue if base is None: base = parent elif parent._meta.concrete_model is not base._meta.concrete_model: raise TypeError("Proxy model '%s' has more than one non-abstract model base class." % name) if base is None: raise TypeError("Proxy model '%s' has no non-abstract model base class." % name) new_class._meta.setup_proxy(base) new_class._meta.concrete_model = base._meta.concrete_model else: new_class._meta.concrete_model = new_class # Collect the parent links for multi-table inheritance. parent_links = {} for base in reversed([new_class] + parents): # Conceptually equivalent to `if base is Model`. if not hasattr(base, '_meta'): continue # Skip concrete parent classes. if base != new_class and not base._meta.abstract: continue # Locate OneToOneField instances. for field in base._meta.local_fields: if isinstance(field, OneToOneField): related = resolve_relation(new_class, field.remote_field.model) parent_links[make_model_tuple(related)] = field # Do the appropriate setup for any model parents. for base in parents: original_base = base if not hasattr(base, '_meta'): # Things without _meta aren't functional models, so they're # uninteresting parents. continue parent_fields = base._meta.local_fields + base._meta.local_many_to_many # Check for clashes between locally declared fields and those # on the base classes (we cannot handle shadowed fields at the # moment). for field in parent_fields: if field.name in field_names: raise FieldError( 'Local field %r in class %r clashes ' 'with field of similar name from ' 'base class %r' % (field.name, name, base.__name__) ) if not base._meta.abstract: # Concrete classes... base = base._meta.concrete_model base_key = make_model_tuple(base) if base_key in parent_links: field = parent_links[base_key] elif not is_proxy: attr_name = '%s_ptr' % base._meta.model_name field = OneToOneField( base, on_delete=CASCADE, name=attr_name, auto_created=True, parent_link=True, ) # Only add the ptr field if it's not already present; if not hasattr(new_class, attr_name): new_class.add_to_class(attr_name, field) else: field = None new_class._meta.parents[base] = field else: base_parents = base._meta.parents.copy() for field in parent_fields: new_field = copy.deepcopy(field) new_class.add_to_class(field.name, new_field) if field.one_to_one: for parent, parent_link in base_parents.items(): if field == parent_link: base_parents[parent] = new_field new_class._meta.parents.update(base_parents) new_class.copy_managers(base._meta.abstract_managers) if is_proxy: new_class.copy_managers(original_base._meta.concrete_managers) for field in base._meta.private_fields: if base._meta.abstract and field.name in field_names: raise FieldError( 'Local field %r in class %r clashes ' 'with field of similar name from ' 'abstract base class %r' % (field.name, name, base.__name__) ) new_class.add_to_class(field.name, copy.deepcopy(field)) if abstract: attr_meta.abstract = False new_class.Meta = attr_meta return new_class new_class._prepare() new_class._meta.apps.register_model(new_class._meta.app_label, new_class) return new_class def copy_managers(cls, base_managers): base_managers.sort() for _, mgr_name, manager in base_managers: # NOQA (redefinition of _) val = getattr(cls, mgr_name, None) if not val or val is manager: new_manager = manager._copy_to_model(cls) cls.add_to_class(mgr_name, new_manager) def add_to_class(cls, name, value): # We should call the contribute_to_class method only if it's bound if not inspect.isclass(value) and hasattr(value, 'contribute_to_class'): value.contribute_to_class(cls, name) else: setattr(cls, name, value) def _prepare(cls): opts = cls._meta opts._prepare(cls) if opts.order_with_respect_to: cls.get_next_in_order = curry(cls._get_next_or_previous_in_order, is_next=True) cls.get_previous_in_order = curry(cls._get_next_or_previous_in_order, is_next=False) # with respect to a GenericForeignKey and don't know what the # contribute_to_class(). if opts.order_with_respect_to.remote_field: wrt = opts.order_with_respect_to remote = wrt.remote_field.model lazy_related_operation(make_foreign_order_accessors, cls, remote) # Give the class a docstring -- its definition. if cls.__doc__ is None: cls.__doc__ = "%s(%s)" % (cls.__name__, ", ".join(f.name for f in opts.fields)) get_absolute_url_override = settings.ABSOLUTE_URL_OVERRIDES.get(opts.label_lower) if get_absolute_url_override: setattr(cls, 'get_absolute_url', get_absolute_url_override) ensure_default_manager(cls) signals.class_prepared.send(sender=cls) class ModelState(object): def __init__(self, db=None): self.db = db # If true, uniqueness validation checks will consider this a new, as-yet-unsaved object. # Necessary for correct validation of new instances of objects with explicit (non-auto) PKs. # This impacts validation only; it has no effect on the actual save. self.adding = True class Model(six.with_metaclass(ModelBase)): _deferred = False def __init__(self, *args, **kwargs): signals.pre_init.send(sender=self.__class__, args=args, kwargs=kwargs) # Set up the storage for instance state self._state = ModelState() # There is a rather weird disparity here; if kwargs, it's set, then args # The reason for the kwargs check is that standard iterator passes in by # args, and instantiation for iteration is 33% faster. args_len = len(args) if args_len > len(self._meta.concrete_fields): # Daft, but matches old exception sans the err msg. raise IndexError("Number of args exceeds number of fields") if not kwargs: fields_iter = iter(self._meta.concrete_fields) # The ordering of the zip calls matter - zip throws StopIteration # when an iter throws it. So if the first iter throws it, the second # is *not* consumed. We rely on this, so don't change the order for val, field in zip(args, fields_iter): setattr(self, field.attname, val) else: fields_iter = iter(self._meta.fields) for val, field in zip(args, fields_iter): setattr(self, field.attname, val) kwargs.pop(field.name, None) if isinstance(field.remote_field, ManyToOneRel): kwargs.pop(field.attname, None) # keywords, or default. for field in fields_iter: is_related_object = False # This slightly odd construct is so that we can access any # data-descriptor object (DeferredAttribute) without triggering its # __get__ method. if (field.attname not in kwargs and (isinstance(self.__class__.__dict__.get(field.attname), DeferredAttribute) or field.column is None)): # This field will be populated on request. continue if kwargs: if isinstance(field.remote_field, ForeignObjectRel): try: # Assume object instance was passed in. rel_obj = kwargs.pop(field.name) is_related_object = True except KeyError: try: # Object instance wasn't passed in -- must be an ID. val = kwargs.pop(field.attname) except KeyError: val = field.get_default() else: if rel_obj is None and field.null: val = None else: try: val = kwargs.pop(field.attname) except KeyError: # This is done with an exception rather than the # default argument on pop because we don't want val = field.get_default() else: val = field.get_default() if is_related_object: setattr(self, field.name, rel_obj) else: setattr(self, field.attname, val) if kwargs: for prop in list(kwargs): try: if isinstance(getattr(self.__class__, prop), property): setattr(self, prop, kwargs[prop]) del kwargs[prop] except AttributeError: pass if kwargs: raise TypeError("'%s' is an invalid keyword argument for this function" % list(kwargs)[0]) super(Model, self).__init__() signals.post_init.send(sender=self.__class__, instance=self) @classmethod def from_db(cls, db, field_names, values): if cls._deferred: new = cls(**dict(zip(field_names, values))) else: new = cls(*values) new._state.adding = False new._state.db = db return new def __repr__(self): try: u = six.text_type(self) except (UnicodeEncodeError, UnicodeDecodeError): u = '[Bad Unicode data]' return force_str('<%s: %s>' % (self.__class__.__name__, u)) def __str__(self): if six.PY2 and hasattr(self, '__unicode__'): return force_text(self).encode('utf-8') return str('%s object' % self.__class__.__name__) def __eq__(self, other): if not isinstance(other, Model): return False if self._meta.concrete_model != other._meta.concrete_model: return False my_pk = self._get_pk_val() if my_pk is None: return self is other return my_pk == other._get_pk_val() def __ne__(self, other): return not self.__eq__(other) def __hash__(self): if self._get_pk_val() is None: raise TypeError("Model instances without primary key value are unhashable") return hash(self._get_pk_val()) def __reduce__(self): data = self.__dict__ data[DJANGO_VERSION_PICKLE_KEY] = get_version() if not self._deferred: class_id = self._meta.app_label, self._meta.object_name return model_unpickle, (class_id, [], simple_class_factory), data defers = [] for field in self._meta.fields: if isinstance(self.__class__.__dict__.get(field.attname), DeferredAttribute): defers.append(field.attname) model = self._meta.proxy_for_model class_id = model._meta.app_label, model._meta.object_name return (model_unpickle, (class_id, defers, deferred_class_factory), data) def __setstate__(self, state): msg = None pickled_version = state.get(DJANGO_VERSION_PICKLE_KEY) if pickled_version: current_version = get_version() if current_version != pickled_version: msg = ( "Pickled model instance's Django version %s does not match " "the current version %s." % (pickled_version, current_version) ) else: msg = "Pickled model instance's Django version is not specified." if msg: warnings.warn(msg, RuntimeWarning, stacklevel=2) self.__dict__.update(state) def _get_pk_val(self, meta=None): if not meta: meta = self._meta return getattr(self, meta.pk.attname) def _set_pk_val(self, value): return setattr(self, self._meta.pk.attname, value) pk = property(_get_pk_val, _set_pk_val) def get_deferred_fields(self): return { f.attname for f in self._meta.concrete_fields if isinstance(self.__class__.__dict__.get(f.attname), DeferredAttribute) } def refresh_from_db(self, using=None, fields=None, **kwargs): if fields is not None: if len(fields) == 0: return if any(LOOKUP_SEP in f for f in fields): raise ValueError( 'Found "%s" in fields argument. Relations and transforms ' 'are not allowed in fields.' % LOOKUP_SEP) db = using if using is not None else self._state.db if self._deferred: non_deferred_model = self._meta.proxy_for_model else: non_deferred_model = self.__class__ db_instance_qs = non_deferred_model._default_manager.using(db).filter(pk=self.pk) if fields is not None: fields = list(fields) db_instance_qs = db_instance_qs.only(*fields) elif self._deferred: deferred_fields = self.get_deferred_fields() fields = [f.attname for f in self._meta.concrete_fields if f.attname not in deferred_fields] db_instance_qs = db_instance_qs.only(*fields) db_instance = db_instance_qs.get() non_loaded_fields = db_instance.get_deferred_fields() for field in self._meta.concrete_fields: if field.attname in non_loaded_fields: continue setattr(self, field.attname, getattr(db_instance, field.attname)) # Throw away stale foreign key references. if field.is_relation and field.get_cache_name() in self.__dict__: rel_instance = getattr(self, field.get_cache_name()) local_val = getattr(db_instance, field.attname) related_val = None if rel_instance is None else getattr(rel_instance, field.target_field.attname) if local_val != related_val or (local_val is None and related_val is None): del self.__dict__[field.get_cache_name()] self._state.db = db_instance._state.db def serializable_value(self, field_name): try: field = self._meta.get_field(field_name) except FieldDoesNotExist: return getattr(self, field_name) return getattr(self, field.attname) def save(self, force_insert=False, force_update=False, using=None, update_fields=None): # Ensure that a model instance without a PK hasn't been assigned to for field in self._meta.concrete_fields: if field.is_relation: try: getattr(self, field.get_cache_name()) except AttributeError: continue obj = getattr(self, field.name, None) # A pk may have been assigned manually to a model instance not # saved to the database (or auto-generated in a case like # UUIDField), but we allow the save to proceed and rely on the # database to raise an IntegrityError if applicable. If # constraints aren't supported by the database, there's the # unavoidable risk of data corruption. if obj and obj.pk is None: # Remove the object from a related instance cache. if not field.remote_field.multiple: delattr(obj, field.remote_field.get_cache_name()) raise ValueError( "save() prohibited to prevent data loss due to " "unsaved related object '%s'." % field.name ) using = using or router.db_for_write(self.__class__, instance=self) if force_insert and (force_update or update_fields): raise ValueError("Cannot force both insert and updating in model saving.") if update_fields is not None: # If update_fields is empty, skip the save. We do also check for # no-op saves later on for inheritance cases. This bailout is # still needed for skipping signal sending. if len(update_fields) == 0: return update_fields = frozenset(update_fields) field_names = set() for field in self._meta.fields: if not field.primary_key: field_names.add(field.name) if field.name != field.attname: field_names.add(field.attname) non_model_fields = update_fields.difference(field_names) if non_model_fields: raise ValueError("The following fields do not exist in this " "model or are m2m fields: %s" % ', '.join(non_model_fields)) # If saving to the same database, and this model is deferred, then # automatically do a "update_fields" save on the loaded fields. elif not force_insert and self._deferred and using == self._state.db: field_names = set() for field in self._meta.concrete_fields: if not field.primary_key and not hasattr(field, 'through'): field_names.add(field.attname) deferred_fields = [ f.attname for f in self._meta.fields if (f.attname not in self.__dict__ and isinstance(self.__class__.__dict__[f.attname], DeferredAttribute)) ] loaded_fields = field_names.difference(deferred_fields) if loaded_fields: update_fields = frozenset(loaded_fields) self.save_base(using=using, force_insert=force_insert, force_update=force_update, update_fields=update_fields) save.alters_data = True def save_base(self, raw=False, force_insert=False, force_update=False, using=None, update_fields=None): using = using or router.db_for_write(self.__class__, instance=self) assert not (force_insert and (force_update or update_fields)) assert update_fields is None or len(update_fields) > 0 cls = origin = self.__class__ # Skip proxies, but keep the origin as the proxy model. if cls._meta.proxy: cls = cls._meta.concrete_model meta = cls._meta if not meta.auto_created: signals.pre_save.send(sender=origin, instance=self, raw=raw, using=using, update_fields=update_fields) with transaction.atomic(using=using, savepoint=False): if not raw: self._save_parents(cls, using, update_fields) updated = self._save_table(raw, cls, force_insert, force_update, using, update_fields) # Store the database on which the object was saved self._state.db = using # Once saved, this is no longer a to-be-added instance. self._state.adding = False # Signal that the save is complete if not meta.auto_created: signals.post_save.send(sender=origin, instance=self, created=(not updated), update_fields=update_fields, raw=raw, using=using) save_base.alters_data = True def _save_parents(self, cls, using, update_fields): meta = cls._meta for parent, field in meta.parents.items(): # Make sure the link fields are synced between parent and self. if (field and getattr(self, parent._meta.pk.attname) is None and getattr(self, field.attname) is not None): setattr(self, parent._meta.pk.attname, getattr(self, field.attname)) self._save_parents(cls=parent, using=using, update_fields=update_fields) self._save_table(cls=parent, using=using, update_fields=update_fields) # Set the parent's PK value to self. if field: setattr(self, field.attname, self._get_pk_val(parent._meta)) # attname directly, bypassing the descriptor. Invalidate # the related object cache, in case it's been accidentally cache_name = field.get_cache_name() if hasattr(self, cache_name): delattr(self, cache_name) def _save_table(self, raw=False, cls=None, force_insert=False, force_update=False, using=None, update_fields=None): meta = cls._meta non_pks = [f for f in meta.local_concrete_fields if not f.primary_key] if update_fields: non_pks = [f for f in non_pks if f.name in update_fields or f.attname in update_fields] pk_val = self._get_pk_val(meta) if pk_val is None: pk_val = meta.pk.get_pk_value_on_save(self) setattr(self, meta.pk.attname, pk_val) pk_set = pk_val is not None if not pk_set and (force_update or update_fields): raise ValueError("Cannot force an update in save() with no primary key.") updated = False if pk_set and not force_insert: base_qs = cls._base_manager.using(using) values = [(f, None, (getattr(self, f.attname) if raw else f.pre_save(self, False))) for f in non_pks] forced_update = update_fields or force_update updated = self._do_update(base_qs, using, pk_val, values, update_fields, forced_update) if force_update and not updated: raise DatabaseError("Forced update did not affect any rows.") if update_fields and not updated: raise DatabaseError("Save with update_fields did not affect any rows.") if not updated: if meta.order_with_respect_to: # If this is a model with an order_with_respect_to # autopopulate the _order field field = meta.order_with_respect_to filter_args = field.get_filter_kwargs_for_object(self) order_value = cls._base_manager.using(using).filter(**filter_args).count() self._order = order_value fields = meta.local_concrete_fields if not pk_set: fields = [f for f in fields if not isinstance(f, AutoField)] update_pk = bool(meta.has_auto_field and not pk_set) result = self._do_insert(cls._base_manager, using, fields, update_pk, raw) if update_pk: setattr(self, meta.pk.attname, result) return updated def _do_update(self, base_qs, using, pk_val, values, update_fields, forced_update): filtered = base_qs.filter(pk=pk_val) if not values: # We can end up here when saving a model in inheritance chain where # update_fields doesn't target any field in current model. In that return update_fields is not None or filtered.exists() if self._meta.select_on_save and not forced_update: if filtered.exists(): # database is again checked for if the UPDATE query returns 0. return filtered._update(values) > 0 or filtered.exists() else: return False return filtered._update(values) > 0 def _do_insert(self, manager, using, fields, update_pk, raw): return manager._insert([self], fields=fields, return_id=update_pk, using=using, raw=raw) def delete(self, using=None, keep_parents=False): using = using or router.db_for_write(self.__class__, instance=self) assert self._get_pk_val() is not None, ( "%s object can't be deleted because its %s attribute is set to None." % (self._meta.object_name, self._meta.pk.attname) ) collector = Collector(using=using) collector.collect([self], keep_parents=keep_parents) return collector.delete() delete.alters_data = True def _get_FIELD_display(self, field): value = getattr(self, field.attname) return force_text(dict(field.flatchoices).get(value, value), strings_only=True) def _get_next_or_previous_by_FIELD(self, field, is_next, **kwargs): if not self.pk: raise ValueError("get_next/get_previous cannot be used on unsaved objects.") op = 'gt' if is_next else 'lt' order = '' if is_next else '-' param = force_text(getattr(self, field.attname)) q = Q(**{'%s__%s' % (field.name, op): param}) q = q | Q(**{field.name: param, 'pk__%s' % op: self.pk}) qs = self.__class__._default_manager.using(self._state.db).filter(**kwargs).filter(q).order_by( '%s%s' % (order, field.name), '%spk' % order ) try: return qs[0] except IndexError: raise self.DoesNotExist("%s matching query does not exist." % self.__class__._meta.object_name) def _get_next_or_previous_in_order(self, is_next): cachename = "__%s_order_cache" % is_next if not hasattr(self, cachename): op = 'gt' if is_next else 'lt' order = '_order' if is_next else '-_order' order_field = self._meta.order_with_respect_to filter_args = order_field.get_filter_kwargs_for_object(self) obj = self._default_manager.filter(**filter_args).filter(**{ '_order__%s' % op: self._default_manager.values('_order').filter(**{ self._meta.pk.name: self.pk }) }).order_by(order)[:1].get() setattr(self, cachename, obj) return getattr(self, cachename) def prepare_database_save(self, field): if self.pk is None: raise ValueError("Unsaved model instance %r cannot be used in an ORM query." % self) return getattr(self, field.remote_field.get_related_field().attname) def clean(self): pass def validate_unique(self, exclude=None): unique_checks, date_checks = self._get_unique_checks(exclude=exclude) errors = self._perform_unique_checks(unique_checks) date_errors = self._perform_date_checks(date_checks) for k, v in date_errors.items(): errors.setdefault(k, []).extend(v) if errors: raise ValidationError(errors) def _get_unique_checks(self, exclude=None): if exclude is None: exclude = [] unique_checks = [] unique_togethers = [(self.__class__, self._meta.unique_together)] for parent_class in self._meta.get_parent_list(): if parent_class._meta.unique_together: unique_togethers.append((parent_class, parent_class._meta.unique_together)) for model_class, unique_together in unique_togethers: for check in unique_together: for name in check: if name in exclude: break else: unique_checks.append((model_class, tuple(check))) # These are checks for the unique_for_<date/year/month>. date_checks = [] # Gather a list of checks for fields declared as unique and add them to # the list of checks. fields_with_class = [(self.__class__, self._meta.local_fields)] for parent_class in self._meta.get_parent_list(): fields_with_class.append((parent_class, parent_class._meta.local_fields)) for model_class, fields in fields_with_class: for f in fields: name = f.name if name in exclude: continue if f.unique: unique_checks.append((model_class, (name,))) if f.unique_for_date and f.unique_for_date not in exclude: date_checks.append((model_class, 'date', name, f.unique_for_date)) if f.unique_for_year and f.unique_for_year not in exclude: date_checks.append((model_class, 'year', name, f.unique_for_year)) if f.unique_for_month and f.unique_for_month not in exclude: date_checks.append((model_class, 'month', name, f.unique_for_month)) return unique_checks, date_checks def _perform_unique_checks(self, unique_checks): errors = {} for model_class, unique_check in unique_checks: # Try to look up an existing object with the same values as this # object's values for all the unique field. lookup_kwargs = {} for field_name in unique_check: f = self._meta.get_field(field_name) lookup_value = getattr(self, f.attname) if lookup_value is None: continue if f.primary_key and not self._state.adding: continue lookup_kwargs[str(field_name)] = lookup_value if len(unique_check) != len(lookup_kwargs): continue qs = model_class._default_manager.filter(**lookup_kwargs) model_class_pk = self._get_pk_val(model_class._meta) if not self._state.adding and model_class_pk is not None: qs = qs.exclude(pk=model_class_pk) if qs.exists(): if len(unique_check) == 1: key = unique_check[0] else: key = NON_FIELD_ERRORS errors.setdefault(key, []).append(self.unique_error_message(model_class, unique_check)) return errors def _perform_date_checks(self, date_checks): errors = {} for model_class, lookup_type, field, unique_for in date_checks: lookup_kwargs = {} # case if that makes it's way in date = getattr(self, unique_for) if date is None: continue if lookup_type == 'date': lookup_kwargs['%s__day' % unique_for] = date.day lookup_kwargs['%s__month' % unique_for] = date.month lookup_kwargs['%s__year' % unique_for] = date.year else: lookup_kwargs['%s__%s' % (unique_for, lookup_type)] = getattr(date, lookup_type) lookup_kwargs[field] = getattr(self, field) qs = model_class._default_manager.filter(**lookup_kwargs) if not self._state.adding and self.pk is not None: qs = qs.exclude(pk=self.pk) if qs.exists(): errors.setdefault(field, []).append( self.date_error_message(lookup_type, field, unique_for) ) return errors def date_error_message(self, lookup_type, field_name, unique_for): opts = self._meta field = opts.get_field(field_name) return ValidationError( message=field.error_messages['unique_for_date'], code='unique_for_date', params={ 'model': self, 'model_name': six.text_type(capfirst(opts.verbose_name)), 'lookup_type': lookup_type, 'field': field_name, 'field_label': six.text_type(capfirst(field.verbose_name)), 'date_field': unique_for, 'date_field_label': six.text_type(capfirst(opts.get_field(unique_for).verbose_name)), } ) def unique_error_message(self, model_class, unique_check): opts = model_class._meta params = { 'model': self, 'model_class': model_class, 'model_name': six.text_type(capfirst(opts.verbose_name)), 'unique_check': unique_check, } if len(unique_check) == 1: field = opts.get_field(unique_check[0]) params['field_label'] = six.text_type(capfirst(field.verbose_name)) return ValidationError( message=field.error_messages['unique'], code='unique', params=params, ) else: field_labels = [capfirst(opts.get_field(f).verbose_name) for f in unique_check] params['field_labels'] = six.text_type(get_text_list(field_labels, _('and'))) return ValidationError( message=_("%(model_name)s with this %(field_labels)s already exists."), code='unique_together', params=params, ) def full_clean(self, exclude=None, validate_unique=True): errors = {} if exclude is None: exclude = [] else: exclude = list(exclude) try: self.clean_fields(exclude=exclude) except ValidationError as e: errors = e.update_error_dict(errors) try: self.clean() except ValidationError as e: errors = e.update_error_dict(errors) if validate_unique: for name in errors.keys(): if name != NON_FIELD_ERRORS and name not in exclude: exclude.append(name) try: self.validate_unique(exclude=exclude) except ValidationError as e: errors = e.update_error_dict(errors) if errors: raise ValidationError(errors) def clean_fields(self, exclude=None): if exclude is None: exclude = [] errors = {} for f in self._meta.fields: if f.name in exclude: continue raw_value = getattr(self, f.attname) if f.blank and raw_value in f.empty_values: continue try: setattr(self, f.attname, f.clean(raw_value, self)) except ValidationError as e: errors[f.name] = e.error_list if errors: raise ValidationError(errors) @classmethod def check(cls, **kwargs): errors = [] errors.extend(cls._check_swappable()) errors.extend(cls._check_model()) errors.extend(cls._check_managers(**kwargs)) if not cls._meta.swapped: errors.extend(cls._check_fields(**kwargs)) errors.extend(cls._check_m2m_through_same_relationship()) errors.extend(cls._check_long_column_names()) clash_errors = cls._check_id_field() + cls._check_field_name_clashes() errors.extend(clash_errors) if not clash_errors: errors.extend(cls._check_column_name_clashes()) errors.extend(cls._check_index_together()) errors.extend(cls._check_unique_together()) errors.extend(cls._check_ordering()) return errors @classmethod def _check_swappable(cls): errors = [] if cls._meta.swapped: try: apps.get_model(cls._meta.swapped) except ValueError: errors.append( checks.Error( "'%s' is not of the form 'app_label.app_name'." % cls._meta.swappable, id='models.E001', ) ) except LookupError: app_label, model_name = cls._meta.swapped.split('.') errors.append( checks.Error( "'%s' references '%s.%s', which has not been " "installed, or is abstract." % ( cls._meta.swappable, app_label, model_name ), id='models.E002', ) ) return errors @classmethod def _check_model(cls): errors = [] if cls._meta.proxy: if cls._meta.local_fields or cls._meta.local_many_to_many: errors.append( checks.Error( "Proxy model '%s' contains model fields." % cls.__name__, id='models.E017', ) ) return errors @classmethod def _check_managers(cls, **kwargs): errors = [] for __, manager, __ in cls._meta.managers: errors.extend(manager.check(**kwargs)) return errors @classmethod def _check_fields(cls, **kwargs): errors = [] for field in cls._meta.local_fields: errors.extend(field.check(**kwargs)) for field in cls._meta.local_many_to_many: errors.extend(field.check(from_model=cls, **kwargs)) return errors @classmethod def _check_m2m_through_same_relationship(cls): errors = [] seen_intermediary_signatures = [] fields = cls._meta.local_many_to_many fields = (f for f in fields if isinstance(f.remote_field.model, ModelBase)) # Skip when the relationship model wasn't found. fields = (f for f in fields if isinstance(f.remote_field.through, ModelBase)) for f in fields: signature = (f.remote_field.model, cls, f.remote_field.through) if signature in seen_intermediary_signatures: errors.append( checks.Error( "The model has two many-to-many relations through " "the intermediate model '%s'." % f.remote_field.through._meta.label, obj=cls, id='models.E003', ) ) else: seen_intermediary_signatures.append(signature) return errors @classmethod def _check_id_field(cls): fields = list(f for f in cls._meta.local_fields if f.name == 'id' and f != cls._meta.pk) if fields and not fields[0].primary_key and cls._meta.pk.name == 'id': return [ checks.Error( "'id' can only be used as a field name if the field also " "sets 'primary_key=True'.", obj=cls, id='models.E004', ) ] else: return [] @classmethod def _check_field_name_clashes(cls): errors = [] used_fields = {} for parent in cls._meta.get_parent_list(): for f in parent._meta.local_fields: clash = used_fields.get(f.name) or used_fields.get(f.attname) or None if clash: errors.append( checks.Error( "The field '%s' from parent model " "'%s' clashes with the field '%s' " "from parent model '%s'." % ( clash.name, clash.model._meta, f.name, f.model._meta ), obj=cls, id='models.E005', ) ) used_fields[f.name] = f used_fields[f.attname] = f # Check that fields defined in the model don't clash with fields from for parent in cls._meta.get_parent_list(): for f in parent._meta.get_fields(): if f not in used_fields: used_fields[f.name] = f for f in cls._meta.local_fields: clash = used_fields.get(f.name) or used_fields.get(f.attname) or None id_conflict = f.name == "id" and clash and clash.name == "id" and clash.model == cls if clash and not id_conflict: errors.append( checks.Error( "The field '%s' clashes with the field '%s' " "from model '%s'." % ( f.name, clash.name, clash.model._meta ), obj=f, id='models.E006', ) ) used_fields[f.name] = f used_fields[f.attname] = f return errors @classmethod def _check_column_name_clashes(cls): used_column_names = [] errors = [] for f in cls._meta.local_fields: _, column_name = f.get_attname_column() if column_name and column_name in used_column_names: errors.append( checks.Error( "Field '%s' has column name '%s' that is used by " "another field." % (f.name, column_name), hint="Specify a 'db_column' for the field.", obj=cls, id='models.E007' ) ) else: used_column_names.append(column_name) return errors @classmethod def _check_index_together(cls): if not isinstance(cls._meta.index_together, (tuple, list)): return [ checks.Error( "'index_together' must be a list or tuple.", obj=cls, id='models.E008', ) ] elif any(not isinstance(fields, (tuple, list)) for fields in cls._meta.index_together): return [ checks.Error( "All 'index_together' elements must be lists or tuples.", obj=cls, id='models.E009', ) ] else: errors = [] for fields in cls._meta.index_together: errors.extend(cls._check_local_fields(fields, "index_together")) return errors @classmethod def _check_unique_together(cls): if not isinstance(cls._meta.unique_together, (tuple, list)): return [ checks.Error( "'unique_together' must be a list or tuple.", obj=cls, id='models.E010', ) ] elif any(not isinstance(fields, (tuple, list)) for fields in cls._meta.unique_together): return [ checks.Error( "All 'unique_together' elements must be lists or tuples.", obj=cls, id='models.E011', ) ] else: errors = [] for fields in cls._meta.unique_together: errors.extend(cls._check_local_fields(fields, "unique_together")) return errors @classmethod def _check_local_fields(cls, fields, option): from django.db import models forward_fields_map = { field.name: field for field in cls._meta._get_fields(reverse=False) } errors = [] for field_name in fields: try: field = forward_fields_map[field_name] except KeyError: errors.append( checks.Error( "'%s' refers to the non-existent field '%s'." % ( option, field_name, ), obj=cls, id='models.E012', ) ) else: if isinstance(field.remote_field, models.ManyToManyRel): errors.append( checks.Error( "'%s' refers to a ManyToManyField '%s', but " "ManyToManyFields are not permitted in '%s'." % ( option, field_name, option, ), obj=cls, id='models.E013', ) ) elif field not in cls._meta.local_fields: errors.append( checks.Error( "'%s' refers to field '%s' which is not local to model '%s'." % (option, field_name, cls._meta.object_name), hint="This issue may be caused by multi-table inheritance.", obj=cls, id='models.E016', ) ) return errors @classmethod def _check_ordering(cls): if cls._meta._ordering_clash: return [ checks.Error( "'ordering' and 'order_with_respect_to' cannot be used together.", obj=cls, id='models.E021', ), ] if cls._meta.order_with_respect_to or not cls._meta.ordering: return [] if not isinstance(cls._meta.ordering, (list, tuple)): return [ checks.Error( "'ordering' must be a tuple or list (even if you want to order by only one field).", obj=cls, id='models.E014', ) ] errors = [] fields = cls._meta.ordering fields = (f for f in fields if f != '?') fields = ((f[1:] if f.startswith('-') else f) for f in fields) fields = (f for f in fields if '__' not in f) # Skip ordering on pk. This is always a valid order_by field # but is an alias and therefore won't be found by opts.get_field. fields = {f for f in fields if f != 'pk'} invalid_fields = [] opts = cls._meta valid_fields = set(chain.from_iterable( (f.name, f.attname) if not (f.auto_created and not f.concrete) else (f.field.related_query_name(),) for f in chain(opts.fields, opts.related_objects) )) invalid_fields.extend(fields - valid_fields) for invalid_field in invalid_fields: errors.append( checks.Error( "'ordering' refers to the non-existent field '%s'." % invalid_field, obj=cls, id='models.E015', ) ) return errors @classmethod def _check_long_column_names(cls): errors = [] allowed_len = None db_alias = None for db in settings.DATABASES.keys(): if not router.allow_migrate_model(db, cls): continue connection = connections[db] max_name_length = connection.ops.max_name_length() if max_name_length is None or connection.features.truncates_names: continue else: if allowed_len is None: allowed_len = max_name_length db_alias = db elif max_name_length < allowed_len: allowed_len = max_name_length db_alias = db if allowed_len is None: return errors for f in cls._meta.local_fields: _, column_name = f.get_attname_column() # Check if auto-generated name for the field is too long # for the database. if f.db_column is None and column_name is not None and len(column_name) > allowed_len: errors.append( checks.Error( 'Autogenerated column name too long for field "%s". ' 'Maximum length is "%s" for database "%s".' % (column_name, allowed_len, db_alias), hint="Set the column name manually using 'db_column'.", obj=cls, id='models.E018', ) ) for f in cls._meta.local_many_to_many: # Check if auto-generated name for the M2M field is too long # for the database. for m2m in f.remote_field.through._meta.local_fields: _, rel_name = m2m.get_attname_column() if m2m.db_column is None and rel_name is not None and len(rel_name) > allowed_len: errors.append( checks.Error( 'Autogenerated column name too long for M2M field ' '"%s". Maximum length is "%s" for database "%s".' % (rel_name, allowed_len, db_alias), hint=( "Use 'through' to create a separate model for " "M2M and then set column_name using 'db_column'." ), obj=cls, id='models.E019', ) ) return errors ############################################ # HELPER FUNCTIONS (CURRIED MODEL METHODS) # ############################################ # ORDERING METHODS ######################### def method_set_order(ordered_obj, self, id_list, using=None): if using is None: using = DEFAULT_DB_ALIAS order_wrt = ordered_obj._meta.order_with_respect_to filter_args = order_wrt.get_forward_related_filter(self) # FIXME: It would be nice if there was an "update many" version of update # for situations like this. with transaction.atomic(using=using, savepoint=False): for i, j in enumerate(id_list): ordered_obj.objects.filter(pk=j, **filter_args).update(_order=i) def method_get_order(ordered_obj, self): order_wrt = ordered_obj._meta.order_with_respect_to filter_args = order_wrt.get_forward_related_filter(self) pk_name = ordered_obj._meta.pk.name return ordered_obj.objects.filter(**filter_args).values_list(pk_name, flat=True) def make_foreign_order_accessors(model, related_model): setattr( related_model, 'get_%s_order' % model.__name__.lower(), curry(method_get_order, model) ) setattr( related_model, 'set_%s_order' % model.__name__.lower(), curry(method_set_order, model) ) ######## # MISC # ######## def simple_class_factory(model, attrs): return model def model_unpickle(model_id, attrs, factory): if isinstance(model_id, tuple): model = apps.get_model(*model_id) else: # Backwards compat - the model was cached directly in earlier versions. model = model_id cls = factory(model, attrs) return cls.__new__(cls) model_unpickle.__safe_for_unpickle__ = True def unpickle_inner_exception(klass, exception_name): # Get the exception class from the class it is attached to: exception = getattr(klass, exception_name) return exception.__new__(exception)
true
true
1c4552d4e09eadd115dbba54a37526988ca931f4
1,291
py
Python
examples/django/backend/urls.py
envoy/polarwind
bb9781c00abe2b6dfd96b24e8820c6ec50be3e24
[ "MIT" ]
15
2020-06-23T15:23:53.000Z
2022-01-12T21:28:06.000Z
examples/django/backend/urls.py
envoy/polarwind
bb9781c00abe2b6dfd96b24e8820c6ec50be3e24
[ "MIT" ]
221
2020-06-25T18:25:30.000Z
2022-03-24T13:06:20.000Z
examples/django/backend/urls.py
envoy/polarwind
bb9781c00abe2b6dfd96b24e8820c6ec50be3e24
[ "MIT" ]
null
null
null
"""backend URL Configuration The `urlpatterns` list routes URLs to views. For more information please see: https://docs.djangoproject.com/en/3.0/topics/http/urls/ Examples: Function views 1. Add an import: from my_app import views 2. Add a URL to urlpatterns: path('', views.home, name='home') Class-based views 1. Add an import: from other_app.views import Home 2. Add a URL to urlpatterns: path('', Home.as_view(), name='home') Including another URLconf 1. Import the include() function: from django.urls import include, path 2. Add a URL to urlpatterns: path('blog/', include('blog.urls')) """ from django.contrib import admin from django.urls import path, re_path, include from django.conf import settings from cra_helper.views import proxy_cra_requests from . import views urlpatterns = [ path('', views.home_view, name='home'), path('auth', include('envoy_auth.urls')), path('admin/', admin.site.urls), ] # add a reverse-proxy view to help React in the Django view talk to Create-React-App if settings.DEBUG: proxy_urls = [ re_path(r'^__webpack_dev_server__/(?P<path>.*)$', proxy_cra_requests), re_path(r'^(?P<path>.+\.hot-update\.(json|js|js\.map))$', proxy_cra_requests), ] urlpatterns.extend(proxy_urls)
34.891892
86
0.703331
from django.contrib import admin from django.urls import path, re_path, include from django.conf import settings from cra_helper.views import proxy_cra_requests from . import views urlpatterns = [ path('', views.home_view, name='home'), path('auth', include('envoy_auth.urls')), path('admin/', admin.site.urls), ] if settings.DEBUG: proxy_urls = [ re_path(r'^__webpack_dev_server__/(?P<path>.*)$', proxy_cra_requests), re_path(r'^(?P<path>.+\.hot-update\.(json|js|js\.map))$', proxy_cra_requests), ] urlpatterns.extend(proxy_urls)
true
true
1c45542f594a46b1b10eaa45a732b7fa7822eaba
11,884
py
Python
virtual_ta/data_conversions.py
ilankham/virtual-teaching-assistant
105dddee4284209d1deebbfa60793ba7d99c3748
[ "MIT" ]
2
2017-11-21T20:42:41.000Z
2018-03-05T01:18:30.000Z
virtual_ta/data_conversions.py
ilankham/virtual-teaching-assistant
105dddee4284209d1deebbfa60793ba7d99c3748
[ "MIT" ]
null
null
null
virtual_ta/data_conversions.py
ilankham/virtual-teaching-assistant
105dddee4284209d1deebbfa60793ba7d99c3748
[ "MIT" ]
null
null
null
"""Creates functions for converting between data formats""" from calendar import day_name from collections import OrderedDict from csv import DictReader from datetime import date, timedelta from io import BytesIO, FileIO, StringIO, TextIOWrapper from typing import BinaryIO, Dict, List, TextIO, Union from openpyxl import load_workbook from ruamel.yaml import YAML from ruamel.yaml.comments import CommentedMap FileIO = Union[BinaryIO, BytesIO, FileIO, StringIO, TextIO, TextIOWrapper] def convert_csv_to_dict( data_csv_fp: FileIO, *, key: str = None, ) -> Dict[str, Dict[str, str]]: """Converts a CSV file to a dictionary of dictionaries This function inputs a CSV file and a key column (defaulting to the left-most column, if not specified) and outputs a dictionary keyed by the specified key column and having as values dictionaries encoding the row from the CSV file corresponding to the key value Args: data_csv_fp: pointer to CSV file or file-like object with columns headers in its first row and ready to be read from key: a column header from data_csv_fp, whose values should be used as keys in the dictionary generated Returns: A dictionary keyed by the specified key column and having as values dictionaries encoding the row from the CSV file corresponding to the key value """ csv_file_reader = DictReader(data_csv_fp) if key is None: key = csv_file_reader.fieldnames[0] return_value = OrderedDict() for row in csv_file_reader: return_value[row[key]] = row return return_value def convert_csv_to_multimap( data_csv_fp: FileIO, *, key_column: str = None, values_column: str = None, overwrite_values: bool = False, ) -> Dict[str, Union[str, List[str]]]: """Converts a CSV file to a dictionary of dictionaries This function inputs a CSV file, a key column (defaulting to the left-most column, if not specified), a values column (defaulting to the second column from the left, if not specified), and a flag for whether values should be overwritten (defaulting to False), and outputs a dictionary keyed by the specified key column and having as values the entries from the specified values column, with values collected into a list if overwrite_values is False, and the last value found when reading the file otherwise Args: data_csv_fp: pointer to CSV file or file-like object with columns headers in its first row and ready to be read from key_column: a column header from data_csv_fp, whose values should be used as keys in the dictionary generated values_column: a column header from data_csv_fp, whose values should be used as values in the dictionary generated overwrite_values: determines where the last-appearing value corresponding to each key is returned; if False, then a list of values is returned for each key Returns: A dictionary keyed by the specified key column and having as values the entries from the specified values column, with values collected into a list if overwrite_values == False, and the last value found when reading the file otherwise """ csv_file_reader = DictReader(data_csv_fp) if key_column is None: key_column = csv_file_reader.fieldnames[0] if values_column is None: values_column = csv_file_reader.fieldnames[1] return_value = {} for row in csv_file_reader: if overwrite_values: return_value[row[key_column]] = row[values_column] elif row[key_column] in return_value.keys(): return_value[row[key_column]].append(row[values_column]) else: return_value[row[key_column]] = [row[values_column]] return return_value def convert_xlsx_to_dict( data_xlsx_fp: FileIO, *, key: str = None, worksheet: str = None, ) -> Dict[str, Dict[str, str]]: """Converts an XLSX file to dictionary of dictionaries This function inputs an XLSX file, a key column (defaulting to the left-most column, if not specified), and a worksheet name (defaulting to the first worksheet, if not specified), and outputs a dictionary keyed by the specified key column and having as values dictionaries encoding the row from the specified worksheet of the XLSX file corresponding to the key value Args: data_xlsx_fp: pointer to an XLSX file or file-like object with columns headers in its first row and ready to be read from key: a column header from data_xlsx_fp, whose values should be used as keys in the dictionary generated worksheet: a worksheet name from data_xlsx_fp, whose values should be used in the dictionary generated Returns: A dictionary keyed by the specified key column and having as values dictionaries encoding the row from the specified worksheet of the XLSX file corresponding to the key value """ xlsx_file_reader = load_workbook( data_xlsx_fp, read_only=True, data_only=True ) if worksheet is None: worksheet = xlsx_file_reader[0] if key is None: key = worksheet.cell(row=1, column=1) xlsx_worksheet_reader = xlsx_file_reader[worksheet] xlsx_worksheet_columns = xlsx_worksheet_reader.rows xlsx_worksheet_headers = [ cell.value for cell in next(xlsx_worksheet_columns) ] key_column_index = xlsx_worksheet_headers.index(key) return_value = {} for i, row in enumerate(xlsx_worksheet_columns): new_row_to_add = {} for j, cell in enumerate(row): new_row_to_add[xlsx_worksheet_headers[j]] = row[j].value return_value[row[key_column_index].value] = new_row_to_add return return_value def convert_xlsx_to_yaml_calendar( data_xlsx_fp: FileIO, start_date: date, *, item_delimiter: str = '|', relative_week_number_column: str = None, worksheet: str = None, ) -> str: """Converts an XLSX file to a YAML string representing a weekly calendar This function inputs an XLSX file, a start date, an item delimiter for decomposing Excel-file cell values into lists (defaulting to a vertical pipe), a key column for week numbers (defaulting to the left-most column, if not specified), and a worksheet name (defaulting to the first worksheet, if not specified), and outputs a string containing a YAML representation of the XLSX file as a dictionary keyed by the specified key column and having as values dictionaries encoding the row from the specified worksheet of the XLSX file corresponding to the key value Args: data_xlsx_fp: pointer to an XLSX file or file-like object with columns headers in its first row and ready to be read from; any column names in data_xlsx_fp corresponding to day names in the current locale, as identified by the calendar module, are treated as providing activities for the corresponding calendar date and will be ordered according to ISO 8601 in output; all other columns are treated as providing information about the week itself start_date: specifies the start date for the calendar, which is adjusted to the Monday of the week that the start_date appears in, per ISO 8601's specification that weeks run from Monday to Sunday item_delimiter: a string whose values will be used to split item values into lists relative_week_number_column: a column header from data_xlsx_fp, whose values should be used as key values in the YAML string generated; the values of relative_week_number_column should be integers, with the value one (1) representing the week that start_date appears in worksheet: a worksheet name from data_xlsx_fp, whose values should be used in the dictionary generated Returns: A string containing a YAML representation of the XLSX file as a dictionary keyed by the specified key column and having as values dictionaries encoding the row from the specified worksheet of the XLSX file corresponding to the key value """ data_dict = convert_xlsx_to_dict( data_xlsx_fp, key=relative_week_number_column, worksheet=worksheet ) start_date_adjusted = start_date - timedelta(days=start_date.weekday()) weekdays_lookup_dict = {day.lower(): n for n, day in enumerate(day_name)} calendar_dict = CommentedMap() for week_number, week_data in data_dict.items(): week_number = int(week_number) calendar_dict[week_number] = CommentedMap() for weekday in week_data: if ( weekday == relative_week_number_column or week_data[weekday] is None ): continue if weekday.lower() in weekdays_lookup_dict: weekday_date = ( start_date_adjusted + timedelta( days=7 * (int(week_number) - 1) + int(weekdays_lookup_dict[weekday.lower()]) ) ).strftime('%d%b%Y').upper() calendar_dict[week_number][weekday] = CommentedMap() calendar_dict[week_number][weekday]['Date'] = weekday_date calendar_dict[week_number][weekday]['Activities'] = ( week_data[weekday].split(item_delimiter) ) else: calendar_dict[week_number][weekday] = ( week_data[weekday].split(item_delimiter) ) yaml = YAML() calendar_yaml = StringIO() yaml.dump(data=calendar_dict, stream=calendar_yaml) calendar_yaml.seek(0) return calendar_yaml.read() def flatten_dict( data_items: dict, key_value_separator: str = '\n', items_separator: str = '\n', *, suppress_keys: bool = False, sort_keys: bool = True, **kwargs ) -> str: """Converts a dictionary to a string with specified separators This function converts dictionary data_items to a string, with key_value_separator used to separate keys from values and items_separator used to separate items; in addition, keyword arguments can be passed to the builtin function sorted Args: data_items: a dictionary whose keys and items will be treated as or converted to strings key_value_separator: used to separate keys from values in the output string items_separator: used to separate items in the output string suppress_keys: Boolean for determining whether to include keys in the returned string sort_keys: Boolean for determining whether to sort keys **kwargs: options passed through to the builtin function sorted if sort_keys is True Returns: A string representation of data_items with key_value_separator used to separate keys from values and items_separator used to separate items """ if sort_keys: enumeration_order = enumerate(sorted(data_items.keys(), **kwargs)) else: enumeration_order = enumerate(data_items, **kwargs) return_value = items_separator last_record_number = len(data_items) for n, k in enumeration_order: if not suppress_keys: return_value += str(k) return_value += key_value_separator return_value += str(data_items[k]) if n < last_record_number - 1: return_value += items_separator return return_value
38.089744
79
0.680326
from calendar import day_name from collections import OrderedDict from csv import DictReader from datetime import date, timedelta from io import BytesIO, FileIO, StringIO, TextIOWrapper from typing import BinaryIO, Dict, List, TextIO, Union from openpyxl import load_workbook from ruamel.yaml import YAML from ruamel.yaml.comments import CommentedMap FileIO = Union[BinaryIO, BytesIO, FileIO, StringIO, TextIO, TextIOWrapper] def convert_csv_to_dict( data_csv_fp: FileIO, *, key: str = None, ) -> Dict[str, Dict[str, str]]: csv_file_reader = DictReader(data_csv_fp) if key is None: key = csv_file_reader.fieldnames[0] return_value = OrderedDict() for row in csv_file_reader: return_value[row[key]] = row return return_value def convert_csv_to_multimap( data_csv_fp: FileIO, *, key_column: str = None, values_column: str = None, overwrite_values: bool = False, ) -> Dict[str, Union[str, List[str]]]: csv_file_reader = DictReader(data_csv_fp) if key_column is None: key_column = csv_file_reader.fieldnames[0] if values_column is None: values_column = csv_file_reader.fieldnames[1] return_value = {} for row in csv_file_reader: if overwrite_values: return_value[row[key_column]] = row[values_column] elif row[key_column] in return_value.keys(): return_value[row[key_column]].append(row[values_column]) else: return_value[row[key_column]] = [row[values_column]] return return_value def convert_xlsx_to_dict( data_xlsx_fp: FileIO, *, key: str = None, worksheet: str = None, ) -> Dict[str, Dict[str, str]]: xlsx_file_reader = load_workbook( data_xlsx_fp, read_only=True, data_only=True ) if worksheet is None: worksheet = xlsx_file_reader[0] if key is None: key = worksheet.cell(row=1, column=1) xlsx_worksheet_reader = xlsx_file_reader[worksheet] xlsx_worksheet_columns = xlsx_worksheet_reader.rows xlsx_worksheet_headers = [ cell.value for cell in next(xlsx_worksheet_columns) ] key_column_index = xlsx_worksheet_headers.index(key) return_value = {} for i, row in enumerate(xlsx_worksheet_columns): new_row_to_add = {} for j, cell in enumerate(row): new_row_to_add[xlsx_worksheet_headers[j]] = row[j].value return_value[row[key_column_index].value] = new_row_to_add return return_value def convert_xlsx_to_yaml_calendar( data_xlsx_fp: FileIO, start_date: date, *, item_delimiter: str = '|', relative_week_number_column: str = None, worksheet: str = None, ) -> str: data_dict = convert_xlsx_to_dict( data_xlsx_fp, key=relative_week_number_column, worksheet=worksheet ) start_date_adjusted = start_date - timedelta(days=start_date.weekday()) weekdays_lookup_dict = {day.lower(): n for n, day in enumerate(day_name)} calendar_dict = CommentedMap() for week_number, week_data in data_dict.items(): week_number = int(week_number) calendar_dict[week_number] = CommentedMap() for weekday in week_data: if ( weekday == relative_week_number_column or week_data[weekday] is None ): continue if weekday.lower() in weekdays_lookup_dict: weekday_date = ( start_date_adjusted + timedelta( days=7 * (int(week_number) - 1) + int(weekdays_lookup_dict[weekday.lower()]) ) ).strftime('%d%b%Y').upper() calendar_dict[week_number][weekday] = CommentedMap() calendar_dict[week_number][weekday]['Date'] = weekday_date calendar_dict[week_number][weekday]['Activities'] = ( week_data[weekday].split(item_delimiter) ) else: calendar_dict[week_number][weekday] = ( week_data[weekday].split(item_delimiter) ) yaml = YAML() calendar_yaml = StringIO() yaml.dump(data=calendar_dict, stream=calendar_yaml) calendar_yaml.seek(0) return calendar_yaml.read() def flatten_dict( data_items: dict, key_value_separator: str = '\n', items_separator: str = '\n', *, suppress_keys: bool = False, sort_keys: bool = True, **kwargs ) -> str: if sort_keys: enumeration_order = enumerate(sorted(data_items.keys(), **kwargs)) else: enumeration_order = enumerate(data_items, **kwargs) return_value = items_separator last_record_number = len(data_items) for n, k in enumeration_order: if not suppress_keys: return_value += str(k) return_value += key_value_separator return_value += str(data_items[k]) if n < last_record_number - 1: return_value += items_separator return return_value
true
true
1c45545157e97f9c4e1cc68b6cafb654b5d57282
439
py
Python
news/views.py
valch85/newssite
ef612a7bde4ff1d6e1e35f5cc4ec9407f031270e
[ "Apache-2.0" ]
null
null
null
news/views.py
valch85/newssite
ef612a7bde4ff1d6e1e35f5cc4ec9407f031270e
[ "Apache-2.0" ]
2
2020-02-12T00:16:37.000Z
2020-06-05T20:42:49.000Z
news/views.py
valch85/newssite
ef612a7bde4ff1d6e1e35f5cc4ec9407f031270e
[ "Apache-2.0" ]
null
null
null
from django.shortcuts import render, get_object_or_404 from .models import News # Create your views here. def index(request): latest_news_list = News.objects.order_by('-pub_date')[:10] context = {'latest_news_list': latest_news_list} return render(request, 'news/index.html', context) def detail(request, news_id): new = get_object_or_404(News, pk=news_id) return render(request, 'news/detail.html', {'new': new})
27.4375
62
0.728929
from django.shortcuts import render, get_object_or_404 from .models import News def index(request): latest_news_list = News.objects.order_by('-pub_date')[:10] context = {'latest_news_list': latest_news_list} return render(request, 'news/index.html', context) def detail(request, news_id): new = get_object_or_404(News, pk=news_id) return render(request, 'news/detail.html', {'new': new})
true
true
1c4554791df5c97d5a6a036317b43076dea94512
9,639
py
Python
celery_manager/static_precompiler/compilers/base.py
churchlab/millstone
ddb5d003a5b8a7675e5a56bafd5c432d9642b473
[ "MIT" ]
45
2015-09-30T14:55:33.000Z
2021-06-28T02:33:30.000Z
celery_manager/static_precompiler/compilers/base.py
churchlab/millstone
ddb5d003a5b8a7675e5a56bafd5c432d9642b473
[ "MIT" ]
261
2015-06-03T20:41:56.000Z
2022-03-07T08:46:10.000Z
celery_manager/static_precompiler/compilers/base.py
churchlab/millstone
ddb5d003a5b8a7675e5a56bafd5c432d9642b473
[ "MIT" ]
22
2015-06-04T20:43:10.000Z
2022-02-27T08:27:34.000Z
# coding: utf-8 from django.conf import settings from django.contrib.staticfiles import finders from static_precompiler.models import Dependency from static_precompiler.settings import STATIC_ROOT, ROOT, OUTPUT_DIR from static_precompiler.utils import get_mtime import logging import os logger = logging.getLogger("static_precompiler") class BaseCompiler(object): supports_dependencies = False def is_supported(self, source_path): """ Return True iff provided source file type is supported by this precompiler. :param source_path: relative path to a source file :type source_path: str :returns: bool """ raise NotImplementedError #noinspection PyMethodMayBeStatic def get_full_source_path(self, source_path): """ Return the full path to the given source file. Check if the source file exists. :param source_path: relative path to a source file :type source_path: basestring :returns: str :raises: ValueError """ full_path = os.path.join(STATIC_ROOT, source_path) if settings.DEBUG and not os.path.exists(full_path): # while developing it is more confortable # searching for the source files rather then # doing collectstatics all the time full_path = finders.find(source_path) if full_path is None: raise ValueError("Can't find staticfile named: {0}".format(source_path)) return full_path def get_output_filename(self, source_filename): """ Return the name of compiled file based on the name of source file. :param source_filename: name of a source file :type source_filename: str :returns: str """ raise NotImplementedError def get_output_path(self, source_path): """ Get ralative path to compiled file based for the given source file. :param source_path: relative path to a source file :type source_path: str :returns: str """ source_dir = os.path.dirname(source_path) source_filename = os.path.basename(source_path) output_filename = self.get_output_filename(source_filename) return os.path.join(OUTPUT_DIR, source_dir, output_filename) def get_full_output_path(self, source_path): """ Get full path to compiled file based for the given source file. :param source_path: relative path to a source file :type source_path: str :returns: str """ return os.path.join(ROOT, self.get_output_path(source_path)) def get_source_mtime(self, source_path): """ Get the modification time of the source file. :param source_path: relative path to a source file :type source_path: str :returns: int """ return get_mtime(self.get_full_source_path(source_path)) def get_output_mtime(self, source_path): """ Get the modification time of the compiled file. Return None of compiled file does not exist. :param source_path: relative path to a source file :type source_path: str :returns: int, None """ full_output_path = self.get_full_output_path(source_path) if not os.path.exists(full_output_path): return None return get_mtime(full_output_path) def should_compile(self, source_path, watch=False): """ Return True iff provided source file should be compiled. :param source_path: relative path to a source file :type source_path: str :param watch: whether the method was invoked from watch utility :type watch: bool :returns: bool """ compiled_mtime = self.get_output_mtime(source_path) if compiled_mtime is None: return True source_mtime = self.get_source_mtime(source_path) if self.supports_dependencies: for dependency in self.get_dependencies(source_path): if compiled_mtime <= self.get_source_mtime(dependency): return True return compiled_mtime <= source_mtime def get_source(self, source_path): """ Get the source code to be compiled. :param source_path: relative path to a source file :type source_path: str :returns: str """ return open(self.get_full_source_path(source_path)).read() def write_output(self, output, source_path): """ Write the compiled output to a file. :param output: compiled code :type output: str :param source_path: relative path to a source file :type source_path: str """ output_path = self.get_full_output_path(source_path) output_dir = os.path.dirname(output_path) if not os.path.exists(output_dir): os.makedirs(output_dir) compiled_file = open(output_path, "w+") compiled_file.write(output) compiled_file.close() def compile(self, source_path, watch=False): """ Compile the given source path and return relative path to the compiled file. Raise ValueError is the source file type is not supported. May raise a StaticCompilationError if something goes wrong with compilation. :param source_path: relative path to a source file :type source_path: str :param watch: whether the method was invoked from watch utility :type watch: bool :returns: str """ if not self.is_supported(source_path): raise ValueError("'{0}' file type is not supported by '{1}'".format( source_path, self.__class__.__name__ )) if self.should_compile(source_path, watch=watch): compiled = self.compile_file(source_path) compiled = self.postprocess(compiled, source_path) self.write_output(compiled, source_path) if self.supports_dependencies: self.update_dependencies(source_path, self.find_dependencies(source_path)) logging.info("Compiled: '{0}'".format(source_path)) return self.get_output_path(source_path) def compile_file(self, source_path): """ Compile the source file. Return the compiled code. May raise a StaticCompilationError if something goes wrong with compilation. :param source_path: path to the source file :type source_path: str :returns: str """ raise NotImplementedError def compile_source(self, source): """ Compile the source code. May raise a StaticCompilationError if something goes wrong with compilation. :param source: source code :type source: str :returns: str """ raise NotImplementedError #noinspection PyMethodMayBeStatic,PyUnusedLocal def postprocess(self, compiled, source_path): """ Post-process the compiled code. :param compiled: compiled code :type compiled: str :param source_path: relative path to a source file :type source_path: str :returns: str """ return compiled def find_dependencies(self, source_path): """ Find the dependencies for the given source file. :param source_path: relative path to a source file :type source_path: str :returns: list """ raise NotImplementedError #noinspection PyMethodMayBeStatic def get_dependencies(self, source_path): """ Get the saved dependencies for the given source file. :param source_path: relative path to a source file :type source_path: str :returns: list of str """ return list(Dependency.objects.filter( source=source_path ).order_by("depends_on").values_list( "depends_on", flat=True )) #noinspection PyMethodMayBeStatic def get_dependents(self, source_path): """ Get a list of files that depends on the given source file. :param source_path: relative path to a source file :type source_path: str :returns: list of str """ return list(Dependency.objects.filter( depends_on=source_path ).order_by("source").values_list( "source", flat=True )) #noinspection PyMethodMayBeStatic def update_dependencies(self, source_path, dependencies): """ Updates the saved dependencies for the given source file. :param source_path: relative path to a source file :type source_path: str :param dependencies: list of files that source file depends on :type dependencies: list of str """ if not dependencies: Dependency.objects.filter(source=source_path).delete() else: Dependency.objects.filter( source=source_path ).exclude( depends_on__in=dependencies, ).delete() for dependency in dependencies: Dependency.objects.get_or_create( source=source_path, depends_on=dependency, ) def handle_changed_file(self, source_path): """ Handle the modication of the source file. :param source_path: relative path to a source file :type source_path: str """ self.compile(source_path, watch=True) for dependent in self.get_dependents(source_path): self.compile(dependent, watch=True)
32.674576
90
0.641768
from django.conf import settings from django.contrib.staticfiles import finders from static_precompiler.models import Dependency from static_precompiler.settings import STATIC_ROOT, ROOT, OUTPUT_DIR from static_precompiler.utils import get_mtime import logging import os logger = logging.getLogger("static_precompiler") class BaseCompiler(object): supports_dependencies = False def is_supported(self, source_path): raise NotImplementedError def get_full_source_path(self, source_path): full_path = os.path.join(STATIC_ROOT, source_path) if settings.DEBUG and not os.path.exists(full_path): full_path = finders.find(source_path) if full_path is None: raise ValueError("Can't find staticfile named: {0}".format(source_path)) return full_path def get_output_filename(self, source_filename): raise NotImplementedError def get_output_path(self, source_path): source_dir = os.path.dirname(source_path) source_filename = os.path.basename(source_path) output_filename = self.get_output_filename(source_filename) return os.path.join(OUTPUT_DIR, source_dir, output_filename) def get_full_output_path(self, source_path): return os.path.join(ROOT, self.get_output_path(source_path)) def get_source_mtime(self, source_path): return get_mtime(self.get_full_source_path(source_path)) def get_output_mtime(self, source_path): full_output_path = self.get_full_output_path(source_path) if not os.path.exists(full_output_path): return None return get_mtime(full_output_path) def should_compile(self, source_path, watch=False): compiled_mtime = self.get_output_mtime(source_path) if compiled_mtime is None: return True source_mtime = self.get_source_mtime(source_path) if self.supports_dependencies: for dependency in self.get_dependencies(source_path): if compiled_mtime <= self.get_source_mtime(dependency): return True return compiled_mtime <= source_mtime def get_source(self, source_path): return open(self.get_full_source_path(source_path)).read() def write_output(self, output, source_path): output_path = self.get_full_output_path(source_path) output_dir = os.path.dirname(output_path) if not os.path.exists(output_dir): os.makedirs(output_dir) compiled_file = open(output_path, "w+") compiled_file.write(output) compiled_file.close() def compile(self, source_path, watch=False): if not self.is_supported(source_path): raise ValueError("'{0}' file type is not supported by '{1}'".format( source_path, self.__class__.__name__ )) if self.should_compile(source_path, watch=watch): compiled = self.compile_file(source_path) compiled = self.postprocess(compiled, source_path) self.write_output(compiled, source_path) if self.supports_dependencies: self.update_dependencies(source_path, self.find_dependencies(source_path)) logging.info("Compiled: '{0}'".format(source_path)) return self.get_output_path(source_path) def compile_file(self, source_path): raise NotImplementedError def compile_source(self, source): raise NotImplementedError #noinspection PyMethodMayBeStatic,PyUnusedLocal def postprocess(self, compiled, source_path): return compiled def find_dependencies(self, source_path): raise NotImplementedError #noinspection PyMethodMayBeStatic def get_dependencies(self, source_path): return list(Dependency.objects.filter( source=source_path ).order_by("depends_on").values_list( "depends_on", flat=True )) #noinspection PyMethodMayBeStatic def get_dependents(self, source_path): return list(Dependency.objects.filter( depends_on=source_path ).order_by("source").values_list( "source", flat=True )) #noinspection PyMethodMayBeStatic def update_dependencies(self, source_path, dependencies): if not dependencies: Dependency.objects.filter(source=source_path).delete() else: Dependency.objects.filter( source=source_path ).exclude( depends_on__in=dependencies, ).delete() for dependency in dependencies: Dependency.objects.get_or_create( source=source_path, depends_on=dependency, ) def handle_changed_file(self, source_path): self.compile(source_path, watch=True) for dependent in self.get_dependents(source_path): self.compile(dependent, watch=True)
true
true
1c4554d8d53932ad17004044f7fe096837dd57b5
6,209
py
Python
infra/bots/recipe_modules/core/api.py
henry-luo/skia
2f2187b66dca1761f590668d3cbdf07453df7b6f
[ "BSD-3-Clause" ]
null
null
null
infra/bots/recipe_modules/core/api.py
henry-luo/skia
2f2187b66dca1761f590668d3cbdf07453df7b6f
[ "BSD-3-Clause" ]
null
null
null
infra/bots/recipe_modules/core/api.py
henry-luo/skia
2f2187b66dca1761f590668d3cbdf07453df7b6f
[ "BSD-3-Clause" ]
null
null
null
# Copyright 2014 The Chromium Authors. All rights reserved. # Use of this source code is governed by a BSD-style license that can be # found in the LICENSE file. # pylint: disable=W0201 import json import os import re import sys from recipe_engine import recipe_api from recipe_engine import config_types class SkiaApi(recipe_api.RecipeApi): def setup(self): """Prepare the bot to run.""" # Setup dependencies. self.m.vars.setup() # Check out the Skia code. self.checkout_steps() if not self.m.path.exists(self.m.vars.tmp_dir): self.m.run.run_once(self.m.file.makedirs, 'tmp_dir', self.m.vars.tmp_dir, infra_step=True) self.m.flavor.setup() def update_repo(self, parent_dir, repo): """Update an existing repo. This is safe to call without gen_steps.""" repo_path = parent_dir.join(repo.name) if self.m.path.exists(repo_path): # pragma: nocover if self.m.platform.is_win: git = 'git.bat' else: git = 'git' with self.m.step.context({'cwd': repo_path}): self.m.step('git remote set-url', cmd=[git, 'remote', 'set-url', 'origin', repo.url], infra_step=True) self.m.step('git fetch', cmd=[git, 'fetch'], infra_step=True) self.m.step('git reset', cmd=[git, 'reset', '--hard', repo.revision], infra_step=True) self.m.step('git clean', cmd=[git, 'clean', '-d', '-f'], infra_step=True) def checkout_steps(self): """Run the steps to obtain a checkout of Skia.""" cfg_kwargs = {} if not self.m.vars.persistent_checkout: # We should've obtained the Skia checkout through isolates, so we don't # need to perform the checkout ourselves. return # Use a persistent gclient cache for Swarming. cfg_kwargs['CACHE_DIR'] = self.m.vars.gclient_cache # Create the checkout path if necessary. if not self.m.path.exists(self.m.vars.checkout_root): self.m.file.makedirs('checkout_path', self.m.vars.checkout_root, infra_step=True) # Initial cleanup. gclient_cfg = self.m.gclient.make_config(**cfg_kwargs) main_repo = self.m.properties['repository'] if self.m.vars.need_pdfium_checkout: main_repo = 'https://pdfium.googlesource.com/pdfium.git' if self.m.vars.need_flutter_checkout: main_repo = 'https://github.com/flutter/engine.git' main_name = self.m.path.basename(main_repo) if main_name.endswith('.git'): main_name = main_name[:-len('.git')] # Special case for flutter because it seems to need a very specific # directory structure to successfully build. if self.m.vars.need_flutter_checkout and main_name == 'engine': main_name = 'src/flutter' main = gclient_cfg.solutions.add() main.name = main_name main.managed = False main.url = main_repo main.revision = self.m.properties.get('revision') or 'origin/master' m = gclient_cfg.got_revision_mapping m[main_name] = 'got_revision' patch_root = main_name if self.m.vars.need_pdfium_checkout: # Skia is a DEP of PDFium; the 'revision' property is a Skia revision, and # any patch should be applied to Skia, not PDFium. main.revision = 'origin/master' main.managed = True m[main_name] = 'got_%s_revision' % main_name skia_dep_path = 'pdfium/third_party/skia' gclient_cfg.patch_projects['skia'] = (skia_dep_path, 'HEAD') gclient_cfg.revisions[skia_dep_path] = self.m.properties['revision'] m[skia_dep_path] = 'got_revision' patch_root = skia_dep_path if self.m.vars.need_flutter_checkout: # Skia is a DEP of Flutter; the 'revision' property is a Skia revision, # and any patch should be applied to Skia, not Flutter. main.revision = 'origin/master' main.managed = True m[main_name] = 'got_flutter_revision' if 'Android' in self.m.vars.builder_cfg.get('extra_config', ''): gclient_cfg.target_os.add('android') skia_dep_path = 'src/third_party/skia' gclient_cfg.patch_projects['skia'] = (skia_dep_path, 'HEAD') gclient_cfg.revisions[skia_dep_path] = self.m.properties['revision'] m[skia_dep_path] = 'got_revision' patch_root = skia_dep_path self.update_repo(self.m.vars.checkout_root, main) # TODO(rmistry): Remove the below block after there is a solution for # crbug.com/616443 entries_file = self.m.vars.checkout_root.join('.gclient_entries') if self.m.path.exists(entries_file): self.m.file.remove('remove %s' % entries_file, entries_file, infra_step=True) # pragma: no cover if self.m.vars.need_chromium_checkout: chromium = gclient_cfg.solutions.add() chromium.name = 'src' chromium.managed = False chromium.url = 'https://chromium.googlesource.com/chromium/src.git' chromium.revision = 'origin/lkgr' self.update_repo(self.m.vars.checkout_root, chromium) # Run bot_update. checkout_kwargs = {} checkout_kwargs['env'] = self.m.vars.default_env # Hack the patch ref if necessary. if self.m.properties.get('patch_storage', '') == 'gerrit': if self.m.bot_update._issue and self.m.bot_update._patchset: self.m.bot_update._gerrit_ref = 'refs/changes/%s/%d/%d' % ( str(self.m.bot_update._issue)[-2:], self.m.bot_update._issue, self.m.bot_update._patchset, ) self.m.gclient.c = gclient_cfg with self.m.step.context({'cwd': self.m.vars.checkout_root}): update_step = self.m.bot_update.ensure_checkout( patch_root=patch_root, **checkout_kwargs) self.m.vars.got_revision = ( update_step.presentation.properties['got_revision']) if self.m.vars.need_chromium_checkout: with self.m.step.context({'cwd': self.m.vars.checkout_root}): self.m.gclient.runhooks(env=self.m.vars.gclient_env)
36.739645
80
0.639717
import json import os import re import sys from recipe_engine import recipe_api from recipe_engine import config_types class SkiaApi(recipe_api.RecipeApi): def setup(self): self.m.vars.setup() self.checkout_steps() if not self.m.path.exists(self.m.vars.tmp_dir): self.m.run.run_once(self.m.file.makedirs, 'tmp_dir', self.m.vars.tmp_dir, infra_step=True) self.m.flavor.setup() def update_repo(self, parent_dir, repo): repo_path = parent_dir.join(repo.name) if self.m.path.exists(repo_path): if self.m.platform.is_win: git = 'git.bat' else: git = 'git' with self.m.step.context({'cwd': repo_path}): self.m.step('git remote set-url', cmd=[git, 'remote', 'set-url', 'origin', repo.url], infra_step=True) self.m.step('git fetch', cmd=[git, 'fetch'], infra_step=True) self.m.step('git reset', cmd=[git, 'reset', '--hard', repo.revision], infra_step=True) self.m.step('git clean', cmd=[git, 'clean', '-d', '-f'], infra_step=True) def checkout_steps(self): cfg_kwargs = {} if not self.m.vars.persistent_checkout: return cfg_kwargs['CACHE_DIR'] = self.m.vars.gclient_cache if not self.m.path.exists(self.m.vars.checkout_root): self.m.file.makedirs('checkout_path', self.m.vars.checkout_root, infra_step=True) gclient_cfg = self.m.gclient.make_config(**cfg_kwargs) main_repo = self.m.properties['repository'] if self.m.vars.need_pdfium_checkout: main_repo = 'https://pdfium.googlesource.com/pdfium.git' if self.m.vars.need_flutter_checkout: main_repo = 'https://github.com/flutter/engine.git' main_name = self.m.path.basename(main_repo) if main_name.endswith('.git'): main_name = main_name[:-len('.git')] if self.m.vars.need_flutter_checkout and main_name == 'engine': main_name = 'src/flutter' main = gclient_cfg.solutions.add() main.name = main_name main.managed = False main.url = main_repo main.revision = self.m.properties.get('revision') or 'origin/master' m = gclient_cfg.got_revision_mapping m[main_name] = 'got_revision' patch_root = main_name if self.m.vars.need_pdfium_checkout: main.revision = 'origin/master' main.managed = True m[main_name] = 'got_%s_revision' % main_name skia_dep_path = 'pdfium/third_party/skia' gclient_cfg.patch_projects['skia'] = (skia_dep_path, 'HEAD') gclient_cfg.revisions[skia_dep_path] = self.m.properties['revision'] m[skia_dep_path] = 'got_revision' patch_root = skia_dep_path if self.m.vars.need_flutter_checkout: main.revision = 'origin/master' main.managed = True m[main_name] = 'got_flutter_revision' if 'Android' in self.m.vars.builder_cfg.get('extra_config', ''): gclient_cfg.target_os.add('android') skia_dep_path = 'src/third_party/skia' gclient_cfg.patch_projects['skia'] = (skia_dep_path, 'HEAD') gclient_cfg.revisions[skia_dep_path] = self.m.properties['revision'] m[skia_dep_path] = 'got_revision' patch_root = skia_dep_path self.update_repo(self.m.vars.checkout_root, main) entries_file = self.m.vars.checkout_root.join('.gclient_entries') if self.m.path.exists(entries_file): self.m.file.remove('remove %s' % entries_file, entries_file, infra_step=True) if self.m.vars.need_chromium_checkout: chromium = gclient_cfg.solutions.add() chromium.name = 'src' chromium.managed = False chromium.url = 'https://chromium.googlesource.com/chromium/src.git' chromium.revision = 'origin/lkgr' self.update_repo(self.m.vars.checkout_root, chromium) checkout_kwargs = {} checkout_kwargs['env'] = self.m.vars.default_env if self.m.properties.get('patch_storage', '') == 'gerrit': if self.m.bot_update._issue and self.m.bot_update._patchset: self.m.bot_update._gerrit_ref = 'refs/changes/%s/%d/%d' % ( str(self.m.bot_update._issue)[-2:], self.m.bot_update._issue, self.m.bot_update._patchset, ) self.m.gclient.c = gclient_cfg with self.m.step.context({'cwd': self.m.vars.checkout_root}): update_step = self.m.bot_update.ensure_checkout( patch_root=patch_root, **checkout_kwargs) self.m.vars.got_revision = ( update_step.presentation.properties['got_revision']) if self.m.vars.need_chromium_checkout: with self.m.step.context({'cwd': self.m.vars.checkout_root}): self.m.gclient.runhooks(env=self.m.vars.gclient_env)
true
true
1c4554eae75d1b7c7c6e5d32aeb944d8689b1f7b
345
py
Python
Payment/manage.py
silop4all/payment-api
c331af421cd882d0b82d291251d1ce1c7f1a7223
[ "Apache-2.0" ]
2
2018-02-27T20:51:15.000Z
2019-11-25T10:12:06.000Z
Payment/manage.py
silop4all/payment-api
c331af421cd882d0b82d291251d1ce1c7f1a7223
[ "Apache-2.0" ]
null
null
null
Payment/manage.py
silop4all/payment-api
c331af421cd882d0b82d291251d1ce1c7f1a7223
[ "Apache-2.0" ]
null
null
null
#!/usr/bin/env python """ Command-line utility for administrative tasks. """ import os import sys if __name__ == "__main__": os.environ.setdefault( "DJANGO_SETTINGS_MODULE", "Payment.settings" ) from django.core.management import execute_from_command_line execute_from_command_line(sys.argv)
19.166667
65
0.675362
import os import sys if __name__ == "__main__": os.environ.setdefault( "DJANGO_SETTINGS_MODULE", "Payment.settings" ) from django.core.management import execute_from_command_line execute_from_command_line(sys.argv)
true
true
1c45550a7c5f0ce477cb38a1f1274ca4f984e780
1,326
py
Python
zerver/management/commands/sync_ldap_user_data.py
Supermanu/zulip
26f6d708c2e30cfe50d9d61031edb759e8117596
[ "Apache-2.0" ]
null
null
null
zerver/management/commands/sync_ldap_user_data.py
Supermanu/zulip
26f6d708c2e30cfe50d9d61031edb759e8117596
[ "Apache-2.0" ]
15
2020-06-05T18:44:15.000Z
2022-03-11T23:26:03.000Z
zerver/management/commands/sync_ldap_user_data.py
Supermanu/zulip
26f6d708c2e30cfe50d9d61031edb759e8117596
[ "Apache-2.0" ]
null
null
null
from __future__ import absolute_import from typing import Any from django.core.management.base import BaseCommand from django.db.utils import IntegrityError from django.conf import settings from zproject.backends import ZulipLDAPUserPopulator from zerver.models import UserProfile from zerver.lib.logging_util import create_logger ## Setup ## logger = create_logger(__name__, settings.LDAP_SYNC_LOG_PATH, 'INFO') # Run this on a cronjob to pick up on name changes. def sync_ldap_user_data(): # type: () -> None logger.info("Starting update.") backend = ZulipLDAPUserPopulator() for u in UserProfile.objects.select_related().filter(is_active=True, is_bot=False).all(): # This will save the user if relevant, and will do nothing if the user # does not exist. try: if backend.populate_user(backend.django_to_ldap_username(u.email)) is not None: logger.info("Updated %s." % (u.email,)) else: logger.warning("Did not find %s in LDAP." % (u.email,)) except IntegrityError: logger.warning("User populated did not match an existing user.") logger.info("Finished update.") class Command(BaseCommand): def handle(self, *args, **options): # type: (*Any, **Any) -> None sync_ldap_user_data()
35.837838
93
0.692308
from __future__ import absolute_import from typing import Any from django.core.management.base import BaseCommand from django.db.utils import IntegrityError from django.conf import settings from zproject.backends import ZulipLDAPUserPopulator from zerver.models import UserProfile from zerver.lib.logging_util import create_logger ate_logger(__name__, settings.LDAP_SYNC_LOG_PATH, 'INFO') def sync_ldap_user_data(): logger.info("Starting update.") backend = ZulipLDAPUserPopulator() for u in UserProfile.objects.select_related().filter(is_active=True, is_bot=False).all(): try: if backend.populate_user(backend.django_to_ldap_username(u.email)) is not None: logger.info("Updated %s." % (u.email,)) else: logger.warning("Did not find %s in LDAP." % (u.email,)) except IntegrityError: logger.warning("User populated did not match an existing user.") logger.info("Finished update.") class Command(BaseCommand): def handle(self, *args, **options): sync_ldap_user_data()
true
true
1c45559ff167fb23cf4728841148d6e890c7d890
2,190
py
Python
app.py
ODU-Internship/BedSore
c9927ce181eb48fc93a3d2adf2330cc0ec412182
[ "MIT" ]
null
null
null
app.py
ODU-Internship/BedSore
c9927ce181eb48fc93a3d2adf2330cc0ec412182
[ "MIT" ]
null
null
null
app.py
ODU-Internship/BedSore
c9927ce181eb48fc93a3d2adf2330cc0ec412182
[ "MIT" ]
null
null
null
import os import plotly.express as px import plotly.figure_factory as ff import dash import dash_core_components as dcc import dash_html_components as html import numpy as np import time external_stylesheets = ['https://codepen.io/chriddyp/pen/bWLwgP.css'] app = dash.Dash(__name__, external_stylesheets=external_stylesheets) #pressure_data = np.random.randint(1000, size=(10, 10)) #a = np.random.randint(1000, size=(5, 5)) t = np.zeros((5, 5)) server = app.server app.layout = html.Div([ html.H2('Bed Pressure Status'), html.Div([ dcc.Graph(id='bed_pressure'), html.Div(id='sen_alerts'), dcc.Interval(id='graph-update', interval=10000, n_intervals=0) ], style={'width': '100%', 'display': 'inline-block', 'padding': '0 20'}), ]) @app.callback( [dash.dependencies.Output('bed_pressure', 'figure'), dash.dependencies.Output('sen_alerts', 'children')], [dash.dependencies.Input('graph-update', 'n_intervals')]) def update_graph(n): #pressure_data = np.random.randint(1000, size=(15, 30)) a = np.random.randint(1000, size=(5, 5)) alert_msg = detect(a, t) sens = html.Ul([html.Li(x) for x in alert_msg]) #fig = px.imshow(a,color_continuous_scale='Hot_r') #colorscale = [[0, 'white'],[400,'red'] [1000, 'black']] font_colors = ['black', 'white'] fig = ff.create_annotated_heatmap( a, colorscale='Hot_r', font_colors=font_colors, showscale=True) #fig = ff.create_annotated_heatmap(a,color_continuous_scale='Hot_r') # fig.update_layout(width=int(1000)) #fig = px.imshow(pressure_data) return fig, sens def detect(arr, t): sen_list = [] for (x, y), element in np.ndenumerate(np.array(arr)): if(element > 400 and t[x][y] == 0.0): t[x][y] = time.time() elif(element > 400 and t[x][y] != 0): if(time.time() - t[x][y] > 9): sen_list.append("Alert of Sensor placed at " + str(x) + "," + str(y)) elif(element <= 400): t[x][y] = 0.0 return sen_list if __name__ == '__main__': app.run(debug=True)
32.205882
79
0.607763
import os import plotly.express as px import plotly.figure_factory as ff import dash import dash_core_components as dcc import dash_html_components as html import numpy as np import time external_stylesheets = ['https://codepen.io/chriddyp/pen/bWLwgP.css'] app = dash.Dash(__name__, external_stylesheets=external_stylesheets) t = np.zeros((5, 5)) server = app.server app.layout = html.Div([ html.H2('Bed Pressure Status'), html.Div([ dcc.Graph(id='bed_pressure'), html.Div(id='sen_alerts'), dcc.Interval(id='graph-update', interval=10000, n_intervals=0) ], style={'width': '100%', 'display': 'inline-block', 'padding': '0 20'}), ]) @app.callback( [dash.dependencies.Output('bed_pressure', 'figure'), dash.dependencies.Output('sen_alerts', 'children')], [dash.dependencies.Input('graph-update', 'n_intervals')]) def update_graph(n): a = np.random.randint(1000, size=(5, 5)) alert_msg = detect(a, t) sens = html.Ul([html.Li(x) for x in alert_msg]) font_colors = ['black', 'white'] fig = ff.create_annotated_heatmap( a, colorscale='Hot_r', font_colors=font_colors, showscale=True) return fig, sens def detect(arr, t): sen_list = [] for (x, y), element in np.ndenumerate(np.array(arr)): if(element > 400 and t[x][y] == 0.0): t[x][y] = time.time() elif(element > 400 and t[x][y] != 0): if(time.time() - t[x][y] > 9): sen_list.append("Alert of Sensor placed at " + str(x) + "," + str(y)) elif(element <= 400): t[x][y] = 0.0 return sen_list if __name__ == '__main__': app.run(debug=True)
true
true
1c4558ef8db3c87d9205525a1d0af1de3e5c9a0d
1,816
py
Python
digitaltmuseum/controllers/duplicates.py
danmichaelo/digimus-commons
32a44823dadbe0ae0160ff24fcbb7645d8304ff7
[ "Unlicense" ]
1
2020-08-10T15:12:50.000Z
2020-08-10T15:12:50.000Z
digitaltmuseum/controllers/duplicates.py
danmichaelo/digimus-commons
32a44823dadbe0ae0160ff24fcbb7645d8304ff7
[ "Unlicense" ]
null
null
null
digitaltmuseum/controllers/duplicates.py
danmichaelo/digimus-commons
32a44823dadbe0ae0160ff24fcbb7645d8304ff7
[ "Unlicense" ]
null
null
null
# -*- coding: utf-8; tab-width: 4; indent-tabs-mode: nil; c-basic-offset: 4 -*- vim:fenc=utf-8:et:sw=4:ts=4:sts=4 import sqlite3 import urllib.request, urllib.parse, urllib.error from flask import render_template from .controller import Controller class DuplicatesController(Controller): def __init__(self, app, config): Controller.__init__(self, app) self.config = config def get(self): db = self.open_db() cur = db.cursor() dups = [] for row in cur.execute('SELECT institution,imageid,count(*) FROM files GROUP BY institution,imageid'): if row[2] > 1: dups.append([row[0], row[1]]) html = '<ul>' for dup in dups: html += '<li>%s/%s er oppgitt som kilde for:\n<ul class="dups">\n' % tuple(dup) # yield(type(html).__name__) for row in cur.execute('SELECT filename, width, height FROM files WHERE institution=? AND imageid=?', dup): name = row[0].replace(' ', '_') name_enc = urllib.parse.quote(name.encode('utf-8')) thumbmax = 120 if row[1] > row[2]: thumbw = thumbmax thumbh = round(float(row[2])/row[1]*thumbmax) else: thumbh = thumbmax thumbw = round(float(row[1])/row[2]*thumbmax) thumb_url = self.get_thumb_url(name, thumbw) thumb = '<img src="%s" border="0" alt="%s" width="%d" height="%d"/>' % (thumb_url, name, thumbw, thumbh) html += '<li><a href="https://commons.wikimedia.org/wiki/File:%s">%s<br />%s</a></li>\n' % (name_enc, thumb, row[0]) html += '</ul>\n' html += '</ul>\n' return render_template('dups.html', main=html)
39.478261
132
0.543502
import sqlite3 import urllib.request, urllib.parse, urllib.error from flask import render_template from .controller import Controller class DuplicatesController(Controller): def __init__(self, app, config): Controller.__init__(self, app) self.config = config def get(self): db = self.open_db() cur = db.cursor() dups = [] for row in cur.execute('SELECT institution,imageid,count(*) FROM files GROUP BY institution,imageid'): if row[2] > 1: dups.append([row[0], row[1]]) html = '<ul>' for dup in dups: html += '<li>%s/%s er oppgitt som kilde for:\n<ul class="dups">\n' % tuple(dup) for row in cur.execute('SELECT filename, width, height FROM files WHERE institution=? AND imageid=?', dup): name = row[0].replace(' ', '_') name_enc = urllib.parse.quote(name.encode('utf-8')) thumbmax = 120 if row[1] > row[2]: thumbw = thumbmax thumbh = round(float(row[2])/row[1]*thumbmax) else: thumbh = thumbmax thumbw = round(float(row[1])/row[2]*thumbmax) thumb_url = self.get_thumb_url(name, thumbw) thumb = '<img src="%s" border="0" alt="%s" width="%d" height="%d"/>' % (thumb_url, name, thumbw, thumbh) html += '<li><a href="https://commons.wikimedia.org/wiki/File:%s">%s<br />%s</a></li>\n' % (name_enc, thumb, row[0]) html += '</ul>\n' html += '</ul>\n' return render_template('dups.html', main=html)
true
true
1c45595dbeb1ee754f37d0d735e5cb42d450fdc5
463
py
Python
python3/third_max.py
joshiaj7/CodingChallenges
f95dd79132f07c296e074d675819031912f6a943
[ "MIT" ]
1
2020-10-08T09:17:40.000Z
2020-10-08T09:17:40.000Z
python3/third_max.py
joshiaj7/CodingChallenges
f95dd79132f07c296e074d675819031912f6a943
[ "MIT" ]
null
null
null
python3/third_max.py
joshiaj7/CodingChallenges
f95dd79132f07c296e074d675819031912f6a943
[ "MIT" ]
null
null
null
""" Space : O(1) Time : O(n) """ class Solution: def thirdMax(self, nums: List[int]) -> int: a, b, c = -10**10, -10**10, -10**10 nums = list(set(nums)) n = len(nums) for i in nums: a = max(i, a) if n <= 2: return a for j in nums: if j < a: b = max(b, j) for k in nums: if k < b: c = max(c, k) return c
15.965517
47
0.360691
class Solution: def thirdMax(self, nums: List[int]) -> int: a, b, c = -10**10, -10**10, -10**10 nums = list(set(nums)) n = len(nums) for i in nums: a = max(i, a) if n <= 2: return a for j in nums: if j < a: b = max(b, j) for k in nums: if k < b: c = max(c, k) return c
true
true
1c4559619debbfab81b5667b6115f6d8185615c5
1,229
py
Python
benchmark/generate_libs/jamplus.py
chadaustin/ibb
ea1e25cc53a1ad7c302a12d95fc704c443924dff
[ "MIT" ]
4
2015-04-09T17:24:58.000Z
2019-07-02T12:05:56.000Z
benchmark/generate_libs/jamplus.py
chadaustin/ibb
ea1e25cc53a1ad7c302a12d95fc704c443924dff
[ "MIT" ]
null
null
null
benchmark/generate_libs/jamplus.py
chadaustin/ibb
ea1e25cc53a1ad7c302a12d95fc704c443924dff
[ "MIT" ]
1
2019-11-08T15:38:29.000Z
2019-11-08T15:38:29.000Z
#!/usr/bin/python import os.path import cppcodebase import random def CreateLibJamfile(lib_number, classes): os.chdir(cppcodebase.lib_name(lib_number)) handle = file("Jamfile.jam", "w") handle.write ("SubDir TOP lib_" + str(lib_number) + " ;\n\n") handle.write ("SubDirHdrs $(INCLUDES) ;\n\n") handle.write ("Library lib_" + str(lib_number) + " :\n") for i in xrange(classes): handle.write(' class_' + str(i) + '.cpp\n') handle.write (' ;\n') os.chdir('..') def CreateFullJamfile(libs): handle = file("Jamfile.jam", "w") handle.write ("SubDir TOP ;\n\n") for i in xrange(libs): handle.write('SubInclude TOP ' + cppcodebase.lib_name(i) + ' ;\n') handle.write('\nWorkspace GeneratedLibs :\n') for i in xrange(libs): handle.write('\t\t' + cppcodebase.lib_name(i) + '\n') handle.write(';\n') handle = file("Jamrules.jam", "w") handle.write ('INCLUDES = $(TOP) ;\n') def CreateCodebase(libs, classes, internal_includes, external_includes): cppcodebase.SetDir('jamplus') cppcodebase.CreateSetOfLibraries(libs, classes, internal_includes, external_includes, CreateLibJamfile) CreateFullJamfile(libs) os.chdir('..')
29.261905
107
0.643613
import os.path import cppcodebase import random def CreateLibJamfile(lib_number, classes): os.chdir(cppcodebase.lib_name(lib_number)) handle = file("Jamfile.jam", "w") handle.write ("SubDir TOP lib_" + str(lib_number) + " ;\n\n") handle.write ("SubDirHdrs $(INCLUDES) ;\n\n") handle.write ("Library lib_" + str(lib_number) + " :\n") for i in xrange(classes): handle.write(' class_' + str(i) + '.cpp\n') handle.write (' ;\n') os.chdir('..') def CreateFullJamfile(libs): handle = file("Jamfile.jam", "w") handle.write ("SubDir TOP ;\n\n") for i in xrange(libs): handle.write('SubInclude TOP ' + cppcodebase.lib_name(i) + ' ;\n') handle.write('\nWorkspace GeneratedLibs :\n') for i in xrange(libs): handle.write('\t\t' + cppcodebase.lib_name(i) + '\n') handle.write(';\n') handle = file("Jamrules.jam", "w") handle.write ('INCLUDES = $(TOP) ;\n') def CreateCodebase(libs, classes, internal_includes, external_includes): cppcodebase.SetDir('jamplus') cppcodebase.CreateSetOfLibraries(libs, classes, internal_includes, external_includes, CreateLibJamfile) CreateFullJamfile(libs) os.chdir('..')
true
true
1c4559ad4582ddb2d757dd3fc5e5fa4bd27dcdd3
5,260
py
Python
build/android/pylib/base_test_sharder.py
leiferikb/bitpop-private
4c967307d228e86f07f2576068a169e846c833ca
[ "BSD-3-Clause-No-Nuclear-License-2014", "BSD-3-Clause" ]
1
2021-11-15T15:17:43.000Z
2021-11-15T15:17:43.000Z
build/android/pylib/base_test_sharder.py
leiferikb/bitpop-private
4c967307d228e86f07f2576068a169e846c833ca
[ "BSD-3-Clause-No-Nuclear-License-2014", "BSD-3-Clause" ]
null
null
null
build/android/pylib/base_test_sharder.py
leiferikb/bitpop-private
4c967307d228e86f07f2576068a169e846c833ca
[ "BSD-3-Clause-No-Nuclear-License-2014", "BSD-3-Clause" ]
1
2019-02-21T16:13:42.000Z
2019-02-21T16:13:42.000Z
# Copyright (c) 2012 The Chromium Authors. All rights reserved. # Use of this source code is governed by a BSD-style license that can be # found in the LICENSE file. import android_commands import logging import multiprocessing from android_commands import errors from forwarder import Forwarder from test_result import TestResults def _ShardedTestRunnable(test): """Standalone function needed by multiprocessing.Pool.""" log_format = '[' + test.device + '] # %(asctime)-15s: %(message)s' if logging.getLogger().handlers: logging.getLogger().handlers[0].setFormatter(logging.Formatter(log_format)) else: logging.basicConfig(format=log_format) # Handle SystemExit here since python has a bug to exit current process try: return test.Run() except SystemExit: return TestResults() def SetTestsContainer(tests_container): """Sets tests container. multiprocessing.Queue can't be pickled across processes, so we need to set this as a 'global', per process, via multiprocessing.Pool. """ BaseTestSharder.tests_container = tests_container class BaseTestSharder(object): """Base class for sharding tests across multiple devices. Args: attached_devices: A list of attached devices. """ # See more in SetTestsContainer. tests_container = None def __init__(self, attached_devices, build_type='Debug'): self.attached_devices = attached_devices # Worst case scenario: a device will drop offline per run, so we need # to retry until we're out of devices. self.retries = len(self.attached_devices) self.tests = [] self.build_type = build_type def CreateShardedTestRunner(self, device, index): """Factory function to create a suite-specific test runner. Args: device: Device serial where this shard will run index: Index of this device in the pool. Returns: An object of BaseTestRunner type (that can provide a "Run()" method). """ pass def SetupSharding(self, tests): """Called before starting the shards.""" pass def OnTestsCompleted(self, test_runners, test_results): """Notifies that we completed the tests.""" pass def _KillHostForwarder(self): Forwarder.KillHost(self.build_type) def RunShardedTests(self): """Runs the tests in all connected devices. Returns: A TestResults object. """ logging.warning('*' * 80) logging.warning('Sharding in ' + str(len(self.attached_devices)) + ' devices.') logging.warning('Note that the output is not synchronized.') logging.warning('Look for the "Final result" banner in the end.') logging.warning('*' * 80) final_results = TestResults() self._KillHostForwarder() for retry in xrange(self.retries): logging.warning('Try %d of %d', retry + 1, self.retries) self.SetupSharding(self.tests) test_runners = [] # Try to create N shards, and retrying on failure. try: for index, device in enumerate(self.attached_devices): logging.warning('*' * 80) logging.warning('Creating shard %d for %s', index, device) logging.warning('*' * 80) test_runner = self.CreateShardedTestRunner(device, index) test_runners += [test_runner] except errors.DeviceUnresponsiveError as e: logging.critical('****Failed to create a shard: [%s]', e) self.attached_devices.remove(device) continue logging.warning('Starting...') pool = multiprocessing.Pool(len(self.attached_devices), SetTestsContainer, [BaseTestSharder.tests_container]) # map can't handle KeyboardInterrupt exception. It's a python bug. # So use map_async instead. async_results = pool.map_async(_ShardedTestRunnable, test_runners) try: results_lists = async_results.get(999999) except errors.DeviceUnresponsiveError as e: logging.critical('****Failed to run test: [%s]', e) self.attached_devices = android_commands.GetAttachedDevices() continue test_results = TestResults.FromTestResults(results_lists) # Re-check the attached devices for some devices may # become offline retry_devices = set(android_commands.GetAttachedDevices()) # Remove devices that had exceptions. retry_devices -= TestResults.DeviceExceptions(results_lists) # Retry on devices that didn't have any exception. self.attached_devices = list(retry_devices) if (retry == self.retries - 1 or len(self.attached_devices) == 0): all_passed = final_results.ok + test_results.ok final_results = test_results final_results.ok = all_passed break else: final_results.ok += test_results.ok self.tests = [] for t in test_results.GetAllBroken(): self.tests += [t.name] if not self.tests: break else: # We ran out retries, possibly out of healthy devices. # There's no recovery at this point. raise Exception('Unrecoverable error while retrying test runs.') self.OnTestsCompleted(test_runners, final_results) self._KillHostForwarder() return final_results
34.834437
79
0.680989
import android_commands import logging import multiprocessing from android_commands import errors from forwarder import Forwarder from test_result import TestResults def _ShardedTestRunnable(test): log_format = '[' + test.device + '] # %(asctime)-15s: %(message)s' if logging.getLogger().handlers: logging.getLogger().handlers[0].setFormatter(logging.Formatter(log_format)) else: logging.basicConfig(format=log_format) try: return test.Run() except SystemExit: return TestResults() def SetTestsContainer(tests_container): BaseTestSharder.tests_container = tests_container class BaseTestSharder(object): tests_container = None def __init__(self, attached_devices, build_type='Debug'): self.attached_devices = attached_devices self.retries = len(self.attached_devices) self.tests = [] self.build_type = build_type def CreateShardedTestRunner(self, device, index): pass def SetupSharding(self, tests): pass def OnTestsCompleted(self, test_runners, test_results): pass def _KillHostForwarder(self): Forwarder.KillHost(self.build_type) def RunShardedTests(self): logging.warning('*' * 80) logging.warning('Sharding in ' + str(len(self.attached_devices)) + ' devices.') logging.warning('Note that the output is not synchronized.') logging.warning('Look for the "Final result" banner in the end.') logging.warning('*' * 80) final_results = TestResults() self._KillHostForwarder() for retry in xrange(self.retries): logging.warning('Try %d of %d', retry + 1, self.retries) self.SetupSharding(self.tests) test_runners = [] # Try to create N shards, and retrying on failure. try: for index, device in enumerate(self.attached_devices): logging.warning('*' * 80) logging.warning('Creating shard %d for %s', index, device) logging.warning('*' * 80) test_runner = self.CreateShardedTestRunner(device, index) test_runners += [test_runner] except errors.DeviceUnresponsiveError as e: logging.critical('****Failed to create a shard: [%s]', e) self.attached_devices.remove(device) continue logging.warning('Starting...') pool = multiprocessing.Pool(len(self.attached_devices), SetTestsContainer, [BaseTestSharder.tests_container]) # map can't handle KeyboardInterrupt exception. It's a python bug. # So use map_async instead. async_results = pool.map_async(_ShardedTestRunnable, test_runners) try: results_lists = async_results.get(999999) except errors.DeviceUnresponsiveError as e: logging.critical('****Failed to run test: [%s]', e) self.attached_devices = android_commands.GetAttachedDevices() continue test_results = TestResults.FromTestResults(results_lists) # Re-check the attached devices for some devices may # become offline retry_devices = set(android_commands.GetAttachedDevices()) # Remove devices that had exceptions. retry_devices -= TestResults.DeviceExceptions(results_lists) # Retry on devices that didn't have any exception. self.attached_devices = list(retry_devices) if (retry == self.retries - 1 or len(self.attached_devices) == 0): all_passed = final_results.ok + test_results.ok final_results = test_results final_results.ok = all_passed break else: final_results.ok += test_results.ok self.tests = [] for t in test_results.GetAllBroken(): self.tests += [t.name] if not self.tests: break else: raise Exception('Unrecoverable error while retrying test runs.') self.OnTestsCompleted(test_runners, final_results) self._KillHostForwarder() return final_results
true
true
1c455a3b6c64198e9f6c6b8b99f938134a554603
817
py
Python
mmelemental/models/forcefield/bonded/bonds/base.py
RlyehAD/mmelemental
5f0754356fd2c89e9119cf810f1972430dfa75dc
[ "BSD-3-Clause" ]
null
null
null
mmelemental/models/forcefield/bonded/bonds/base.py
RlyehAD/mmelemental
5f0754356fd2c89e9119cf810f1972430dfa75dc
[ "BSD-3-Clause" ]
null
null
null
mmelemental/models/forcefield/bonded/bonds/base.py
RlyehAD/mmelemental
5f0754356fd2c89e9119cf810f1972430dfa75dc
[ "BSD-3-Clause" ]
null
null
null
from pydantic import Field from mmelemental.models.forcefield.params import Params from typing import Optional, List, Tuple, Union from cmselemental.types import Array import os import pathlib __all__ = ["Bonds"] class Bonds(Params): lengths: Array[float] = Field( ..., description="Equilibrium bond lengths. Default unit is Angstroms." ) lengths_units: Optional[str] = Field( "angstroms", description="Equilibrium bond lengths unit." ) connectivity: List[Tuple[Union[int, str], Union[int, str], float]] = Field( # type: ignore ..., description="Particle indices or names e.g. types for each bond and the bond order: (index1, index2, order).", min_items=1, ) _path = os.path.join(pathlib.Path(__file__).parent.absolute(), "potentials", "*.py")
34.041667
119
0.684211
from pydantic import Field from mmelemental.models.forcefield.params import Params from typing import Optional, List, Tuple, Union from cmselemental.types import Array import os import pathlib __all__ = ["Bonds"] class Bonds(Params): lengths: Array[float] = Field( ..., description="Equilibrium bond lengths. Default unit is Angstroms." ) lengths_units: Optional[str] = Field( "angstroms", description="Equilibrium bond lengths unit." ) connectivity: List[Tuple[Union[int, str], Union[int, str], float]] = Field( ..., description="Particle indices or names e.g. types for each bond and the bond order: (index1, index2, order).", min_items=1, ) _path = os.path.join(pathlib.Path(__file__).parent.absolute(), "potentials", "*.py")
true
true
1c455aa0f8a6d073be57b1f48b7b42ece8de7bc8
22,104
py
Python
cirq/ops/three_qubit_gates.py
Hongbo-Miao/Cirq
d6c6f9b1ea282e79db4475e5327d0380e6558ba6
[ "Apache-2.0" ]
null
null
null
cirq/ops/three_qubit_gates.py
Hongbo-Miao/Cirq
d6c6f9b1ea282e79db4475e5327d0380e6558ba6
[ "Apache-2.0" ]
null
null
null
cirq/ops/three_qubit_gates.py
Hongbo-Miao/Cirq
d6c6f9b1ea282e79db4475e5327d0380e6558ba6
[ "Apache-2.0" ]
1
2020-12-24T07:13:40.000Z
2020-12-24T07:13:40.000Z
# Copyright 2018 The Cirq Developers # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # https://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """Common quantum gates that target three qubits.""" from typing import AbstractSet, Any, List, Optional, Tuple, TYPE_CHECKING import numpy as np import sympy from cirq import linalg, protocols, value from cirq._compat import proper_repr from cirq._doc import document from cirq.ops import ( common_gates, controlled_gate, eigen_gate, gate_features, pauli_gates, swap_gates, ) if TYPE_CHECKING: # pylint: disable=unused-import import cirq class CCZPowGate( eigen_gate.EigenGate, gate_features.ThreeQubitGate, gate_features.InterchangeableQubitsGate ): """A doubly-controlled-Z that can be raised to a power. The matrix of `CCZ**t` is `diag(1, 1, 1, 1, 1, 1, 1, exp(i pi t))`. """ def _eigen_components(self): return [ (0, np.diag([1, 1, 1, 1, 1, 1, 1, 0])), (1, np.diag([0, 0, 0, 0, 0, 0, 0, 1])), ] def _trace_distance_bound_(self) -> Optional[float]: if self._is_parameterized_(): return None return abs(np.sin(self._exponent * 0.5 * np.pi)) def _pauli_expansion_(self) -> value.LinearDict[str]: if protocols.is_parameterized(self): return NotImplemented global_phase = 1j ** (2 * self._exponent * self._global_shift) z_phase = 1j ** self._exponent c = -1j * z_phase * np.sin(np.pi * self._exponent / 2) / 4 return value.LinearDict( { 'III': global_phase * (1 - c), 'IIZ': global_phase * c, 'IZI': global_phase * c, 'ZII': global_phase * c, 'ZZI': global_phase * -c, 'ZIZ': global_phase * -c, 'IZZ': global_phase * -c, 'ZZZ': global_phase * c, } ) def _decompose_(self, qubits): """An adjacency-respecting decomposition. 0: ───p───@──────────────@───────@──────────@────────── │ │ │ │ 1: ───p───X───@───p^-1───X───@───X──────@───X──────@─── │ │ │ │ 2: ───p───────X───p──────────X───p^-1───X───p^-1───X─── where p = T**self._exponent """ if protocols.is_parameterized(self): return NotImplemented a, b, c = qubits # Hacky magic: avoid the non-adjacent edge. if hasattr(b, 'is_adjacent'): if not b.is_adjacent(a): b, c = c, b elif not b.is_adjacent(c): a, b = b, a p = common_gates.T ** self._exponent sweep_abc = [common_gates.CNOT(a, b), common_gates.CNOT(b, c)] return [ p(a), p(b), p(c), sweep_abc, p(b) ** -1, p(c), sweep_abc, p(c) ** -1, sweep_abc, p(c) ** -1, sweep_abc, ] def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: if protocols.is_parameterized(self): return NotImplemented ooo = args.subspace_index(0b111) args.target_tensor[ooo] *= np.exp(1j * self.exponent * np.pi) p = 1j ** (2 * self._exponent * self._global_shift) if p != 1: args.target_tensor *= p return args.target_tensor def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': return protocols.CircuitDiagramInfo(('@', '@', '@'), exponent=self._diagram_exponent(args)) def _qasm_(self, args: 'cirq.QasmArgs', qubits: Tuple['cirq.Qid', ...]) -> Optional[str]: if self._exponent != 1: return None args.validate_version('2.0') lines = [ args.format('h {0};\n', qubits[2]), args.format('ccx {0},{1},{2};\n', qubits[0], qubits[1], qubits[2]), args.format('h {0};\n', qubits[2]), ] return ''.join(lines) def _quil_( self, qubits: Tuple['cirq.Qid', ...], formatter: 'cirq.QuilFormatter' ) -> Optional[str]: if self._exponent != 1: return None lines = [ formatter.format('H {0}\n', qubits[2]), formatter.format('CCNOT {0} {1} {2}\n', qubits[0], qubits[1], qubits[2]), formatter.format('H {0}\n', qubits[2]), ] return ''.join(lines) def __repr__(self) -> str: if self._global_shift == 0: if self._exponent == 1: return 'cirq.CCZ' return '(cirq.CCZ**{})'.format(proper_repr(self._exponent)) return 'cirq.CCZPowGate(exponent={}, global_shift={!r})'.format( proper_repr(self._exponent), self._global_shift ) def __str__(self) -> str: if self._exponent == 1: return 'CCZ' return 'CCZ**{}'.format(self._exponent) @value.value_equality() class ThreeQubitDiagonalGate(gate_features.ThreeQubitGate): """A gate given by a diagonal 8x8 matrix.""" def __init__(self, diag_angles_radians: List[value.TParamVal]) -> None: r"""A three qubit gate with only diagonal elements. This gate's off-diagonal elements are zero and it's on diagonal elements are all phases. Args: diag_angles_radians: The list of angles on the diagonal in radians. If these values are $(x_0, x_1, \ldots , x_7)$ then the unitary has diagonal values $(e^{i x_0}, e^{i x_1}, \ldots, e^{i x_7})$. """ self._diag_angles_radians: List[value.TParamVal] = diag_angles_radians def _is_parameterized_(self) -> bool: return any(protocols.is_parameterized(angle) for angle in self._diag_angles_radians) def _parameter_names_(self) -> AbstractSet[str]: return { name for angle in self._diag_angles_radians for name in protocols.parameter_names(angle) } def _resolve_parameters_( self, resolver: 'cirq.ParamResolverOrSimilarType' ) -> 'ThreeQubitDiagonalGate': return self.__class__( [protocols.resolve_parameters(angle, resolver) for angle in self._diag_angles_radians] ) def _has_unitary_(self) -> bool: return not self._is_parameterized_() def _unitary_(self) -> np.ndarray: if self._is_parameterized_(): return NotImplemented return np.diag([np.exp(1j * angle) for angle in self._diag_angles_radians]) def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: if self._is_parameterized_(): return NotImplemented for index, angle in enumerate(self._diag_angles_radians): little_endian_index = 4 * (index & 1) + 2 * ((index >> 1) & 1) + ((index >> 2) & 1) subspace_index = args.subspace_index(little_endian_index) args.target_tensor[subspace_index] *= np.exp(1j * angle) return args.target_tensor def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': rounded_angles = np.array(self._diag_angles_radians) if args.precision is not None: rounded_angles = rounded_angles.round(args.precision) diag_str = 'diag({})'.format(', '.join(proper_repr(angle) for angle in rounded_angles)) return protocols.CircuitDiagramInfo((diag_str, '#2', '#3')) def __pow__(self, exponent: Any) -> 'ThreeQubitDiagonalGate': if not isinstance(exponent, (int, float, sympy.Basic)): return NotImplemented return ThreeQubitDiagonalGate( [protocols.mul(angle, exponent, NotImplemented) for angle in self._diag_angles_radians] ) def _decompose_(self, qubits): """An adjacency-respecting decomposition. 0: ───p_0───@──────────────@───────@──────────@────────── │ │ │ │ 1: ───p_1───X───@───p_3────X───@───X──────@───X──────@─── │ │ │ │ 2: ───p_2───────X───p_4────────X───p_5────X───p_6────X─── where p_i = T**(4*x_i) and x_i solve the system of equations [0, 0, 1, 0, 1, 1, 1][x_0] [r_1] [0, 1, 0, 1, 1, 0, 1][x_1] [r_2] [0, 1, 1, 1, 0, 1, 0][x_2] [r_3] [1, 0, 0, 1, 1, 1, 0][x_3] = [r_4] [1, 0, 1, 1, 0, 0, 1][x_4] [r_5] [1, 1, 0, 0, 0, 1, 1][x_5] [r_6] [1, 1, 1, 0, 1, 0, 0][x_6] [r_7] where r_i is self._diag_angles_radians[i]. The above system was created by equating the composition of the gates in the circuit diagram to np.diag(self._diag_angles) (shifted by a global phase of np.exp(-1j * self._diag_angles[0])). """ a, b, c = qubits if hasattr(b, 'is_adjacent'): if not b.is_adjacent(a): b, c = c, b elif not b.is_adjacent(c): a, b = b, a sweep_abc = [common_gates.CNOT(a, b), common_gates.CNOT(b, c)] phase_matrix_inverse = 0.25 * np.array( [ [-1, -1, -1, 1, 1, 1, 1], [-1, 1, 1, -1, -1, 1, 1], [1, -1, 1, -1, 1, -1, 1], [-1, 1, 1, 1, 1, -1, -1], [1, 1, -1, 1, -1, -1, 1], [1, -1, 1, 1, -1, 1, -1], [1, 1, -1, -1, 1, 1, -1], ] ) shifted_angles_tail = [ angle - self._diag_angles_radians[0] for angle in self._diag_angles_radians[1:] ] phase_solutions = phase_matrix_inverse.dot(shifted_angles_tail) p_gates = [pauli_gates.Z ** (solution / np.pi) for solution in phase_solutions] return [ p_gates[0](a), p_gates[1](b), p_gates[2](c), sweep_abc, p_gates[3](b), p_gates[4](c), sweep_abc, p_gates[5](c), sweep_abc, p_gates[6](c), sweep_abc, ] def _value_equality_values_(self): return tuple(self._diag_angles_radians) def _pauli_expansion_(self) -> value.LinearDict[str]: if protocols.is_parameterized(self): return NotImplemented x = [np.exp(1j * angle) for angle in self._diag_angles_radians] return value.LinearDict( { 'III': (x[0] + x[1] + x[2] + x[3] + x[4] + x[5] + x[6] + x[7]) / 8, 'IIZ': (x[0] - x[1] + x[2] - x[3] + x[4] - x[5] + x[6] - x[7]) / 8, 'IZI': (x[0] + x[1] - x[2] - x[3] + x[4] + x[5] - x[6] - x[7]) / 8, 'IZZ': (x[0] - x[1] - x[2] + x[3] + x[4] - x[5] - x[6] + x[7]) / 8, 'ZII': (x[0] + x[1] + x[2] + x[3] - x[4] - x[5] - x[6] - x[7]) / 8, 'ZIZ': (x[0] - x[1] + x[2] - x[3] - x[4] + x[5] - x[6] + x[7]) / 8, 'ZZI': (x[0] + x[1] - x[2] - x[3] - x[4] - x[5] + x[6] + x[7]) / 8, 'ZZZ': (x[0] - x[1] - x[2] + x[3] - x[4] + x[5] + x[6] - x[7]) / 8, } ) def __repr__(self) -> str: return 'cirq.ThreeQubitDiagonalGate([{}])'.format( ','.join(proper_repr(angle) for angle in self._diag_angles_radians) ) class CCXPowGate( eigen_gate.EigenGate, gate_features.ThreeQubitGate, gate_features.InterchangeableQubitsGate ): """A Toffoli (doubly-controlled-NOT) that can be raised to a power. The matrix of `CCX**t` is an 8x8 identity except the bottom right 2x2 area is the matrix of `X**t`. """ def _eigen_components(self): return [ (0, linalg.block_diag(np.diag([1, 1, 1, 1, 1, 1]), np.array([[0.5, 0.5], [0.5, 0.5]]))), ( 1, linalg.block_diag( np.diag([0, 0, 0, 0, 0, 0]), np.array([[0.5, -0.5], [-0.5, 0.5]]) ), ), ] def _trace_distance_bound_(self) -> Optional[float]: if self._is_parameterized_(): return None return abs(np.sin(self._exponent * 0.5 * np.pi)) def _pauli_expansion_(self) -> value.LinearDict[str]: if protocols.is_parameterized(self): return NotImplemented global_phase = 1j ** (2 * self._exponent * self._global_shift) z_phase = 1j ** self._exponent c = -1j * z_phase * np.sin(np.pi * self._exponent / 2) / 4 return value.LinearDict( { 'III': global_phase * (1 - c), 'IIX': global_phase * c, 'IZI': global_phase * c, 'ZII': global_phase * c, 'ZZI': global_phase * -c, 'ZIX': global_phase * -c, 'IZX': global_phase * -c, 'ZZX': global_phase * c, } ) def qubit_index_to_equivalence_group_key(self, index): return index < 2 def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: if protocols.is_parameterized(self): return NotImplemented p = 1j ** (2 * self._exponent * self._global_shift) if p != 1: args.target_tensor *= p return protocols.apply_unitary( controlled_gate.ControlledGate( controlled_gate.ControlledGate(pauli_gates.X ** self.exponent) ), protocols.ApplyUnitaryArgs(args.target_tensor, args.available_buffer, args.axes), default=NotImplemented, ) def _decompose_(self, qubits): c1, c2, t = qubits yield common_gates.H(t) yield CCZ(c1, c2, t) ** self._exponent yield common_gates.H(t) def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': return protocols.CircuitDiagramInfo(('@', '@', 'X'), exponent=self._diagram_exponent(args)) def _qasm_(self, args: 'cirq.QasmArgs', qubits: Tuple['cirq.Qid', ...]) -> Optional[str]: if self._exponent != 1: return None args.validate_version('2.0') return args.format('ccx {0},{1},{2};\n', qubits[0], qubits[1], qubits[2]) def _quil_( self, qubits: Tuple['cirq.Qid', ...], formatter: 'cirq.QuilFormatter' ) -> Optional[str]: if self._exponent != 1: return None return formatter.format('CCNOT {0} {1} {2}\n', qubits[0], qubits[1], qubits[2]) def __repr__(self) -> str: if self._global_shift == 0: if self._exponent == 1: return 'cirq.TOFFOLI' return '(cirq.TOFFOLI**{})'.format(proper_repr(self._exponent)) return 'cirq.CCXPowGate(exponent={}, global_shift={!r})'.format( proper_repr(self._exponent), self._global_shift ) def __str__(self) -> str: if self._exponent == 1: return 'TOFFOLI' return 'TOFFOLI**{}'.format(self._exponent) @value.value_equality() class CSwapGate(gate_features.ThreeQubitGate, gate_features.InterchangeableQubitsGate): """A controlled swap gate. The Fredkin gate.""" def qubit_index_to_equivalence_group_key(self, index): return 0 if index == 0 else 1 def _pauli_expansion_(self) -> value.LinearDict[str]: return value.LinearDict( { 'III': 3 / 4, 'IXX': 1 / 4, 'IYY': 1 / 4, 'IZZ': 1 / 4, 'ZII': 1 / 4, 'ZXX': -1 / 4, 'ZYY': -1 / 4, 'ZZZ': -1 / 4, } ) def _trace_distance_bound_(self) -> float: return 1.0 def _decompose_(self, qubits): c, t1, t2 = qubits # Hacky magic: special case based on adjacency. if hasattr(t1, 'is_adjacent'): if not t1.is_adjacent(t2): # Targets separated by control. return self._decompose_inside_control(t1, c, t2) if not t1.is_adjacent(c): # Control separated from t1 by t2. return self._decompose_outside_control(c, t2, t1) return self._decompose_outside_control(c, t1, t2) def _decompose_inside_control( self, target1: 'cirq.Qid', control: 'cirq.Qid', target2: 'cirq.Qid' ) -> 'cirq.OP_TREE': """A decomposition assuming the control separates the targets. target1: ─@─X───────T──────@────────@─────────X───@─────X^-0.5─ │ │ │ │ │ │ control: ─X─@─X─────@─T^-1─X─@─T────X─@─X^0.5─@─@─X─@────────── │ │ │ │ │ │ target2: ─────@─H─T─X─T──────X─T^-1───X─T^-1────X───X─H─S^-1─── """ a, b, c = target1, control, target2 yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, a) yield common_gates.CNOT(c, b) yield common_gates.H(c) yield common_gates.T(c) yield common_gates.CNOT(b, c) yield common_gates.T(a) yield common_gates.T(b) ** -1 yield common_gates.T(c) yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, c) yield common_gates.T(b) yield common_gates.T(c) ** -1 yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, c) yield pauli_gates.X(b) ** 0.5 yield common_gates.T(c) ** -1 yield common_gates.CNOT(b, a) yield common_gates.CNOT(b, c) yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, c) yield common_gates.H(c) yield common_gates.S(c) ** -1 yield pauli_gates.X(a) ** -0.5 def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: return protocols.apply_unitary( controlled_gate.ControlledGate(swap_gates.SWAP), protocols.ApplyUnitaryArgs(args.target_tensor, args.available_buffer, args.axes), default=NotImplemented, ) def _decompose_outside_control( self, control: 'cirq.Qid', near_target: 'cirq.Qid', far_target: 'cirq.Qid' ) -> 'cirq.OP_TREE': """A decomposition assuming one of the targets is in the middle. control: ───T──────@────────@───@────────────@──────────────── │ │ │ │ near: ─X─T──────X─@─T^-1─X─@─X────@─X^0.5─X─@─X^0.5──────── │ │ │ │ │ far: ─@─Y^-0.5─T─X─T──────X─T^-1─X─T^-1────X─S─────X^-0.5─ """ a, b, c = control, near_target, far_target t = common_gates.T sweep_abc = [common_gates.CNOT(a, b), common_gates.CNOT(b, c)] yield common_gates.CNOT(c, b) yield pauli_gates.Y(c) ** -0.5 yield t(a), t(b), t(c) yield sweep_abc yield t(b) ** -1, t(c) yield sweep_abc yield t(c) ** -1 yield sweep_abc yield t(c) ** -1 yield pauli_gates.X(b) ** 0.5 yield sweep_abc yield common_gates.S(c) yield pauli_gates.X(b) ** 0.5 yield pauli_gates.X(c) ** -0.5 def _has_unitary_(self) -> bool: return True def _unitary_(self) -> np.ndarray: return linalg.block_diag(np.diag([1, 1, 1, 1, 1]), np.array([[0, 1], [1, 0]]), np.diag([1])) def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': if not args.use_unicode_characters: return protocols.CircuitDiagramInfo(('@', 'swap', 'swap')) return protocols.CircuitDiagramInfo(('@', '×', '×')) def _qasm_(self, args: 'cirq.QasmArgs', qubits: Tuple['cirq.Qid', ...]) -> Optional[str]: args.validate_version('2.0') return args.format('cswap {0},{1},{2};\n', qubits[0], qubits[1], qubits[2]) def _quil_( self, qubits: Tuple['cirq.Qid', ...], formatter: 'cirq.QuilFormatter' ) -> Optional[str]: return formatter.format('CSWAP {0} {1} {2}\n', qubits[0], qubits[1], qubits[2]) def _value_equality_values_(self): return () def __str__(self) -> str: return 'FREDKIN' def __repr__(self) -> str: return 'cirq.FREDKIN' CCZ = CCZPowGate() document( CCZ, """The Controlled-Controlled-Z gate. The `exponent=1` instance of `cirq.CCZPowGate`. Matrix: ``` [[1 . . . . . . .], [. 1 . . . . . .], [. . 1 . . . . .], [. . . 1 . . . .], [. . . . 1 . . .], [. . . . . 1 . .], [. . . . . . 1 .], [. . . . . . . -1]] ``` """, ) CCNotPowGate = CCXPowGate CCX = TOFFOLI = CCNOT = CCXPowGate() document( CCX, """The TOFFOLI gate. The `exponent=1` instance of `cirq.CCXPowGate`. Matrix: ``` [[1 . . . . . . .], [. 1 . . . . . .], [. . 1 . . . . .], [. . . 1 . . . .], [. . . . 1 . . .], [. . . . . 1 . .], [. . . . . . . 1], [. . . . . . 1 .]] ``` """, ) CSWAP = FREDKIN = CSwapGate() document( CSWAP, """The Controlled Swap gate. An instance of `cirq.CSwapGate`. Matrix: ``` [[1 . . . . . . .], [. 1 . . . . . .], [. . 1 . . . . .], [. . . 1 . . . .], [. . . . 1 . . .], [. . . . . . 1 .], [. . . . . 1 . .], [. . . . . . . 1]] ``` """, )
34.864353
100
0.513346
from typing import AbstractSet, Any, List, Optional, Tuple, TYPE_CHECKING import numpy as np import sympy from cirq import linalg, protocols, value from cirq._compat import proper_repr from cirq._doc import document from cirq.ops import ( common_gates, controlled_gate, eigen_gate, gate_features, pauli_gates, swap_gates, ) if TYPE_CHECKING: import cirq class CCZPowGate( eigen_gate.EigenGate, gate_features.ThreeQubitGate, gate_features.InterchangeableQubitsGate ): def _eigen_components(self): return [ (0, np.diag([1, 1, 1, 1, 1, 1, 1, 0])), (1, np.diag([0, 0, 0, 0, 0, 0, 0, 1])), ] def _trace_distance_bound_(self) -> Optional[float]: if self._is_parameterized_(): return None return abs(np.sin(self._exponent * 0.5 * np.pi)) def _pauli_expansion_(self) -> value.LinearDict[str]: if protocols.is_parameterized(self): return NotImplemented global_phase = 1j ** (2 * self._exponent * self._global_shift) z_phase = 1j ** self._exponent c = -1j * z_phase * np.sin(np.pi * self._exponent / 2) / 4 return value.LinearDict( { 'III': global_phase * (1 - c), 'IIZ': global_phase * c, 'IZI': global_phase * c, 'ZII': global_phase * c, 'ZZI': global_phase * -c, 'ZIZ': global_phase * -c, 'IZZ': global_phase * -c, 'ZZZ': global_phase * c, } ) def _decompose_(self, qubits): if protocols.is_parameterized(self): return NotImplemented a, b, c = qubits if hasattr(b, 'is_adjacent'): if not b.is_adjacent(a): b, c = c, b elif not b.is_adjacent(c): a, b = b, a p = common_gates.T ** self._exponent sweep_abc = [common_gates.CNOT(a, b), common_gates.CNOT(b, c)] return [ p(a), p(b), p(c), sweep_abc, p(b) ** -1, p(c), sweep_abc, p(c) ** -1, sweep_abc, p(c) ** -1, sweep_abc, ] def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: if protocols.is_parameterized(self): return NotImplemented ooo = args.subspace_index(0b111) args.target_tensor[ooo] *= np.exp(1j * self.exponent * np.pi) p = 1j ** (2 * self._exponent * self._global_shift) if p != 1: args.target_tensor *= p return args.target_tensor def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': return protocols.CircuitDiagramInfo(('@', '@', '@'), exponent=self._diagram_exponent(args)) def _qasm_(self, args: 'cirq.QasmArgs', qubits: Tuple['cirq.Qid', ...]) -> Optional[str]: if self._exponent != 1: return None args.validate_version('2.0') lines = [ args.format('h {0};\n', qubits[2]), args.format('ccx {0},{1},{2};\n', qubits[0], qubits[1], qubits[2]), args.format('h {0};\n', qubits[2]), ] return ''.join(lines) def _quil_( self, qubits: Tuple['cirq.Qid', ...], formatter: 'cirq.QuilFormatter' ) -> Optional[str]: if self._exponent != 1: return None lines = [ formatter.format('H {0}\n', qubits[2]), formatter.format('CCNOT {0} {1} {2}\n', qubits[0], qubits[1], qubits[2]), formatter.format('H {0}\n', qubits[2]), ] return ''.join(lines) def __repr__(self) -> str: if self._global_shift == 0: if self._exponent == 1: return 'cirq.CCZ' return '(cirq.CCZ**{})'.format(proper_repr(self._exponent)) return 'cirq.CCZPowGate(exponent={}, global_shift={!r})'.format( proper_repr(self._exponent), self._global_shift ) def __str__(self) -> str: if self._exponent == 1: return 'CCZ' return 'CCZ**{}'.format(self._exponent) @value.value_equality() class ThreeQubitDiagonalGate(gate_features.ThreeQubitGate): def __init__(self, diag_angles_radians: List[value.TParamVal]) -> None: self._diag_angles_radians: List[value.TParamVal] = diag_angles_radians def _is_parameterized_(self) -> bool: return any(protocols.is_parameterized(angle) for angle in self._diag_angles_radians) def _parameter_names_(self) -> AbstractSet[str]: return { name for angle in self._diag_angles_radians for name in protocols.parameter_names(angle) } def _resolve_parameters_( self, resolver: 'cirq.ParamResolverOrSimilarType' ) -> 'ThreeQubitDiagonalGate': return self.__class__( [protocols.resolve_parameters(angle, resolver) for angle in self._diag_angles_radians] ) def _has_unitary_(self) -> bool: return not self._is_parameterized_() def _unitary_(self) -> np.ndarray: if self._is_parameterized_(): return NotImplemented return np.diag([np.exp(1j * angle) for angle in self._diag_angles_radians]) def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: if self._is_parameterized_(): return NotImplemented for index, angle in enumerate(self._diag_angles_radians): little_endian_index = 4 * (index & 1) + 2 * ((index >> 1) & 1) + ((index >> 2) & 1) subspace_index = args.subspace_index(little_endian_index) args.target_tensor[subspace_index] *= np.exp(1j * angle) return args.target_tensor def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': rounded_angles = np.array(self._diag_angles_radians) if args.precision is not None: rounded_angles = rounded_angles.round(args.precision) diag_str = 'diag({})'.format(', '.join(proper_repr(angle) for angle in rounded_angles)) return protocols.CircuitDiagramInfo((diag_str, '#2', '#3')) def __pow__(self, exponent: Any) -> 'ThreeQubitDiagonalGate': if not isinstance(exponent, (int, float, sympy.Basic)): return NotImplemented return ThreeQubitDiagonalGate( [protocols.mul(angle, exponent, NotImplemented) for angle in self._diag_angles_radians] ) def _decompose_(self, qubits): a, b, c = qubits if hasattr(b, 'is_adjacent'): if not b.is_adjacent(a): b, c = c, b elif not b.is_adjacent(c): a, b = b, a sweep_abc = [common_gates.CNOT(a, b), common_gates.CNOT(b, c)] phase_matrix_inverse = 0.25 * np.array( [ [-1, -1, -1, 1, 1, 1, 1], [-1, 1, 1, -1, -1, 1, 1], [1, -1, 1, -1, 1, -1, 1], [-1, 1, 1, 1, 1, -1, -1], [1, 1, -1, 1, -1, -1, 1], [1, -1, 1, 1, -1, 1, -1], [1, 1, -1, -1, 1, 1, -1], ] ) shifted_angles_tail = [ angle - self._diag_angles_radians[0] for angle in self._diag_angles_radians[1:] ] phase_solutions = phase_matrix_inverse.dot(shifted_angles_tail) p_gates = [pauli_gates.Z ** (solution / np.pi) for solution in phase_solutions] return [ p_gates[0](a), p_gates[1](b), p_gates[2](c), sweep_abc, p_gates[3](b), p_gates[4](c), sweep_abc, p_gates[5](c), sweep_abc, p_gates[6](c), sweep_abc, ] def _value_equality_values_(self): return tuple(self._diag_angles_radians) def _pauli_expansion_(self) -> value.LinearDict[str]: if protocols.is_parameterized(self): return NotImplemented x = [np.exp(1j * angle) for angle in self._diag_angles_radians] return value.LinearDict( { 'III': (x[0] + x[1] + x[2] + x[3] + x[4] + x[5] + x[6] + x[7]) / 8, 'IIZ': (x[0] - x[1] + x[2] - x[3] + x[4] - x[5] + x[6] - x[7]) / 8, 'IZI': (x[0] + x[1] - x[2] - x[3] + x[4] + x[5] - x[6] - x[7]) / 8, 'IZZ': (x[0] - x[1] - x[2] + x[3] + x[4] - x[5] - x[6] + x[7]) / 8, 'ZII': (x[0] + x[1] + x[2] + x[3] - x[4] - x[5] - x[6] - x[7]) / 8, 'ZIZ': (x[0] - x[1] + x[2] - x[3] - x[4] + x[5] - x[6] + x[7]) / 8, 'ZZI': (x[0] + x[1] - x[2] - x[3] - x[4] - x[5] + x[6] + x[7]) / 8, 'ZZZ': (x[0] - x[1] - x[2] + x[3] - x[4] + x[5] + x[6] - x[7]) / 8, } ) def __repr__(self) -> str: return 'cirq.ThreeQubitDiagonalGate([{}])'.format( ','.join(proper_repr(angle) for angle in self._diag_angles_radians) ) class CCXPowGate( eigen_gate.EigenGate, gate_features.ThreeQubitGate, gate_features.InterchangeableQubitsGate ): def _eigen_components(self): return [ (0, linalg.block_diag(np.diag([1, 1, 1, 1, 1, 1]), np.array([[0.5, 0.5], [0.5, 0.5]]))), ( 1, linalg.block_diag( np.diag([0, 0, 0, 0, 0, 0]), np.array([[0.5, -0.5], [-0.5, 0.5]]) ), ), ] def _trace_distance_bound_(self) -> Optional[float]: if self._is_parameterized_(): return None return abs(np.sin(self._exponent * 0.5 * np.pi)) def _pauli_expansion_(self) -> value.LinearDict[str]: if protocols.is_parameterized(self): return NotImplemented global_phase = 1j ** (2 * self._exponent * self._global_shift) z_phase = 1j ** self._exponent c = -1j * z_phase * np.sin(np.pi * self._exponent / 2) / 4 return value.LinearDict( { 'III': global_phase * (1 - c), 'IIX': global_phase * c, 'IZI': global_phase * c, 'ZII': global_phase * c, 'ZZI': global_phase * -c, 'ZIX': global_phase * -c, 'IZX': global_phase * -c, 'ZZX': global_phase * c, } ) def qubit_index_to_equivalence_group_key(self, index): return index < 2 def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: if protocols.is_parameterized(self): return NotImplemented p = 1j ** (2 * self._exponent * self._global_shift) if p != 1: args.target_tensor *= p return protocols.apply_unitary( controlled_gate.ControlledGate( controlled_gate.ControlledGate(pauli_gates.X ** self.exponent) ), protocols.ApplyUnitaryArgs(args.target_tensor, args.available_buffer, args.axes), default=NotImplemented, ) def _decompose_(self, qubits): c1, c2, t = qubits yield common_gates.H(t) yield CCZ(c1, c2, t) ** self._exponent yield common_gates.H(t) def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': return protocols.CircuitDiagramInfo(('@', '@', 'X'), exponent=self._diagram_exponent(args)) def _qasm_(self, args: 'cirq.QasmArgs', qubits: Tuple['cirq.Qid', ...]) -> Optional[str]: if self._exponent != 1: return None args.validate_version('2.0') return args.format('ccx {0},{1},{2};\n', qubits[0], qubits[1], qubits[2]) def _quil_( self, qubits: Tuple['cirq.Qid', ...], formatter: 'cirq.QuilFormatter' ) -> Optional[str]: if self._exponent != 1: return None return formatter.format('CCNOT {0} {1} {2}\n', qubits[0], qubits[1], qubits[2]) def __repr__(self) -> str: if self._global_shift == 0: if self._exponent == 1: return 'cirq.TOFFOLI' return '(cirq.TOFFOLI**{})'.format(proper_repr(self._exponent)) return 'cirq.CCXPowGate(exponent={}, global_shift={!r})'.format( proper_repr(self._exponent), self._global_shift ) def __str__(self) -> str: if self._exponent == 1: return 'TOFFOLI' return 'TOFFOLI**{}'.format(self._exponent) @value.value_equality() class CSwapGate(gate_features.ThreeQubitGate, gate_features.InterchangeableQubitsGate): def qubit_index_to_equivalence_group_key(self, index): return 0 if index == 0 else 1 def _pauli_expansion_(self) -> value.LinearDict[str]: return value.LinearDict( { 'III': 3 / 4, 'IXX': 1 / 4, 'IYY': 1 / 4, 'IZZ': 1 / 4, 'ZII': 1 / 4, 'ZXX': -1 / 4, 'ZYY': -1 / 4, 'ZZZ': -1 / 4, } ) def _trace_distance_bound_(self) -> float: return 1.0 def _decompose_(self, qubits): c, t1, t2 = qubits if hasattr(t1, 'is_adjacent'): if not t1.is_adjacent(t2): return self._decompose_inside_control(t1, c, t2) if not t1.is_adjacent(c): return self._decompose_outside_control(c, t2, t1) return self._decompose_outside_control(c, t1, t2) def _decompose_inside_control( self, target1: 'cirq.Qid', control: 'cirq.Qid', target2: 'cirq.Qid' ) -> 'cirq.OP_TREE': a, b, c = target1, control, target2 yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, a) yield common_gates.CNOT(c, b) yield common_gates.H(c) yield common_gates.T(c) yield common_gates.CNOT(b, c) yield common_gates.T(a) yield common_gates.T(b) ** -1 yield common_gates.T(c) yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, c) yield common_gates.T(b) yield common_gates.T(c) ** -1 yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, c) yield pauli_gates.X(b) ** 0.5 yield common_gates.T(c) ** -1 yield common_gates.CNOT(b, a) yield common_gates.CNOT(b, c) yield common_gates.CNOT(a, b) yield common_gates.CNOT(b, c) yield common_gates.H(c) yield common_gates.S(c) ** -1 yield pauli_gates.X(a) ** -0.5 def _apply_unitary_(self, args: 'protocols.ApplyUnitaryArgs') -> np.ndarray: return protocols.apply_unitary( controlled_gate.ControlledGate(swap_gates.SWAP), protocols.ApplyUnitaryArgs(args.target_tensor, args.available_buffer, args.axes), default=NotImplemented, ) def _decompose_outside_control( self, control: 'cirq.Qid', near_target: 'cirq.Qid', far_target: 'cirq.Qid' ) -> 'cirq.OP_TREE': a, b, c = control, near_target, far_target t = common_gates.T sweep_abc = [common_gates.CNOT(a, b), common_gates.CNOT(b, c)] yield common_gates.CNOT(c, b) yield pauli_gates.Y(c) ** -0.5 yield t(a), t(b), t(c) yield sweep_abc yield t(b) ** -1, t(c) yield sweep_abc yield t(c) ** -1 yield sweep_abc yield t(c) ** -1 yield pauli_gates.X(b) ** 0.5 yield sweep_abc yield common_gates.S(c) yield pauli_gates.X(b) ** 0.5 yield pauli_gates.X(c) ** -0.5 def _has_unitary_(self) -> bool: return True def _unitary_(self) -> np.ndarray: return linalg.block_diag(np.diag([1, 1, 1, 1, 1]), np.array([[0, 1], [1, 0]]), np.diag([1])) def _circuit_diagram_info_( self, args: 'cirq.CircuitDiagramInfoArgs' ) -> 'cirq.CircuitDiagramInfo': if not args.use_unicode_characters: return protocols.CircuitDiagramInfo(('@', 'swap', 'swap')) return protocols.CircuitDiagramInfo(('@', '×', '×')) def _qasm_(self, args: 'cirq.QasmArgs', qubits: Tuple['cirq.Qid', ...]) -> Optional[str]: args.validate_version('2.0') return args.format('cswap {0},{1},{2};\n', qubits[0], qubits[1], qubits[2]) def _quil_( self, qubits: Tuple['cirq.Qid', ...], formatter: 'cirq.QuilFormatter' ) -> Optional[str]: return formatter.format('CSWAP {0} {1} {2}\n', qubits[0], qubits[1], qubits[2]) def _value_equality_values_(self): return () def __str__(self) -> str: return 'FREDKIN' def __repr__(self) -> str: return 'cirq.FREDKIN' CCZ = CCZPowGate() document( CCZ, """The Controlled-Controlled-Z gate. The `exponent=1` instance of `cirq.CCZPowGate`. Matrix: ``` [[1 . . . . . . .], [. 1 . . . . . .], [. . 1 . . . . .], [. . . 1 . . . .], [. . . . 1 . . .], [. . . . . 1 . .], [. . . . . . 1 .], [. . . . . . . -1]] ``` """, ) CCNotPowGate = CCXPowGate CCX = TOFFOLI = CCNOT = CCXPowGate() document( CCX, """The TOFFOLI gate. The `exponent=1` instance of `cirq.CCXPowGate`. Matrix: ``` [[1 . . . . . . .], [. 1 . . . . . .], [. . 1 . . . . .], [. . . 1 . . . .], [. . . . 1 . . .], [. . . . . 1 . .], [. . . . . . . 1], [. . . . . . 1 .]] ``` """, ) CSWAP = FREDKIN = CSwapGate() document( CSWAP, """The Controlled Swap gate. An instance of `cirq.CSwapGate`. Matrix: ``` [[1 . . . . . . .], [. 1 . . . . . .], [. . 1 . . . . .], [. . . 1 . . . .], [. . . . 1 . . .], [. . . . . . 1 .], [. . . . . 1 . .], [. . . . . . . 1]] ``` """, )
true
true
1c455c21b416c77406ef8ef3f269649ffa99767d
657
py
Python
tests/while/test_while_class_in_body.py
sco1/pylox
b4820828306c20cee3f8533c2547fafb92c6c1bd
[ "MIT" ]
2
2021-12-18T01:52:50.000Z
2022-01-17T19:41:52.000Z
tests/while/test_while_class_in_body.py
sco1/pylox
b4820828306c20cee3f8533c2547fafb92c6c1bd
[ "MIT" ]
18
2021-11-30T04:05:53.000Z
2022-02-01T03:30:04.000Z
tests/while/test_while_class_in_body.py
sco1/pylox
b4820828306c20cee3f8533c2547fafb92c6c1bd
[ "MIT" ]
null
null
null
from textwrap import dedent import pytest from pylox.lox import Lox # Base cases from https://github.com/munificent/craftinginterpreters/blob/master/test/while/class_in_body.lox TEST_SRC = dedent( """\ // [line 2] Error at 'class': Expect expression. while (true) class Foo {} """ ) EXPECTED_STDOUTS = ["2:14: LoxParseError: Expected expression."] def test_class_in_body(capsys: pytest.CaptureFixture) -> None: interpreter = Lox() interpreter.run(TEST_SRC) assert interpreter.had_error assert not interpreter.had_runtime_error all_out = capsys.readouterr().out.splitlines() assert all_out == EXPECTED_STDOUTS
24.333333
109
0.727549
from textwrap import dedent import pytest from pylox.lox import Lox TEST_SRC = dedent( """\ // [line 2] Error at 'class': Expect expression. while (true) class Foo {} """ ) EXPECTED_STDOUTS = ["2:14: LoxParseError: Expected expression."] def test_class_in_body(capsys: pytest.CaptureFixture) -> None: interpreter = Lox() interpreter.run(TEST_SRC) assert interpreter.had_error assert not interpreter.had_runtime_error all_out = capsys.readouterr().out.splitlines() assert all_out == EXPECTED_STDOUTS
true
true
1c455d557f5e17a71c8823251f3fd837386f7ace
2,004
py
Python
launch/mouse_with_lidar.launch.py
rt-net/raspimouse_ros2_examples
f16aef6c087a6e6325801b9f6a10b272b4d59c91
[ "Apache-2.0" ]
30
2020-05-08T12:13:03.000Z
2021-12-27T20:14:43.000Z
launch/mouse_with_lidar.launch.py
rt-net/raspimouse_ros2_examples
f16aef6c087a6e6325801b9f6a10b272b4d59c91
[ "Apache-2.0" ]
16
2020-05-28T02:35:24.000Z
2021-12-10T05:41:31.000Z
launch/mouse_with_lidar.launch.py
rt-net/raspimouse_ros2_examples
f16aef6c087a6e6325801b9f6a10b272b4d59c91
[ "Apache-2.0" ]
4
2020-10-02T23:50:02.000Z
2021-08-25T14:19:17.000Z
# Copyright 2020 RT Corporation # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import os from ament_index_python.packages import get_package_share_directory from launch import LaunchDescription from launch.actions import DeclareLaunchArgument from launch.actions import IncludeLaunchDescription from launch.actions import OpaqueFunction from launch.launch_description_sources import PythonLaunchDescriptionSource from launch_ros.actions import LifecycleNode def generate_launch_description(): declare_lidar = DeclareLaunchArgument( 'lidar', default_value='lds', description='LiDAR: lds only, for now.' ) mouse_node = LifecycleNode( name='raspimouse', package='raspimouse', executable='raspimouse', output='screen', parameters=[os.path.join(get_package_share_directory( 'raspimouse_ros2_examples'), 'config', 'mouse.yml')] ) def func_launch_lidar_node(context): if context.launch_configurations['lidar'] == 'lds': return [IncludeLaunchDescription( PythonLaunchDescriptionSource([os.path.join( get_package_share_directory('hls_lfcd_lds_driver'), 'launch'), '/hlds_laser.launch.py' ]),)] launch_lidar_node = OpaqueFunction(function=func_launch_lidar_node) ld = LaunchDescription() ld.add_action(declare_lidar) ld.add_action(mouse_node) ld.add_action(launch_lidar_node) return ld
35.785714
75
0.72006
import os from ament_index_python.packages import get_package_share_directory from launch import LaunchDescription from launch.actions import DeclareLaunchArgument from launch.actions import IncludeLaunchDescription from launch.actions import OpaqueFunction from launch.launch_description_sources import PythonLaunchDescriptionSource from launch_ros.actions import LifecycleNode def generate_launch_description(): declare_lidar = DeclareLaunchArgument( 'lidar', default_value='lds', description='LiDAR: lds only, for now.' ) mouse_node = LifecycleNode( name='raspimouse', package='raspimouse', executable='raspimouse', output='screen', parameters=[os.path.join(get_package_share_directory( 'raspimouse_ros2_examples'), 'config', 'mouse.yml')] ) def func_launch_lidar_node(context): if context.launch_configurations['lidar'] == 'lds': return [IncludeLaunchDescription( PythonLaunchDescriptionSource([os.path.join( get_package_share_directory('hls_lfcd_lds_driver'), 'launch'), '/hlds_laser.launch.py' ]),)] launch_lidar_node = OpaqueFunction(function=func_launch_lidar_node) ld = LaunchDescription() ld.add_action(declare_lidar) ld.add_action(mouse_node) ld.add_action(launch_lidar_node) return ld
true
true
1c455e490ae1d668471a3db85f33281fb0cacecb
1,017
py
Python
CGPA_Claculator.py
DharaneeswaranR/CGPA-Calculator
ce8390288057ac8e1f79b2d76a233e63d6d7402c
[ "BSD-3-Clause" ]
1
2021-11-20T15:42:15.000Z
2021-11-20T15:42:15.000Z
CGPA_Claculator.py
DharaneeswaranR/CGPA-Calculator
ce8390288057ac8e1f79b2d76a233e63d6d7402c
[ "BSD-3-Clause" ]
null
null
null
CGPA_Claculator.py
DharaneeswaranR/CGPA-Calculator
ce8390288057ac8e1f79b2d76a233e63d6d7402c
[ "BSD-3-Clause" ]
null
null
null
def calculate_cgpa(grade_points, credits, num): mark_sum = list() for i in range(num): Mark_sum.append(grade_points[i] * credits[i]) cgpa = sum(mark_sum) / sum(credits) return cgpa if __name__ == '__main__': num = int(input("\nEnter number of subjects : ")) grade_points = list() credits = list() for i in range(1, num+1): mark = int(input("\nEnter marks of Subject " + str(i) + " : ")) credit = int(input("Enter credit of Subject " + str(i) + " : ")) if 90 <= mark <= 100: grade_points.append(10) elif 80 <= mark <= 89: grade_points.append(9) elif 70 <= mark <= 79: grade_points.append(8) elif 60 <= mark <= 69: grade_points.append(7) elif 50 <= mark <= 59: grade_points.append(6) else: grade_points.append(0) credits.append(credit) print("\nCGPA is {:.2f}\n".format(calculate_cgpa(grade_points, credits, num)))
26.763158
82
0.547689
def calculate_cgpa(grade_points, credits, num): mark_sum = list() for i in range(num): Mark_sum.append(grade_points[i] * credits[i]) cgpa = sum(mark_sum) / sum(credits) return cgpa if __name__ == '__main__': num = int(input("\nEnter number of subjects : ")) grade_points = list() credits = list() for i in range(1, num+1): mark = int(input("\nEnter marks of Subject " + str(i) + " : ")) credit = int(input("Enter credit of Subject " + str(i) + " : ")) if 90 <= mark <= 100: grade_points.append(10) elif 80 <= mark <= 89: grade_points.append(9) elif 70 <= mark <= 79: grade_points.append(8) elif 60 <= mark <= 69: grade_points.append(7) elif 50 <= mark <= 59: grade_points.append(6) else: grade_points.append(0) credits.append(credit) print("\nCGPA is {:.2f}\n".format(calculate_cgpa(grade_points, credits, num)))
true
true
1c455ea2754f11157926ef47242fd8393fbd2d15
9,560
py
Python
mlfromscratch/supervised_learning/regression.py
sourcepirate/ML-From-Scratch
c6839bf47c360d6fa48861302fd90ccd4a8c38db
[ "MIT" ]
null
null
null
mlfromscratch/supervised_learning/regression.py
sourcepirate/ML-From-Scratch
c6839bf47c360d6fa48861302fd90ccd4a8c38db
[ "MIT" ]
null
null
null
mlfromscratch/supervised_learning/regression.py
sourcepirate/ML-From-Scratch
c6839bf47c360d6fa48861302fd90ccd4a8c38db
[ "MIT" ]
2
2017-10-03T07:45:16.000Z
2018-12-21T01:31:21.000Z
from __future__ import print_function, division import numpy as np import math from mlfromscratch.utils import normalize, polynomial_features class Regression(object): """ Base regression model. Models the relationship between a scalar dependent variable y and the independent variables X. Parameters: ----------- reg_factor: float The factor that will determine the amount of regularization and feature shrinkage. n_iterations: float The number of training iterations the algorithm will tune the weights for. learning_rate: float The step length that will be used when updating the weights. gradient_descent: boolean True or false depending if gradient descent should be used when training. If false then we use batch optimization by least squares. """ def __init__(self, reg_factor, n_iterations, learning_rate, gradient_descent): self.w = None self.n_iterations = n_iterations self.learning_rate = learning_rate self.gradient_descent = gradient_descent self.reg_factor = reg_factor def initialize_weights(self, n_features): """ Initialize weights randomly [-1/N, 1/N] """ limit = 1 / math.sqrt(n_features) self.w = np.random.uniform(-limit, limit, (n_features, )) def regularization(self): # No regularization by default return 0 def regularization_gradient(self): # No regularization by default return 0 def fit(self, X, y): # Insert constant ones as first column (for bias weights) X = np.insert(X, 0, 1, axis=1) n_features = np.shape(X)[1] # Get weights by gradient descent opt. if self.gradient_descent: self.training_errors = [] self.initialize_weights(n_features) # Do gradient descent for n_iterations for _ in range(self.n_iterations): y_pred = X.dot(self.w) # Calculate mean squared error mse = np.mean(0.5 * (y - y_pred)**2 + self.regularization()) self.training_errors.append(mse) # Gradient of l2 loss w.r.t w grad_w = - (y - y_pred).dot(X) + self.regularization_gradient() # Update the weights self.w -= self.learning_rate * grad_w # Get weights by least squares (using Moore-Penrose pseudoinverse) else: U, S, V = np.linalg.svd(X.T.dot(X) + self.reg_factor * np.identity(n_features)) S = np.diag(S) X_sq_reg_inv = V.dot(np.linalg.pinv(S)).dot(U.T) self.w = X_sq_reg_inv.dot(X.T).dot(y) def predict(self, X): # Insert constant ones for bias weights X = np.insert(X, 0, 1, axis=1) y_pred = X.dot(self.w) return y_pred class LinearRegression(Regression): """Linear model. Parameters: ----------- n_iterations: float The number of training iterations the algorithm will tune the weights for. learning_rate: float The step length that will be used when updating the weights. gradient_descent: boolean True or false depending if gradient descent should be used when training. If false then we use batch optimization by least squares. """ def __init__(self, n_iterations=100, learning_rate=0.001, gradient_descent=True): super(LinearRegression, self).__init__(reg_factor=0, n_iterations=n_iterations, \ learning_rate=learning_rate, gradient_descent=gradient_descent) class PolynomialRegression(Regression): """Performs a non-linear transformation of the data before fitting the model and doing predictions which allows for doing non-linear regression. Parameters: ----------- degree: int The power of the polynomial that the independent variable X will be transformed to. n_iterations: float The number of training iterations the algorithm will tune the weights for. learning_rate: float The step length that will be used when updating the weights. gradient_descent: boolean True or false depending if gradient descent should be used when training. If false then we use batch optimization by least squares. """ def __init__(self, degree, n_iterations=3000, learning_rate=0.001, gradient_descent=True): self.degree = degree super(PolynomialRegression, self).__init__(reg_factor=0, n_iterations=n_iterations, \ learning_rate=learning_rate, gradient_descent=gradient_descent) def fit(self, X, y): X_transformed = polynomial_features(X, degree=self.degree) super(PolynomialRegression, self).fit(X_transformed, y) def predict(self, X): X_transformed = polynomial_features(X, degree=self.degree) return super(PolynomialRegression, self).predict(X_transformed) class RidgeRegression(Regression): """Also referred to as Tikhonov regularization. Linear regression model with a regularization factor. Model that tries to balance the fit of the model with respect to the training data and the complexity of the model. A large regularization factor with decreases the variance of the model. Parameters: ----------- reg_factor: float The factor that will determine the amount of regularization and feature shrinkage. n_iterations: float The number of training iterations the algorithm will tune the weights for. learning_rate: float The step length that will be used when updating the weights. gradient_descent: boolean True or false depending if gradient descent should be used when training. If false then we use batch optimization by least squares. """ def __init__(self, reg_factor, n_iterations=1000, learning_rate=0.001, gradient_descent=True): super(RidgeRegression, self).__init__(reg_factor, n_iterations, learning_rate, gradient_descent) def regularization(self): return self.reg_factor * self.w.T.dot(self.w) def regularization_gradient(self): return self.reg_factor * self.w class LassoRegression(Regression): """Linear regression model with a regularization factor which does both variable selection and regularization. Model that tries to balance the fit of the model with respect to the training data and the complexity of the model. A large regularization factor with decreases the variance of the model and do para. Parameters: ----------- degree: int The power of the polynomial that the independent variable X will be transformed to. reg_factor: float The factor that will determine the amount of regularization and feature shrinkage. n_iterations: float The number of training iterations the algorithm will tune the weights for. learning_rate: float The step length that will be used when updating the weights. gradient_descent: boolean True or false depending if gradient descent should be used when training. If false then we use batch optimization by least squares. """ def __init__(self, degree, reg_factor, n_iterations=3000, learning_rate=0.01, gradient_descent=True): self.degree = degree super(LassoRegression, self).__init__(reg_factor, n_iterations, learning_rate, gradient_descent) def fit(self, X, y): X_transformed = normalize(polynomial_features(X, degree=self.degree)) super(LassoRegression, self).fit(X_transformed, y) def predict(self, X): X_transformed = normalize(polynomial_features(X, degree=self.degree)) return super(LassoRegression, self).predict(X_transformed) def regularization(self): return self.reg_factor * len(self.w) def regularization_gradient(self): return self.reg_factor * np.sign(self.w) class PolynomialRidgeRegression(Regression): """Similar to regular ridge regression except that the data is transformed to allow for polynomial regression. Parameters: ----------- degree: int The power of the polynomial that the independent variable X will be transformed to. reg_factor: float The factor that will determine the amount of regularization and feature shrinkage. n_iterations: float The number of training iterations the algorithm will tune the weights for. learning_rate: float The step length that will be used when updating the weights. gradient_descent: boolean True or false depending if gradient descent should be used when training. If false then we use batch optimization by least squares. """ def __init__(self, degree, reg_factor, n_iterations=3000, learning_rate=0.01, gradient_descent=True): self.degree = degree super(PolynomialRidgeRegression, self).__init__(reg_factor, n_iterations, learning_rate, gradient_descent) def fit(self, X, y): X_transformed = normalize(polynomial_features(X, degree=self.degree)) super(PolynomialRidgeRegression, self).fit(X_transformed, y) def predict(self, X): X_transformed = normalize(polynomial_features(X, degree=self.degree)) return super(PolynomialRidgeRegression, self).predict(X_transformed) def regularization(self): return self.reg_factor * self.w.T.dot(self.w) def regularization_gradient(self): return self.reg_factor * self.w
43.853211
114
0.688808
from __future__ import print_function, division import numpy as np import math from mlfromscratch.utils import normalize, polynomial_features class Regression(object): def __init__(self, reg_factor, n_iterations, learning_rate, gradient_descent): self.w = None self.n_iterations = n_iterations self.learning_rate = learning_rate self.gradient_descent = gradient_descent self.reg_factor = reg_factor def initialize_weights(self, n_features): limit = 1 / math.sqrt(n_features) self.w = np.random.uniform(-limit, limit, (n_features, )) def regularization(self): return 0 def regularization_gradient(self): return 0 def fit(self, X, y): X = np.insert(X, 0, 1, axis=1) n_features = np.shape(X)[1] if self.gradient_descent: self.training_errors = [] self.initialize_weights(n_features) for _ in range(self.n_iterations): y_pred = X.dot(self.w) mse = np.mean(0.5 * (y - y_pred)**2 + self.regularization()) self.training_errors.append(mse) grad_w = - (y - y_pred).dot(X) + self.regularization_gradient() self.w -= self.learning_rate * grad_w else: U, S, V = np.linalg.svd(X.T.dot(X) + self.reg_factor * np.identity(n_features)) S = np.diag(S) X_sq_reg_inv = V.dot(np.linalg.pinv(S)).dot(U.T) self.w = X_sq_reg_inv.dot(X.T).dot(y) def predict(self, X): X = np.insert(X, 0, 1, axis=1) y_pred = X.dot(self.w) return y_pred class LinearRegression(Regression): def __init__(self, n_iterations=100, learning_rate=0.001, gradient_descent=True): super(LinearRegression, self).__init__(reg_factor=0, n_iterations=n_iterations, \ learning_rate=learning_rate, gradient_descent=gradient_descent) class PolynomialRegression(Regression): def __init__(self, degree, n_iterations=3000, learning_rate=0.001, gradient_descent=True): self.degree = degree super(PolynomialRegression, self).__init__(reg_factor=0, n_iterations=n_iterations, \ learning_rate=learning_rate, gradient_descent=gradient_descent) def fit(self, X, y): X_transformed = polynomial_features(X, degree=self.degree) super(PolynomialRegression, self).fit(X_transformed, y) def predict(self, X): X_transformed = polynomial_features(X, degree=self.degree) return super(PolynomialRegression, self).predict(X_transformed) class RidgeRegression(Regression): def __init__(self, reg_factor, n_iterations=1000, learning_rate=0.001, gradient_descent=True): super(RidgeRegression, self).__init__(reg_factor, n_iterations, learning_rate, gradient_descent) def regularization(self): return self.reg_factor * self.w.T.dot(self.w) def regularization_gradient(self): return self.reg_factor * self.w class LassoRegression(Regression): def __init__(self, degree, reg_factor, n_iterations=3000, learning_rate=0.01, gradient_descent=True): self.degree = degree super(LassoRegression, self).__init__(reg_factor, n_iterations, learning_rate, gradient_descent) def fit(self, X, y): X_transformed = normalize(polynomial_features(X, degree=self.degree)) super(LassoRegression, self).fit(X_transformed, y) def predict(self, X): X_transformed = normalize(polynomial_features(X, degree=self.degree)) return super(LassoRegression, self).predict(X_transformed) def regularization(self): return self.reg_factor * len(self.w) def regularization_gradient(self): return self.reg_factor * np.sign(self.w) class PolynomialRidgeRegression(Regression): def __init__(self, degree, reg_factor, n_iterations=3000, learning_rate=0.01, gradient_descent=True): self.degree = degree super(PolynomialRidgeRegression, self).__init__(reg_factor, n_iterations, learning_rate, gradient_descent) def fit(self, X, y): X_transformed = normalize(polynomial_features(X, degree=self.degree)) super(PolynomialRidgeRegression, self).fit(X_transformed, y) def predict(self, X): X_transformed = normalize(polynomial_features(X, degree=self.degree)) return super(PolynomialRidgeRegression, self).predict(X_transformed) def regularization(self): return self.reg_factor * self.w.T.dot(self.w) def regularization_gradient(self): return self.reg_factor * self.w
true
true
1c455f55b99a0f9313f7b61d44989bbe51ff3591
72,468
py
Python
intersight/model/virtualization_vmware_datacenter_relationship.py
CiscoDevNet/intersight-python
04b721f37c3044646a91c185c7259edfb991557a
[ "Apache-2.0" ]
5
2021-12-16T15:13:32.000Z
2022-03-29T16:09:54.000Z
intersight/model/virtualization_vmware_datacenter_relationship.py
CiscoDevNet/intersight-python
04b721f37c3044646a91c185c7259edfb991557a
[ "Apache-2.0" ]
4
2022-01-25T19:05:51.000Z
2022-03-29T20:18:37.000Z
intersight/model/virtualization_vmware_datacenter_relationship.py
CiscoDevNet/intersight-python
04b721f37c3044646a91c185c7259edfb991557a
[ "Apache-2.0" ]
2
2020-07-07T15:01:08.000Z
2022-01-31T04:27:35.000Z
""" Cisco Intersight Cisco Intersight is a management platform delivered as a service with embedded analytics for your Cisco and 3rd party IT infrastructure. This platform offers an intelligent level of management that enables IT organizations to analyze, simplify, and automate their environments in more advanced ways than the prior generations of tools. Cisco Intersight provides an integrated and intuitive management experience for resources in the traditional data center as well as at the edge. With flexible deployment options to address complex security needs, getting started with Intersight is quick and easy. Cisco Intersight has deep integration with Cisco UCS and HyperFlex systems allowing for remote deployment, configuration, and ongoing maintenance. The model-based deployment works for a single system in a remote location or hundreds of systems in a data center and enables rapid, standardized configuration and deployment. It also streamlines maintaining those systems whether you are working with small or very large configurations. The Intersight OpenAPI document defines the complete set of properties that are returned in the HTTP response. From that perspective, a client can expect that no additional properties are returned, unless these properties are explicitly defined in the OpenAPI document. However, when a client uses an older version of the Intersight OpenAPI document, the server may send additional properties because the software is more recent than the client. In that case, the client may receive properties that it does not know about. Some generated SDKs perform a strict validation of the HTTP response body against the OpenAPI document. # noqa: E501 The version of the OpenAPI document: 1.0.9-4950 Contact: intersight@cisco.com Generated by: https://openapi-generator.tech """ import re # noqa: F401 import sys # noqa: F401 from intersight.model_utils import ( # noqa: F401 ApiTypeError, ModelComposed, ModelNormal, ModelSimple, cached_property, change_keys_js_to_python, convert_js_args_to_python_args, date, datetime, file_type, none_type, validate_get_composed_info, ) def lazy_import(): from intersight.model.asset_device_registration_relationship import AssetDeviceRegistrationRelationship from intersight.model.display_names import DisplayNames from intersight.model.mo_base_mo_relationship import MoBaseMoRelationship from intersight.model.mo_mo_ref import MoMoRef from intersight.model.mo_tag import MoTag from intersight.model.mo_version_context import MoVersionContext from intersight.model.virtualization_vmware_datacenter import VirtualizationVmwareDatacenter from intersight.model.virtualization_vmware_folder_relationship import VirtualizationVmwareFolderRelationship from intersight.model.virtualization_vmware_vcenter_relationship import VirtualizationVmwareVcenterRelationship globals()['AssetDeviceRegistrationRelationship'] = AssetDeviceRegistrationRelationship globals()['DisplayNames'] = DisplayNames globals()['MoBaseMoRelationship'] = MoBaseMoRelationship globals()['MoMoRef'] = MoMoRef globals()['MoTag'] = MoTag globals()['MoVersionContext'] = MoVersionContext globals()['VirtualizationVmwareDatacenter'] = VirtualizationVmwareDatacenter globals()['VirtualizationVmwareFolderRelationship'] = VirtualizationVmwareFolderRelationship globals()['VirtualizationVmwareVcenterRelationship'] = VirtualizationVmwareVcenterRelationship class VirtualizationVmwareDatacenterRelationship(ModelComposed): """NOTE: This class is auto generated by OpenAPI Generator. Ref: https://openapi-generator.tech Do not edit the class manually. Attributes: allowed_values (dict): The key is the tuple path to the attribute and the for var_name this is (var_name,). The value is a dict with a capitalized key describing the allowed value and an allowed value. These dicts store the allowed enum values. attribute_map (dict): The key is attribute name and the value is json key in definition. discriminator_value_class_map (dict): A dict to go from the discriminator variable value to the discriminator class name. validations (dict): The key is the tuple path to the attribute and the for var_name this is (var_name,). The value is a dict that stores validations for max_length, min_length, max_items, min_items, exclusive_maximum, inclusive_maximum, exclusive_minimum, inclusive_minimum, and regex. additional_properties_type (tuple): A tuple of classes accepted as additional properties values. """ allowed_values = { ('class_id',): { 'MO.MOREF': "mo.MoRef", }, ('object_type',): { 'AAA.AUDITRECORD': "aaa.AuditRecord", 'AAA.RETENTIONCONFIG': "aaa.RetentionConfig", 'AAA.RETENTIONPOLICY': "aaa.RetentionPolicy", 'ACCESS.POLICY': "access.Policy", 'ADAPTER.CONFIGPOLICY': "adapter.ConfigPolicy", 'ADAPTER.EXTETHINTERFACE': "adapter.ExtEthInterface", 'ADAPTER.HOSTETHINTERFACE': "adapter.HostEthInterface", 'ADAPTER.HOSTFCINTERFACE': "adapter.HostFcInterface", 'ADAPTER.HOSTISCSIINTERFACE': "adapter.HostIscsiInterface", 'ADAPTER.UNIT': "adapter.Unit", 'ADAPTER.UNITEXPANDER': "adapter.UnitExpander", 'APPLIANCE.APPSTATUS': "appliance.AppStatus", 'APPLIANCE.AUTORMAPOLICY': "appliance.AutoRmaPolicy", 'APPLIANCE.BACKUP': "appliance.Backup", 'APPLIANCE.BACKUPPOLICY': "appliance.BackupPolicy", 'APPLIANCE.CERTIFICATESETTING': "appliance.CertificateSetting", 'APPLIANCE.DATAEXPORTPOLICY': "appliance.DataExportPolicy", 'APPLIANCE.DEVICECERTIFICATE': "appliance.DeviceCertificate", 'APPLIANCE.DEVICECLAIM': "appliance.DeviceClaim", 'APPLIANCE.DEVICEUPGRADEPOLICY': "appliance.DeviceUpgradePolicy", 'APPLIANCE.DIAGSETTING': "appliance.DiagSetting", 'APPLIANCE.EXTERNALSYSLOGSETTING': "appliance.ExternalSyslogSetting", 'APPLIANCE.FILEGATEWAY': "appliance.FileGateway", 'APPLIANCE.FILESYSTEMSTATUS': "appliance.FileSystemStatus", 'APPLIANCE.GROUPSTATUS': "appliance.GroupStatus", 'APPLIANCE.IMAGEBUNDLE': "appliance.ImageBundle", 'APPLIANCE.NODEINFO': "appliance.NodeInfo", 'APPLIANCE.NODESTATUS': "appliance.NodeStatus", 'APPLIANCE.RELEASENOTE': "appliance.ReleaseNote", 'APPLIANCE.REMOTEFILEIMPORT': "appliance.RemoteFileImport", 'APPLIANCE.RESTORE': "appliance.Restore", 'APPLIANCE.SETUPINFO': "appliance.SetupInfo", 'APPLIANCE.SYSTEMINFO': "appliance.SystemInfo", 'APPLIANCE.SYSTEMSTATUS': "appliance.SystemStatus", 'APPLIANCE.UPGRADE': "appliance.Upgrade", 'APPLIANCE.UPGRADEPOLICY': "appliance.UpgradePolicy", 'ASSET.CLUSTERMEMBER': "asset.ClusterMember", 'ASSET.DEPLOYMENT': "asset.Deployment", 'ASSET.DEPLOYMENTDEVICE': "asset.DeploymentDevice", 'ASSET.DEVICECLAIM': "asset.DeviceClaim", 'ASSET.DEVICECONFIGURATION': "asset.DeviceConfiguration", 'ASSET.DEVICECONNECTORMANAGER': "asset.DeviceConnectorManager", 'ASSET.DEVICECONTRACTINFORMATION': "asset.DeviceContractInformation", 'ASSET.DEVICECONTRACTNOTIFICATION': "asset.DeviceContractNotification", 'ASSET.DEVICEREGISTRATION': "asset.DeviceRegistration", 'ASSET.SUBSCRIPTION': "asset.Subscription", 'ASSET.SUBSCRIPTIONACCOUNT': "asset.SubscriptionAccount", 'ASSET.SUBSCRIPTIONDEVICECONTRACTINFORMATION': "asset.SubscriptionDeviceContractInformation", 'ASSET.TARGET': "asset.Target", 'BIOS.BOOTDEVICE': "bios.BootDevice", 'BIOS.BOOTMODE': "bios.BootMode", 'BIOS.POLICY': "bios.Policy", 'BIOS.SYSTEMBOOTORDER': "bios.SystemBootOrder", 'BIOS.TOKENSETTINGS': "bios.TokenSettings", 'BIOS.UNIT': "bios.Unit", 'BIOS.VFSELECTMEMORYRASCONFIGURATION': "bios.VfSelectMemoryRasConfiguration", 'BOOT.CDDDEVICE': "boot.CddDevice", 'BOOT.DEVICEBOOTMODE': "boot.DeviceBootMode", 'BOOT.DEVICEBOOTSECURITY': "boot.DeviceBootSecurity", 'BOOT.HDDDEVICE': "boot.HddDevice", 'BOOT.ISCSIDEVICE': "boot.IscsiDevice", 'BOOT.NVMEDEVICE': "boot.NvmeDevice", 'BOOT.PCHSTORAGEDEVICE': "boot.PchStorageDevice", 'BOOT.PRECISIONPOLICY': "boot.PrecisionPolicy", 'BOOT.PXEDEVICE': "boot.PxeDevice", 'BOOT.SANDEVICE': "boot.SanDevice", 'BOOT.SDDEVICE': "boot.SdDevice", 'BOOT.UEFISHELLDEVICE': "boot.UefiShellDevice", 'BOOT.USBDEVICE': "boot.UsbDevice", 'BOOT.VMEDIADEVICE': "boot.VmediaDevice", 'BULK.EXPORT': "bulk.Export", 'BULK.EXPORTEDITEM': "bulk.ExportedItem", 'BULK.MOCLONER': "bulk.MoCloner", 'BULK.MOMERGER': "bulk.MoMerger", 'BULK.REQUEST': "bulk.Request", 'BULK.SUBREQUESTOBJ': "bulk.SubRequestObj", 'CAPABILITY.ADAPTERUNITDESCRIPTOR': "capability.AdapterUnitDescriptor", 'CAPABILITY.CATALOG': "capability.Catalog", 'CAPABILITY.CHASSISDESCRIPTOR': "capability.ChassisDescriptor", 'CAPABILITY.CHASSISMANUFACTURINGDEF': "capability.ChassisManufacturingDef", 'CAPABILITY.CIMCFIRMWAREDESCRIPTOR': "capability.CimcFirmwareDescriptor", 'CAPABILITY.EQUIPMENTPHYSICALDEF': "capability.EquipmentPhysicalDef", 'CAPABILITY.EQUIPMENTSLOTARRAY': "capability.EquipmentSlotArray", 'CAPABILITY.FANMODULEDESCRIPTOR': "capability.FanModuleDescriptor", 'CAPABILITY.FANMODULEMANUFACTURINGDEF': "capability.FanModuleManufacturingDef", 'CAPABILITY.IOCARDCAPABILITYDEF': "capability.IoCardCapabilityDef", 'CAPABILITY.IOCARDDESCRIPTOR': "capability.IoCardDescriptor", 'CAPABILITY.IOCARDMANUFACTURINGDEF': "capability.IoCardManufacturingDef", 'CAPABILITY.PORTGROUPAGGREGATIONDEF': "capability.PortGroupAggregationDef", 'CAPABILITY.PSUDESCRIPTOR': "capability.PsuDescriptor", 'CAPABILITY.PSUMANUFACTURINGDEF': "capability.PsuManufacturingDef", 'CAPABILITY.SERVERMODELSCAPABILITYDEF': "capability.ServerModelsCapabilityDef", 'CAPABILITY.SERVERSCHEMADESCRIPTOR': "capability.ServerSchemaDescriptor", 'CAPABILITY.SIOCMODULECAPABILITYDEF': "capability.SiocModuleCapabilityDef", 'CAPABILITY.SIOCMODULEDESCRIPTOR': "capability.SiocModuleDescriptor", 'CAPABILITY.SIOCMODULEMANUFACTURINGDEF': "capability.SiocModuleManufacturingDef", 'CAPABILITY.SWITCHCAPABILITY': "capability.SwitchCapability", 'CAPABILITY.SWITCHDESCRIPTOR': "capability.SwitchDescriptor", 'CAPABILITY.SWITCHMANUFACTURINGDEF': "capability.SwitchManufacturingDef", 'CERTIFICATEMANAGEMENT.POLICY': "certificatemanagement.Policy", 'CHASSIS.CONFIGCHANGEDETAIL': "chassis.ConfigChangeDetail", 'CHASSIS.CONFIGIMPORT': "chassis.ConfigImport", 'CHASSIS.CONFIGRESULT': "chassis.ConfigResult", 'CHASSIS.CONFIGRESULTENTRY': "chassis.ConfigResultEntry", 'CHASSIS.IOMPROFILE': "chassis.IomProfile", 'CHASSIS.PROFILE': "chassis.Profile", 'CLOUD.AWSBILLINGUNIT': "cloud.AwsBillingUnit", 'CLOUD.AWSKEYPAIR': "cloud.AwsKeyPair", 'CLOUD.AWSNETWORKINTERFACE': "cloud.AwsNetworkInterface", 'CLOUD.AWSORGANIZATIONALUNIT': "cloud.AwsOrganizationalUnit", 'CLOUD.AWSSECURITYGROUP': "cloud.AwsSecurityGroup", 'CLOUD.AWSSUBNET': "cloud.AwsSubnet", 'CLOUD.AWSVIRTUALMACHINE': "cloud.AwsVirtualMachine", 'CLOUD.AWSVOLUME': "cloud.AwsVolume", 'CLOUD.AWSVPC': "cloud.AwsVpc", 'CLOUD.COLLECTINVENTORY': "cloud.CollectInventory", 'CLOUD.REGIONS': "cloud.Regions", 'CLOUD.SKUCONTAINERTYPE': "cloud.SkuContainerType", 'CLOUD.SKUDATABASETYPE': "cloud.SkuDatabaseType", 'CLOUD.SKUINSTANCETYPE': "cloud.SkuInstanceType", 'CLOUD.SKUNETWORKTYPE': "cloud.SkuNetworkType", 'CLOUD.SKUREGIONRATECARDS': "cloud.SkuRegionRateCards", 'CLOUD.SKUVOLUMETYPE': "cloud.SkuVolumeType", 'CLOUD.TFCAGENTPOOL': "cloud.TfcAgentpool", 'CLOUD.TFCORGANIZATION': "cloud.TfcOrganization", 'CLOUD.TFCWORKSPACE': "cloud.TfcWorkspace", 'COMM.HTTPPROXYPOLICY': "comm.HttpProxyPolicy", 'COMPUTE.BIOSPOSTPOLICY': "compute.BiosPostPolicy", 'COMPUTE.BLADE': "compute.Blade", 'COMPUTE.BLADEIDENTITY': "compute.BladeIdentity", 'COMPUTE.BOARD': "compute.Board", 'COMPUTE.MAPPING': "compute.Mapping", 'COMPUTE.PHYSICALSUMMARY': "compute.PhysicalSummary", 'COMPUTE.RACKUNIT': "compute.RackUnit", 'COMPUTE.RACKUNITIDENTITY': "compute.RackUnitIdentity", 'COMPUTE.SERVERPOWERPOLICY': "compute.ServerPowerPolicy", 'COMPUTE.SERVERSETTING': "compute.ServerSetting", 'COMPUTE.VMEDIA': "compute.Vmedia", 'COND.ALARM': "cond.Alarm", 'COND.ALARMAGGREGATION': "cond.AlarmAggregation", 'COND.HCLSTATUS': "cond.HclStatus", 'COND.HCLSTATUSDETAIL': "cond.HclStatusDetail", 'COND.HCLSTATUSJOB': "cond.HclStatusJob", 'CONNECTORPACK.CONNECTORPACKUPGRADE': "connectorpack.ConnectorPackUpgrade", 'CONNECTORPACK.UPGRADEIMPACT': "connectorpack.UpgradeImpact", 'CONVERGEDINFRA.HEALTHCHECKDEFINITION': "convergedinfra.HealthCheckDefinition", 'CONVERGEDINFRA.HEALTHCHECKEXECUTION': "convergedinfra.HealthCheckExecution", 'CONVERGEDINFRA.POD': "convergedinfra.Pod", 'CRD.CUSTOMRESOURCE': "crd.CustomResource", 'DEVICECONNECTOR.POLICY': "deviceconnector.Policy", 'EQUIPMENT.CHASSIS': "equipment.Chassis", 'EQUIPMENT.CHASSISIDENTITY': "equipment.ChassisIdentity", 'EQUIPMENT.CHASSISOPERATION': "equipment.ChassisOperation", 'EQUIPMENT.DEVICESUMMARY': "equipment.DeviceSummary", 'EQUIPMENT.EXPANDERMODULE': "equipment.ExpanderModule", 'EQUIPMENT.FAN': "equipment.Fan", 'EQUIPMENT.FANCONTROL': "equipment.FanControl", 'EQUIPMENT.FANMODULE': "equipment.FanModule", 'EQUIPMENT.FEX': "equipment.Fex", 'EQUIPMENT.FEXIDENTITY': "equipment.FexIdentity", 'EQUIPMENT.FEXOPERATION': "equipment.FexOperation", 'EQUIPMENT.FRU': "equipment.Fru", 'EQUIPMENT.IDENTITYSUMMARY': "equipment.IdentitySummary", 'EQUIPMENT.IOCARD': "equipment.IoCard", 'EQUIPMENT.IOCARDOPERATION': "equipment.IoCardOperation", 'EQUIPMENT.IOEXPANDER': "equipment.IoExpander", 'EQUIPMENT.LOCATORLED': "equipment.LocatorLed", 'EQUIPMENT.PSU': "equipment.Psu", 'EQUIPMENT.PSUCONTROL': "equipment.PsuControl", 'EQUIPMENT.RACKENCLOSURE': "equipment.RackEnclosure", 'EQUIPMENT.RACKENCLOSURESLOT': "equipment.RackEnclosureSlot", 'EQUIPMENT.SHAREDIOMODULE': "equipment.SharedIoModule", 'EQUIPMENT.SWITCHCARD': "equipment.SwitchCard", 'EQUIPMENT.SYSTEMIOCONTROLLER': "equipment.SystemIoController", 'EQUIPMENT.TPM': "equipment.Tpm", 'EQUIPMENT.TRANSCEIVER': "equipment.Transceiver", 'ETHER.HOSTPORT': "ether.HostPort", 'ETHER.NETWORKPORT': "ether.NetworkPort", 'ETHER.PHYSICALPORT': "ether.PhysicalPort", 'ETHER.PORTCHANNEL': "ether.PortChannel", 'EXTERNALSITE.AUTHORIZATION': "externalsite.Authorization", 'FABRIC.APPLIANCEPCROLE': "fabric.AppliancePcRole", 'FABRIC.APPLIANCEROLE': "fabric.ApplianceRole", 'FABRIC.CONFIGCHANGEDETAIL': "fabric.ConfigChangeDetail", 'FABRIC.CONFIGRESULT': "fabric.ConfigResult", 'FABRIC.CONFIGRESULTENTRY': "fabric.ConfigResultEntry", 'FABRIC.ELEMENTIDENTITY': "fabric.ElementIdentity", 'FABRIC.ESTIMATEIMPACT': "fabric.EstimateImpact", 'FABRIC.ETHNETWORKCONTROLPOLICY': "fabric.EthNetworkControlPolicy", 'FABRIC.ETHNETWORKGROUPPOLICY': "fabric.EthNetworkGroupPolicy", 'FABRIC.ETHNETWORKPOLICY': "fabric.EthNetworkPolicy", 'FABRIC.FCNETWORKPOLICY': "fabric.FcNetworkPolicy", 'FABRIC.FCSTORAGEROLE': "fabric.FcStorageRole", 'FABRIC.FCUPLINKPCROLE': "fabric.FcUplinkPcRole", 'FABRIC.FCUPLINKROLE': "fabric.FcUplinkRole", 'FABRIC.FCOEUPLINKPCROLE': "fabric.FcoeUplinkPcRole", 'FABRIC.FCOEUPLINKROLE': "fabric.FcoeUplinkRole", 'FABRIC.FLOWCONTROLPOLICY': "fabric.FlowControlPolicy", 'FABRIC.LINKAGGREGATIONPOLICY': "fabric.LinkAggregationPolicy", 'FABRIC.LINKCONTROLPOLICY': "fabric.LinkControlPolicy", 'FABRIC.MULTICASTPOLICY': "fabric.MulticastPolicy", 'FABRIC.PCMEMBER': "fabric.PcMember", 'FABRIC.PCOPERATION': "fabric.PcOperation", 'FABRIC.PORTMODE': "fabric.PortMode", 'FABRIC.PORTOPERATION': "fabric.PortOperation", 'FABRIC.PORTPOLICY': "fabric.PortPolicy", 'FABRIC.SERVERROLE': "fabric.ServerRole", 'FABRIC.SWITCHCLUSTERPROFILE': "fabric.SwitchClusterProfile", 'FABRIC.SWITCHCONTROLPOLICY': "fabric.SwitchControlPolicy", 'FABRIC.SWITCHPROFILE': "fabric.SwitchProfile", 'FABRIC.SYSTEMQOSPOLICY': "fabric.SystemQosPolicy", 'FABRIC.UPLINKPCROLE': "fabric.UplinkPcRole", 'FABRIC.UPLINKROLE': "fabric.UplinkRole", 'FABRIC.VLAN': "fabric.Vlan", 'FABRIC.VSAN': "fabric.Vsan", 'FAULT.INSTANCE': "fault.Instance", 'FC.PHYSICALPORT': "fc.PhysicalPort", 'FC.PORTCHANNEL': "fc.PortChannel", 'FCPOOL.FCBLOCK': "fcpool.FcBlock", 'FCPOOL.LEASE': "fcpool.Lease", 'FCPOOL.POOL': "fcpool.Pool", 'FCPOOL.POOLMEMBER': "fcpool.PoolMember", 'FCPOOL.UNIVERSE': "fcpool.Universe", 'FEEDBACK.FEEDBACKPOST': "feedback.FeedbackPost", 'FIRMWARE.BIOSDESCRIPTOR': "firmware.BiosDescriptor", 'FIRMWARE.BOARDCONTROLLERDESCRIPTOR': "firmware.BoardControllerDescriptor", 'FIRMWARE.CHASSISUPGRADE': "firmware.ChassisUpgrade", 'FIRMWARE.CIMCDESCRIPTOR': "firmware.CimcDescriptor", 'FIRMWARE.DIMMDESCRIPTOR': "firmware.DimmDescriptor", 'FIRMWARE.DISTRIBUTABLE': "firmware.Distributable", 'FIRMWARE.DISTRIBUTABLEMETA': "firmware.DistributableMeta", 'FIRMWARE.DRIVEDESCRIPTOR': "firmware.DriveDescriptor", 'FIRMWARE.DRIVERDISTRIBUTABLE': "firmware.DriverDistributable", 'FIRMWARE.EULA': "firmware.Eula", 'FIRMWARE.FIRMWARESUMMARY': "firmware.FirmwareSummary", 'FIRMWARE.GPUDESCRIPTOR': "firmware.GpuDescriptor", 'FIRMWARE.HBADESCRIPTOR': "firmware.HbaDescriptor", 'FIRMWARE.IOMDESCRIPTOR': "firmware.IomDescriptor", 'FIRMWARE.MSWITCHDESCRIPTOR': "firmware.MswitchDescriptor", 'FIRMWARE.NXOSDESCRIPTOR': "firmware.NxosDescriptor", 'FIRMWARE.PCIEDESCRIPTOR': "firmware.PcieDescriptor", 'FIRMWARE.PSUDESCRIPTOR': "firmware.PsuDescriptor", 'FIRMWARE.RUNNINGFIRMWARE': "firmware.RunningFirmware", 'FIRMWARE.SASEXPANDERDESCRIPTOR': "firmware.SasExpanderDescriptor", 'FIRMWARE.SERVERCONFIGURATIONUTILITYDISTRIBUTABLE': "firmware.ServerConfigurationUtilityDistributable", 'FIRMWARE.STORAGECONTROLLERDESCRIPTOR': "firmware.StorageControllerDescriptor", 'FIRMWARE.SWITCHUPGRADE': "firmware.SwitchUpgrade", 'FIRMWARE.UNSUPPORTEDVERSIONUPGRADE': "firmware.UnsupportedVersionUpgrade", 'FIRMWARE.UPGRADE': "firmware.Upgrade", 'FIRMWARE.UPGRADEIMPACT': "firmware.UpgradeImpact", 'FIRMWARE.UPGRADEIMPACTSTATUS': "firmware.UpgradeImpactStatus", 'FIRMWARE.UPGRADESTATUS': "firmware.UpgradeStatus", 'FORECAST.CATALOG': "forecast.Catalog", 'FORECAST.DEFINITION': "forecast.Definition", 'FORECAST.INSTANCE': "forecast.Instance", 'GRAPHICS.CARD': "graphics.Card", 'GRAPHICS.CONTROLLER': "graphics.Controller", 'HCL.COMPATIBILITYSTATUS': "hcl.CompatibilityStatus", 'HCL.DRIVERIMAGE': "hcl.DriverImage", 'HCL.EXEMPTEDCATALOG': "hcl.ExemptedCatalog", 'HCL.HYPERFLEXSOFTWARECOMPATIBILITYINFO': "hcl.HyperflexSoftwareCompatibilityInfo", 'HCL.OPERATINGSYSTEM': "hcl.OperatingSystem", 'HCL.OPERATINGSYSTEMVENDOR': "hcl.OperatingSystemVendor", 'HCL.SUPPORTEDDRIVERNAME': "hcl.SupportedDriverName", 'HYPERFLEX.ALARM': "hyperflex.Alarm", 'HYPERFLEX.APPCATALOG': "hyperflex.AppCatalog", 'HYPERFLEX.AUTOSUPPORTPOLICY': "hyperflex.AutoSupportPolicy", 'HYPERFLEX.BACKUPCLUSTER': "hyperflex.BackupCluster", 'HYPERFLEX.CAPABILITYINFO': "hyperflex.CapabilityInfo", 'HYPERFLEX.CLUSTER': "hyperflex.Cluster", 'HYPERFLEX.CLUSTERBACKUPPOLICY': "hyperflex.ClusterBackupPolicy", 'HYPERFLEX.CLUSTERBACKUPPOLICYDEPLOYMENT': "hyperflex.ClusterBackupPolicyDeployment", 'HYPERFLEX.CLUSTERBACKUPPOLICYINVENTORY': "hyperflex.ClusterBackupPolicyInventory", 'HYPERFLEX.CLUSTERHEALTHCHECKEXECUTIONSNAPSHOT': "hyperflex.ClusterHealthCheckExecutionSnapshot", 'HYPERFLEX.CLUSTERNETWORKPOLICY': "hyperflex.ClusterNetworkPolicy", 'HYPERFLEX.CLUSTERPROFILE': "hyperflex.ClusterProfile", 'HYPERFLEX.CLUSTERREPLICATIONNETWORKPOLICY': "hyperflex.ClusterReplicationNetworkPolicy", 'HYPERFLEX.CLUSTERREPLICATIONNETWORKPOLICYDEPLOYMENT': "hyperflex.ClusterReplicationNetworkPolicyDeployment", 'HYPERFLEX.CLUSTERSTORAGEPOLICY': "hyperflex.ClusterStoragePolicy", 'HYPERFLEX.CONFIGRESULT': "hyperflex.ConfigResult", 'HYPERFLEX.CONFIGRESULTENTRY': "hyperflex.ConfigResultEntry", 'HYPERFLEX.DATAPROTECTIONPEER': "hyperflex.DataProtectionPeer", 'HYPERFLEX.DATASTORESTATISTIC': "hyperflex.DatastoreStatistic", 'HYPERFLEX.DEVICEPACKAGEDOWNLOADSTATE': "hyperflex.DevicePackageDownloadState", 'HYPERFLEX.DRIVE': "hyperflex.Drive", 'HYPERFLEX.EXTFCSTORAGEPOLICY': "hyperflex.ExtFcStoragePolicy", 'HYPERFLEX.EXTISCSISTORAGEPOLICY': "hyperflex.ExtIscsiStoragePolicy", 'HYPERFLEX.FEATURELIMITEXTERNAL': "hyperflex.FeatureLimitExternal", 'HYPERFLEX.FEATURELIMITINTERNAL': "hyperflex.FeatureLimitInternal", 'HYPERFLEX.HEALTH': "hyperflex.Health", 'HYPERFLEX.HEALTHCHECKDEFINITION': "hyperflex.HealthCheckDefinition", 'HYPERFLEX.HEALTHCHECKEXECUTION': "hyperflex.HealthCheckExecution", 'HYPERFLEX.HEALTHCHECKEXECUTIONSNAPSHOT': "hyperflex.HealthCheckExecutionSnapshot", 'HYPERFLEX.HEALTHCHECKPACKAGECHECKSUM': "hyperflex.HealthCheckPackageChecksum", 'HYPERFLEX.HXDPVERSION': "hyperflex.HxdpVersion", 'HYPERFLEX.LICENSE': "hyperflex.License", 'HYPERFLEX.LOCALCREDENTIALPOLICY': "hyperflex.LocalCredentialPolicy", 'HYPERFLEX.NODE': "hyperflex.Node", 'HYPERFLEX.NODECONFIGPOLICY': "hyperflex.NodeConfigPolicy", 'HYPERFLEX.NODEPROFILE': "hyperflex.NodeProfile", 'HYPERFLEX.PROTECTEDCLUSTER': "hyperflex.ProtectedCluster", 'HYPERFLEX.PROXYSETTINGPOLICY': "hyperflex.ProxySettingPolicy", 'HYPERFLEX.SERVERFIRMWAREVERSION': "hyperflex.ServerFirmwareVersion", 'HYPERFLEX.SERVERFIRMWAREVERSIONENTRY': "hyperflex.ServerFirmwareVersionEntry", 'HYPERFLEX.SERVERMODEL': "hyperflex.ServerModel", 'HYPERFLEX.SERVICEAUTHTOKEN': "hyperflex.ServiceAuthToken", 'HYPERFLEX.SOFTWAREDISTRIBUTIONCOMPONENT': "hyperflex.SoftwareDistributionComponent", 'HYPERFLEX.SOFTWAREDISTRIBUTIONENTRY': "hyperflex.SoftwareDistributionEntry", 'HYPERFLEX.SOFTWAREDISTRIBUTIONVERSION': "hyperflex.SoftwareDistributionVersion", 'HYPERFLEX.SOFTWAREVERSIONPOLICY': "hyperflex.SoftwareVersionPolicy", 'HYPERFLEX.STORAGECONTAINER': "hyperflex.StorageContainer", 'HYPERFLEX.SYSCONFIGPOLICY': "hyperflex.SysConfigPolicy", 'HYPERFLEX.UCSMCONFIGPOLICY': "hyperflex.UcsmConfigPolicy", 'HYPERFLEX.VCENTERCONFIGPOLICY': "hyperflex.VcenterConfigPolicy", 'HYPERFLEX.VMBACKUPINFO': "hyperflex.VmBackupInfo", 'HYPERFLEX.VMIMPORTOPERATION': "hyperflex.VmImportOperation", 'HYPERFLEX.VMRESTOREOPERATION': "hyperflex.VmRestoreOperation", 'HYPERFLEX.VMSNAPSHOTINFO': "hyperflex.VmSnapshotInfo", 'HYPERFLEX.VOLUME': "hyperflex.Volume", 'HYPERFLEX.WITNESSCONFIGURATION': "hyperflex.WitnessConfiguration", 'IAAS.CONNECTORPACK': "iaas.ConnectorPack", 'IAAS.DEVICESTATUS': "iaas.DeviceStatus", 'IAAS.DIAGNOSTICMESSAGES': "iaas.DiagnosticMessages", 'IAAS.LICENSEINFO': "iaas.LicenseInfo", 'IAAS.MOSTRUNTASKS': "iaas.MostRunTasks", 'IAAS.SERVICEREQUEST': "iaas.ServiceRequest", 'IAAS.UCSDINFO': "iaas.UcsdInfo", 'IAAS.UCSDMANAGEDINFRA': "iaas.UcsdManagedInfra", 'IAAS.UCSDMESSAGES': "iaas.UcsdMessages", 'IAM.ACCOUNT': "iam.Account", 'IAM.ACCOUNTEXPERIENCE': "iam.AccountExperience", 'IAM.APIKEY': "iam.ApiKey", 'IAM.APPREGISTRATION': "iam.AppRegistration", 'IAM.BANNERMESSAGE': "iam.BannerMessage", 'IAM.CERTIFICATE': "iam.Certificate", 'IAM.CERTIFICATEREQUEST': "iam.CertificateRequest", 'IAM.DOMAINGROUP': "iam.DomainGroup", 'IAM.ENDPOINTPRIVILEGE': "iam.EndPointPrivilege", 'IAM.ENDPOINTROLE': "iam.EndPointRole", 'IAM.ENDPOINTUSER': "iam.EndPointUser", 'IAM.ENDPOINTUSERPOLICY': "iam.EndPointUserPolicy", 'IAM.ENDPOINTUSERROLE': "iam.EndPointUserRole", 'IAM.IDP': "iam.Idp", 'IAM.IDPREFERENCE': "iam.IdpReference", 'IAM.IPACCESSMANAGEMENT': "iam.IpAccessManagement", 'IAM.IPADDRESS': "iam.IpAddress", 'IAM.LDAPGROUP': "iam.LdapGroup", 'IAM.LDAPPOLICY': "iam.LdapPolicy", 'IAM.LDAPPROVIDER': "iam.LdapProvider", 'IAM.LOCALUSERPASSWORD': "iam.LocalUserPassword", 'IAM.LOCALUSERPASSWORDPOLICY': "iam.LocalUserPasswordPolicy", 'IAM.OAUTHTOKEN': "iam.OAuthToken", 'IAM.PERMISSION': "iam.Permission", 'IAM.PRIVATEKEYSPEC': "iam.PrivateKeySpec", 'IAM.PRIVILEGE': "iam.Privilege", 'IAM.PRIVILEGESET': "iam.PrivilegeSet", 'IAM.QUALIFIER': "iam.Qualifier", 'IAM.RESOURCELIMITS': "iam.ResourceLimits", 'IAM.RESOURCEPERMISSION': "iam.ResourcePermission", 'IAM.RESOURCEROLES': "iam.ResourceRoles", 'IAM.ROLE': "iam.Role", 'IAM.SECURITYHOLDER': "iam.SecurityHolder", 'IAM.SERVICEPROVIDER': "iam.ServiceProvider", 'IAM.SESSION': "iam.Session", 'IAM.SESSIONLIMITS': "iam.SessionLimits", 'IAM.SYSTEM': "iam.System", 'IAM.TRUSTPOINT': "iam.TrustPoint", 'IAM.USER': "iam.User", 'IAM.USERGROUP': "iam.UserGroup", 'IAM.USERPREFERENCE': "iam.UserPreference", 'INVENTORY.DEVICEINFO': "inventory.DeviceInfo", 'INVENTORY.DNMOBINDING': "inventory.DnMoBinding", 'INVENTORY.GENERICINVENTORY': "inventory.GenericInventory", 'INVENTORY.GENERICINVENTORYHOLDER': "inventory.GenericInventoryHolder", 'INVENTORY.REQUEST': "inventory.Request", 'IPMIOVERLAN.POLICY': "ipmioverlan.Policy", 'IPPOOL.BLOCKLEASE': "ippool.BlockLease", 'IPPOOL.IPLEASE': "ippool.IpLease", 'IPPOOL.POOL': "ippool.Pool", 'IPPOOL.POOLMEMBER': "ippool.PoolMember", 'IPPOOL.SHADOWBLOCK': "ippool.ShadowBlock", 'IPPOOL.SHADOWPOOL': "ippool.ShadowPool", 'IPPOOL.UNIVERSE': "ippool.Universe", 'IQNPOOL.BLOCK': "iqnpool.Block", 'IQNPOOL.LEASE': "iqnpool.Lease", 'IQNPOOL.POOL': "iqnpool.Pool", 'IQNPOOL.POOLMEMBER': "iqnpool.PoolMember", 'IQNPOOL.UNIVERSE': "iqnpool.Universe", 'IWOTENANT.TENANTSTATUS': "iwotenant.TenantStatus", 'KUBERNETES.ACICNIAPIC': "kubernetes.AciCniApic", 'KUBERNETES.ACICNIPROFILE': "kubernetes.AciCniProfile", 'KUBERNETES.ACICNITENANTCLUSTERALLOCATION': "kubernetes.AciCniTenantClusterAllocation", 'KUBERNETES.ADDONDEFINITION': "kubernetes.AddonDefinition", 'KUBERNETES.ADDONPOLICY': "kubernetes.AddonPolicy", 'KUBERNETES.ADDONREPOSITORY': "kubernetes.AddonRepository", 'KUBERNETES.BAREMETALNODEPROFILE': "kubernetes.BaremetalNodeProfile", 'KUBERNETES.CATALOG': "kubernetes.Catalog", 'KUBERNETES.CLUSTER': "kubernetes.Cluster", 'KUBERNETES.CLUSTERADDONPROFILE': "kubernetes.ClusterAddonProfile", 'KUBERNETES.CLUSTERPROFILE': "kubernetes.ClusterProfile", 'KUBERNETES.CONFIGRESULT': "kubernetes.ConfigResult", 'KUBERNETES.CONFIGRESULTENTRY': "kubernetes.ConfigResultEntry", 'KUBERNETES.CONTAINERRUNTIMEPOLICY': "kubernetes.ContainerRuntimePolicy", 'KUBERNETES.DAEMONSET': "kubernetes.DaemonSet", 'KUBERNETES.DEPLOYMENT': "kubernetes.Deployment", 'KUBERNETES.INGRESS': "kubernetes.Ingress", 'KUBERNETES.NETWORKPOLICY': "kubernetes.NetworkPolicy", 'KUBERNETES.NODE': "kubernetes.Node", 'KUBERNETES.NODEGROUPPROFILE': "kubernetes.NodeGroupProfile", 'KUBERNETES.POD': "kubernetes.Pod", 'KUBERNETES.SERVICE': "kubernetes.Service", 'KUBERNETES.STATEFULSET': "kubernetes.StatefulSet", 'KUBERNETES.SYSCONFIGPOLICY': "kubernetes.SysConfigPolicy", 'KUBERNETES.TRUSTEDREGISTRIESPOLICY': "kubernetes.TrustedRegistriesPolicy", 'KUBERNETES.VERSION': "kubernetes.Version", 'KUBERNETES.VERSIONPOLICY': "kubernetes.VersionPolicy", 'KUBERNETES.VIRTUALMACHINEINFRACONFIGPOLICY': "kubernetes.VirtualMachineInfraConfigPolicy", 'KUBERNETES.VIRTUALMACHINEINFRASTRUCTUREPROVIDER': "kubernetes.VirtualMachineInfrastructureProvider", 'KUBERNETES.VIRTUALMACHINEINSTANCETYPE': "kubernetes.VirtualMachineInstanceType", 'KUBERNETES.VIRTUALMACHINENODEPROFILE': "kubernetes.VirtualMachineNodeProfile", 'KVM.POLICY': "kvm.Policy", 'KVM.SESSION': "kvm.Session", 'KVM.TUNNEL': "kvm.Tunnel", 'LICENSE.ACCOUNTLICENSEDATA': "license.AccountLicenseData", 'LICENSE.CUSTOMEROP': "license.CustomerOp", 'LICENSE.IKSCUSTOMEROP': "license.IksCustomerOp", 'LICENSE.IKSLICENSECOUNT': "license.IksLicenseCount", 'LICENSE.IWOCUSTOMEROP': "license.IwoCustomerOp", 'LICENSE.IWOLICENSECOUNT': "license.IwoLicenseCount", 'LICENSE.LICENSEINFO': "license.LicenseInfo", 'LICENSE.LICENSERESERVATIONOP': "license.LicenseReservationOp", 'LICENSE.SMARTLICENSETOKEN': "license.SmartlicenseToken", 'LS.SERVICEPROFILE': "ls.ServiceProfile", 'MACPOOL.IDBLOCK': "macpool.IdBlock", 'MACPOOL.LEASE': "macpool.Lease", 'MACPOOL.POOL': "macpool.Pool", 'MACPOOL.POOLMEMBER': "macpool.PoolMember", 'MACPOOL.UNIVERSE': "macpool.Universe", 'MANAGEMENT.CONTROLLER': "management.Controller", 'MANAGEMENT.ENTITY': "management.Entity", 'MANAGEMENT.INTERFACE': "management.Interface", 'MEMORY.ARRAY': "memory.Array", 'MEMORY.PERSISTENTMEMORYCONFIGRESULT': "memory.PersistentMemoryConfigResult", 'MEMORY.PERSISTENTMEMORYCONFIGURATION': "memory.PersistentMemoryConfiguration", 'MEMORY.PERSISTENTMEMORYNAMESPACE': "memory.PersistentMemoryNamespace", 'MEMORY.PERSISTENTMEMORYNAMESPACECONFIGRESULT': "memory.PersistentMemoryNamespaceConfigResult", 'MEMORY.PERSISTENTMEMORYPOLICY': "memory.PersistentMemoryPolicy", 'MEMORY.PERSISTENTMEMORYREGION': "memory.PersistentMemoryRegion", 'MEMORY.PERSISTENTMEMORYUNIT': "memory.PersistentMemoryUnit", 'MEMORY.UNIT': "memory.Unit", 'META.DEFINITION': "meta.Definition", 'NETWORK.ELEMENT': "network.Element", 'NETWORK.ELEMENTSUMMARY': "network.ElementSummary", 'NETWORK.FCZONEINFO': "network.FcZoneInfo", 'NETWORK.VLANPORTINFO': "network.VlanPortInfo", 'NETWORKCONFIG.POLICY': "networkconfig.Policy", 'NIAAPI.APICCCOPOST': "niaapi.ApicCcoPost", 'NIAAPI.APICFIELDNOTICE': "niaapi.ApicFieldNotice", 'NIAAPI.APICHWEOL': "niaapi.ApicHweol", 'NIAAPI.APICLATESTMAINTAINEDRELEASE': "niaapi.ApicLatestMaintainedRelease", 'NIAAPI.APICRELEASERECOMMEND': "niaapi.ApicReleaseRecommend", 'NIAAPI.APICSWEOL': "niaapi.ApicSweol", 'NIAAPI.DCNMCCOPOST': "niaapi.DcnmCcoPost", 'NIAAPI.DCNMFIELDNOTICE': "niaapi.DcnmFieldNotice", 'NIAAPI.DCNMHWEOL': "niaapi.DcnmHweol", 'NIAAPI.DCNMLATESTMAINTAINEDRELEASE': "niaapi.DcnmLatestMaintainedRelease", 'NIAAPI.DCNMRELEASERECOMMEND': "niaapi.DcnmReleaseRecommend", 'NIAAPI.DCNMSWEOL': "niaapi.DcnmSweol", 'NIAAPI.FILEDOWNLOADER': "niaapi.FileDownloader", 'NIAAPI.NIAMETADATA': "niaapi.NiaMetadata", 'NIAAPI.NIBFILEDOWNLOADER': "niaapi.NibFileDownloader", 'NIAAPI.NIBMETADATA': "niaapi.NibMetadata", 'NIAAPI.VERSIONREGEX': "niaapi.VersionRegex", 'NIATELEMETRY.AAALDAPPROVIDERDETAILS': "niatelemetry.AaaLdapProviderDetails", 'NIATELEMETRY.AAARADIUSPROVIDERDETAILS': "niatelemetry.AaaRadiusProviderDetails", 'NIATELEMETRY.AAATACACSPROVIDERDETAILS': "niatelemetry.AaaTacacsProviderDetails", 'NIATELEMETRY.APICAPPPLUGINDETAILS': "niatelemetry.ApicAppPluginDetails", 'NIATELEMETRY.APICCOREFILEDETAILS': "niatelemetry.ApicCoreFileDetails", 'NIATELEMETRY.APICDBGEXPRSEXPORTDEST': "niatelemetry.ApicDbgexpRsExportDest", 'NIATELEMETRY.APICDBGEXPRSTSSCHEDULER': "niatelemetry.ApicDbgexpRsTsScheduler", 'NIATELEMETRY.APICFANDETAILS': "niatelemetry.ApicFanDetails", 'NIATELEMETRY.APICFEXDETAILS': "niatelemetry.ApicFexDetails", 'NIATELEMETRY.APICFLASHDETAILS': "niatelemetry.ApicFlashDetails", 'NIATELEMETRY.APICNTPAUTH': "niatelemetry.ApicNtpAuth", 'NIATELEMETRY.APICPSUDETAILS': "niatelemetry.ApicPsuDetails", 'NIATELEMETRY.APICREALMDETAILS': "niatelemetry.ApicRealmDetails", 'NIATELEMETRY.APICSNMPCLIENTGRPDETAILS': "niatelemetry.ApicSnmpClientGrpDetails", 'NIATELEMETRY.APICSNMPCOMMUNITYACCESSDETAILS': "niatelemetry.ApicSnmpCommunityAccessDetails", 'NIATELEMETRY.APICSNMPCOMMUNITYDETAILS': "niatelemetry.ApicSnmpCommunityDetails", 'NIATELEMETRY.APICSNMPTRAPDETAILS': "niatelemetry.ApicSnmpTrapDetails", 'NIATELEMETRY.APICSNMPTRAPFWDSERVERDETAILS': "niatelemetry.ApicSnmpTrapFwdServerDetails", 'NIATELEMETRY.APICSNMPVERSIONTHREEDETAILS': "niatelemetry.ApicSnmpVersionThreeDetails", 'NIATELEMETRY.APICSYSLOGGRP': "niatelemetry.ApicSysLogGrp", 'NIATELEMETRY.APICSYSLOGSRC': "niatelemetry.ApicSysLogSrc", 'NIATELEMETRY.APICTRANSCEIVERDETAILS': "niatelemetry.ApicTransceiverDetails", 'NIATELEMETRY.APICUIPAGECOUNTS': "niatelemetry.ApicUiPageCounts", 'NIATELEMETRY.APPDETAILS': "niatelemetry.AppDetails", 'NIATELEMETRY.COMMONPOLICIES': "niatelemetry.CommonPolicies", 'NIATELEMETRY.DCNMFANDETAILS': "niatelemetry.DcnmFanDetails", 'NIATELEMETRY.DCNMFEXDETAILS': "niatelemetry.DcnmFexDetails", 'NIATELEMETRY.DCNMMODULEDETAILS': "niatelemetry.DcnmModuleDetails", 'NIATELEMETRY.DCNMPSUDETAILS': "niatelemetry.DcnmPsuDetails", 'NIATELEMETRY.DCNMTRANSCEIVERDETAILS': "niatelemetry.DcnmTransceiverDetails", 'NIATELEMETRY.EPG': "niatelemetry.Epg", 'NIATELEMETRY.FABRICMODULEDETAILS': "niatelemetry.FabricModuleDetails", 'NIATELEMETRY.FABRICPODPROFILE': "niatelemetry.FabricPodProfile", 'NIATELEMETRY.FABRICPODSS': "niatelemetry.FabricPodSs", 'NIATELEMETRY.FAULT': "niatelemetry.Fault", 'NIATELEMETRY.HTTPSACLCONTRACTDETAILS': "niatelemetry.HttpsAclContractDetails", 'NIATELEMETRY.HTTPSACLCONTRACTFILTERMAP': "niatelemetry.HttpsAclContractFilterMap", 'NIATELEMETRY.HTTPSACLEPGCONTRACTMAP': "niatelemetry.HttpsAclEpgContractMap", 'NIATELEMETRY.HTTPSACLEPGDETAILS': "niatelemetry.HttpsAclEpgDetails", 'NIATELEMETRY.HTTPSACLFILTERDETAILS': "niatelemetry.HttpsAclFilterDetails", 'NIATELEMETRY.LC': "niatelemetry.Lc", 'NIATELEMETRY.MSOCONTRACTDETAILS': "niatelemetry.MsoContractDetails", 'NIATELEMETRY.MSOEPGDETAILS': "niatelemetry.MsoEpgDetails", 'NIATELEMETRY.MSOSCHEMADETAILS': "niatelemetry.MsoSchemaDetails", 'NIATELEMETRY.MSOSITEDETAILS': "niatelemetry.MsoSiteDetails", 'NIATELEMETRY.MSOTENANTDETAILS': "niatelemetry.MsoTenantDetails", 'NIATELEMETRY.NEXUSDASHBOARDCONTROLLERDETAILS': "niatelemetry.NexusDashboardControllerDetails", 'NIATELEMETRY.NEXUSDASHBOARDDETAILS': "niatelemetry.NexusDashboardDetails", 'NIATELEMETRY.NEXUSDASHBOARDMEMORYDETAILS': "niatelemetry.NexusDashboardMemoryDetails", 'NIATELEMETRY.NEXUSDASHBOARDS': "niatelemetry.NexusDashboards", 'NIATELEMETRY.NIAFEATUREUSAGE': "niatelemetry.NiaFeatureUsage", 'NIATELEMETRY.NIAINVENTORY': "niatelemetry.NiaInventory", 'NIATELEMETRY.NIAINVENTORYDCNM': "niatelemetry.NiaInventoryDcnm", 'NIATELEMETRY.NIAINVENTORYFABRIC': "niatelemetry.NiaInventoryFabric", 'NIATELEMETRY.NIALICENSESTATE': "niatelemetry.NiaLicenseState", 'NIATELEMETRY.PASSWORDSTRENGTHCHECK': "niatelemetry.PasswordStrengthCheck", 'NIATELEMETRY.PODCOMMPOLICIES': "niatelemetry.PodCommPolicies", 'NIATELEMETRY.PODSNMPPOLICIES': "niatelemetry.PodSnmpPolicies", 'NIATELEMETRY.PODTIMESERVERPOLICIES': "niatelemetry.PodTimeServerPolicies", 'NIATELEMETRY.SITEINVENTORY': "niatelemetry.SiteInventory", 'NIATELEMETRY.SNMPSRC': "niatelemetry.SnmpSrc", 'NIATELEMETRY.SSHVERSIONTWO': "niatelemetry.SshVersionTwo", 'NIATELEMETRY.SUPERVISORMODULEDETAILS': "niatelemetry.SupervisorModuleDetails", 'NIATELEMETRY.SYSLOGREMOTEDEST': "niatelemetry.SyslogRemoteDest", 'NIATELEMETRY.SYSLOGSYSMSG': "niatelemetry.SyslogSysMsg", 'NIATELEMETRY.SYSLOGSYSMSGFACFILTER': "niatelemetry.SyslogSysMsgFacFilter", 'NIATELEMETRY.SYSTEMCONTROLLERDETAILS': "niatelemetry.SystemControllerDetails", 'NIATELEMETRY.TENANT': "niatelemetry.Tenant", 'NOTIFICATION.ACCOUNTSUBSCRIPTION': "notification.AccountSubscription", 'NTP.POLICY': "ntp.Policy", 'OAUTH.ACCESSTOKEN': "oauth.AccessToken", 'OAUTH.AUTHORIZATION': "oauth.Authorization", 'OPRS.DEPLOYMENT': "oprs.Deployment", 'OPRS.SYNCTARGETLISTMESSAGE': "oprs.SyncTargetListMessage", 'ORGANIZATION.ORGANIZATION': "organization.Organization", 'OS.BULKINSTALLINFO': "os.BulkInstallInfo", 'OS.CATALOG': "os.Catalog", 'OS.CONFIGURATIONFILE': "os.ConfigurationFile", 'OS.DISTRIBUTION': "os.Distribution", 'OS.INSTALL': "os.Install", 'OS.OSSUPPORT': "os.OsSupport", 'OS.SUPPORTEDVERSION': "os.SupportedVersion", 'OS.TEMPLATEFILE': "os.TemplateFile", 'OS.VALIDINSTALLTARGET': "os.ValidInstallTarget", 'PCI.COPROCESSORCARD': "pci.CoprocessorCard", 'PCI.DEVICE': "pci.Device", 'PCI.LINK': "pci.Link", 'PCI.SWITCH': "pci.Switch", 'PORT.GROUP': "port.Group", 'PORT.MACBINDING': "port.MacBinding", 'PORT.SUBGROUP': "port.SubGroup", 'POWER.CONTROLSTATE': "power.ControlState", 'POWER.POLICY': "power.Policy", 'PROCESSOR.UNIT': "processor.Unit", 'RACK.UNITPERSONALITY': "rack.UnitPersonality", 'RECOMMENDATION.CAPACITYRUNWAY': "recommendation.CapacityRunway", 'RECOMMENDATION.PHYSICALITEM': "recommendation.PhysicalItem", 'RECOVERY.BACKUPCONFIGPOLICY': "recovery.BackupConfigPolicy", 'RECOVERY.BACKUPPROFILE': "recovery.BackupProfile", 'RECOVERY.CONFIGRESULT': "recovery.ConfigResult", 'RECOVERY.CONFIGRESULTENTRY': "recovery.ConfigResultEntry", 'RECOVERY.ONDEMANDBACKUP': "recovery.OnDemandBackup", 'RECOVERY.RESTORE': "recovery.Restore", 'RECOVERY.SCHEDULECONFIGPOLICY': "recovery.ScheduleConfigPolicy", 'RESOURCE.GROUP': "resource.Group", 'RESOURCE.GROUPMEMBER': "resource.GroupMember", 'RESOURCE.LICENSERESOURCECOUNT': "resource.LicenseResourceCount", 'RESOURCE.MEMBERSHIP': "resource.Membership", 'RESOURCE.MEMBERSHIPHOLDER': "resource.MembershipHolder", 'RESOURCE.RESERVATION': "resource.Reservation", 'RESOURCEPOOL.LEASE': "resourcepool.Lease", 'RESOURCEPOOL.LEASERESOURCE': "resourcepool.LeaseResource", 'RESOURCEPOOL.POOL': "resourcepool.Pool", 'RESOURCEPOOL.POOLMEMBER': "resourcepool.PoolMember", 'RESOURCEPOOL.UNIVERSE': "resourcepool.Universe", 'RPROXY.REVERSEPROXY': "rproxy.ReverseProxy", 'SDCARD.POLICY': "sdcard.Policy", 'SDWAN.PROFILE': "sdwan.Profile", 'SDWAN.ROUTERNODE': "sdwan.RouterNode", 'SDWAN.ROUTERPOLICY': "sdwan.RouterPolicy", 'SDWAN.VMANAGEACCOUNTPOLICY': "sdwan.VmanageAccountPolicy", 'SEARCH.SEARCHITEM': "search.SearchItem", 'SEARCH.TAGITEM': "search.TagItem", 'SECURITY.UNIT': "security.Unit", 'SERVER.CONFIGCHANGEDETAIL': "server.ConfigChangeDetail", 'SERVER.CONFIGIMPORT': "server.ConfigImport", 'SERVER.CONFIGRESULT': "server.ConfigResult", 'SERVER.CONFIGRESULTENTRY': "server.ConfigResultEntry", 'SERVER.PROFILE': "server.Profile", 'SERVER.PROFILETEMPLATE': "server.ProfileTemplate", 'SMTP.POLICY': "smtp.Policy", 'SNMP.POLICY': "snmp.Policy", 'SOFTWARE.APPLIANCEDISTRIBUTABLE': "software.ApplianceDistributable", 'SOFTWARE.DOWNLOADHISTORY': "software.DownloadHistory", 'SOFTWARE.HCLMETA': "software.HclMeta", 'SOFTWARE.HYPERFLEXBUNDLEDISTRIBUTABLE': "software.HyperflexBundleDistributable", 'SOFTWARE.HYPERFLEXDISTRIBUTABLE': "software.HyperflexDistributable", 'SOFTWARE.RELEASEMETA': "software.ReleaseMeta", 'SOFTWARE.SOLUTIONDISTRIBUTABLE': "software.SolutionDistributable", 'SOFTWARE.UCSDBUNDLEDISTRIBUTABLE': "software.UcsdBundleDistributable", 'SOFTWARE.UCSDDISTRIBUTABLE': "software.UcsdDistributable", 'SOFTWAREREPOSITORY.AUTHORIZATION': "softwarerepository.Authorization", 'SOFTWAREREPOSITORY.CACHEDIMAGE': "softwarerepository.CachedImage", 'SOFTWAREREPOSITORY.CATALOG': "softwarerepository.Catalog", 'SOFTWAREREPOSITORY.CATEGORYMAPPER': "softwarerepository.CategoryMapper", 'SOFTWAREREPOSITORY.CATEGORYMAPPERMODEL': "softwarerepository.CategoryMapperModel", 'SOFTWAREREPOSITORY.CATEGORYSUPPORTCONSTRAINT': "softwarerepository.CategorySupportConstraint", 'SOFTWAREREPOSITORY.DOWNLOADSPEC': "softwarerepository.DownloadSpec", 'SOFTWAREREPOSITORY.OPERATINGSYSTEMFILE': "softwarerepository.OperatingSystemFile", 'SOFTWAREREPOSITORY.RELEASE': "softwarerepository.Release", 'SOL.POLICY': "sol.Policy", 'SSH.POLICY': "ssh.Policy", 'STORAGE.CONTROLLER': "storage.Controller", 'STORAGE.DISKGROUP': "storage.DiskGroup", 'STORAGE.DISKSLOT': "storage.DiskSlot", 'STORAGE.DRIVEGROUP': "storage.DriveGroup", 'STORAGE.ENCLOSURE': "storage.Enclosure", 'STORAGE.ENCLOSUREDISK': "storage.EnclosureDisk", 'STORAGE.ENCLOSUREDISKSLOTEP': "storage.EnclosureDiskSlotEp", 'STORAGE.FLEXFLASHCONTROLLER': "storage.FlexFlashController", 'STORAGE.FLEXFLASHCONTROLLERPROPS': "storage.FlexFlashControllerProps", 'STORAGE.FLEXFLASHPHYSICALDRIVE': "storage.FlexFlashPhysicalDrive", 'STORAGE.FLEXFLASHVIRTUALDRIVE': "storage.FlexFlashVirtualDrive", 'STORAGE.FLEXUTILCONTROLLER': "storage.FlexUtilController", 'STORAGE.FLEXUTILPHYSICALDRIVE': "storage.FlexUtilPhysicalDrive", 'STORAGE.FLEXUTILVIRTUALDRIVE': "storage.FlexUtilVirtualDrive", 'STORAGE.HITACHIARRAY': "storage.HitachiArray", 'STORAGE.HITACHICONTROLLER': "storage.HitachiController", 'STORAGE.HITACHIDISK': "storage.HitachiDisk", 'STORAGE.HITACHIHOST': "storage.HitachiHost", 'STORAGE.HITACHIHOSTLUN': "storage.HitachiHostLun", 'STORAGE.HITACHIPARITYGROUP': "storage.HitachiParityGroup", 'STORAGE.HITACHIPOOL': "storage.HitachiPool", 'STORAGE.HITACHIPORT': "storage.HitachiPort", 'STORAGE.HITACHIVOLUME': "storage.HitachiVolume", 'STORAGE.HYPERFLEXSTORAGECONTAINER': "storage.HyperFlexStorageContainer", 'STORAGE.HYPERFLEXVOLUME': "storage.HyperFlexVolume", 'STORAGE.ITEM': "storage.Item", 'STORAGE.NETAPPAGGREGATE': "storage.NetAppAggregate", 'STORAGE.NETAPPBASEDISK': "storage.NetAppBaseDisk", 'STORAGE.NETAPPCLUSTER': "storage.NetAppCluster", 'STORAGE.NETAPPETHERNETPORT': "storage.NetAppEthernetPort", 'STORAGE.NETAPPEXPORTPOLICY': "storage.NetAppExportPolicy", 'STORAGE.NETAPPFCINTERFACE': "storage.NetAppFcInterface", 'STORAGE.NETAPPFCPORT': "storage.NetAppFcPort", 'STORAGE.NETAPPINITIATORGROUP': "storage.NetAppInitiatorGroup", 'STORAGE.NETAPPIPINTERFACE': "storage.NetAppIpInterface", 'STORAGE.NETAPPLICENSE': "storage.NetAppLicense", 'STORAGE.NETAPPLUN': "storage.NetAppLun", 'STORAGE.NETAPPLUNMAP': "storage.NetAppLunMap", 'STORAGE.NETAPPNODE': "storage.NetAppNode", 'STORAGE.NETAPPNTPSERVER': "storage.NetAppNtpServer", 'STORAGE.NETAPPSENSOR': "storage.NetAppSensor", 'STORAGE.NETAPPSTORAGEVM': "storage.NetAppStorageVm", 'STORAGE.NETAPPVOLUME': "storage.NetAppVolume", 'STORAGE.NETAPPVOLUMESNAPSHOT': "storage.NetAppVolumeSnapshot", 'STORAGE.PHYSICALDISK': "storage.PhysicalDisk", 'STORAGE.PHYSICALDISKEXTENSION': "storage.PhysicalDiskExtension", 'STORAGE.PHYSICALDISKUSAGE': "storage.PhysicalDiskUsage", 'STORAGE.PUREARRAY': "storage.PureArray", 'STORAGE.PURECONTROLLER': "storage.PureController", 'STORAGE.PUREDISK': "storage.PureDisk", 'STORAGE.PUREHOST': "storage.PureHost", 'STORAGE.PUREHOSTGROUP': "storage.PureHostGroup", 'STORAGE.PUREHOSTLUN': "storage.PureHostLun", 'STORAGE.PUREPORT': "storage.PurePort", 'STORAGE.PUREPROTECTIONGROUP': "storage.PureProtectionGroup", 'STORAGE.PUREPROTECTIONGROUPSNAPSHOT': "storage.PureProtectionGroupSnapshot", 'STORAGE.PUREREPLICATIONSCHEDULE': "storage.PureReplicationSchedule", 'STORAGE.PURESNAPSHOTSCHEDULE': "storage.PureSnapshotSchedule", 'STORAGE.PUREVOLUME': "storage.PureVolume", 'STORAGE.PUREVOLUMESNAPSHOT': "storage.PureVolumeSnapshot", 'STORAGE.SASEXPANDER': "storage.SasExpander", 'STORAGE.SASPORT': "storage.SasPort", 'STORAGE.SPAN': "storage.Span", 'STORAGE.STORAGEPOLICY': "storage.StoragePolicy", 'STORAGE.VDMEMBEREP': "storage.VdMemberEp", 'STORAGE.VIRTUALDRIVE': "storage.VirtualDrive", 'STORAGE.VIRTUALDRIVECONTAINER': "storage.VirtualDriveContainer", 'STORAGE.VIRTUALDRIVEEXTENSION': "storage.VirtualDriveExtension", 'STORAGE.VIRTUALDRIVEIDENTITY': "storage.VirtualDriveIdentity", 'SYSLOG.POLICY': "syslog.Policy", 'TAM.ADVISORYCOUNT': "tam.AdvisoryCount", 'TAM.ADVISORYDEFINITION': "tam.AdvisoryDefinition", 'TAM.ADVISORYINFO': "tam.AdvisoryInfo", 'TAM.ADVISORYINSTANCE': "tam.AdvisoryInstance", 'TAM.SECURITYADVISORY': "tam.SecurityAdvisory", 'TASK.HITACHISCOPEDINVENTORY': "task.HitachiScopedInventory", 'TASK.HYPERFLEXSCOPEDINVENTORY': "task.HyperflexScopedInventory", 'TASK.IWESCOPEDINVENTORY': "task.IweScopedInventory", 'TASK.NETAPPSCOPEDINVENTORY': "task.NetAppScopedInventory", 'TASK.PUBLICCLOUDSCOPEDINVENTORY': "task.PublicCloudScopedInventory", 'TASK.PURESCOPEDINVENTORY': "task.PureScopedInventory", 'TASK.SERVERSCOPEDINVENTORY': "task.ServerScopedInventory", 'TECHSUPPORTMANAGEMENT.COLLECTIONCONTROLPOLICY': "techsupportmanagement.CollectionControlPolicy", 'TECHSUPPORTMANAGEMENT.DOWNLOAD': "techsupportmanagement.Download", 'TECHSUPPORTMANAGEMENT.TECHSUPPORTBUNDLE': "techsupportmanagement.TechSupportBundle", 'TECHSUPPORTMANAGEMENT.TECHSUPPORTSTATUS': "techsupportmanagement.TechSupportStatus", 'TERMINAL.AUDITLOG': "terminal.AuditLog", 'TERRAFORM.EXECUTOR': "terraform.Executor", 'THERMAL.POLICY': "thermal.Policy", 'TOP.SYSTEM': "top.System", 'UCSD.BACKUPINFO': "ucsd.BackupInfo", 'UUIDPOOL.BLOCK': "uuidpool.Block", 'UUIDPOOL.POOL': "uuidpool.Pool", 'UUIDPOOL.POOLMEMBER': "uuidpool.PoolMember", 'UUIDPOOL.UNIVERSE': "uuidpool.Universe", 'UUIDPOOL.UUIDLEASE': "uuidpool.UuidLease", 'VIRTUALIZATION.CISCOHYPERVISORMANAGER': "virtualization.CiscoHypervisorManager", 'VIRTUALIZATION.ESXICONSOLE': "virtualization.EsxiConsole", 'VIRTUALIZATION.HOST': "virtualization.Host", 'VIRTUALIZATION.IWECLUSTER': "virtualization.IweCluster", 'VIRTUALIZATION.IWEDATACENTER': "virtualization.IweDatacenter", 'VIRTUALIZATION.IWEDVUPLINK': "virtualization.IweDvUplink", 'VIRTUALIZATION.IWEDVSWITCH': "virtualization.IweDvswitch", 'VIRTUALIZATION.IWEHOST': "virtualization.IweHost", 'VIRTUALIZATION.IWEHOSTINTERFACE': "virtualization.IweHostInterface", 'VIRTUALIZATION.IWEHOSTVSWITCH': "virtualization.IweHostVswitch", 'VIRTUALIZATION.IWENETWORK': "virtualization.IweNetwork", 'VIRTUALIZATION.IWEVIRTUALDISK': "virtualization.IweVirtualDisk", 'VIRTUALIZATION.IWEVIRTUALMACHINE': "virtualization.IweVirtualMachine", 'VIRTUALIZATION.IWEVIRTUALMACHINENETWORKINTERFACE': "virtualization.IweVirtualMachineNetworkInterface", 'VIRTUALIZATION.VIRTUALDISK': "virtualization.VirtualDisk", 'VIRTUALIZATION.VIRTUALMACHINE': "virtualization.VirtualMachine", 'VIRTUALIZATION.VIRTUALNETWORK': "virtualization.VirtualNetwork", 'VIRTUALIZATION.VMWARECLUSTER': "virtualization.VmwareCluster", 'VIRTUALIZATION.VMWAREDATACENTER': "virtualization.VmwareDatacenter", 'VIRTUALIZATION.VMWAREDATASTORE': "virtualization.VmwareDatastore", 'VIRTUALIZATION.VMWAREDATASTORECLUSTER': "virtualization.VmwareDatastoreCluster", 'VIRTUALIZATION.VMWAREDISTRIBUTEDNETWORK': "virtualization.VmwareDistributedNetwork", 'VIRTUALIZATION.VMWAREDISTRIBUTEDSWITCH': "virtualization.VmwareDistributedSwitch", 'VIRTUALIZATION.VMWAREFOLDER': "virtualization.VmwareFolder", 'VIRTUALIZATION.VMWAREHOST': "virtualization.VmwareHost", 'VIRTUALIZATION.VMWAREKERNELNETWORK': "virtualization.VmwareKernelNetwork", 'VIRTUALIZATION.VMWARENETWORK': "virtualization.VmwareNetwork", 'VIRTUALIZATION.VMWAREPHYSICALNETWORKINTERFACE': "virtualization.VmwarePhysicalNetworkInterface", 'VIRTUALIZATION.VMWAREUPLINKPORT': "virtualization.VmwareUplinkPort", 'VIRTUALIZATION.VMWAREVCENTER': "virtualization.VmwareVcenter", 'VIRTUALIZATION.VMWAREVIRTUALDISK': "virtualization.VmwareVirtualDisk", 'VIRTUALIZATION.VMWAREVIRTUALMACHINE': "virtualization.VmwareVirtualMachine", 'VIRTUALIZATION.VMWAREVIRTUALMACHINESNAPSHOT': "virtualization.VmwareVirtualMachineSnapshot", 'VIRTUALIZATION.VMWAREVIRTUALNETWORKINTERFACE': "virtualization.VmwareVirtualNetworkInterface", 'VIRTUALIZATION.VMWAREVIRTUALSWITCH': "virtualization.VmwareVirtualSwitch", 'VMEDIA.POLICY': "vmedia.Policy", 'VMRC.CONSOLE': "vmrc.Console", 'VNC.CONSOLE': "vnc.Console", 'VNIC.ETHADAPTERPOLICY': "vnic.EthAdapterPolicy", 'VNIC.ETHIF': "vnic.EthIf", 'VNIC.ETHNETWORKPOLICY': "vnic.EthNetworkPolicy", 'VNIC.ETHQOSPOLICY': "vnic.EthQosPolicy", 'VNIC.FCADAPTERPOLICY': "vnic.FcAdapterPolicy", 'VNIC.FCIF': "vnic.FcIf", 'VNIC.FCNETWORKPOLICY': "vnic.FcNetworkPolicy", 'VNIC.FCQOSPOLICY': "vnic.FcQosPolicy", 'VNIC.ISCSIADAPTERPOLICY': "vnic.IscsiAdapterPolicy", 'VNIC.ISCSIBOOTPOLICY': "vnic.IscsiBootPolicy", 'VNIC.ISCSISTATICTARGETPOLICY': "vnic.IscsiStaticTargetPolicy", 'VNIC.LANCONNECTIVITYPOLICY': "vnic.LanConnectivityPolicy", 'VNIC.LCPSTATUS': "vnic.LcpStatus", 'VNIC.SANCONNECTIVITYPOLICY': "vnic.SanConnectivityPolicy", 'VNIC.SCPSTATUS': "vnic.ScpStatus", 'VRF.VRF': "vrf.Vrf", 'WORKFLOW.ANSIBLEBATCHEXECUTOR': "workflow.AnsibleBatchExecutor", 'WORKFLOW.BATCHAPIEXECUTOR': "workflow.BatchApiExecutor", 'WORKFLOW.BUILDTASKMETA': "workflow.BuildTaskMeta", 'WORKFLOW.BUILDTASKMETAOWNER': "workflow.BuildTaskMetaOwner", 'WORKFLOW.CATALOG': "workflow.Catalog", 'WORKFLOW.CUSTOMDATATYPEDEFINITION': "workflow.CustomDataTypeDefinition", 'WORKFLOW.ERRORRESPONSEHANDLER': "workflow.ErrorResponseHandler", 'WORKFLOW.PENDINGDYNAMICWORKFLOWINFO': "workflow.PendingDynamicWorkflowInfo", 'WORKFLOW.ROLLBACKWORKFLOW': "workflow.RollbackWorkflow", 'WORKFLOW.SOLUTIONACTIONDEFINITION': "workflow.SolutionActionDefinition", 'WORKFLOW.SOLUTIONACTIONINSTANCE': "workflow.SolutionActionInstance", 'WORKFLOW.SOLUTIONDEFINITION': "workflow.SolutionDefinition", 'WORKFLOW.SOLUTIONINSTANCE': "workflow.SolutionInstance", 'WORKFLOW.SOLUTIONOUTPUT': "workflow.SolutionOutput", 'WORKFLOW.SSHBATCHEXECUTOR': "workflow.SshBatchExecutor", 'WORKFLOW.TASKDEBUGLOG': "workflow.TaskDebugLog", 'WORKFLOW.TASKDEFINITION': "workflow.TaskDefinition", 'WORKFLOW.TASKINFO': "workflow.TaskInfo", 'WORKFLOW.TASKMETADATA': "workflow.TaskMetadata", 'WORKFLOW.TASKNOTIFICATION': "workflow.TaskNotification", 'WORKFLOW.TEMPLATEEVALUATION': "workflow.TemplateEvaluation", 'WORKFLOW.TEMPLATEFUNCTIONMETA': "workflow.TemplateFunctionMeta", 'WORKFLOW.WORKFLOWDEFINITION': "workflow.WorkflowDefinition", 'WORKFLOW.WORKFLOWINFO': "workflow.WorkflowInfo", 'WORKFLOW.WORKFLOWMETA': "workflow.WorkflowMeta", 'WORKFLOW.WORKFLOWMETADATA': "workflow.WorkflowMetadata", 'WORKFLOW.WORKFLOWNOTIFICATION': "workflow.WorkflowNotification", }, } validations = { ('uuid',): { 'regex': { 'pattern': r'^$|^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{12}$', # noqa: E501 }, }, } @cached_property def additional_properties_type(): """ This must be a method because a model may have properties that are of type self, this must run after the class is loaded """ lazy_import() return (bool, date, datetime, dict, float, int, list, str, none_type,) # noqa: E501 _nullable = False @cached_property def openapi_types(): """ This must be a method because a model may have properties that are of type self, this must run after the class is loaded Returns openapi_types (dict): The key is attribute name and the value is attribute type. """ lazy_import() return { 'class_id': (str,), # noqa: E501 'moid': (str,), # noqa: E501 'selector': (str,), # noqa: E501 'link': (str,), # noqa: E501 'account_moid': (str,), # noqa: E501 'create_time': (datetime,), # noqa: E501 'domain_group_moid': (str,), # noqa: E501 'mod_time': (datetime,), # noqa: E501 'owners': ([str], none_type,), # noqa: E501 'shared_scope': (str,), # noqa: E501 'tags': ([MoTag], none_type,), # noqa: E501 'version_context': (MoVersionContext,), # noqa: E501 'ancestors': ([MoBaseMoRelationship], none_type,), # noqa: E501 'parent': (MoBaseMoRelationship,), # noqa: E501 'permission_resources': ([MoBaseMoRelationship], none_type,), # noqa: E501 'display_names': (DisplayNames,), # noqa: E501 'registered_device': (AssetDeviceRegistrationRelationship,), # noqa: E501 'name': (str,), # noqa: E501 'uuid': (str,), # noqa: E501 'identity': (str,), # noqa: E501 'cluster_count': (int,), # noqa: E501 'datastore_count': (int,), # noqa: E501 'host_count': (int,), # noqa: E501 'inventory_path': (str,), # noqa: E501 'network_count': (int,), # noqa: E501 'vm_count': (int,), # noqa: E501 'vm_template_count': (int,), # noqa: E501 'hypervisor_manager': (VirtualizationVmwareVcenterRelationship,), # noqa: E501 'parent_folder': (VirtualizationVmwareFolderRelationship,), # noqa: E501 'object_type': (str,), # noqa: E501 } @cached_property def discriminator(): lazy_import() val = { 'mo.MoRef': MoMoRef, 'virtualization.VmwareDatacenter': VirtualizationVmwareDatacenter, } if not val: return None return {'class_id': val} attribute_map = { 'class_id': 'ClassId', # noqa: E501 'moid': 'Moid', # noqa: E501 'selector': 'Selector', # noqa: E501 'link': 'link', # noqa: E501 'account_moid': 'AccountMoid', # noqa: E501 'create_time': 'CreateTime', # noqa: E501 'domain_group_moid': 'DomainGroupMoid', # noqa: E501 'mod_time': 'ModTime', # noqa: E501 'owners': 'Owners', # noqa: E501 'shared_scope': 'SharedScope', # noqa: E501 'tags': 'Tags', # noqa: E501 'version_context': 'VersionContext', # noqa: E501 'ancestors': 'Ancestors', # noqa: E501 'parent': 'Parent', # noqa: E501 'permission_resources': 'PermissionResources', # noqa: E501 'display_names': 'DisplayNames', # noqa: E501 'registered_device': 'RegisteredDevice', # noqa: E501 'name': 'Name', # noqa: E501 'uuid': 'Uuid', # noqa: E501 'identity': 'Identity', # noqa: E501 'cluster_count': 'ClusterCount', # noqa: E501 'datastore_count': 'DatastoreCount', # noqa: E501 'host_count': 'HostCount', # noqa: E501 'inventory_path': 'InventoryPath', # noqa: E501 'network_count': 'NetworkCount', # noqa: E501 'vm_count': 'VmCount', # noqa: E501 'vm_template_count': 'VmTemplateCount', # noqa: E501 'hypervisor_manager': 'HypervisorManager', # noqa: E501 'parent_folder': 'ParentFolder', # noqa: E501 'object_type': 'ObjectType', # noqa: E501 } required_properties = set([ '_data_store', '_check_type', '_spec_property_naming', '_path_to_item', '_configuration', '_visited_composed_classes', '_composed_instances', '_var_name_to_model_instances', '_additional_properties_model_instances', ]) @convert_js_args_to_python_args def __init__(self, *args, **kwargs): # noqa: E501 """VirtualizationVmwareDatacenterRelationship - a model defined in OpenAPI Args: Keyword Args: class_id (str): The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.. defaults to "mo.MoRef", must be one of ["mo.MoRef", ] # noqa: E501 _check_type (bool): if True, values for parameters in openapi_types will be type checked and a TypeError will be raised if the wrong type is input. Defaults to True _path_to_item (tuple/list): This is a list of keys or values to drill down to the model in received_data when deserializing a response _spec_property_naming (bool): True if the variable names in the input data are serialized names, as specified in the OpenAPI document. False if the variable names in the input data are pythonic names, e.g. snake case (default) _configuration (Configuration): the instance to use when deserializing a file_type parameter. If passed, type conversion is attempted If omitted no type conversion is done. _visited_composed_classes (tuple): This stores a tuple of classes that we have traveled through so that if we see that class again we will not use its discriminator again. When traveling through a discriminator, the composed schema that is is traveled through is added to this set. For example if Animal has a discriminator petType and we pass in "Dog", and the class Dog allOf includes Animal, we move through Animal once using the discriminator, and pick Dog. Then in Dog, we will make an instance of the Animal class but this time we won't travel through its discriminator because we passed in _visited_composed_classes = (Animal,) moid (str): The Moid of the referenced REST resource.. [optional] # noqa: E501 selector (str): An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients. 1. If 'moid' is set this field is ignored. 1. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.. [optional] # noqa: E501 link (str): A URL to an instance of the 'mo.MoRef' class.. [optional] # noqa: E501 account_moid (str): The Account ID for this managed object.. [optional] # noqa: E501 create_time (datetime): The time when this managed object was created.. [optional] # noqa: E501 domain_group_moid (str): The DomainGroup ID for this managed object.. [optional] # noqa: E501 mod_time (datetime): The time when this managed object was last modified.. [optional] # noqa: E501 owners ([str], none_type): [optional] # noqa: E501 shared_scope (str): Intersight provides pre-built workflows, tasks and policies to end users through global catalogs. Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.. [optional] # noqa: E501 tags ([MoTag], none_type): [optional] # noqa: E501 version_context (MoVersionContext): [optional] # noqa: E501 ancestors ([MoBaseMoRelationship], none_type): An array of relationships to moBaseMo resources.. [optional] # noqa: E501 parent (MoBaseMoRelationship): [optional] # noqa: E501 permission_resources ([MoBaseMoRelationship], none_type): An array of relationships to moBaseMo resources.. [optional] # noqa: E501 display_names (DisplayNames): [optional] # noqa: E501 registered_device (AssetDeviceRegistrationRelationship): [optional] # noqa: E501 name (str): Name of the virtual machine placement. It is the name of the VPC (Virtual Private Cloud) in case of AWS virtual machine, and datacenter name in case of VMware virtual machine.. [optional] # noqa: E501 uuid (str): The uuid of this placement. The uuid is internally generated and not user specified.. [optional] # noqa: E501 identity (str): The internally generated identity of this placement. This entity is not manipulated by users. It aids in uniquely identifying the placement object.. [optional] # noqa: E501 cluster_count (int): Count of all clusters associated with this DC.. [optional] # noqa: E501 datastore_count (int): Count of all datastores associated with this DC.. [optional] # noqa: E501 host_count (int): Count of all hosts associated with this DC.. [optional] # noqa: E501 inventory_path (str): Inventory path of the DC.. [optional] # noqa: E501 network_count (int): Count of all networks associated with this datacenter (DC).. [optional] # noqa: E501 vm_count (int): Count of all virtual machines (VMs) associated with this DC.. [optional] # noqa: E501 vm_template_count (int): Count of all virtual machines templates associated with this DC.. [optional] # noqa: E501 hypervisor_manager (VirtualizationVmwareVcenterRelationship): [optional] # noqa: E501 parent_folder (VirtualizationVmwareFolderRelationship): [optional] # noqa: E501 object_type (str): The fully-qualified name of the remote type referred by this relationship.. [optional] # noqa: E501 """ class_id = kwargs.get('class_id', "mo.MoRef") _check_type = kwargs.pop('_check_type', True) _spec_property_naming = kwargs.pop('_spec_property_naming', False) _path_to_item = kwargs.pop('_path_to_item', ()) _configuration = kwargs.pop('_configuration', None) _visited_composed_classes = kwargs.pop('_visited_composed_classes', ()) if args: raise ApiTypeError( "Invalid positional arguments=%s passed to %s. Remove those invalid positional arguments." % ( args, self.__class__.__name__, ), path_to_item=_path_to_item, valid_classes=(self.__class__,), ) self._data_store = {} self._check_type = _check_type self._spec_property_naming = _spec_property_naming self._path_to_item = _path_to_item self._configuration = _configuration self._visited_composed_classes = _visited_composed_classes + (self.__class__,) constant_args = { '_check_type': _check_type, '_path_to_item': _path_to_item, '_spec_property_naming': _spec_property_naming, '_configuration': _configuration, '_visited_composed_classes': self._visited_composed_classes, } required_args = { 'class_id': class_id, } model_args = {} model_args.update(required_args) model_args.update(kwargs) composed_info = validate_get_composed_info( constant_args, model_args, self) self._composed_instances = composed_info[0] self._var_name_to_model_instances = composed_info[1] self._additional_properties_model_instances = composed_info[2] unused_args = composed_info[3] for var_name, var_value in required_args.items(): setattr(self, var_name, var_value) for var_name, var_value in kwargs.items(): if var_name in unused_args and \ self._configuration is not None and \ self._configuration.discard_unknown_keys and \ not self._additional_properties_model_instances: # discard variable. continue setattr(self, var_name, var_value) @cached_property def _composed_schemas(): # we need this here to make our import statements work # we must store _composed_schemas in here so the code is only run # when we invoke this method. If we kept this at the class # level we would get an error beause the class level # code would be run when this module is imported, and these composed # classes don't exist yet because their module has not finished # loading lazy_import() return { 'anyOf': [ ], 'allOf': [ ], 'oneOf': [ MoMoRef, VirtualizationVmwareDatacenter, none_type, ], }
63.070496
1,678
0.659325
import re import sys from intersight.model_utils import ( ApiTypeError, ModelComposed, ModelNormal, ModelSimple, cached_property, change_keys_js_to_python, convert_js_args_to_python_args, date, datetime, file_type, none_type, validate_get_composed_info, ) def lazy_import(): from intersight.model.asset_device_registration_relationship import AssetDeviceRegistrationRelationship from intersight.model.display_names import DisplayNames from intersight.model.mo_base_mo_relationship import MoBaseMoRelationship from intersight.model.mo_mo_ref import MoMoRef from intersight.model.mo_tag import MoTag from intersight.model.mo_version_context import MoVersionContext from intersight.model.virtualization_vmware_datacenter import VirtualizationVmwareDatacenter from intersight.model.virtualization_vmware_folder_relationship import VirtualizationVmwareFolderRelationship from intersight.model.virtualization_vmware_vcenter_relationship import VirtualizationVmwareVcenterRelationship globals()['AssetDeviceRegistrationRelationship'] = AssetDeviceRegistrationRelationship globals()['DisplayNames'] = DisplayNames globals()['MoBaseMoRelationship'] = MoBaseMoRelationship globals()['MoMoRef'] = MoMoRef globals()['MoTag'] = MoTag globals()['MoVersionContext'] = MoVersionContext globals()['VirtualizationVmwareDatacenter'] = VirtualizationVmwareDatacenter globals()['VirtualizationVmwareFolderRelationship'] = VirtualizationVmwareFolderRelationship globals()['VirtualizationVmwareVcenterRelationship'] = VirtualizationVmwareVcenterRelationship class VirtualizationVmwareDatacenterRelationship(ModelComposed): allowed_values = { ('class_id',): { 'MO.MOREF': "mo.MoRef", }, ('object_type',): { 'AAA.AUDITRECORD': "aaa.AuditRecord", 'AAA.RETENTIONCONFIG': "aaa.RetentionConfig", 'AAA.RETENTIONPOLICY': "aaa.RetentionPolicy", 'ACCESS.POLICY': "access.Policy", 'ADAPTER.CONFIGPOLICY': "adapter.ConfigPolicy", 'ADAPTER.EXTETHINTERFACE': "adapter.ExtEthInterface", 'ADAPTER.HOSTETHINTERFACE': "adapter.HostEthInterface", 'ADAPTER.HOSTFCINTERFACE': "adapter.HostFcInterface", 'ADAPTER.HOSTISCSIINTERFACE': "adapter.HostIscsiInterface", 'ADAPTER.UNIT': "adapter.Unit", 'ADAPTER.UNITEXPANDER': "adapter.UnitExpander", 'APPLIANCE.APPSTATUS': "appliance.AppStatus", 'APPLIANCE.AUTORMAPOLICY': "appliance.AutoRmaPolicy", 'APPLIANCE.BACKUP': "appliance.Backup", 'APPLIANCE.BACKUPPOLICY': "appliance.BackupPolicy", 'APPLIANCE.CERTIFICATESETTING': "appliance.CertificateSetting", 'APPLIANCE.DATAEXPORTPOLICY': "appliance.DataExportPolicy", 'APPLIANCE.DEVICECERTIFICATE': "appliance.DeviceCertificate", 'APPLIANCE.DEVICECLAIM': "appliance.DeviceClaim", 'APPLIANCE.DEVICEUPGRADEPOLICY': "appliance.DeviceUpgradePolicy", 'APPLIANCE.DIAGSETTING': "appliance.DiagSetting", 'APPLIANCE.EXTERNALSYSLOGSETTING': "appliance.ExternalSyslogSetting", 'APPLIANCE.FILEGATEWAY': "appliance.FileGateway", 'APPLIANCE.FILESYSTEMSTATUS': "appliance.FileSystemStatus", 'APPLIANCE.GROUPSTATUS': "appliance.GroupStatus", 'APPLIANCE.IMAGEBUNDLE': "appliance.ImageBundle", 'APPLIANCE.NODEINFO': "appliance.NodeInfo", 'APPLIANCE.NODESTATUS': "appliance.NodeStatus", 'APPLIANCE.RELEASENOTE': "appliance.ReleaseNote", 'APPLIANCE.REMOTEFILEIMPORT': "appliance.RemoteFileImport", 'APPLIANCE.RESTORE': "appliance.Restore", 'APPLIANCE.SETUPINFO': "appliance.SetupInfo", 'APPLIANCE.SYSTEMINFO': "appliance.SystemInfo", 'APPLIANCE.SYSTEMSTATUS': "appliance.SystemStatus", 'APPLIANCE.UPGRADE': "appliance.Upgrade", 'APPLIANCE.UPGRADEPOLICY': "appliance.UpgradePolicy", 'ASSET.CLUSTERMEMBER': "asset.ClusterMember", 'ASSET.DEPLOYMENT': "asset.Deployment", 'ASSET.DEPLOYMENTDEVICE': "asset.DeploymentDevice", 'ASSET.DEVICECLAIM': "asset.DeviceClaim", 'ASSET.DEVICECONFIGURATION': "asset.DeviceConfiguration", 'ASSET.DEVICECONNECTORMANAGER': "asset.DeviceConnectorManager", 'ASSET.DEVICECONTRACTINFORMATION': "asset.DeviceContractInformation", 'ASSET.DEVICECONTRACTNOTIFICATION': "asset.DeviceContractNotification", 'ASSET.DEVICEREGISTRATION': "asset.DeviceRegistration", 'ASSET.SUBSCRIPTION': "asset.Subscription", 'ASSET.SUBSCRIPTIONACCOUNT': "asset.SubscriptionAccount", 'ASSET.SUBSCRIPTIONDEVICECONTRACTINFORMATION': "asset.SubscriptionDeviceContractInformation", 'ASSET.TARGET': "asset.Target", 'BIOS.BOOTDEVICE': "bios.BootDevice", 'BIOS.BOOTMODE': "bios.BootMode", 'BIOS.POLICY': "bios.Policy", 'BIOS.SYSTEMBOOTORDER': "bios.SystemBootOrder", 'BIOS.TOKENSETTINGS': "bios.TokenSettings", 'BIOS.UNIT': "bios.Unit", 'BIOS.VFSELECTMEMORYRASCONFIGURATION': "bios.VfSelectMemoryRasConfiguration", 'BOOT.CDDDEVICE': "boot.CddDevice", 'BOOT.DEVICEBOOTMODE': "boot.DeviceBootMode", 'BOOT.DEVICEBOOTSECURITY': "boot.DeviceBootSecurity", 'BOOT.HDDDEVICE': "boot.HddDevice", 'BOOT.ISCSIDEVICE': "boot.IscsiDevice", 'BOOT.NVMEDEVICE': "boot.NvmeDevice", 'BOOT.PCHSTORAGEDEVICE': "boot.PchStorageDevice", 'BOOT.PRECISIONPOLICY': "boot.PrecisionPolicy", 'BOOT.PXEDEVICE': "boot.PxeDevice", 'BOOT.SANDEVICE': "boot.SanDevice", 'BOOT.SDDEVICE': "boot.SdDevice", 'BOOT.UEFISHELLDEVICE': "boot.UefiShellDevice", 'BOOT.USBDEVICE': "boot.UsbDevice", 'BOOT.VMEDIADEVICE': "boot.VmediaDevice", 'BULK.EXPORT': "bulk.Export", 'BULK.EXPORTEDITEM': "bulk.ExportedItem", 'BULK.MOCLONER': "bulk.MoCloner", 'BULK.MOMERGER': "bulk.MoMerger", 'BULK.REQUEST': "bulk.Request", 'BULK.SUBREQUESTOBJ': "bulk.SubRequestObj", 'CAPABILITY.ADAPTERUNITDESCRIPTOR': "capability.AdapterUnitDescriptor", 'CAPABILITY.CATALOG': "capability.Catalog", 'CAPABILITY.CHASSISDESCRIPTOR': "capability.ChassisDescriptor", 'CAPABILITY.CHASSISMANUFACTURINGDEF': "capability.ChassisManufacturingDef", 'CAPABILITY.CIMCFIRMWAREDESCRIPTOR': "capability.CimcFirmwareDescriptor", 'CAPABILITY.EQUIPMENTPHYSICALDEF': "capability.EquipmentPhysicalDef", 'CAPABILITY.EQUIPMENTSLOTARRAY': "capability.EquipmentSlotArray", 'CAPABILITY.FANMODULEDESCRIPTOR': "capability.FanModuleDescriptor", 'CAPABILITY.FANMODULEMANUFACTURINGDEF': "capability.FanModuleManufacturingDef", 'CAPABILITY.IOCARDCAPABILITYDEF': "capability.IoCardCapabilityDef", 'CAPABILITY.IOCARDDESCRIPTOR': "capability.IoCardDescriptor", 'CAPABILITY.IOCARDMANUFACTURINGDEF': "capability.IoCardManufacturingDef", 'CAPABILITY.PORTGROUPAGGREGATIONDEF': "capability.PortGroupAggregationDef", 'CAPABILITY.PSUDESCRIPTOR': "capability.PsuDescriptor", 'CAPABILITY.PSUMANUFACTURINGDEF': "capability.PsuManufacturingDef", 'CAPABILITY.SERVERMODELSCAPABILITYDEF': "capability.ServerModelsCapabilityDef", 'CAPABILITY.SERVERSCHEMADESCRIPTOR': "capability.ServerSchemaDescriptor", 'CAPABILITY.SIOCMODULECAPABILITYDEF': "capability.SiocModuleCapabilityDef", 'CAPABILITY.SIOCMODULEDESCRIPTOR': "capability.SiocModuleDescriptor", 'CAPABILITY.SIOCMODULEMANUFACTURINGDEF': "capability.SiocModuleManufacturingDef", 'CAPABILITY.SWITCHCAPABILITY': "capability.SwitchCapability", 'CAPABILITY.SWITCHDESCRIPTOR': "capability.SwitchDescriptor", 'CAPABILITY.SWITCHMANUFACTURINGDEF': "capability.SwitchManufacturingDef", 'CERTIFICATEMANAGEMENT.POLICY': "certificatemanagement.Policy", 'CHASSIS.CONFIGCHANGEDETAIL': "chassis.ConfigChangeDetail", 'CHASSIS.CONFIGIMPORT': "chassis.ConfigImport", 'CHASSIS.CONFIGRESULT': "chassis.ConfigResult", 'CHASSIS.CONFIGRESULTENTRY': "chassis.ConfigResultEntry", 'CHASSIS.IOMPROFILE': "chassis.IomProfile", 'CHASSIS.PROFILE': "chassis.Profile", 'CLOUD.AWSBILLINGUNIT': "cloud.AwsBillingUnit", 'CLOUD.AWSKEYPAIR': "cloud.AwsKeyPair", 'CLOUD.AWSNETWORKINTERFACE': "cloud.AwsNetworkInterface", 'CLOUD.AWSORGANIZATIONALUNIT': "cloud.AwsOrganizationalUnit", 'CLOUD.AWSSECURITYGROUP': "cloud.AwsSecurityGroup", 'CLOUD.AWSSUBNET': "cloud.AwsSubnet", 'CLOUD.AWSVIRTUALMACHINE': "cloud.AwsVirtualMachine", 'CLOUD.AWSVOLUME': "cloud.AwsVolume", 'CLOUD.AWSVPC': "cloud.AwsVpc", 'CLOUD.COLLECTINVENTORY': "cloud.CollectInventory", 'CLOUD.REGIONS': "cloud.Regions", 'CLOUD.SKUCONTAINERTYPE': "cloud.SkuContainerType", 'CLOUD.SKUDATABASETYPE': "cloud.SkuDatabaseType", 'CLOUD.SKUINSTANCETYPE': "cloud.SkuInstanceType", 'CLOUD.SKUNETWORKTYPE': "cloud.SkuNetworkType", 'CLOUD.SKUREGIONRATECARDS': "cloud.SkuRegionRateCards", 'CLOUD.SKUVOLUMETYPE': "cloud.SkuVolumeType", 'CLOUD.TFCAGENTPOOL': "cloud.TfcAgentpool", 'CLOUD.TFCORGANIZATION': "cloud.TfcOrganization", 'CLOUD.TFCWORKSPACE': "cloud.TfcWorkspace", 'COMM.HTTPPROXYPOLICY': "comm.HttpProxyPolicy", 'COMPUTE.BIOSPOSTPOLICY': "compute.BiosPostPolicy", 'COMPUTE.BLADE': "compute.Blade", 'COMPUTE.BLADEIDENTITY': "compute.BladeIdentity", 'COMPUTE.BOARD': "compute.Board", 'COMPUTE.MAPPING': "compute.Mapping", 'COMPUTE.PHYSICALSUMMARY': "compute.PhysicalSummary", 'COMPUTE.RACKUNIT': "compute.RackUnit", 'COMPUTE.RACKUNITIDENTITY': "compute.RackUnitIdentity", 'COMPUTE.SERVERPOWERPOLICY': "compute.ServerPowerPolicy", 'COMPUTE.SERVERSETTING': "compute.ServerSetting", 'COMPUTE.VMEDIA': "compute.Vmedia", 'COND.ALARM': "cond.Alarm", 'COND.ALARMAGGREGATION': "cond.AlarmAggregation", 'COND.HCLSTATUS': "cond.HclStatus", 'COND.HCLSTATUSDETAIL': "cond.HclStatusDetail", 'COND.HCLSTATUSJOB': "cond.HclStatusJob", 'CONNECTORPACK.CONNECTORPACKUPGRADE': "connectorpack.ConnectorPackUpgrade", 'CONNECTORPACK.UPGRADEIMPACT': "connectorpack.UpgradeImpact", 'CONVERGEDINFRA.HEALTHCHECKDEFINITION': "convergedinfra.HealthCheckDefinition", 'CONVERGEDINFRA.HEALTHCHECKEXECUTION': "convergedinfra.HealthCheckExecution", 'CONVERGEDINFRA.POD': "convergedinfra.Pod", 'CRD.CUSTOMRESOURCE': "crd.CustomResource", 'DEVICECONNECTOR.POLICY': "deviceconnector.Policy", 'EQUIPMENT.CHASSIS': "equipment.Chassis", 'EQUIPMENT.CHASSISIDENTITY': "equipment.ChassisIdentity", 'EQUIPMENT.CHASSISOPERATION': "equipment.ChassisOperation", 'EQUIPMENT.DEVICESUMMARY': "equipment.DeviceSummary", 'EQUIPMENT.EXPANDERMODULE': "equipment.ExpanderModule", 'EQUIPMENT.FAN': "equipment.Fan", 'EQUIPMENT.FANCONTROL': "equipment.FanControl", 'EQUIPMENT.FANMODULE': "equipment.FanModule", 'EQUIPMENT.FEX': "equipment.Fex", 'EQUIPMENT.FEXIDENTITY': "equipment.FexIdentity", 'EQUIPMENT.FEXOPERATION': "equipment.FexOperation", 'EQUIPMENT.FRU': "equipment.Fru", 'EQUIPMENT.IDENTITYSUMMARY': "equipment.IdentitySummary", 'EQUIPMENT.IOCARD': "equipment.IoCard", 'EQUIPMENT.IOCARDOPERATION': "equipment.IoCardOperation", 'EQUIPMENT.IOEXPANDER': "equipment.IoExpander", 'EQUIPMENT.LOCATORLED': "equipment.LocatorLed", 'EQUIPMENT.PSU': "equipment.Psu", 'EQUIPMENT.PSUCONTROL': "equipment.PsuControl", 'EQUIPMENT.RACKENCLOSURE': "equipment.RackEnclosure", 'EQUIPMENT.RACKENCLOSURESLOT': "equipment.RackEnclosureSlot", 'EQUIPMENT.SHAREDIOMODULE': "equipment.SharedIoModule", 'EQUIPMENT.SWITCHCARD': "equipment.SwitchCard", 'EQUIPMENT.SYSTEMIOCONTROLLER': "equipment.SystemIoController", 'EQUIPMENT.TPM': "equipment.Tpm", 'EQUIPMENT.TRANSCEIVER': "equipment.Transceiver", 'ETHER.HOSTPORT': "ether.HostPort", 'ETHER.NETWORKPORT': "ether.NetworkPort", 'ETHER.PHYSICALPORT': "ether.PhysicalPort", 'ETHER.PORTCHANNEL': "ether.PortChannel", 'EXTERNALSITE.AUTHORIZATION': "externalsite.Authorization", 'FABRIC.APPLIANCEPCROLE': "fabric.AppliancePcRole", 'FABRIC.APPLIANCEROLE': "fabric.ApplianceRole", 'FABRIC.CONFIGCHANGEDETAIL': "fabric.ConfigChangeDetail", 'FABRIC.CONFIGRESULT': "fabric.ConfigResult", 'FABRIC.CONFIGRESULTENTRY': "fabric.ConfigResultEntry", 'FABRIC.ELEMENTIDENTITY': "fabric.ElementIdentity", 'FABRIC.ESTIMATEIMPACT': "fabric.EstimateImpact", 'FABRIC.ETHNETWORKCONTROLPOLICY': "fabric.EthNetworkControlPolicy", 'FABRIC.ETHNETWORKGROUPPOLICY': "fabric.EthNetworkGroupPolicy", 'FABRIC.ETHNETWORKPOLICY': "fabric.EthNetworkPolicy", 'FABRIC.FCNETWORKPOLICY': "fabric.FcNetworkPolicy", 'FABRIC.FCSTORAGEROLE': "fabric.FcStorageRole", 'FABRIC.FCUPLINKPCROLE': "fabric.FcUplinkPcRole", 'FABRIC.FCUPLINKROLE': "fabric.FcUplinkRole", 'FABRIC.FCOEUPLINKPCROLE': "fabric.FcoeUplinkPcRole", 'FABRIC.FCOEUPLINKROLE': "fabric.FcoeUplinkRole", 'FABRIC.FLOWCONTROLPOLICY': "fabric.FlowControlPolicy", 'FABRIC.LINKAGGREGATIONPOLICY': "fabric.LinkAggregationPolicy", 'FABRIC.LINKCONTROLPOLICY': "fabric.LinkControlPolicy", 'FABRIC.MULTICASTPOLICY': "fabric.MulticastPolicy", 'FABRIC.PCMEMBER': "fabric.PcMember", 'FABRIC.PCOPERATION': "fabric.PcOperation", 'FABRIC.PORTMODE': "fabric.PortMode", 'FABRIC.PORTOPERATION': "fabric.PortOperation", 'FABRIC.PORTPOLICY': "fabric.PortPolicy", 'FABRIC.SERVERROLE': "fabric.ServerRole", 'FABRIC.SWITCHCLUSTERPROFILE': "fabric.SwitchClusterProfile", 'FABRIC.SWITCHCONTROLPOLICY': "fabric.SwitchControlPolicy", 'FABRIC.SWITCHPROFILE': "fabric.SwitchProfile", 'FABRIC.SYSTEMQOSPOLICY': "fabric.SystemQosPolicy", 'FABRIC.UPLINKPCROLE': "fabric.UplinkPcRole", 'FABRIC.UPLINKROLE': "fabric.UplinkRole", 'FABRIC.VLAN': "fabric.Vlan", 'FABRIC.VSAN': "fabric.Vsan", 'FAULT.INSTANCE': "fault.Instance", 'FC.PHYSICALPORT': "fc.PhysicalPort", 'FC.PORTCHANNEL': "fc.PortChannel", 'FCPOOL.FCBLOCK': "fcpool.FcBlock", 'FCPOOL.LEASE': "fcpool.Lease", 'FCPOOL.POOL': "fcpool.Pool", 'FCPOOL.POOLMEMBER': "fcpool.PoolMember", 'FCPOOL.UNIVERSE': "fcpool.Universe", 'FEEDBACK.FEEDBACKPOST': "feedback.FeedbackPost", 'FIRMWARE.BIOSDESCRIPTOR': "firmware.BiosDescriptor", 'FIRMWARE.BOARDCONTROLLERDESCRIPTOR': "firmware.BoardControllerDescriptor", 'FIRMWARE.CHASSISUPGRADE': "firmware.ChassisUpgrade", 'FIRMWARE.CIMCDESCRIPTOR': "firmware.CimcDescriptor", 'FIRMWARE.DIMMDESCRIPTOR': "firmware.DimmDescriptor", 'FIRMWARE.DISTRIBUTABLE': "firmware.Distributable", 'FIRMWARE.DISTRIBUTABLEMETA': "firmware.DistributableMeta", 'FIRMWARE.DRIVEDESCRIPTOR': "firmware.DriveDescriptor", 'FIRMWARE.DRIVERDISTRIBUTABLE': "firmware.DriverDistributable", 'FIRMWARE.EULA': "firmware.Eula", 'FIRMWARE.FIRMWARESUMMARY': "firmware.FirmwareSummary", 'FIRMWARE.GPUDESCRIPTOR': "firmware.GpuDescriptor", 'FIRMWARE.HBADESCRIPTOR': "firmware.HbaDescriptor", 'FIRMWARE.IOMDESCRIPTOR': "firmware.IomDescriptor", 'FIRMWARE.MSWITCHDESCRIPTOR': "firmware.MswitchDescriptor", 'FIRMWARE.NXOSDESCRIPTOR': "firmware.NxosDescriptor", 'FIRMWARE.PCIEDESCRIPTOR': "firmware.PcieDescriptor", 'FIRMWARE.PSUDESCRIPTOR': "firmware.PsuDescriptor", 'FIRMWARE.RUNNINGFIRMWARE': "firmware.RunningFirmware", 'FIRMWARE.SASEXPANDERDESCRIPTOR': "firmware.SasExpanderDescriptor", 'FIRMWARE.SERVERCONFIGURATIONUTILITYDISTRIBUTABLE': "firmware.ServerConfigurationUtilityDistributable", 'FIRMWARE.STORAGECONTROLLERDESCRIPTOR': "firmware.StorageControllerDescriptor", 'FIRMWARE.SWITCHUPGRADE': "firmware.SwitchUpgrade", 'FIRMWARE.UNSUPPORTEDVERSIONUPGRADE': "firmware.UnsupportedVersionUpgrade", 'FIRMWARE.UPGRADE': "firmware.Upgrade", 'FIRMWARE.UPGRADEIMPACT': "firmware.UpgradeImpact", 'FIRMWARE.UPGRADEIMPACTSTATUS': "firmware.UpgradeImpactStatus", 'FIRMWARE.UPGRADESTATUS': "firmware.UpgradeStatus", 'FORECAST.CATALOG': "forecast.Catalog", 'FORECAST.DEFINITION': "forecast.Definition", 'FORECAST.INSTANCE': "forecast.Instance", 'GRAPHICS.CARD': "graphics.Card", 'GRAPHICS.CONTROLLER': "graphics.Controller", 'HCL.COMPATIBILITYSTATUS': "hcl.CompatibilityStatus", 'HCL.DRIVERIMAGE': "hcl.DriverImage", 'HCL.EXEMPTEDCATALOG': "hcl.ExemptedCatalog", 'HCL.HYPERFLEXSOFTWARECOMPATIBILITYINFO': "hcl.HyperflexSoftwareCompatibilityInfo", 'HCL.OPERATINGSYSTEM': "hcl.OperatingSystem", 'HCL.OPERATINGSYSTEMVENDOR': "hcl.OperatingSystemVendor", 'HCL.SUPPORTEDDRIVERNAME': "hcl.SupportedDriverName", 'HYPERFLEX.ALARM': "hyperflex.Alarm", 'HYPERFLEX.APPCATALOG': "hyperflex.AppCatalog", 'HYPERFLEX.AUTOSUPPORTPOLICY': "hyperflex.AutoSupportPolicy", 'HYPERFLEX.BACKUPCLUSTER': "hyperflex.BackupCluster", 'HYPERFLEX.CAPABILITYINFO': "hyperflex.CapabilityInfo", 'HYPERFLEX.CLUSTER': "hyperflex.Cluster", 'HYPERFLEX.CLUSTERBACKUPPOLICY': "hyperflex.ClusterBackupPolicy", 'HYPERFLEX.CLUSTERBACKUPPOLICYDEPLOYMENT': "hyperflex.ClusterBackupPolicyDeployment", 'HYPERFLEX.CLUSTERBACKUPPOLICYINVENTORY': "hyperflex.ClusterBackupPolicyInventory", 'HYPERFLEX.CLUSTERHEALTHCHECKEXECUTIONSNAPSHOT': "hyperflex.ClusterHealthCheckExecutionSnapshot", 'HYPERFLEX.CLUSTERNETWORKPOLICY': "hyperflex.ClusterNetworkPolicy", 'HYPERFLEX.CLUSTERPROFILE': "hyperflex.ClusterProfile", 'HYPERFLEX.CLUSTERREPLICATIONNETWORKPOLICY': "hyperflex.ClusterReplicationNetworkPolicy", 'HYPERFLEX.CLUSTERREPLICATIONNETWORKPOLICYDEPLOYMENT': "hyperflex.ClusterReplicationNetworkPolicyDeployment", 'HYPERFLEX.CLUSTERSTORAGEPOLICY': "hyperflex.ClusterStoragePolicy", 'HYPERFLEX.CONFIGRESULT': "hyperflex.ConfigResult", 'HYPERFLEX.CONFIGRESULTENTRY': "hyperflex.ConfigResultEntry", 'HYPERFLEX.DATAPROTECTIONPEER': "hyperflex.DataProtectionPeer", 'HYPERFLEX.DATASTORESTATISTIC': "hyperflex.DatastoreStatistic", 'HYPERFLEX.DEVICEPACKAGEDOWNLOADSTATE': "hyperflex.DevicePackageDownloadState", 'HYPERFLEX.DRIVE': "hyperflex.Drive", 'HYPERFLEX.EXTFCSTORAGEPOLICY': "hyperflex.ExtFcStoragePolicy", 'HYPERFLEX.EXTISCSISTORAGEPOLICY': "hyperflex.ExtIscsiStoragePolicy", 'HYPERFLEX.FEATURELIMITEXTERNAL': "hyperflex.FeatureLimitExternal", 'HYPERFLEX.FEATURELIMITINTERNAL': "hyperflex.FeatureLimitInternal", 'HYPERFLEX.HEALTH': "hyperflex.Health", 'HYPERFLEX.HEALTHCHECKDEFINITION': "hyperflex.HealthCheckDefinition", 'HYPERFLEX.HEALTHCHECKEXECUTION': "hyperflex.HealthCheckExecution", 'HYPERFLEX.HEALTHCHECKEXECUTIONSNAPSHOT': "hyperflex.HealthCheckExecutionSnapshot", 'HYPERFLEX.HEALTHCHECKPACKAGECHECKSUM': "hyperflex.HealthCheckPackageChecksum", 'HYPERFLEX.HXDPVERSION': "hyperflex.HxdpVersion", 'HYPERFLEX.LICENSE': "hyperflex.License", 'HYPERFLEX.LOCALCREDENTIALPOLICY': "hyperflex.LocalCredentialPolicy", 'HYPERFLEX.NODE': "hyperflex.Node", 'HYPERFLEX.NODECONFIGPOLICY': "hyperflex.NodeConfigPolicy", 'HYPERFLEX.NODEPROFILE': "hyperflex.NodeProfile", 'HYPERFLEX.PROTECTEDCLUSTER': "hyperflex.ProtectedCluster", 'HYPERFLEX.PROXYSETTINGPOLICY': "hyperflex.ProxySettingPolicy", 'HYPERFLEX.SERVERFIRMWAREVERSION': "hyperflex.ServerFirmwareVersion", 'HYPERFLEX.SERVERFIRMWAREVERSIONENTRY': "hyperflex.ServerFirmwareVersionEntry", 'HYPERFLEX.SERVERMODEL': "hyperflex.ServerModel", 'HYPERFLEX.SERVICEAUTHTOKEN': "hyperflex.ServiceAuthToken", 'HYPERFLEX.SOFTWAREDISTRIBUTIONCOMPONENT': "hyperflex.SoftwareDistributionComponent", 'HYPERFLEX.SOFTWAREDISTRIBUTIONENTRY': "hyperflex.SoftwareDistributionEntry", 'HYPERFLEX.SOFTWAREDISTRIBUTIONVERSION': "hyperflex.SoftwareDistributionVersion", 'HYPERFLEX.SOFTWAREVERSIONPOLICY': "hyperflex.SoftwareVersionPolicy", 'HYPERFLEX.STORAGECONTAINER': "hyperflex.StorageContainer", 'HYPERFLEX.SYSCONFIGPOLICY': "hyperflex.SysConfigPolicy", 'HYPERFLEX.UCSMCONFIGPOLICY': "hyperflex.UcsmConfigPolicy", 'HYPERFLEX.VCENTERCONFIGPOLICY': "hyperflex.VcenterConfigPolicy", 'HYPERFLEX.VMBACKUPINFO': "hyperflex.VmBackupInfo", 'HYPERFLEX.VMIMPORTOPERATION': "hyperflex.VmImportOperation", 'HYPERFLEX.VMRESTOREOPERATION': "hyperflex.VmRestoreOperation", 'HYPERFLEX.VMSNAPSHOTINFO': "hyperflex.VmSnapshotInfo", 'HYPERFLEX.VOLUME': "hyperflex.Volume", 'HYPERFLEX.WITNESSCONFIGURATION': "hyperflex.WitnessConfiguration", 'IAAS.CONNECTORPACK': "iaas.ConnectorPack", 'IAAS.DEVICESTATUS': "iaas.DeviceStatus", 'IAAS.DIAGNOSTICMESSAGES': "iaas.DiagnosticMessages", 'IAAS.LICENSEINFO': "iaas.LicenseInfo", 'IAAS.MOSTRUNTASKS': "iaas.MostRunTasks", 'IAAS.SERVICEREQUEST': "iaas.ServiceRequest", 'IAAS.UCSDINFO': "iaas.UcsdInfo", 'IAAS.UCSDMANAGEDINFRA': "iaas.UcsdManagedInfra", 'IAAS.UCSDMESSAGES': "iaas.UcsdMessages", 'IAM.ACCOUNT': "iam.Account", 'IAM.ACCOUNTEXPERIENCE': "iam.AccountExperience", 'IAM.APIKEY': "iam.ApiKey", 'IAM.APPREGISTRATION': "iam.AppRegistration", 'IAM.BANNERMESSAGE': "iam.BannerMessage", 'IAM.CERTIFICATE': "iam.Certificate", 'IAM.CERTIFICATEREQUEST': "iam.CertificateRequest", 'IAM.DOMAINGROUP': "iam.DomainGroup", 'IAM.ENDPOINTPRIVILEGE': "iam.EndPointPrivilege", 'IAM.ENDPOINTROLE': "iam.EndPointRole", 'IAM.ENDPOINTUSER': "iam.EndPointUser", 'IAM.ENDPOINTUSERPOLICY': "iam.EndPointUserPolicy", 'IAM.ENDPOINTUSERROLE': "iam.EndPointUserRole", 'IAM.IDP': "iam.Idp", 'IAM.IDPREFERENCE': "iam.IdpReference", 'IAM.IPACCESSMANAGEMENT': "iam.IpAccessManagement", 'IAM.IPADDRESS': "iam.IpAddress", 'IAM.LDAPGROUP': "iam.LdapGroup", 'IAM.LDAPPOLICY': "iam.LdapPolicy", 'IAM.LDAPPROVIDER': "iam.LdapProvider", 'IAM.LOCALUSERPASSWORD': "iam.LocalUserPassword", 'IAM.LOCALUSERPASSWORDPOLICY': "iam.LocalUserPasswordPolicy", 'IAM.OAUTHTOKEN': "iam.OAuthToken", 'IAM.PERMISSION': "iam.Permission", 'IAM.PRIVATEKEYSPEC': "iam.PrivateKeySpec", 'IAM.PRIVILEGE': "iam.Privilege", 'IAM.PRIVILEGESET': "iam.PrivilegeSet", 'IAM.QUALIFIER': "iam.Qualifier", 'IAM.RESOURCELIMITS': "iam.ResourceLimits", 'IAM.RESOURCEPERMISSION': "iam.ResourcePermission", 'IAM.RESOURCEROLES': "iam.ResourceRoles", 'IAM.ROLE': "iam.Role", 'IAM.SECURITYHOLDER': "iam.SecurityHolder", 'IAM.SERVICEPROVIDER': "iam.ServiceProvider", 'IAM.SESSION': "iam.Session", 'IAM.SESSIONLIMITS': "iam.SessionLimits", 'IAM.SYSTEM': "iam.System", 'IAM.TRUSTPOINT': "iam.TrustPoint", 'IAM.USER': "iam.User", 'IAM.USERGROUP': "iam.UserGroup", 'IAM.USERPREFERENCE': "iam.UserPreference", 'INVENTORY.DEVICEINFO': "inventory.DeviceInfo", 'INVENTORY.DNMOBINDING': "inventory.DnMoBinding", 'INVENTORY.GENERICINVENTORY': "inventory.GenericInventory", 'INVENTORY.GENERICINVENTORYHOLDER': "inventory.GenericInventoryHolder", 'INVENTORY.REQUEST': "inventory.Request", 'IPMIOVERLAN.POLICY': "ipmioverlan.Policy", 'IPPOOL.BLOCKLEASE': "ippool.BlockLease", 'IPPOOL.IPLEASE': "ippool.IpLease", 'IPPOOL.POOL': "ippool.Pool", 'IPPOOL.POOLMEMBER': "ippool.PoolMember", 'IPPOOL.SHADOWBLOCK': "ippool.ShadowBlock", 'IPPOOL.SHADOWPOOL': "ippool.ShadowPool", 'IPPOOL.UNIVERSE': "ippool.Universe", 'IQNPOOL.BLOCK': "iqnpool.Block", 'IQNPOOL.LEASE': "iqnpool.Lease", 'IQNPOOL.POOL': "iqnpool.Pool", 'IQNPOOL.POOLMEMBER': "iqnpool.PoolMember", 'IQNPOOL.UNIVERSE': "iqnpool.Universe", 'IWOTENANT.TENANTSTATUS': "iwotenant.TenantStatus", 'KUBERNETES.ACICNIAPIC': "kubernetes.AciCniApic", 'KUBERNETES.ACICNIPROFILE': "kubernetes.AciCniProfile", 'KUBERNETES.ACICNITENANTCLUSTERALLOCATION': "kubernetes.AciCniTenantClusterAllocation", 'KUBERNETES.ADDONDEFINITION': "kubernetes.AddonDefinition", 'KUBERNETES.ADDONPOLICY': "kubernetes.AddonPolicy", 'KUBERNETES.ADDONREPOSITORY': "kubernetes.AddonRepository", 'KUBERNETES.BAREMETALNODEPROFILE': "kubernetes.BaremetalNodeProfile", 'KUBERNETES.CATALOG': "kubernetes.Catalog", 'KUBERNETES.CLUSTER': "kubernetes.Cluster", 'KUBERNETES.CLUSTERADDONPROFILE': "kubernetes.ClusterAddonProfile", 'KUBERNETES.CLUSTERPROFILE': "kubernetes.ClusterProfile", 'KUBERNETES.CONFIGRESULT': "kubernetes.ConfigResult", 'KUBERNETES.CONFIGRESULTENTRY': "kubernetes.ConfigResultEntry", 'KUBERNETES.CONTAINERRUNTIMEPOLICY': "kubernetes.ContainerRuntimePolicy", 'KUBERNETES.DAEMONSET': "kubernetes.DaemonSet", 'KUBERNETES.DEPLOYMENT': "kubernetes.Deployment", 'KUBERNETES.INGRESS': "kubernetes.Ingress", 'KUBERNETES.NETWORKPOLICY': "kubernetes.NetworkPolicy", 'KUBERNETES.NODE': "kubernetes.Node", 'KUBERNETES.NODEGROUPPROFILE': "kubernetes.NodeGroupProfile", 'KUBERNETES.POD': "kubernetes.Pod", 'KUBERNETES.SERVICE': "kubernetes.Service", 'KUBERNETES.STATEFULSET': "kubernetes.StatefulSet", 'KUBERNETES.SYSCONFIGPOLICY': "kubernetes.SysConfigPolicy", 'KUBERNETES.TRUSTEDREGISTRIESPOLICY': "kubernetes.TrustedRegistriesPolicy", 'KUBERNETES.VERSION': "kubernetes.Version", 'KUBERNETES.VERSIONPOLICY': "kubernetes.VersionPolicy", 'KUBERNETES.VIRTUALMACHINEINFRACONFIGPOLICY': "kubernetes.VirtualMachineInfraConfigPolicy", 'KUBERNETES.VIRTUALMACHINEINFRASTRUCTUREPROVIDER': "kubernetes.VirtualMachineInfrastructureProvider", 'KUBERNETES.VIRTUALMACHINEINSTANCETYPE': "kubernetes.VirtualMachineInstanceType", 'KUBERNETES.VIRTUALMACHINENODEPROFILE': "kubernetes.VirtualMachineNodeProfile", 'KVM.POLICY': "kvm.Policy", 'KVM.SESSION': "kvm.Session", 'KVM.TUNNEL': "kvm.Tunnel", 'LICENSE.ACCOUNTLICENSEDATA': "license.AccountLicenseData", 'LICENSE.CUSTOMEROP': "license.CustomerOp", 'LICENSE.IKSCUSTOMEROP': "license.IksCustomerOp", 'LICENSE.IKSLICENSECOUNT': "license.IksLicenseCount", 'LICENSE.IWOCUSTOMEROP': "license.IwoCustomerOp", 'LICENSE.IWOLICENSECOUNT': "license.IwoLicenseCount", 'LICENSE.LICENSEINFO': "license.LicenseInfo", 'LICENSE.LICENSERESERVATIONOP': "license.LicenseReservationOp", 'LICENSE.SMARTLICENSETOKEN': "license.SmartlicenseToken", 'LS.SERVICEPROFILE': "ls.ServiceProfile", 'MACPOOL.IDBLOCK': "macpool.IdBlock", 'MACPOOL.LEASE': "macpool.Lease", 'MACPOOL.POOL': "macpool.Pool", 'MACPOOL.POOLMEMBER': "macpool.PoolMember", 'MACPOOL.UNIVERSE': "macpool.Universe", 'MANAGEMENT.CONTROLLER': "management.Controller", 'MANAGEMENT.ENTITY': "management.Entity", 'MANAGEMENT.INTERFACE': "management.Interface", 'MEMORY.ARRAY': "memory.Array", 'MEMORY.PERSISTENTMEMORYCONFIGRESULT': "memory.PersistentMemoryConfigResult", 'MEMORY.PERSISTENTMEMORYCONFIGURATION': "memory.PersistentMemoryConfiguration", 'MEMORY.PERSISTENTMEMORYNAMESPACE': "memory.PersistentMemoryNamespace", 'MEMORY.PERSISTENTMEMORYNAMESPACECONFIGRESULT': "memory.PersistentMemoryNamespaceConfigResult", 'MEMORY.PERSISTENTMEMORYPOLICY': "memory.PersistentMemoryPolicy", 'MEMORY.PERSISTENTMEMORYREGION': "memory.PersistentMemoryRegion", 'MEMORY.PERSISTENTMEMORYUNIT': "memory.PersistentMemoryUnit", 'MEMORY.UNIT': "memory.Unit", 'META.DEFINITION': "meta.Definition", 'NETWORK.ELEMENT': "network.Element", 'NETWORK.ELEMENTSUMMARY': "network.ElementSummary", 'NETWORK.FCZONEINFO': "network.FcZoneInfo", 'NETWORK.VLANPORTINFO': "network.VlanPortInfo", 'NETWORKCONFIG.POLICY': "networkconfig.Policy", 'NIAAPI.APICCCOPOST': "niaapi.ApicCcoPost", 'NIAAPI.APICFIELDNOTICE': "niaapi.ApicFieldNotice", 'NIAAPI.APICHWEOL': "niaapi.ApicHweol", 'NIAAPI.APICLATESTMAINTAINEDRELEASE': "niaapi.ApicLatestMaintainedRelease", 'NIAAPI.APICRELEASERECOMMEND': "niaapi.ApicReleaseRecommend", 'NIAAPI.APICSWEOL': "niaapi.ApicSweol", 'NIAAPI.DCNMCCOPOST': "niaapi.DcnmCcoPost", 'NIAAPI.DCNMFIELDNOTICE': "niaapi.DcnmFieldNotice", 'NIAAPI.DCNMHWEOL': "niaapi.DcnmHweol", 'NIAAPI.DCNMLATESTMAINTAINEDRELEASE': "niaapi.DcnmLatestMaintainedRelease", 'NIAAPI.DCNMRELEASERECOMMEND': "niaapi.DcnmReleaseRecommend", 'NIAAPI.DCNMSWEOL': "niaapi.DcnmSweol", 'NIAAPI.FILEDOWNLOADER': "niaapi.FileDownloader", 'NIAAPI.NIAMETADATA': "niaapi.NiaMetadata", 'NIAAPI.NIBFILEDOWNLOADER': "niaapi.NibFileDownloader", 'NIAAPI.NIBMETADATA': "niaapi.NibMetadata", 'NIAAPI.VERSIONREGEX': "niaapi.VersionRegex", 'NIATELEMETRY.AAALDAPPROVIDERDETAILS': "niatelemetry.AaaLdapProviderDetails", 'NIATELEMETRY.AAARADIUSPROVIDERDETAILS': "niatelemetry.AaaRadiusProviderDetails", 'NIATELEMETRY.AAATACACSPROVIDERDETAILS': "niatelemetry.AaaTacacsProviderDetails", 'NIATELEMETRY.APICAPPPLUGINDETAILS': "niatelemetry.ApicAppPluginDetails", 'NIATELEMETRY.APICCOREFILEDETAILS': "niatelemetry.ApicCoreFileDetails", 'NIATELEMETRY.APICDBGEXPRSEXPORTDEST': "niatelemetry.ApicDbgexpRsExportDest", 'NIATELEMETRY.APICDBGEXPRSTSSCHEDULER': "niatelemetry.ApicDbgexpRsTsScheduler", 'NIATELEMETRY.APICFANDETAILS': "niatelemetry.ApicFanDetails", 'NIATELEMETRY.APICFEXDETAILS': "niatelemetry.ApicFexDetails", 'NIATELEMETRY.APICFLASHDETAILS': "niatelemetry.ApicFlashDetails", 'NIATELEMETRY.APICNTPAUTH': "niatelemetry.ApicNtpAuth", 'NIATELEMETRY.APICPSUDETAILS': "niatelemetry.ApicPsuDetails", 'NIATELEMETRY.APICREALMDETAILS': "niatelemetry.ApicRealmDetails", 'NIATELEMETRY.APICSNMPCLIENTGRPDETAILS': "niatelemetry.ApicSnmpClientGrpDetails", 'NIATELEMETRY.APICSNMPCOMMUNITYACCESSDETAILS': "niatelemetry.ApicSnmpCommunityAccessDetails", 'NIATELEMETRY.APICSNMPCOMMUNITYDETAILS': "niatelemetry.ApicSnmpCommunityDetails", 'NIATELEMETRY.APICSNMPTRAPDETAILS': "niatelemetry.ApicSnmpTrapDetails", 'NIATELEMETRY.APICSNMPTRAPFWDSERVERDETAILS': "niatelemetry.ApicSnmpTrapFwdServerDetails", 'NIATELEMETRY.APICSNMPVERSIONTHREEDETAILS': "niatelemetry.ApicSnmpVersionThreeDetails", 'NIATELEMETRY.APICSYSLOGGRP': "niatelemetry.ApicSysLogGrp", 'NIATELEMETRY.APICSYSLOGSRC': "niatelemetry.ApicSysLogSrc", 'NIATELEMETRY.APICTRANSCEIVERDETAILS': "niatelemetry.ApicTransceiverDetails", 'NIATELEMETRY.APICUIPAGECOUNTS': "niatelemetry.ApicUiPageCounts", 'NIATELEMETRY.APPDETAILS': "niatelemetry.AppDetails", 'NIATELEMETRY.COMMONPOLICIES': "niatelemetry.CommonPolicies", 'NIATELEMETRY.DCNMFANDETAILS': "niatelemetry.DcnmFanDetails", 'NIATELEMETRY.DCNMFEXDETAILS': "niatelemetry.DcnmFexDetails", 'NIATELEMETRY.DCNMMODULEDETAILS': "niatelemetry.DcnmModuleDetails", 'NIATELEMETRY.DCNMPSUDETAILS': "niatelemetry.DcnmPsuDetails", 'NIATELEMETRY.DCNMTRANSCEIVERDETAILS': "niatelemetry.DcnmTransceiverDetails", 'NIATELEMETRY.EPG': "niatelemetry.Epg", 'NIATELEMETRY.FABRICMODULEDETAILS': "niatelemetry.FabricModuleDetails", 'NIATELEMETRY.FABRICPODPROFILE': "niatelemetry.FabricPodProfile", 'NIATELEMETRY.FABRICPODSS': "niatelemetry.FabricPodSs", 'NIATELEMETRY.FAULT': "niatelemetry.Fault", 'NIATELEMETRY.HTTPSACLCONTRACTDETAILS': "niatelemetry.HttpsAclContractDetails", 'NIATELEMETRY.HTTPSACLCONTRACTFILTERMAP': "niatelemetry.HttpsAclContractFilterMap", 'NIATELEMETRY.HTTPSACLEPGCONTRACTMAP': "niatelemetry.HttpsAclEpgContractMap", 'NIATELEMETRY.HTTPSACLEPGDETAILS': "niatelemetry.HttpsAclEpgDetails", 'NIATELEMETRY.HTTPSACLFILTERDETAILS': "niatelemetry.HttpsAclFilterDetails", 'NIATELEMETRY.LC': "niatelemetry.Lc", 'NIATELEMETRY.MSOCONTRACTDETAILS': "niatelemetry.MsoContractDetails", 'NIATELEMETRY.MSOEPGDETAILS': "niatelemetry.MsoEpgDetails", 'NIATELEMETRY.MSOSCHEMADETAILS': "niatelemetry.MsoSchemaDetails", 'NIATELEMETRY.MSOSITEDETAILS': "niatelemetry.MsoSiteDetails", 'NIATELEMETRY.MSOTENANTDETAILS': "niatelemetry.MsoTenantDetails", 'NIATELEMETRY.NEXUSDASHBOARDCONTROLLERDETAILS': "niatelemetry.NexusDashboardControllerDetails", 'NIATELEMETRY.NEXUSDASHBOARDDETAILS': "niatelemetry.NexusDashboardDetails", 'NIATELEMETRY.NEXUSDASHBOARDMEMORYDETAILS': "niatelemetry.NexusDashboardMemoryDetails", 'NIATELEMETRY.NEXUSDASHBOARDS': "niatelemetry.NexusDashboards", 'NIATELEMETRY.NIAFEATUREUSAGE': "niatelemetry.NiaFeatureUsage", 'NIATELEMETRY.NIAINVENTORY': "niatelemetry.NiaInventory", 'NIATELEMETRY.NIAINVENTORYDCNM': "niatelemetry.NiaInventoryDcnm", 'NIATELEMETRY.NIAINVENTORYFABRIC': "niatelemetry.NiaInventoryFabric", 'NIATELEMETRY.NIALICENSESTATE': "niatelemetry.NiaLicenseState", 'NIATELEMETRY.PASSWORDSTRENGTHCHECK': "niatelemetry.PasswordStrengthCheck", 'NIATELEMETRY.PODCOMMPOLICIES': "niatelemetry.PodCommPolicies", 'NIATELEMETRY.PODSNMPPOLICIES': "niatelemetry.PodSnmpPolicies", 'NIATELEMETRY.PODTIMESERVERPOLICIES': "niatelemetry.PodTimeServerPolicies", 'NIATELEMETRY.SITEINVENTORY': "niatelemetry.SiteInventory", 'NIATELEMETRY.SNMPSRC': "niatelemetry.SnmpSrc", 'NIATELEMETRY.SSHVERSIONTWO': "niatelemetry.SshVersionTwo", 'NIATELEMETRY.SUPERVISORMODULEDETAILS': "niatelemetry.SupervisorModuleDetails", 'NIATELEMETRY.SYSLOGREMOTEDEST': "niatelemetry.SyslogRemoteDest", 'NIATELEMETRY.SYSLOGSYSMSG': "niatelemetry.SyslogSysMsg", 'NIATELEMETRY.SYSLOGSYSMSGFACFILTER': "niatelemetry.SyslogSysMsgFacFilter", 'NIATELEMETRY.SYSTEMCONTROLLERDETAILS': "niatelemetry.SystemControllerDetails", 'NIATELEMETRY.TENANT': "niatelemetry.Tenant", 'NOTIFICATION.ACCOUNTSUBSCRIPTION': "notification.AccountSubscription", 'NTP.POLICY': "ntp.Policy", 'OAUTH.ACCESSTOKEN': "oauth.AccessToken", 'OAUTH.AUTHORIZATION': "oauth.Authorization", 'OPRS.DEPLOYMENT': "oprs.Deployment", 'OPRS.SYNCTARGETLISTMESSAGE': "oprs.SyncTargetListMessage", 'ORGANIZATION.ORGANIZATION': "organization.Organization", 'OS.BULKINSTALLINFO': "os.BulkInstallInfo", 'OS.CATALOG': "os.Catalog", 'OS.CONFIGURATIONFILE': "os.ConfigurationFile", 'OS.DISTRIBUTION': "os.Distribution", 'OS.INSTALL': "os.Install", 'OS.OSSUPPORT': "os.OsSupport", 'OS.SUPPORTEDVERSION': "os.SupportedVersion", 'OS.TEMPLATEFILE': "os.TemplateFile", 'OS.VALIDINSTALLTARGET': "os.ValidInstallTarget", 'PCI.COPROCESSORCARD': "pci.CoprocessorCard", 'PCI.DEVICE': "pci.Device", 'PCI.LINK': "pci.Link", 'PCI.SWITCH': "pci.Switch", 'PORT.GROUP': "port.Group", 'PORT.MACBINDING': "port.MacBinding", 'PORT.SUBGROUP': "port.SubGroup", 'POWER.CONTROLSTATE': "power.ControlState", 'POWER.POLICY': "power.Policy", 'PROCESSOR.UNIT': "processor.Unit", 'RACK.UNITPERSONALITY': "rack.UnitPersonality", 'RECOMMENDATION.CAPACITYRUNWAY': "recommendation.CapacityRunway", 'RECOMMENDATION.PHYSICALITEM': "recommendation.PhysicalItem", 'RECOVERY.BACKUPCONFIGPOLICY': "recovery.BackupConfigPolicy", 'RECOVERY.BACKUPPROFILE': "recovery.BackupProfile", 'RECOVERY.CONFIGRESULT': "recovery.ConfigResult", 'RECOVERY.CONFIGRESULTENTRY': "recovery.ConfigResultEntry", 'RECOVERY.ONDEMANDBACKUP': "recovery.OnDemandBackup", 'RECOVERY.RESTORE': "recovery.Restore", 'RECOVERY.SCHEDULECONFIGPOLICY': "recovery.ScheduleConfigPolicy", 'RESOURCE.GROUP': "resource.Group", 'RESOURCE.GROUPMEMBER': "resource.GroupMember", 'RESOURCE.LICENSERESOURCECOUNT': "resource.LicenseResourceCount", 'RESOURCE.MEMBERSHIP': "resource.Membership", 'RESOURCE.MEMBERSHIPHOLDER': "resource.MembershipHolder", 'RESOURCE.RESERVATION': "resource.Reservation", 'RESOURCEPOOL.LEASE': "resourcepool.Lease", 'RESOURCEPOOL.LEASERESOURCE': "resourcepool.LeaseResource", 'RESOURCEPOOL.POOL': "resourcepool.Pool", 'RESOURCEPOOL.POOLMEMBER': "resourcepool.PoolMember", 'RESOURCEPOOL.UNIVERSE': "resourcepool.Universe", 'RPROXY.REVERSEPROXY': "rproxy.ReverseProxy", 'SDCARD.POLICY': "sdcard.Policy", 'SDWAN.PROFILE': "sdwan.Profile", 'SDWAN.ROUTERNODE': "sdwan.RouterNode", 'SDWAN.ROUTERPOLICY': "sdwan.RouterPolicy", 'SDWAN.VMANAGEACCOUNTPOLICY': "sdwan.VmanageAccountPolicy", 'SEARCH.SEARCHITEM': "search.SearchItem", 'SEARCH.TAGITEM': "search.TagItem", 'SECURITY.UNIT': "security.Unit", 'SERVER.CONFIGCHANGEDETAIL': "server.ConfigChangeDetail", 'SERVER.CONFIGIMPORT': "server.ConfigImport", 'SERVER.CONFIGRESULT': "server.ConfigResult", 'SERVER.CONFIGRESULTENTRY': "server.ConfigResultEntry", 'SERVER.PROFILE': "server.Profile", 'SERVER.PROFILETEMPLATE': "server.ProfileTemplate", 'SMTP.POLICY': "smtp.Policy", 'SNMP.POLICY': "snmp.Policy", 'SOFTWARE.APPLIANCEDISTRIBUTABLE': "software.ApplianceDistributable", 'SOFTWARE.DOWNLOADHISTORY': "software.DownloadHistory", 'SOFTWARE.HCLMETA': "software.HclMeta", 'SOFTWARE.HYPERFLEXBUNDLEDISTRIBUTABLE': "software.HyperflexBundleDistributable", 'SOFTWARE.HYPERFLEXDISTRIBUTABLE': "software.HyperflexDistributable", 'SOFTWARE.RELEASEMETA': "software.ReleaseMeta", 'SOFTWARE.SOLUTIONDISTRIBUTABLE': "software.SolutionDistributable", 'SOFTWARE.UCSDBUNDLEDISTRIBUTABLE': "software.UcsdBundleDistributable", 'SOFTWARE.UCSDDISTRIBUTABLE': "software.UcsdDistributable", 'SOFTWAREREPOSITORY.AUTHORIZATION': "softwarerepository.Authorization", 'SOFTWAREREPOSITORY.CACHEDIMAGE': "softwarerepository.CachedImage", 'SOFTWAREREPOSITORY.CATALOG': "softwarerepository.Catalog", 'SOFTWAREREPOSITORY.CATEGORYMAPPER': "softwarerepository.CategoryMapper", 'SOFTWAREREPOSITORY.CATEGORYMAPPERMODEL': "softwarerepository.CategoryMapperModel", 'SOFTWAREREPOSITORY.CATEGORYSUPPORTCONSTRAINT': "softwarerepository.CategorySupportConstraint", 'SOFTWAREREPOSITORY.DOWNLOADSPEC': "softwarerepository.DownloadSpec", 'SOFTWAREREPOSITORY.OPERATINGSYSTEMFILE': "softwarerepository.OperatingSystemFile", 'SOFTWAREREPOSITORY.RELEASE': "softwarerepository.Release", 'SOL.POLICY': "sol.Policy", 'SSH.POLICY': "ssh.Policy", 'STORAGE.CONTROLLER': "storage.Controller", 'STORAGE.DISKGROUP': "storage.DiskGroup", 'STORAGE.DISKSLOT': "storage.DiskSlot", 'STORAGE.DRIVEGROUP': "storage.DriveGroup", 'STORAGE.ENCLOSURE': "storage.Enclosure", 'STORAGE.ENCLOSUREDISK': "storage.EnclosureDisk", 'STORAGE.ENCLOSUREDISKSLOTEP': "storage.EnclosureDiskSlotEp", 'STORAGE.FLEXFLASHCONTROLLER': "storage.FlexFlashController", 'STORAGE.FLEXFLASHCONTROLLERPROPS': "storage.FlexFlashControllerProps", 'STORAGE.FLEXFLASHPHYSICALDRIVE': "storage.FlexFlashPhysicalDrive", 'STORAGE.FLEXFLASHVIRTUALDRIVE': "storage.FlexFlashVirtualDrive", 'STORAGE.FLEXUTILCONTROLLER': "storage.FlexUtilController", 'STORAGE.FLEXUTILPHYSICALDRIVE': "storage.FlexUtilPhysicalDrive", 'STORAGE.FLEXUTILVIRTUALDRIVE': "storage.FlexUtilVirtualDrive", 'STORAGE.HITACHIARRAY': "storage.HitachiArray", 'STORAGE.HITACHICONTROLLER': "storage.HitachiController", 'STORAGE.HITACHIDISK': "storage.HitachiDisk", 'STORAGE.HITACHIHOST': "storage.HitachiHost", 'STORAGE.HITACHIHOSTLUN': "storage.HitachiHostLun", 'STORAGE.HITACHIPARITYGROUP': "storage.HitachiParityGroup", 'STORAGE.HITACHIPOOL': "storage.HitachiPool", 'STORAGE.HITACHIPORT': "storage.HitachiPort", 'STORAGE.HITACHIVOLUME': "storage.HitachiVolume", 'STORAGE.HYPERFLEXSTORAGECONTAINER': "storage.HyperFlexStorageContainer", 'STORAGE.HYPERFLEXVOLUME': "storage.HyperFlexVolume", 'STORAGE.ITEM': "storage.Item", 'STORAGE.NETAPPAGGREGATE': "storage.NetAppAggregate", 'STORAGE.NETAPPBASEDISK': "storage.NetAppBaseDisk", 'STORAGE.NETAPPCLUSTER': "storage.NetAppCluster", 'STORAGE.NETAPPETHERNETPORT': "storage.NetAppEthernetPort", 'STORAGE.NETAPPEXPORTPOLICY': "storage.NetAppExportPolicy", 'STORAGE.NETAPPFCINTERFACE': "storage.NetAppFcInterface", 'STORAGE.NETAPPFCPORT': "storage.NetAppFcPort", 'STORAGE.NETAPPINITIATORGROUP': "storage.NetAppInitiatorGroup", 'STORAGE.NETAPPIPINTERFACE': "storage.NetAppIpInterface", 'STORAGE.NETAPPLICENSE': "storage.NetAppLicense", 'STORAGE.NETAPPLUN': "storage.NetAppLun", 'STORAGE.NETAPPLUNMAP': "storage.NetAppLunMap", 'STORAGE.NETAPPNODE': "storage.NetAppNode", 'STORAGE.NETAPPNTPSERVER': "storage.NetAppNtpServer", 'STORAGE.NETAPPSENSOR': "storage.NetAppSensor", 'STORAGE.NETAPPSTORAGEVM': "storage.NetAppStorageVm", 'STORAGE.NETAPPVOLUME': "storage.NetAppVolume", 'STORAGE.NETAPPVOLUMESNAPSHOT': "storage.NetAppVolumeSnapshot", 'STORAGE.PHYSICALDISK': "storage.PhysicalDisk", 'STORAGE.PHYSICALDISKEXTENSION': "storage.PhysicalDiskExtension", 'STORAGE.PHYSICALDISKUSAGE': "storage.PhysicalDiskUsage", 'STORAGE.PUREARRAY': "storage.PureArray", 'STORAGE.PURECONTROLLER': "storage.PureController", 'STORAGE.PUREDISK': "storage.PureDisk", 'STORAGE.PUREHOST': "storage.PureHost", 'STORAGE.PUREHOSTGROUP': "storage.PureHostGroup", 'STORAGE.PUREHOSTLUN': "storage.PureHostLun", 'STORAGE.PUREPORT': "storage.PurePort", 'STORAGE.PUREPROTECTIONGROUP': "storage.PureProtectionGroup", 'STORAGE.PUREPROTECTIONGROUPSNAPSHOT': "storage.PureProtectionGroupSnapshot", 'STORAGE.PUREREPLICATIONSCHEDULE': "storage.PureReplicationSchedule", 'STORAGE.PURESNAPSHOTSCHEDULE': "storage.PureSnapshotSchedule", 'STORAGE.PUREVOLUME': "storage.PureVolume", 'STORAGE.PUREVOLUMESNAPSHOT': "storage.PureVolumeSnapshot", 'STORAGE.SASEXPANDER': "storage.SasExpander", 'STORAGE.SASPORT': "storage.SasPort", 'STORAGE.SPAN': "storage.Span", 'STORAGE.STORAGEPOLICY': "storage.StoragePolicy", 'STORAGE.VDMEMBEREP': "storage.VdMemberEp", 'STORAGE.VIRTUALDRIVE': "storage.VirtualDrive", 'STORAGE.VIRTUALDRIVECONTAINER': "storage.VirtualDriveContainer", 'STORAGE.VIRTUALDRIVEEXTENSION': "storage.VirtualDriveExtension", 'STORAGE.VIRTUALDRIVEIDENTITY': "storage.VirtualDriveIdentity", 'SYSLOG.POLICY': "syslog.Policy", 'TAM.ADVISORYCOUNT': "tam.AdvisoryCount", 'TAM.ADVISORYDEFINITION': "tam.AdvisoryDefinition", 'TAM.ADVISORYINFO': "tam.AdvisoryInfo", 'TAM.ADVISORYINSTANCE': "tam.AdvisoryInstance", 'TAM.SECURITYADVISORY': "tam.SecurityAdvisory", 'TASK.HITACHISCOPEDINVENTORY': "task.HitachiScopedInventory", 'TASK.HYPERFLEXSCOPEDINVENTORY': "task.HyperflexScopedInventory", 'TASK.IWESCOPEDINVENTORY': "task.IweScopedInventory", 'TASK.NETAPPSCOPEDINVENTORY': "task.NetAppScopedInventory", 'TASK.PUBLICCLOUDSCOPEDINVENTORY': "task.PublicCloudScopedInventory", 'TASK.PURESCOPEDINVENTORY': "task.PureScopedInventory", 'TASK.SERVERSCOPEDINVENTORY': "task.ServerScopedInventory", 'TECHSUPPORTMANAGEMENT.COLLECTIONCONTROLPOLICY': "techsupportmanagement.CollectionControlPolicy", 'TECHSUPPORTMANAGEMENT.DOWNLOAD': "techsupportmanagement.Download", 'TECHSUPPORTMANAGEMENT.TECHSUPPORTBUNDLE': "techsupportmanagement.TechSupportBundle", 'TECHSUPPORTMANAGEMENT.TECHSUPPORTSTATUS': "techsupportmanagement.TechSupportStatus", 'TERMINAL.AUDITLOG': "terminal.AuditLog", 'TERRAFORM.EXECUTOR': "terraform.Executor", 'THERMAL.POLICY': "thermal.Policy", 'TOP.SYSTEM': "top.System", 'UCSD.BACKUPINFO': "ucsd.BackupInfo", 'UUIDPOOL.BLOCK': "uuidpool.Block", 'UUIDPOOL.POOL': "uuidpool.Pool", 'UUIDPOOL.POOLMEMBER': "uuidpool.PoolMember", 'UUIDPOOL.UNIVERSE': "uuidpool.Universe", 'UUIDPOOL.UUIDLEASE': "uuidpool.UuidLease", 'VIRTUALIZATION.CISCOHYPERVISORMANAGER': "virtualization.CiscoHypervisorManager", 'VIRTUALIZATION.ESXICONSOLE': "virtualization.EsxiConsole", 'VIRTUALIZATION.HOST': "virtualization.Host", 'VIRTUALIZATION.IWECLUSTER': "virtualization.IweCluster", 'VIRTUALIZATION.IWEDATACENTER': "virtualization.IweDatacenter", 'VIRTUALIZATION.IWEDVUPLINK': "virtualization.IweDvUplink", 'VIRTUALIZATION.IWEDVSWITCH': "virtualization.IweDvswitch", 'VIRTUALIZATION.IWEHOST': "virtualization.IweHost", 'VIRTUALIZATION.IWEHOSTINTERFACE': "virtualization.IweHostInterface", 'VIRTUALIZATION.IWEHOSTVSWITCH': "virtualization.IweHostVswitch", 'VIRTUALIZATION.IWENETWORK': "virtualization.IweNetwork", 'VIRTUALIZATION.IWEVIRTUALDISK': "virtualization.IweVirtualDisk", 'VIRTUALIZATION.IWEVIRTUALMACHINE': "virtualization.IweVirtualMachine", 'VIRTUALIZATION.IWEVIRTUALMACHINENETWORKINTERFACE': "virtualization.IweVirtualMachineNetworkInterface", 'VIRTUALIZATION.VIRTUALDISK': "virtualization.VirtualDisk", 'VIRTUALIZATION.VIRTUALMACHINE': "virtualization.VirtualMachine", 'VIRTUALIZATION.VIRTUALNETWORK': "virtualization.VirtualNetwork", 'VIRTUALIZATION.VMWARECLUSTER': "virtualization.VmwareCluster", 'VIRTUALIZATION.VMWAREDATACENTER': "virtualization.VmwareDatacenter", 'VIRTUALIZATION.VMWAREDATASTORE': "virtualization.VmwareDatastore", 'VIRTUALIZATION.VMWAREDATASTORECLUSTER': "virtualization.VmwareDatastoreCluster", 'VIRTUALIZATION.VMWAREDISTRIBUTEDNETWORK': "virtualization.VmwareDistributedNetwork", 'VIRTUALIZATION.VMWAREDISTRIBUTEDSWITCH': "virtualization.VmwareDistributedSwitch", 'VIRTUALIZATION.VMWAREFOLDER': "virtualization.VmwareFolder", 'VIRTUALIZATION.VMWAREHOST': "virtualization.VmwareHost", 'VIRTUALIZATION.VMWAREKERNELNETWORK': "virtualization.VmwareKernelNetwork", 'VIRTUALIZATION.VMWARENETWORK': "virtualization.VmwareNetwork", 'VIRTUALIZATION.VMWAREPHYSICALNETWORKINTERFACE': "virtualization.VmwarePhysicalNetworkInterface", 'VIRTUALIZATION.VMWAREUPLINKPORT': "virtualization.VmwareUplinkPort", 'VIRTUALIZATION.VMWAREVCENTER': "virtualization.VmwareVcenter", 'VIRTUALIZATION.VMWAREVIRTUALDISK': "virtualization.VmwareVirtualDisk", 'VIRTUALIZATION.VMWAREVIRTUALMACHINE': "virtualization.VmwareVirtualMachine", 'VIRTUALIZATION.VMWAREVIRTUALMACHINESNAPSHOT': "virtualization.VmwareVirtualMachineSnapshot", 'VIRTUALIZATION.VMWAREVIRTUALNETWORKINTERFACE': "virtualization.VmwareVirtualNetworkInterface", 'VIRTUALIZATION.VMWAREVIRTUALSWITCH': "virtualization.VmwareVirtualSwitch", 'VMEDIA.POLICY': "vmedia.Policy", 'VMRC.CONSOLE': "vmrc.Console", 'VNC.CONSOLE': "vnc.Console", 'VNIC.ETHADAPTERPOLICY': "vnic.EthAdapterPolicy", 'VNIC.ETHIF': "vnic.EthIf", 'VNIC.ETHNETWORKPOLICY': "vnic.EthNetworkPolicy", 'VNIC.ETHQOSPOLICY': "vnic.EthQosPolicy", 'VNIC.FCADAPTERPOLICY': "vnic.FcAdapterPolicy", 'VNIC.FCIF': "vnic.FcIf", 'VNIC.FCNETWORKPOLICY': "vnic.FcNetworkPolicy", 'VNIC.FCQOSPOLICY': "vnic.FcQosPolicy", 'VNIC.ISCSIADAPTERPOLICY': "vnic.IscsiAdapterPolicy", 'VNIC.ISCSIBOOTPOLICY': "vnic.IscsiBootPolicy", 'VNIC.ISCSISTATICTARGETPOLICY': "vnic.IscsiStaticTargetPolicy", 'VNIC.LANCONNECTIVITYPOLICY': "vnic.LanConnectivityPolicy", 'VNIC.LCPSTATUS': "vnic.LcpStatus", 'VNIC.SANCONNECTIVITYPOLICY': "vnic.SanConnectivityPolicy", 'VNIC.SCPSTATUS': "vnic.ScpStatus", 'VRF.VRF': "vrf.Vrf", 'WORKFLOW.ANSIBLEBATCHEXECUTOR': "workflow.AnsibleBatchExecutor", 'WORKFLOW.BATCHAPIEXECUTOR': "workflow.BatchApiExecutor", 'WORKFLOW.BUILDTASKMETA': "workflow.BuildTaskMeta", 'WORKFLOW.BUILDTASKMETAOWNER': "workflow.BuildTaskMetaOwner", 'WORKFLOW.CATALOG': "workflow.Catalog", 'WORKFLOW.CUSTOMDATATYPEDEFINITION': "workflow.CustomDataTypeDefinition", 'WORKFLOW.ERRORRESPONSEHANDLER': "workflow.ErrorResponseHandler", 'WORKFLOW.PENDINGDYNAMICWORKFLOWINFO': "workflow.PendingDynamicWorkflowInfo", 'WORKFLOW.ROLLBACKWORKFLOW': "workflow.RollbackWorkflow", 'WORKFLOW.SOLUTIONACTIONDEFINITION': "workflow.SolutionActionDefinition", 'WORKFLOW.SOLUTIONACTIONINSTANCE': "workflow.SolutionActionInstance", 'WORKFLOW.SOLUTIONDEFINITION': "workflow.SolutionDefinition", 'WORKFLOW.SOLUTIONINSTANCE': "workflow.SolutionInstance", 'WORKFLOW.SOLUTIONOUTPUT': "workflow.SolutionOutput", 'WORKFLOW.SSHBATCHEXECUTOR': "workflow.SshBatchExecutor", 'WORKFLOW.TASKDEBUGLOG': "workflow.TaskDebugLog", 'WORKFLOW.TASKDEFINITION': "workflow.TaskDefinition", 'WORKFLOW.TASKINFO': "workflow.TaskInfo", 'WORKFLOW.TASKMETADATA': "workflow.TaskMetadata", 'WORKFLOW.TASKNOTIFICATION': "workflow.TaskNotification", 'WORKFLOW.TEMPLATEEVALUATION': "workflow.TemplateEvaluation", 'WORKFLOW.TEMPLATEFUNCTIONMETA': "workflow.TemplateFunctionMeta", 'WORKFLOW.WORKFLOWDEFINITION': "workflow.WorkflowDefinition", 'WORKFLOW.WORKFLOWINFO': "workflow.WorkflowInfo", 'WORKFLOW.WORKFLOWMETA': "workflow.WorkflowMeta", 'WORKFLOW.WORKFLOWMETADATA': "workflow.WorkflowMetadata", 'WORKFLOW.WORKFLOWNOTIFICATION': "workflow.WorkflowNotification", }, } validations = { ('uuid',): { 'regex': { 'pattern': r'^$|^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{12}$', }, }, } @cached_property def additional_properties_type(): lazy_import() return (bool, date, datetime, dict, float, int, list, str, none_type,) _nullable = False @cached_property def openapi_types(): lazy_import() return { 'class_id': (str,), 'moid': (str,), 'selector': (str,), 'link': (str,), 'account_moid': (str,), 'create_time': (datetime,), 'domain_group_moid': (str,), 'mod_time': (datetime,), 'owners': ([str], none_type,), 'shared_scope': (str,), 'tags': ([MoTag], none_type,), 'version_context': (MoVersionContext,), 'ancestors': ([MoBaseMoRelationship], none_type,), 'parent': (MoBaseMoRelationship,), 'permission_resources': ([MoBaseMoRelationship], none_type,), 'display_names': (DisplayNames,), 'registered_device': (AssetDeviceRegistrationRelationship,), 'name': (str,), 'uuid': (str,), 'identity': (str,), 'cluster_count': (int,), 'datastore_count': (int,), 'host_count': (int,), 'inventory_path': (str,), 'network_count': (int,), 'vm_count': (int,), 'vm_template_count': (int,), 'hypervisor_manager': (VirtualizationVmwareVcenterRelationship,), 'parent_folder': (VirtualizationVmwareFolderRelationship,), 'object_type': (str,), } @cached_property def discriminator(): lazy_import() val = { 'mo.MoRef': MoMoRef, 'virtualization.VmwareDatacenter': VirtualizationVmwareDatacenter, } if not val: return None return {'class_id': val} attribute_map = { 'class_id': 'ClassId', 'moid': 'Moid', 'selector': 'Selector', 'link': 'link', 'account_moid': 'AccountMoid', 'create_time': 'CreateTime', 'domain_group_moid': 'DomainGroupMoid', 'mod_time': 'ModTime', 'owners': 'Owners', 'shared_scope': 'SharedScope', 'tags': 'Tags', 'version_context': 'VersionContext', 'ancestors': 'Ancestors', 'parent': 'Parent', 'permission_resources': 'PermissionResources', 'display_names': 'DisplayNames', 'registered_device': 'RegisteredDevice', 'name': 'Name', 'uuid': 'Uuid', 'identity': 'Identity', 'cluster_count': 'ClusterCount', 'datastore_count': 'DatastoreCount', 'host_count': 'HostCount', 'inventory_path': 'InventoryPath', 'network_count': 'NetworkCount', 'vm_count': 'VmCount', 'vm_template_count': 'VmTemplateCount', 'hypervisor_manager': 'HypervisorManager', 'parent_folder': 'ParentFolder', 'object_type': 'ObjectType', } required_properties = set([ '_data_store', '_check_type', '_spec_property_naming', '_path_to_item', '_configuration', '_visited_composed_classes', '_composed_instances', '_var_name_to_model_instances', '_additional_properties_model_instances', ]) @convert_js_args_to_python_args def __init__(self, *args, **kwargs): class_id = kwargs.get('class_id', "mo.MoRef") _check_type = kwargs.pop('_check_type', True) _spec_property_naming = kwargs.pop('_spec_property_naming', False) _path_to_item = kwargs.pop('_path_to_item', ()) _configuration = kwargs.pop('_configuration', None) _visited_composed_classes = kwargs.pop('_visited_composed_classes', ()) if args: raise ApiTypeError( "Invalid positional arguments=%s passed to %s. Remove those invalid positional arguments." % ( args, self.__class__.__name__, ), path_to_item=_path_to_item, valid_classes=(self.__class__,), ) self._data_store = {} self._check_type = _check_type self._spec_property_naming = _spec_property_naming self._path_to_item = _path_to_item self._configuration = _configuration self._visited_composed_classes = _visited_composed_classes + (self.__class__,) constant_args = { '_check_type': _check_type, '_path_to_item': _path_to_item, '_spec_property_naming': _spec_property_naming, '_configuration': _configuration, '_visited_composed_classes': self._visited_composed_classes, } required_args = { 'class_id': class_id, } model_args = {} model_args.update(required_args) model_args.update(kwargs) composed_info = validate_get_composed_info( constant_args, model_args, self) self._composed_instances = composed_info[0] self._var_name_to_model_instances = composed_info[1] self._additional_properties_model_instances = composed_info[2] unused_args = composed_info[3] for var_name, var_value in required_args.items(): setattr(self, var_name, var_value) for var_name, var_value in kwargs.items(): if var_name in unused_args and \ self._configuration is not None and \ self._configuration.discard_unknown_keys and \ not self._additional_properties_model_instances: continue setattr(self, var_name, var_value) @cached_property def _composed_schemas(): # loading lazy_import() return { 'anyOf': [ ], 'allOf': [ ], 'oneOf': [ MoMoRef, VirtualizationVmwareDatacenter, none_type, ], }
true
true
1c455fa5c65ef452e853463256b07757be1b7bac
41,048
py
Python
lib/matplotlib/lines.py
SoftwareDev/mat-plot-lib
abaf94859d5ef6e653a4d8a7ce2c59cea1724a57
[ "MIT", "BSD-3-Clause" ]
3
2015-02-25T21:51:26.000Z
2020-01-05T14:11:52.000Z
lib/matplotlib/lines.py
SoftwareDev/mat-plot-lib
abaf94859d5ef6e653a4d8a7ce2c59cea1724a57
[ "MIT", "BSD-3-Clause" ]
7
2015-05-08T19:36:25.000Z
2015-06-30T15:32:17.000Z
lib/matplotlib/lines.py
OceanWolf/matplotlib
a429c415bdb6e54ccfe004a48fdc034ea8e9d329
[ "MIT", "BSD-3-Clause" ]
6
2015-06-05T03:34:06.000Z
2022-01-25T09:07:10.000Z
""" This module contains all the 2D line class which can draw with a variety of line styles, markers and colors. """ # TODO: expose cap and join style attrs from __future__ import (absolute_import, division, print_function, unicode_literals) import six import warnings import numpy as np from numpy import ma from matplotlib import verbose from . import artist from .artist import Artist from .cbook import iterable, is_string_like, is_numlike, ls_mapper from .colors import colorConverter from .path import Path from .transforms import Bbox, TransformedPath, IdentityTransform from matplotlib import rcParams from .artist import allow_rasterization from matplotlib import docstring from matplotlib.markers import MarkerStyle # Imported here for backward compatibility, even though they don't # really belong. from matplotlib.markers import TICKLEFT, TICKRIGHT, TICKUP, TICKDOWN from matplotlib.markers import CARETLEFT, CARETRIGHT, CARETUP, CARETDOWN def segment_hits(cx, cy, x, y, radius): """ Determine if any line segments are within radius of a point. Returns the list of line segments that are within that radius. """ # Process single points specially if len(x) < 2: res, = np.nonzero((cx - x) ** 2 + (cy - y) ** 2 <= radius ** 2) return res # We need to lop the last element off a lot. xr, yr = x[:-1], y[:-1] # Only look at line segments whose nearest point to C on the line # lies within the segment. dx, dy = x[1:] - xr, y[1:] - yr Lnorm_sq = dx ** 2 + dy ** 2 # Possibly want to eliminate Lnorm==0 u = ((cx - xr) * dx + (cy - yr) * dy) / Lnorm_sq candidates = (u >= 0) & (u <= 1) #if any(candidates): print "candidates",xr[candidates] # Note that there is a little area near one side of each point # which will be near neither segment, and another which will # be near both, depending on the angle of the lines. The # following radius test eliminates these ambiguities. point_hits = (cx - x) ** 2 + (cy - y) ** 2 <= radius ** 2 #if any(point_hits): print "points",xr[candidates] candidates = candidates & ~(point_hits[:-1] | point_hits[1:]) # For those candidates which remain, determine how far they lie away # from the line. px, py = xr + u * dx, yr + u * dy line_hits = (cx - px) ** 2 + (cy - py) ** 2 <= radius ** 2 #if any(line_hits): print "lines",xr[candidates] line_hits = line_hits & candidates points, = point_hits.ravel().nonzero() lines, = line_hits.ravel().nonzero() #print points,lines return np.concatenate((points, lines)) class Line2D(Artist): """ A line - the line can have both a solid linestyle connecting all the vertices, and a marker at each vertex. Additionally, the drawing of the solid line is influenced by the drawstyle, eg one can create "stepped" lines in various styles. """ lineStyles = _lineStyles = { # hidden names deprecated '-': '_draw_solid', '--': '_draw_dashed', '-.': '_draw_dash_dot', ':': '_draw_dotted', 'None': '_draw_nothing', ' ': '_draw_nothing', '': '_draw_nothing', } _drawStyles_l = { 'default': '_draw_lines', 'steps-mid': '_draw_steps_mid', 'steps-pre': '_draw_steps_pre', 'steps-post': '_draw_steps_post', } _drawStyles_s = { 'steps': '_draw_steps_pre', } drawStyles = {} drawStyles.update(_drawStyles_l) drawStyles.update(_drawStyles_s) # Need a list ordered with long names first: drawStyleKeys = (list(six.iterkeys(_drawStyles_l)) + list(six.iterkeys(_drawStyles_s))) # Referenced here to maintain API. These are defined in # MarkerStyle markers = MarkerStyle.markers filled_markers = MarkerStyle.filled_markers fillStyles = MarkerStyle.fillstyles zorder = 2 validCap = ('butt', 'round', 'projecting') validJoin = ('miter', 'round', 'bevel') def __str__(self): if self._label != "": return "Line2D(%s)" % (self._label) elif hasattr(self, '_x') and len(self._x) > 3: return "Line2D((%g,%g),(%g,%g),...,(%g,%g))"\ % (self._x[0], self._y[0], self._x[0], self._y[0], self._x[-1], self._y[-1]) elif hasattr(self, '_x'): return "Line2D(%s)"\ % (",".join(["(%g,%g)" % (x, y) for x, y in zip(self._x, self._y)])) else: return "Line2D()" def __init__(self, xdata, ydata, linewidth=None, # all Nones default to rc linestyle=None, color=None, marker=None, markersize=None, markeredgewidth=None, markeredgecolor=None, markerfacecolor=None, markerfacecoloralt='none', fillstyle='full', antialiased=None, dash_capstyle=None, solid_capstyle=None, dash_joinstyle=None, solid_joinstyle=None, pickradius=5, drawstyle=None, markevery=None, **kwargs ): """ Create a :class:`~matplotlib.lines.Line2D` instance with *x* and *y* data in sequences *xdata*, *ydata*. The kwargs are :class:`~matplotlib.lines.Line2D` properties: %(Line2D)s See :meth:`set_linestyle` for a decription of the line styles, :meth:`set_marker` for a description of the markers, and :meth:`set_drawstyle` for a description of the draw styles. """ Artist.__init__(self) #convert sequences to numpy arrays if not iterable(xdata): raise RuntimeError('xdata must be a sequence') if not iterable(ydata): raise RuntimeError('ydata must be a sequence') if linewidth is None: linewidth = rcParams['lines.linewidth'] if linestyle is None: linestyle = rcParams['lines.linestyle'] if marker is None: marker = rcParams['lines.marker'] if color is None: color = rcParams['lines.color'] if markersize is None: markersize = rcParams['lines.markersize'] if antialiased is None: antialiased = rcParams['lines.antialiased'] if dash_capstyle is None: dash_capstyle = rcParams['lines.dash_capstyle'] if dash_joinstyle is None: dash_joinstyle = rcParams['lines.dash_joinstyle'] if solid_capstyle is None: solid_capstyle = rcParams['lines.solid_capstyle'] if solid_joinstyle is None: solid_joinstyle = rcParams['lines.solid_joinstyle'] if drawstyle is None: drawstyle = 'default' self.set_dash_capstyle(dash_capstyle) self.set_dash_joinstyle(dash_joinstyle) self.set_solid_capstyle(solid_capstyle) self.set_solid_joinstyle(solid_joinstyle) self.set_linestyle(linestyle) self.set_drawstyle(drawstyle) self.set_linewidth(linewidth) self.set_color(color) self._marker = MarkerStyle() self.set_marker(marker) self.set_markevery(markevery) self.set_antialiased(antialiased) self.set_markersize(markersize) self._dashSeq = None self.set_markerfacecolor(markerfacecolor) self.set_markerfacecoloralt(markerfacecoloralt) self.set_markeredgecolor(markeredgecolor) self.set_markeredgewidth(markeredgewidth) self.set_fillstyle(fillstyle) self.verticalOffset = None # update kwargs before updating data to give the caller a # chance to init axes (and hence unit support) self.update(kwargs) self.pickradius = pickradius self.ind_offset = 0 if is_numlike(self._picker): self.pickradius = self._picker self._xorig = np.asarray([]) self._yorig = np.asarray([]) self._invalidx = True self._invalidy = True self.set_data(xdata, ydata) def contains(self, mouseevent): """ Test whether the mouse event occurred on the line. The pick radius determines the precision of the location test (usually within five points of the value). Use :meth:`~matplotlib.lines.Line2D.get_pickradius` or :meth:`~matplotlib.lines.Line2D.set_pickradius` to view or modify it. Returns *True* if any values are within the radius along with ``{'ind': pointlist}``, where *pointlist* is the set of points within the radius. TODO: sort returned indices by distance """ if six.callable(self._contains): return self._contains(self, mouseevent) if not is_numlike(self.pickradius): raise ValueError("pick radius should be a distance") # Make sure we have data to plot if self._invalidy or self._invalidx: self.recache() if len(self._xy) == 0: return False, {} # Convert points to pixels transformed_path = self._get_transformed_path() path, affine = transformed_path.get_transformed_path_and_affine() path = affine.transform_path(path) xy = path.vertices xt = xy[:, 0] yt = xy[:, 1] # Convert pick radius from points to pixels if self.figure is None: warnings.warn('no figure set when check if mouse is on line') pixels = self.pickradius else: pixels = self.figure.dpi / 72. * self.pickradius # the math involved in checking for containment (here and inside of # segment_hits) assumes that it is OK to overflow. In case the # application has set the error flags such that an exception is raised # on overflow, we temporarily set the appropriate error flags here and # set them back when we are finished. olderrflags = np.seterr(all='ignore') try: # Check for collision if self._linestyle in ['None', None]: # If no line, return the nearby point(s) d = (xt - mouseevent.x) ** 2 + (yt - mouseevent.y) ** 2 ind, = np.nonzero(np.less_equal(d, pixels ** 2)) else: # If line, return the nearby segment(s) ind = segment_hits(mouseevent.x, mouseevent.y, xt, yt, pixels) finally: np.seterr(**olderrflags) ind += self.ind_offset # Debugging message if False and self._label != '': print("Checking line", self._label, "at", mouseevent.x, mouseevent.y) print('xt', xt) print('yt', yt) #print 'dx,dy', (xt-mouseevent.x)**2., (yt-mouseevent.y)**2. print('ind', ind) # Return the point(s) within radius return len(ind) > 0, dict(ind=ind) def get_pickradius(self): """return the pick radius used for containment tests""" return self.pickradius def set_pickradius(self, d): """Sets the pick radius used for containment tests ACCEPTS: float distance in points """ self.pickradius = d def get_fillstyle(self): """ return the marker fillstyle """ return self._marker.get_fillstyle() def set_fillstyle(self, fs): """ Set the marker fill style; 'full' means fill the whole marker. 'none' means no filling; other options are for half-filled markers. ACCEPTS: ['full' | 'left' | 'right' | 'bottom' | 'top' | 'none'] """ self._marker.set_fillstyle(fs) def set_markevery(self, every): """ Set the markevery property to subsample the plot when using markers. e.g., if ``markevery=5``, every 5-th marker will be plotted. *every* can be None Every point will be plotted an integer N Every N-th marker will be plotted starting with marker 0 A length-2 tuple of integers every=(start, N) will start at point start and plot every N-th marker ACCEPTS: None | integer | (startind, stride) """ self._markevery = every def get_markevery(self): """return the markevery setting""" return self._markevery def set_picker(self, p): """Sets the event picker details for the line. ACCEPTS: float distance in points or callable pick function ``fn(artist, event)`` """ if six.callable(p): self._contains = p else: self.pickradius = p self._picker = p def get_window_extent(self, renderer): bbox = Bbox([[0, 0], [0, 0]]) trans_data_to_xy = self.get_transform().transform bbox.update_from_data_xy(trans_data_to_xy(self.get_xydata()), ignore=True) # correct for marker size, if any if self._marker: ms = (self._markersize / 72.0 * self.figure.dpi) * 0.5 bbox = bbox.padded(ms) return bbox def set_axes(self, ax): Artist.set_axes(self, ax) if ax.xaxis is not None: self._xcid = ax.xaxis.callbacks.connect('units', self.recache_always) if ax.yaxis is not None: self._ycid = ax.yaxis.callbacks.connect('units', self.recache_always) set_axes.__doc__ = Artist.set_axes.__doc__ def set_data(self, *args): """ Set the x and y data ACCEPTS: 2D array (rows are x, y) or two 1D arrays """ if len(args) == 1: x, y = args[0] else: x, y = args self.set_xdata(x) self.set_ydata(y) def recache_always(self): self.recache(always=True) def recache(self, always=False): if always or self._invalidx: xconv = self.convert_xunits(self._xorig) if ma.isMaskedArray(self._xorig): x = ma.asarray(xconv, np.float_) else: x = np.asarray(xconv, np.float_) x = x.ravel() else: x = self._x if always or self._invalidy: yconv = self.convert_yunits(self._yorig) if ma.isMaskedArray(self._yorig): y = ma.asarray(yconv, np.float_) else: y = np.asarray(yconv, np.float_) y = y.ravel() else: y = self._y if len(x) == 1 and len(y) > 1: x = x * np.ones(y.shape, np.float_) if len(y) == 1 and len(x) > 1: y = y * np.ones(x.shape, np.float_) if len(x) != len(y): raise RuntimeError('xdata and ydata must be the same length') x = x.reshape((len(x), 1)) y = y.reshape((len(y), 1)) if ma.isMaskedArray(x) or ma.isMaskedArray(y): self._xy = ma.concatenate((x, y), 1) else: self._xy = np.concatenate((x, y), 1) self._x = self._xy[:, 0] # just a view self._y = self._xy[:, 1] # just a view self._subslice = False if (self.axes and len(x) > 100 and self._is_sorted(x) and self.axes.name == 'rectilinear' and self.axes.get_xscale() == 'linear' and self._markevery is None and self.get_clip_on() is True): self._subslice = True if hasattr(self, '_path'): interpolation_steps = self._path._interpolation_steps else: interpolation_steps = 1 self._path = Path(self._xy, None, interpolation_steps) self._transformed_path = None self._invalidx = False self._invalidy = False def _transform_path(self, subslice=None): """ Puts a TransformedPath instance at self._transformed_path, all invalidation of the transform is then handled by the TransformedPath instance. """ # Masked arrays are now handled by the Path class itself if subslice is not None: _path = Path(self._xy[subslice, :]) else: _path = self._path self._transformed_path = TransformedPath(_path, self.get_transform()) def _get_transformed_path(self): """ Return the :class:`~matplotlib.transforms.TransformedPath` instance of this line. """ if self._transformed_path is None: self._transform_path() return self._transformed_path def set_transform(self, t): """ set the Transformation instance used by this artist ACCEPTS: a :class:`matplotlib.transforms.Transform` instance """ Artist.set_transform(self, t) self._invalidx = True self._invalidy = True def _is_sorted(self, x): """return true if x is sorted""" if len(x) < 2: return 1 return np.amin(x[1:] - x[0:-1]) >= 0 @allow_rasterization def draw(self, renderer): """draw the Line with `renderer` unless visibility is False""" if not self.get_visible(): return if self._invalidy or self._invalidx: self.recache() self.ind_offset = 0 # Needed for contains() method. if self._subslice and self.axes: # Need to handle monotonically decreasing case also... x0, x1 = self.axes.get_xbound() i0, = self._x.searchsorted([x0], 'left') i1, = self._x.searchsorted([x1], 'right') subslice = slice(max(i0 - 1, 0), i1 + 1) self.ind_offset = subslice.start self._transform_path(subslice) transf_path = self._get_transformed_path() if self.get_path_effects(): from matplotlib.patheffects import PathEffectRenderer renderer = PathEffectRenderer(self.get_path_effects(), renderer) renderer.open_group('line2d', self.get_gid()) gc = renderer.new_gc() self._set_gc_clip(gc) ln_color_rgba = self._get_rgba_ln_color() gc.set_foreground(ln_color_rgba, isRGBA=True) gc.set_alpha(ln_color_rgba[3]) gc.set_antialiased(self._antialiased) gc.set_linewidth(self._linewidth) if self.is_dashed(): cap = self._dashcapstyle join = self._dashjoinstyle else: cap = self._solidcapstyle join = self._solidjoinstyle gc.set_joinstyle(join) gc.set_capstyle(cap) gc.set_snap(self.get_snap()) if self.get_sketch_params() is not None: gc.set_sketch_params(*self.get_sketch_params()) funcname = self._lineStyles.get(self._linestyle, '_draw_nothing') if funcname != '_draw_nothing': tpath, affine = transf_path.get_transformed_path_and_affine() if len(tpath.vertices): self._lineFunc = getattr(self, funcname) funcname = self.drawStyles.get(self._drawstyle, '_draw_lines') drawFunc = getattr(self, funcname) drawFunc(renderer, gc, tpath, affine.frozen()) if self._marker: gc = renderer.new_gc() self._set_gc_clip(gc) rgbaFace = self._get_rgba_face() rgbaFaceAlt = self._get_rgba_face(alt=True) edgecolor = self.get_markeredgecolor() if is_string_like(edgecolor) and edgecolor.lower() == 'none': gc.set_linewidth(0) gc.set_foreground(rgbaFace, isRGBA=True) else: gc.set_foreground(edgecolor) gc.set_linewidth(self._markeredgewidth) marker = self._marker tpath, affine = transf_path.get_transformed_points_and_affine() if len(tpath.vertices): # subsample the markers if markevery is not None markevery = self.get_markevery() if markevery is not None: if iterable(markevery): startind, stride = markevery else: startind, stride = 0, markevery if tpath.codes is not None: codes = tpath.codes[startind::stride] else: codes = None vertices = tpath.vertices[startind::stride] subsampled = Path(vertices, codes) else: subsampled = tpath snap = marker.get_snap_threshold() if type(snap) == float: snap = renderer.points_to_pixels(self._markersize) >= snap gc.set_snap(snap) gc.set_joinstyle(marker.get_joinstyle()) gc.set_capstyle(marker.get_capstyle()) marker_path = marker.get_path() marker_trans = marker.get_transform() w = renderer.points_to_pixels(self._markersize) if marker.get_marker() != ',': # Don't scale for pixels, and don't stroke them marker_trans = marker_trans.scale(w) else: gc.set_linewidth(0) if rgbaFace is not None: gc.set_alpha(rgbaFace[3]) renderer.draw_markers(gc, marker_path, marker_trans, subsampled, affine.frozen(), rgbaFace) alt_marker_path = marker.get_alt_path() if alt_marker_path: if rgbaFaceAlt is not None: gc.set_alpha(rgbaFaceAlt[3]) alt_marker_trans = marker.get_alt_transform() alt_marker_trans = alt_marker_trans.scale(w) renderer.draw_markers( gc, alt_marker_path, alt_marker_trans, subsampled, affine.frozen(), rgbaFaceAlt) gc.restore() gc.restore() renderer.close_group('line2d') def get_antialiased(self): return self._antialiased def get_color(self): return self._color def get_drawstyle(self): return self._drawstyle def get_linestyle(self): return self._linestyle def get_linewidth(self): return self._linewidth def get_marker(self): return self._marker.get_marker() def get_markeredgecolor(self): mec = self._markeredgecolor if (is_string_like(mec) and mec == 'auto'): if self._marker.get_marker() in ('.', ','): return self._color if self._marker.is_filled() and self.get_fillstyle() != 'none': return 'k' # Bad hard-wired default... else: return self._color else: return mec def get_markeredgewidth(self): return self._markeredgewidth def _get_markerfacecolor(self, alt=False): if alt: fc = self._markerfacecoloralt else: fc = self._markerfacecolor if (is_string_like(fc) and fc.lower() == 'auto'): if self.get_fillstyle() == 'none': return 'none' else: return self._color else: return fc def get_markerfacecolor(self): return self._get_markerfacecolor(alt=False) def get_markerfacecoloralt(self): return self._get_markerfacecolor(alt=True) def get_markersize(self): return self._markersize def get_data(self, orig=True): """ Return the xdata, ydata. If *orig* is *True*, return the original data. """ return self.get_xdata(orig=orig), self.get_ydata(orig=orig) def get_xdata(self, orig=True): """ Return the xdata. If *orig* is *True*, return the original data, else the processed data. """ if orig: return self._xorig if self._invalidx: self.recache() return self._x def get_ydata(self, orig=True): """ Return the ydata. If *orig* is *True*, return the original data, else the processed data. """ if orig: return self._yorig if self._invalidy: self.recache() return self._y def get_path(self): """ Return the :class:`~matplotlib.path.Path` object associated with this line. """ if self._invalidy or self._invalidx: self.recache() return self._path def get_xydata(self): """ Return the *xy* data as a Nx2 numpy array. """ if self._invalidy or self._invalidx: self.recache() return self._xy def set_antialiased(self, b): """ True if line should be drawin with antialiased rendering ACCEPTS: [True | False] """ self._antialiased = b def set_color(self, color): """ Set the color of the line ACCEPTS: any matplotlib color """ self._color = color def set_drawstyle(self, drawstyle): """ Set the drawstyle of the plot 'default' connects the points with lines. The steps variants produce step-plots. 'steps' is equivalent to 'steps-pre' and is maintained for backward-compatibility. ACCEPTS: ['default' | 'steps' | 'steps-pre' | 'steps-mid' | 'steps-post'] """ self._drawstyle = drawstyle def set_linewidth(self, w): """ Set the line width in points ACCEPTS: float value in points """ self._linewidth = w def set_linestyle(self, linestyle): """ Set the linestyle of the line (also accepts drawstyles) ================ ================= linestyle description ================ ================= ``'-'`` solid ``'--'`` dashed ``'-.'`` dash_dot ``':'`` dotted ``'None'`` draw nothing ``' '`` draw nothing ``''`` draw nothing ================ ================= 'steps' is equivalent to 'steps-pre' and is maintained for backward-compatibility. .. seealso:: :meth:`set_drawstyle` To set the drawing style (stepping) of the plot. ACCEPTS: [``'-'`` | ``'--'`` | ``'-.'`` | ``':'`` | ``'None'`` | ``' '`` | ``''``] and any drawstyle in combination with a linestyle, e.g., ``'steps--'``. """ for ds in self.drawStyleKeys: # long names are first in the list if linestyle.startswith(ds): self.set_drawstyle(ds) if len(linestyle) > len(ds): linestyle = linestyle[len(ds):] else: linestyle = '-' break if linestyle not in self._lineStyles: if linestyle in ls_mapper: linestyle = ls_mapper[linestyle] else: verbose.report('Unrecognized line style %s, %s' % (linestyle, type(linestyle))) if linestyle in [' ', '']: linestyle = 'None' self._linestyle = linestyle @docstring.dedent_interpd def set_marker(self, marker): """ Set the line marker Parameters ----------- marker: marker style See `~matplotlib.markers` for full description of possible argument """ self._marker.set_marker(marker) def set_markeredgecolor(self, ec): """ Set the marker edge color ACCEPTS: any matplotlib color """ if ec is None: ec = 'auto' self._markeredgecolor = ec def set_markeredgewidth(self, ew): """ Set the marker edge width in points ACCEPTS: float value in points """ if ew is None: ew = rcParams['lines.markeredgewidth'] self._markeredgewidth = ew def set_markerfacecolor(self, fc): """ Set the marker face color. ACCEPTS: any matplotlib color """ if fc is None: fc = 'auto' self._markerfacecolor = fc def set_markerfacecoloralt(self, fc): """ Set the alternate marker face color. ACCEPTS: any matplotlib color """ if fc is None: fc = 'auto' self._markerfacecoloralt = fc def set_markersize(self, sz): """ Set the marker size in points ACCEPTS: float """ self._markersize = sz def set_xdata(self, x): """ Set the data np.array for x ACCEPTS: 1D array """ self._xorig = x self._invalidx = True def set_ydata(self, y): """ Set the data np.array for y ACCEPTS: 1D array """ self._yorig = y self._invalidy = True def set_dashes(self, seq): """ Set the dash sequence, sequence of dashes with on off ink in points. If seq is empty or if seq = (None, None), the linestyle will be set to solid. ACCEPTS: sequence of on/off ink in points """ if seq == (None, None) or len(seq) == 0: self.set_linestyle('-') else: self.set_linestyle('--') self._dashSeq = seq # TODO: offset ignored for now def _draw_lines(self, renderer, gc, path, trans): self._lineFunc(renderer, gc, path, trans) def _draw_steps_pre(self, renderer, gc, path, trans): vertices = self._xy steps = ma.zeros((2 * len(vertices) - 1, 2), np.float_) steps[0::2, 0], steps[1::2, 0] = vertices[:, 0], vertices[:-1, 0] steps[0::2, 1], steps[1:-1:2, 1] = vertices[:, 1], vertices[1:, 1] path = Path(steps) path = path.transformed(self.get_transform()) self._lineFunc(renderer, gc, path, IdentityTransform()) def _draw_steps_post(self, renderer, gc, path, trans): vertices = self._xy steps = ma.zeros((2 * len(vertices) - 1, 2), np.float_) steps[::2, 0], steps[1:-1:2, 0] = vertices[:, 0], vertices[1:, 0] steps[0::2, 1], steps[1::2, 1] = vertices[:, 1], vertices[:-1, 1] path = Path(steps) path = path.transformed(self.get_transform()) self._lineFunc(renderer, gc, path, IdentityTransform()) def _draw_steps_mid(self, renderer, gc, path, trans): vertices = self._xy steps = ma.zeros((2 * len(vertices), 2), np.float_) steps[1:-1:2, 0] = 0.5 * (vertices[:-1, 0] + vertices[1:, 0]) steps[2::2, 0] = 0.5 * (vertices[:-1, 0] + vertices[1:, 0]) steps[0, 0] = vertices[0, 0] steps[-1, 0] = vertices[-1, 0] steps[0::2, 1], steps[1::2, 1] = vertices[:, 1], vertices[:, 1] path = Path(steps) path = path.transformed(self.get_transform()) self._lineFunc(renderer, gc, path, IdentityTransform()) def _draw_solid(self, renderer, gc, path, trans): gc.set_linestyle('solid') renderer.draw_path(gc, path, trans) def _draw_dashed(self, renderer, gc, path, trans): gc.set_linestyle('dashed') if self._dashSeq is not None: gc.set_dashes(0, self._dashSeq) renderer.draw_path(gc, path, trans) def _draw_dash_dot(self, renderer, gc, path, trans): gc.set_linestyle('dashdot') renderer.draw_path(gc, path, trans) def _draw_dotted(self, renderer, gc, path, trans): gc.set_linestyle('dotted') renderer.draw_path(gc, path, trans) def update_from(self, other): """copy properties from other to self""" Artist.update_from(self, other) self._linestyle = other._linestyle self._linewidth = other._linewidth self._color = other._color self._markersize = other._markersize self._markerfacecolor = other._markerfacecolor self._markerfacecoloralt = other._markerfacecoloralt self._markeredgecolor = other._markeredgecolor self._markeredgewidth = other._markeredgewidth self._dashSeq = other._dashSeq self._dashcapstyle = other._dashcapstyle self._dashjoinstyle = other._dashjoinstyle self._solidcapstyle = other._solidcapstyle self._solidjoinstyle = other._solidjoinstyle self._linestyle = other._linestyle self._marker = MarkerStyle(other._marker.get_marker(), other._marker.get_fillstyle()) self._drawstyle = other._drawstyle def _get_rgb_face(self, alt=False): facecolor = self._get_markerfacecolor(alt=alt) if is_string_like(facecolor) and facecolor.lower() == 'none': rgbFace = None else: rgbFace = colorConverter.to_rgb(facecolor) return rgbFace def _get_rgba_face(self, alt=False): facecolor = self._get_markerfacecolor(alt=alt) if is_string_like(facecolor) and facecolor.lower() == 'none': rgbaFace = None else: rgbaFace = colorConverter.to_rgba(facecolor, self._alpha) return rgbaFace def _get_rgba_ln_color(self, alt=False): return colorConverter.to_rgba(self._color, self._alpha) # some aliases.... def set_aa(self, val): 'alias for set_antialiased' self.set_antialiased(val) def set_c(self, val): 'alias for set_color' self.set_color(val) def set_ls(self, val): """alias for set_linestyle""" self.set_linestyle(val) def set_lw(self, val): """alias for set_linewidth""" self.set_linewidth(val) def set_mec(self, val): """alias for set_markeredgecolor""" self.set_markeredgecolor(val) def set_mew(self, val): """alias for set_markeredgewidth""" self.set_markeredgewidth(val) def set_mfc(self, val): """alias for set_markerfacecolor""" self.set_markerfacecolor(val) def set_mfcalt(self, val): """alias for set_markerfacecoloralt""" self.set_markerfacecoloralt(val) def set_ms(self, val): """alias for set_markersize""" self.set_markersize(val) def get_aa(self): """alias for get_antialiased""" return self.get_antialiased() def get_c(self): """alias for get_color""" return self.get_color() def get_ls(self): """alias for get_linestyle""" return self.get_linestyle() def get_lw(self): """alias for get_linewidth""" return self.get_linewidth() def get_mec(self): """alias for get_markeredgecolor""" return self.get_markeredgecolor() def get_mew(self): """alias for get_markeredgewidth""" return self.get_markeredgewidth() def get_mfc(self): """alias for get_markerfacecolor""" return self.get_markerfacecolor() def get_mfcalt(self, alt=False): """alias for get_markerfacecoloralt""" return self.get_markerfacecoloralt() def get_ms(self): """alias for get_markersize""" return self.get_markersize() def set_dash_joinstyle(self, s): """ Set the join style for dashed linestyles ACCEPTS: ['miter' | 'round' | 'bevel'] """ s = s.lower() if s not in self.validJoin: raise ValueError('set_dash_joinstyle passed "%s";\n' % (s,) + 'valid joinstyles are %s' % (self.validJoin,)) self._dashjoinstyle = s def set_solid_joinstyle(self, s): """ Set the join style for solid linestyles ACCEPTS: ['miter' | 'round' | 'bevel'] """ s = s.lower() if s not in self.validJoin: raise ValueError('set_solid_joinstyle passed "%s";\n' % (s,) + 'valid joinstyles are %s' % (self.validJoin,)) self._solidjoinstyle = s def get_dash_joinstyle(self): """ Get the join style for dashed linestyles """ return self._dashjoinstyle def get_solid_joinstyle(self): """ Get the join style for solid linestyles """ return self._solidjoinstyle def set_dash_capstyle(self, s): """ Set the cap style for dashed linestyles ACCEPTS: ['butt' | 'round' | 'projecting'] """ s = s.lower() if s not in self.validCap: raise ValueError('set_dash_capstyle passed "%s";\n' % (s,) + 'valid capstyles are %s' % (self.validCap,)) self._dashcapstyle = s def set_solid_capstyle(self, s): """ Set the cap style for solid linestyles ACCEPTS: ['butt' | 'round' | 'projecting'] """ s = s.lower() if s not in self.validCap: raise ValueError('set_solid_capstyle passed "%s";\n' % (s,) + 'valid capstyles are %s' % (self.validCap,)) self._solidcapstyle = s def get_dash_capstyle(self): """ Get the cap style for dashed linestyles """ return self._dashcapstyle def get_solid_capstyle(self): """ Get the cap style for solid linestyles """ return self._solidcapstyle def is_dashed(self): 'return True if line is dashstyle' return self._linestyle in ('--', '-.', ':') class VertexSelector: """ Manage the callbacks to maintain a list of selected vertices for :class:`matplotlib.lines.Line2D`. Derived classes should override :meth:`~matplotlib.lines.VertexSelector.process_selected` to do something with the picks. Here is an example which highlights the selected verts with red circles:: import numpy as np import matplotlib.pyplot as plt import matplotlib.lines as lines class HighlightSelected(lines.VertexSelector): def __init__(self, line, fmt='ro', **kwargs): lines.VertexSelector.__init__(self, line) self.markers, = self.axes.plot([], [], fmt, **kwargs) def process_selected(self, ind, xs, ys): self.markers.set_data(xs, ys) self.canvas.draw() fig = plt.figure() ax = fig.add_subplot(111) x, y = np.random.rand(2, 30) line, = ax.plot(x, y, 'bs-', picker=5) selector = HighlightSelected(line) plt.show() """ def __init__(self, line): """ Initialize the class with a :class:`matplotlib.lines.Line2D` instance. The line should already be added to some :class:`matplotlib.axes.Axes` instance and should have the picker property set. """ if not hasattr(line, 'axes'): raise RuntimeError('You must first add the line to the Axes') if line.get_picker() is None: raise RuntimeError('You must first set the picker property ' 'of the line') self.axes = line.axes self.line = line self.canvas = self.axes.figure.canvas self.cid = self.canvas.mpl_connect('pick_event', self.onpick) self.ind = set() def process_selected(self, ind, xs, ys): """ Default "do nothing" implementation of the :meth:`process_selected` method. *ind* are the indices of the selected vertices. *xs* and *ys* are the coordinates of the selected vertices. """ pass def onpick(self, event): """When the line is picked, update the set of selected indicies.""" if event.artist is not self.line: return for i in event.ind: if i in self.ind: self.ind.remove(i) else: self.ind.add(i) ind = list(self.ind) ind.sort() xdata, ydata = self.line.get_data() self.process_selected(ind, xdata[ind], ydata[ind]) lineStyles = Line2D._lineStyles lineMarkers = MarkerStyle.markers drawStyles = Line2D.drawStyles fillStyles = MarkerStyle.fillstyles docstring.interpd.update(Line2D=artist.kwdoc(Line2D)) # You can not set the docstring of an instancemethod, # but you can on the underlying function. Go figure. docstring.dedent_interpd(Line2D.__init__)
32.474684
79
0.568018
from __future__ import (absolute_import, division, print_function, unicode_literals) import six import warnings import numpy as np from numpy import ma from matplotlib import verbose from . import artist from .artist import Artist from .cbook import iterable, is_string_like, is_numlike, ls_mapper from .colors import colorConverter from .path import Path from .transforms import Bbox, TransformedPath, IdentityTransform from matplotlib import rcParams from .artist import allow_rasterization from matplotlib import docstring from matplotlib.markers import MarkerStyle # really belong. from matplotlib.markers import TICKLEFT, TICKRIGHT, TICKUP, TICKDOWN from matplotlib.markers import CARETLEFT, CARETRIGHT, CARETUP, CARETDOWN def segment_hits(cx, cy, x, y, radius): # Process single points specially if len(x) < 2: res, = np.nonzero((cx - x) ** 2 + (cy - y) ** 2 <= radius ** 2) return res # We need to lop the last element off a lot. xr, yr = x[:-1], y[:-1] # Only look at line segments whose nearest point to C on the line # lies within the segment. dx, dy = x[1:] - xr, y[1:] - yr Lnorm_sq = dx ** 2 + dy ** 2 # Possibly want to eliminate Lnorm==0 u = ((cx - xr) * dx + (cy - yr) * dy) / Lnorm_sq candidates = (u >= 0) & (u <= 1) #if any(candidates): print "candidates",xr[candidates] # Note that there is a little area near one side of each point # which will be near neither segment, and another which will # be near both, depending on the angle of the lines. The # following radius test eliminates these ambiguities. point_hits = (cx - x) ** 2 + (cy - y) ** 2 <= radius ** 2 #if any(point_hits): print "points",xr[candidates] candidates = candidates & ~(point_hits[:-1] | point_hits[1:]) # For those candidates which remain, determine how far they lie away # from the line. px, py = xr + u * dx, yr + u * dy line_hits = (cx - px) ** 2 + (cy - py) ** 2 <= radius ** 2 #if any(line_hits): print "lines",xr[candidates] line_hits = line_hits & candidates points, = point_hits.ravel().nonzero() lines, = line_hits.ravel().nonzero() #print points,lines return np.concatenate((points, lines)) class Line2D(Artist): lineStyles = _lineStyles = { # hidden names deprecated '-': '_draw_solid', '--': '_draw_dashed', '-.': '_draw_dash_dot', ':': '_draw_dotted', 'None': '_draw_nothing', ' ': '_draw_nothing', '': '_draw_nothing', } _drawStyles_l = { 'default': '_draw_lines', 'steps-mid': '_draw_steps_mid', 'steps-pre': '_draw_steps_pre', 'steps-post': '_draw_steps_post', } _drawStyles_s = { 'steps': '_draw_steps_pre', } drawStyles = {} drawStyles.update(_drawStyles_l) drawStyles.update(_drawStyles_s) # Need a list ordered with long names first: drawStyleKeys = (list(six.iterkeys(_drawStyles_l)) + list(six.iterkeys(_drawStyles_s))) # Referenced here to maintain API. These are defined in # MarkerStyle markers = MarkerStyle.markers filled_markers = MarkerStyle.filled_markers fillStyles = MarkerStyle.fillstyles zorder = 2 validCap = ('butt', 'round', 'projecting') validJoin = ('miter', 'round', 'bevel') def __str__(self): if self._label != "": return "Line2D(%s)" % (self._label) elif hasattr(self, '_x') and len(self._x) > 3: return "Line2D((%g,%g),(%g,%g),...,(%g,%g))"\ % (self._x[0], self._y[0], self._x[0], self._y[0], self._x[-1], self._y[-1]) elif hasattr(self, '_x'): return "Line2D(%s)"\ % (",".join(["(%g,%g)" % (x, y) for x, y in zip(self._x, self._y)])) else: return "Line2D()" def __init__(self, xdata, ydata, linewidth=None, # all Nones default to rc linestyle=None, color=None, marker=None, markersize=None, markeredgewidth=None, markeredgecolor=None, markerfacecolor=None, markerfacecoloralt='none', fillstyle='full', antialiased=None, dash_capstyle=None, solid_capstyle=None, dash_joinstyle=None, solid_joinstyle=None, pickradius=5, drawstyle=None, markevery=None, **kwargs ): Artist.__init__(self) #convert sequences to numpy arrays if not iterable(xdata): raise RuntimeError('xdata must be a sequence') if not iterable(ydata): raise RuntimeError('ydata must be a sequence') if linewidth is None: linewidth = rcParams['lines.linewidth'] if linestyle is None: linestyle = rcParams['lines.linestyle'] if marker is None: marker = rcParams['lines.marker'] if color is None: color = rcParams['lines.color'] if markersize is None: markersize = rcParams['lines.markersize'] if antialiased is None: antialiased = rcParams['lines.antialiased'] if dash_capstyle is None: dash_capstyle = rcParams['lines.dash_capstyle'] if dash_joinstyle is None: dash_joinstyle = rcParams['lines.dash_joinstyle'] if solid_capstyle is None: solid_capstyle = rcParams['lines.solid_capstyle'] if solid_joinstyle is None: solid_joinstyle = rcParams['lines.solid_joinstyle'] if drawstyle is None: drawstyle = 'default' self.set_dash_capstyle(dash_capstyle) self.set_dash_joinstyle(dash_joinstyle) self.set_solid_capstyle(solid_capstyle) self.set_solid_joinstyle(solid_joinstyle) self.set_linestyle(linestyle) self.set_drawstyle(drawstyle) self.set_linewidth(linewidth) self.set_color(color) self._marker = MarkerStyle() self.set_marker(marker) self.set_markevery(markevery) self.set_antialiased(antialiased) self.set_markersize(markersize) self._dashSeq = None self.set_markerfacecolor(markerfacecolor) self.set_markerfacecoloralt(markerfacecoloralt) self.set_markeredgecolor(markeredgecolor) self.set_markeredgewidth(markeredgewidth) self.set_fillstyle(fillstyle) self.verticalOffset = None # update kwargs before updating data to give the caller a # chance to init axes (and hence unit support) self.update(kwargs) self.pickradius = pickradius self.ind_offset = 0 if is_numlike(self._picker): self.pickradius = self._picker self._xorig = np.asarray([]) self._yorig = np.asarray([]) self._invalidx = True self._invalidy = True self.set_data(xdata, ydata) def contains(self, mouseevent): if six.callable(self._contains): return self._contains(self, mouseevent) if not is_numlike(self.pickradius): raise ValueError("pick radius should be a distance") # Make sure we have data to plot if self._invalidy or self._invalidx: self.recache() if len(self._xy) == 0: return False, {} # Convert points to pixels transformed_path = self._get_transformed_path() path, affine = transformed_path.get_transformed_path_and_affine() path = affine.transform_path(path) xy = path.vertices xt = xy[:, 0] yt = xy[:, 1] # Convert pick radius from points to pixels if self.figure is None: warnings.warn('no figure set when check if mouse is on line') pixels = self.pickradius else: pixels = self.figure.dpi / 72. * self.pickradius # the math involved in checking for containment (here and inside of # segment_hits) assumes that it is OK to overflow. In case the # application has set the error flags such that an exception is raised # on overflow, we temporarily set the appropriate error flags here and # set them back when we are finished. olderrflags = np.seterr(all='ignore') try: # Check for collision if self._linestyle in ['None', None]: # If no line, return the nearby point(s) d = (xt - mouseevent.x) ** 2 + (yt - mouseevent.y) ** 2 ind, = np.nonzero(np.less_equal(d, pixels ** 2)) else: # If line, return the nearby segment(s) ind = segment_hits(mouseevent.x, mouseevent.y, xt, yt, pixels) finally: np.seterr(**olderrflags) ind += self.ind_offset # Debugging message if False and self._label != '': print("Checking line", self._label, "at", mouseevent.x, mouseevent.y) print('xt', xt) print('yt', yt) #print 'dx,dy', (xt-mouseevent.x)**2., (yt-mouseevent.y)**2. print('ind', ind) # Return the point(s) within radius return len(ind) > 0, dict(ind=ind) def get_pickradius(self): return self.pickradius def set_pickradius(self, d): self.pickradius = d def get_fillstyle(self): return self._marker.get_fillstyle() def set_fillstyle(self, fs): self._marker.set_fillstyle(fs) def set_markevery(self, every): self._markevery = every def get_markevery(self): return self._markevery def set_picker(self, p): if six.callable(p): self._contains = p else: self.pickradius = p self._picker = p def get_window_extent(self, renderer): bbox = Bbox([[0, 0], [0, 0]]) trans_data_to_xy = self.get_transform().transform bbox.update_from_data_xy(trans_data_to_xy(self.get_xydata()), ignore=True) # correct for marker size, if any if self._marker: ms = (self._markersize / 72.0 * self.figure.dpi) * 0.5 bbox = bbox.padded(ms) return bbox def set_axes(self, ax): Artist.set_axes(self, ax) if ax.xaxis is not None: self._xcid = ax.xaxis.callbacks.connect('units', self.recache_always) if ax.yaxis is not None: self._ycid = ax.yaxis.callbacks.connect('units', self.recache_always) set_axes.__doc__ = Artist.set_axes.__doc__ def set_data(self, *args): if len(args) == 1: x, y = args[0] else: x, y = args self.set_xdata(x) self.set_ydata(y) def recache_always(self): self.recache(always=True) def recache(self, always=False): if always or self._invalidx: xconv = self.convert_xunits(self._xorig) if ma.isMaskedArray(self._xorig): x = ma.asarray(xconv, np.float_) else: x = np.asarray(xconv, np.float_) x = x.ravel() else: x = self._x if always or self._invalidy: yconv = self.convert_yunits(self._yorig) if ma.isMaskedArray(self._yorig): y = ma.asarray(yconv, np.float_) else: y = np.asarray(yconv, np.float_) y = y.ravel() else: y = self._y if len(x) == 1 and len(y) > 1: x = x * np.ones(y.shape, np.float_) if len(y) == 1 and len(x) > 1: y = y * np.ones(x.shape, np.float_) if len(x) != len(y): raise RuntimeError('xdata and ydata must be the same length') x = x.reshape((len(x), 1)) y = y.reshape((len(y), 1)) if ma.isMaskedArray(x) or ma.isMaskedArray(y): self._xy = ma.concatenate((x, y), 1) else: self._xy = np.concatenate((x, y), 1) self._x = self._xy[:, 0] # just a view self._y = self._xy[:, 1] # just a view self._subslice = False if (self.axes and len(x) > 100 and self._is_sorted(x) and self.axes.name == 'rectilinear' and self.axes.get_xscale() == 'linear' and self._markevery is None and self.get_clip_on() is True): self._subslice = True if hasattr(self, '_path'): interpolation_steps = self._path._interpolation_steps else: interpolation_steps = 1 self._path = Path(self._xy, None, interpolation_steps) self._transformed_path = None self._invalidx = False self._invalidy = False def _transform_path(self, subslice=None): # Masked arrays are now handled by the Path class itself if subslice is not None: _path = Path(self._xy[subslice, :]) else: _path = self._path self._transformed_path = TransformedPath(_path, self.get_transform()) def _get_transformed_path(self): if self._transformed_path is None: self._transform_path() return self._transformed_path def set_transform(self, t): Artist.set_transform(self, t) self._invalidx = True self._invalidy = True def _is_sorted(self, x): if len(x) < 2: return 1 return np.amin(x[1:] - x[0:-1]) >= 0 @allow_rasterization def draw(self, renderer): if not self.get_visible(): return if self._invalidy or self._invalidx: self.recache() self.ind_offset = 0 # Needed for contains() method. if self._subslice and self.axes: # Need to handle monotonically decreasing case also... x0, x1 = self.axes.get_xbound() i0, = self._x.searchsorted([x0], 'left') i1, = self._x.searchsorted([x1], 'right') subslice = slice(max(i0 - 1, 0), i1 + 1) self.ind_offset = subslice.start self._transform_path(subslice) transf_path = self._get_transformed_path() if self.get_path_effects(): from matplotlib.patheffects import PathEffectRenderer renderer = PathEffectRenderer(self.get_path_effects(), renderer) renderer.open_group('line2d', self.get_gid()) gc = renderer.new_gc() self._set_gc_clip(gc) ln_color_rgba = self._get_rgba_ln_color() gc.set_foreground(ln_color_rgba, isRGBA=True) gc.set_alpha(ln_color_rgba[3]) gc.set_antialiased(self._antialiased) gc.set_linewidth(self._linewidth) if self.is_dashed(): cap = self._dashcapstyle join = self._dashjoinstyle else: cap = self._solidcapstyle join = self._solidjoinstyle gc.set_joinstyle(join) gc.set_capstyle(cap) gc.set_snap(self.get_snap()) if self.get_sketch_params() is not None: gc.set_sketch_params(*self.get_sketch_params()) funcname = self._lineStyles.get(self._linestyle, '_draw_nothing') if funcname != '_draw_nothing': tpath, affine = transf_path.get_transformed_path_and_affine() if len(tpath.vertices): self._lineFunc = getattr(self, funcname) funcname = self.drawStyles.get(self._drawstyle, '_draw_lines') drawFunc = getattr(self, funcname) drawFunc(renderer, gc, tpath, affine.frozen()) if self._marker: gc = renderer.new_gc() self._set_gc_clip(gc) rgbaFace = self._get_rgba_face() rgbaFaceAlt = self._get_rgba_face(alt=True) edgecolor = self.get_markeredgecolor() if is_string_like(edgecolor) and edgecolor.lower() == 'none': gc.set_linewidth(0) gc.set_foreground(rgbaFace, isRGBA=True) else: gc.set_foreground(edgecolor) gc.set_linewidth(self._markeredgewidth) marker = self._marker tpath, affine = transf_path.get_transformed_points_and_affine() if len(tpath.vertices): # subsample the markers if markevery is not None markevery = self.get_markevery() if markevery is not None: if iterable(markevery): startind, stride = markevery else: startind, stride = 0, markevery if tpath.codes is not None: codes = tpath.codes[startind::stride] else: codes = None vertices = tpath.vertices[startind::stride] subsampled = Path(vertices, codes) else: subsampled = tpath snap = marker.get_snap_threshold() if type(snap) == float: snap = renderer.points_to_pixels(self._markersize) >= snap gc.set_snap(snap) gc.set_joinstyle(marker.get_joinstyle()) gc.set_capstyle(marker.get_capstyle()) marker_path = marker.get_path() marker_trans = marker.get_transform() w = renderer.points_to_pixels(self._markersize) if marker.get_marker() != ',': # Don't scale for pixels, and don't stroke them marker_trans = marker_trans.scale(w) else: gc.set_linewidth(0) if rgbaFace is not None: gc.set_alpha(rgbaFace[3]) renderer.draw_markers(gc, marker_path, marker_trans, subsampled, affine.frozen(), rgbaFace) alt_marker_path = marker.get_alt_path() if alt_marker_path: if rgbaFaceAlt is not None: gc.set_alpha(rgbaFaceAlt[3]) alt_marker_trans = marker.get_alt_transform() alt_marker_trans = alt_marker_trans.scale(w) renderer.draw_markers( gc, alt_marker_path, alt_marker_trans, subsampled, affine.frozen(), rgbaFaceAlt) gc.restore() gc.restore() renderer.close_group('line2d') def get_antialiased(self): return self._antialiased def get_color(self): return self._color def get_drawstyle(self): return self._drawstyle def get_linestyle(self): return self._linestyle def get_linewidth(self): return self._linewidth def get_marker(self): return self._marker.get_marker() def get_markeredgecolor(self): mec = self._markeredgecolor if (is_string_like(mec) and mec == 'auto'): if self._marker.get_marker() in ('.', ','): return self._color if self._marker.is_filled() and self.get_fillstyle() != 'none': return 'k' # Bad hard-wired default... else: return self._color else: return mec def get_markeredgewidth(self): return self._markeredgewidth def _get_markerfacecolor(self, alt=False): if alt: fc = self._markerfacecoloralt else: fc = self._markerfacecolor if (is_string_like(fc) and fc.lower() == 'auto'): if self.get_fillstyle() == 'none': return 'none' else: return self._color else: return fc def get_markerfacecolor(self): return self._get_markerfacecolor(alt=False) def get_markerfacecoloralt(self): return self._get_markerfacecolor(alt=True) def get_markersize(self): return self._markersize def get_data(self, orig=True): return self.get_xdata(orig=orig), self.get_ydata(orig=orig) def get_xdata(self, orig=True): if orig: return self._xorig if self._invalidx: self.recache() return self._x def get_ydata(self, orig=True): if orig: return self._yorig if self._invalidy: self.recache() return self._y def get_path(self): if self._invalidy or self._invalidx: self.recache() return self._path def get_xydata(self): if self._invalidy or self._invalidx: self.recache() return self._xy def set_antialiased(self, b): self._antialiased = b def set_color(self, color): self._color = color def set_drawstyle(self, drawstyle): self._drawstyle = drawstyle def set_linewidth(self, w): self._linewidth = w def set_linestyle(self, linestyle): for ds in self.drawStyleKeys: # long names are first in the list if linestyle.startswith(ds): self.set_drawstyle(ds) if len(linestyle) > len(ds): linestyle = linestyle[len(ds):] else: linestyle = '-' break if linestyle not in self._lineStyles: if linestyle in ls_mapper: linestyle = ls_mapper[linestyle] else: verbose.report('Unrecognized line style %s, %s' % (linestyle, type(linestyle))) if linestyle in [' ', '']: linestyle = 'None' self._linestyle = linestyle @docstring.dedent_interpd def set_marker(self, marker): self._marker.set_marker(marker) def set_markeredgecolor(self, ec): if ec is None: ec = 'auto' self._markeredgecolor = ec def set_markeredgewidth(self, ew): if ew is None: ew = rcParams['lines.markeredgewidth'] self._markeredgewidth = ew def set_markerfacecolor(self, fc): if fc is None: fc = 'auto' self._markerfacecolor = fc def set_markerfacecoloralt(self, fc): if fc is None: fc = 'auto' self._markerfacecoloralt = fc def set_markersize(self, sz): self._markersize = sz def set_xdata(self, x): self._xorig = x self._invalidx = True def set_ydata(self, y): self._yorig = y self._invalidy = True def set_dashes(self, seq): if seq == (None, None) or len(seq) == 0: self.set_linestyle('-') else: self.set_linestyle('--') self._dashSeq = seq # TODO: offset ignored for now def _draw_lines(self, renderer, gc, path, trans): self._lineFunc(renderer, gc, path, trans) def _draw_steps_pre(self, renderer, gc, path, trans): vertices = self._xy steps = ma.zeros((2 * len(vertices) - 1, 2), np.float_) steps[0::2, 0], steps[1::2, 0] = vertices[:, 0], vertices[:-1, 0] steps[0::2, 1], steps[1:-1:2, 1] = vertices[:, 1], vertices[1:, 1] path = Path(steps) path = path.transformed(self.get_transform()) self._lineFunc(renderer, gc, path, IdentityTransform()) def _draw_steps_post(self, renderer, gc, path, trans): vertices = self._xy steps = ma.zeros((2 * len(vertices) - 1, 2), np.float_) steps[::2, 0], steps[1:-1:2, 0] = vertices[:, 0], vertices[1:, 0] steps[0::2, 1], steps[1::2, 1] = vertices[:, 1], vertices[:-1, 1] path = Path(steps) path = path.transformed(self.get_transform()) self._lineFunc(renderer, gc, path, IdentityTransform()) def _draw_steps_mid(self, renderer, gc, path, trans): vertices = self._xy steps = ma.zeros((2 * len(vertices), 2), np.float_) steps[1:-1:2, 0] = 0.5 * (vertices[:-1, 0] + vertices[1:, 0]) steps[2::2, 0] = 0.5 * (vertices[:-1, 0] + vertices[1:, 0]) steps[0, 0] = vertices[0, 0] steps[-1, 0] = vertices[-1, 0] steps[0::2, 1], steps[1::2, 1] = vertices[:, 1], vertices[:, 1] path = Path(steps) path = path.transformed(self.get_transform()) self._lineFunc(renderer, gc, path, IdentityTransform()) def _draw_solid(self, renderer, gc, path, trans): gc.set_linestyle('solid') renderer.draw_path(gc, path, trans) def _draw_dashed(self, renderer, gc, path, trans): gc.set_linestyle('dashed') if self._dashSeq is not None: gc.set_dashes(0, self._dashSeq) renderer.draw_path(gc, path, trans) def _draw_dash_dot(self, renderer, gc, path, trans): gc.set_linestyle('dashdot') renderer.draw_path(gc, path, trans) def _draw_dotted(self, renderer, gc, path, trans): gc.set_linestyle('dotted') renderer.draw_path(gc, path, trans) def update_from(self, other): Artist.update_from(self, other) self._linestyle = other._linestyle self._linewidth = other._linewidth self._color = other._color self._markersize = other._markersize self._markerfacecolor = other._markerfacecolor self._markerfacecoloralt = other._markerfacecoloralt self._markeredgecolor = other._markeredgecolor self._markeredgewidth = other._markeredgewidth self._dashSeq = other._dashSeq self._dashcapstyle = other._dashcapstyle self._dashjoinstyle = other._dashjoinstyle self._solidcapstyle = other._solidcapstyle self._solidjoinstyle = other._solidjoinstyle self._linestyle = other._linestyle self._marker = MarkerStyle(other._marker.get_marker(), other._marker.get_fillstyle()) self._drawstyle = other._drawstyle def _get_rgb_face(self, alt=False): facecolor = self._get_markerfacecolor(alt=alt) if is_string_like(facecolor) and facecolor.lower() == 'none': rgbFace = None else: rgbFace = colorConverter.to_rgb(facecolor) return rgbFace def _get_rgba_face(self, alt=False): facecolor = self._get_markerfacecolor(alt=alt) if is_string_like(facecolor) and facecolor.lower() == 'none': rgbaFace = None else: rgbaFace = colorConverter.to_rgba(facecolor, self._alpha) return rgbaFace def _get_rgba_ln_color(self, alt=False): return colorConverter.to_rgba(self._color, self._alpha) # some aliases.... def set_aa(self, val): self.set_antialiased(val) def set_c(self, val): self.set_color(val) def set_ls(self, val): self.set_linestyle(val) def set_lw(self, val): self.set_linewidth(val) def set_mec(self, val): self.set_markeredgecolor(val) def set_mew(self, val): self.set_markeredgewidth(val) def set_mfc(self, val): self.set_markerfacecolor(val) def set_mfcalt(self, val): self.set_markerfacecoloralt(val) def set_ms(self, val): self.set_markersize(val) def get_aa(self): return self.get_antialiased() def get_c(self): return self.get_color() def get_ls(self): return self.get_linestyle() def get_lw(self): return self.get_linewidth() def get_mec(self): return self.get_markeredgecolor() def get_mew(self): return self.get_markeredgewidth() def get_mfc(self): return self.get_markerfacecolor() def get_mfcalt(self, alt=False): return self.get_markerfacecoloralt() def get_ms(self): return self.get_markersize() def set_dash_joinstyle(self, s): s = s.lower() if s not in self.validJoin: raise ValueError('set_dash_joinstyle passed "%s";\n' % (s,) + 'valid joinstyles are %s' % (self.validJoin,)) self._dashjoinstyle = s def set_solid_joinstyle(self, s): s = s.lower() if s not in self.validJoin: raise ValueError('set_solid_joinstyle passed "%s";\n' % (s,) + 'valid joinstyles are %s' % (self.validJoin,)) self._solidjoinstyle = s def get_dash_joinstyle(self): return self._dashjoinstyle def get_solid_joinstyle(self): return self._solidjoinstyle def set_dash_capstyle(self, s): s = s.lower() if s not in self.validCap: raise ValueError('set_dash_capstyle passed "%s";\n' % (s,) + 'valid capstyles are %s' % (self.validCap,)) self._dashcapstyle = s def set_solid_capstyle(self, s): s = s.lower() if s not in self.validCap: raise ValueError('set_solid_capstyle passed "%s";\n' % (s,) + 'valid capstyles are %s' % (self.validCap,)) self._solidcapstyle = s def get_dash_capstyle(self): return self._dashcapstyle def get_solid_capstyle(self): return self._solidcapstyle def is_dashed(self): return self._linestyle in ('--', '-.', ':') class VertexSelector: def __init__(self, line): if not hasattr(line, 'axes'): raise RuntimeError('You must first add the line to the Axes') if line.get_picker() is None: raise RuntimeError('You must first set the picker property ' 'of the line') self.axes = line.axes self.line = line self.canvas = self.axes.figure.canvas self.cid = self.canvas.mpl_connect('pick_event', self.onpick) self.ind = set() def process_selected(self, ind, xs, ys): pass def onpick(self, event): if event.artist is not self.line: return for i in event.ind: if i in self.ind: self.ind.remove(i) else: self.ind.add(i) ind = list(self.ind) ind.sort() xdata, ydata = self.line.get_data() self.process_selected(ind, xdata[ind], ydata[ind]) lineStyles = Line2D._lineStyles lineMarkers = MarkerStyle.markers drawStyles = Line2D.drawStyles fillStyles = MarkerStyle.fillstyles docstring.interpd.update(Line2D=artist.kwdoc(Line2D)) # You can not set the docstring of an instancemethod, # but you can on the underlying function. Go figure. docstring.dedent_interpd(Line2D.__init__)
true
true
1c456142bbc95af7e87173cb0cb84afd5f28b013
929
py
Python
interprete/src/models/gpt/example.py
serjtroshin/PLBART
58e5de3041a2fc8b98e54648c6489fb3c23db9cb
[ "MIT" ]
null
null
null
interprete/src/models/gpt/example.py
serjtroshin/PLBART
58e5de3041a2fc8b98e54648c6489fb3c23db9cb
[ "MIT" ]
null
null
null
interprete/src/models/gpt/example.py
serjtroshin/PLBART
58e5de3041a2fc8b98e54648c6489fb3c23db9cb
[ "MIT" ]
null
null
null
# from transformers import pipeline # generator = pipeline('text-generation', model='EleutherAI/gpt-neo-2.7B') # generator("EleutherAI has", do_sample=True, min_length=50) # [{'generated_text': 'EleutherAI has made a commitment to create new software packages for each of its major clients and has'}] from transformers import GPT2Tokenizer, GPT2Model model_name = "microsoft/CodeGPT-small-java-adaptedGPT2" # model_name = "./CodeGPT-small-java-adaptedGPT2" tokenizer = GPT2Tokenizer.from_pretrained(model_name) # CodeGPT-small-java-adaptedGPT2 model = GPT2Model.from_pretrained(model_name) # tokenizer.save_pretrained(f"./{model_name}") # model.save_pretrained(f"./{model_name}") text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') print(model) output = model(**encoded_input, output_hidden_states=True) print(len(output["hidden_states"])) print(output["hidden_states"][0].shape)
42.227273
128
0.779333
from transformers import GPT2Tokenizer, GPT2Model model_name = "microsoft/CodeGPT-small-java-adaptedGPT2" tokenizer = GPT2Tokenizer.from_pretrained(model_name) model = GPT2Model.from_pretrained(model_name) text = "Replace me by any text you'd like." encoded_input = tokenizer(text, return_tensors='pt') print(model) output = model(**encoded_input, output_hidden_states=True) print(len(output["hidden_states"])) print(output["hidden_states"][0].shape)
true
true
1c456237e48e7b21db5e6e1bb2ccae546249bad4
7,590
py
Python
prov/constants.py
AndreiFrunze/wrangler
076a07de00fc966dcf18ca6b6a6e804be5245ed9
[ "Apache-2.0" ]
2
2017-09-07T04:33:18.000Z
2019-01-07T13:32:15.000Z
prov/constants.py
AndreiFrunze/wrangler
076a07de00fc966dcf18ca6b6a6e804be5245ed9
[ "Apache-2.0" ]
2
2016-10-06T13:07:05.000Z
2017-12-20T09:47:08.000Z
prov/constants.py
AndreiFrunze/wrangler
076a07de00fc966dcf18ca6b6a6e804be5245ed9
[ "Apache-2.0" ]
5
2016-09-01T08:38:20.000Z
2018-08-28T12:08:39.000Z
from __future__ import (absolute_import, division, print_function, unicode_literals) __author__ = 'Trung Dong Huynh' __email__ = 'trungdong@donggiang.com' import six # # PROV record constants - PROV-DM # Built-in namespaces from prov.identifier import Namespace XSD = Namespace('xsd', 'http://www.w3.org/2001/XMLSchema#') PROV = Namespace('prov', 'http://www.w3.org/ns/prov#') XSI = Namespace('xsi', 'http://www.w3.org/2001/XMLSchema-instance') # C1. Entities/Activities PROV_ENTITY = PROV['Entity'] PROV_ACTIVITY = PROV['Activity'] PROV_GENERATION = PROV['Generation'] PROV_USAGE = PROV['Usage'] PROV_COMMUNICATION = PROV['Communication'] PROV_START = PROV['Start'] PROV_END = PROV['End'] PROV_INVALIDATION = PROV['Invalidation'] # C2. Derivations PROV_DERIVATION = PROV['Derivation'] # C3. Agents/Responsibility PROV_AGENT = PROV['Agent'] PROV_ATTRIBUTION = PROV['Attribution'] PROV_ASSOCIATION = PROV['Association'] PROV_DELEGATION = PROV['Delegation'] PROV_INFLUENCE = PROV['Influence'] # C4. Bundles PROV_BUNDLE = PROV['Bundle'] # C5. Alternate PROV_ALTERNATE = PROV['Alternate'] PROV_SPECIALIZATION = PROV['Specialization'] PROV_MENTION = PROV['Mention'] # C6. Collections PROV_MEMBERSHIP = PROV['Membership'] PROV_N_MAP = { PROV_ENTITY: u'entity', PROV_ACTIVITY: u'activity', PROV_GENERATION: u'wasGeneratedBy', PROV_USAGE: u'used', PROV_COMMUNICATION: u'wasInformedBy', PROV_START: u'wasStartedBy', PROV_END: u'wasEndedBy', PROV_INVALIDATION: u'wasInvalidatedBy', PROV_DERIVATION: u'wasDerivedFrom', PROV_AGENT: u'agent', PROV_ATTRIBUTION: u'wasAttributedTo', PROV_ASSOCIATION: u'wasAssociatedWith', PROV_DELEGATION: u'actedOnBehalfOf', PROV_INFLUENCE: u'wasInfluencedBy', PROV_ALTERNATE: u'alternateOf', PROV_SPECIALIZATION: u'specializationOf', PROV_MENTION: u'mentionOf', PROV_MEMBERSHIP: u'hadMember', PROV_BUNDLE: u'bundle', } # Records defined as subtypes in PROV-N but top level types in for example # PROV XML also need a mapping. ADDITIONAL_N_MAP = { PROV['Revision']: u'wasRevisionOf', PROV['Quotation']: u'wasQuotedFrom', PROV['PrimarySource']: u'hadPrimarySource', PROV['SoftwareAgent']: u'softwareAgent', PROV['Person']: u'person', PROV['Organization']: u'organization', PROV['Plan']: u'plan', PROV['Collection']: u'collection', PROV['EmptyCollection']: u'emptyCollection', } # Maps qualified names from the PROV namespace to their base class. If it # has no baseclass it maps to itsself. This is needed for example for PROV # XML (de)serializer where extended types are used a lot. PROV_BASE_CLS = { PROV_ENTITY: PROV_ENTITY, PROV_ACTIVITY: PROV_ACTIVITY, PROV_GENERATION: PROV_GENERATION, PROV_USAGE: PROV_USAGE, PROV_COMMUNICATION: PROV_COMMUNICATION, PROV_START: PROV_START, PROV_END: PROV_END, PROV_INVALIDATION: PROV_INVALIDATION, PROV_DERIVATION: PROV_DERIVATION, PROV['Revision']: PROV_DERIVATION, PROV['Quotation']: PROV_DERIVATION, PROV['PrimarySource']: PROV_DERIVATION, PROV_AGENT: PROV_AGENT, PROV['SoftwareAgent']: PROV_AGENT, PROV['Person']: PROV_AGENT, PROV['Organization']: PROV_AGENT, PROV_ATTRIBUTION: PROV_ATTRIBUTION, PROV_ASSOCIATION: PROV_ASSOCIATION, PROV['Plan']: PROV_ENTITY, PROV_DELEGATION: PROV_DELEGATION, PROV_INFLUENCE: PROV_INFLUENCE, PROV_ALTERNATE: PROV_ALTERNATE, PROV_SPECIALIZATION: PROV_SPECIALIZATION, PROV_MENTION: PROV_MENTION, PROV['Collection']: PROV_ENTITY, PROV['EmptyCollection']: PROV_ENTITY, PROV_MEMBERSHIP: PROV_MEMBERSHIP, PROV_BUNDLE: PROV_ENTITY } # Identifiers for PROV's attributes PROV_ATTR_ENTITY = PROV['entity'] PROV_ATTR_ACTIVITY = PROV['activity'] PROV_ATTR_TRIGGER = PROV['trigger'] PROV_ATTR_INFORMED = PROV['informed'] PROV_ATTR_INFORMANT = PROV['informant'] PROV_ATTR_STARTER = PROV['starter'] PROV_ATTR_ENDER = PROV['ender'] PROV_ATTR_AGENT = PROV['agent'] PROV_ATTR_PLAN = PROV['plan'] PROV_ATTR_DELEGATE = PROV['delegate'] PROV_ATTR_RESPONSIBLE = PROV['responsible'] PROV_ATTR_GENERATED_ENTITY = PROV['generatedEntity'] PROV_ATTR_USED_ENTITY = PROV['usedEntity'] PROV_ATTR_GENERATION = PROV['generation'] PROV_ATTR_USAGE = PROV['usage'] PROV_ATTR_SPECIFIC_ENTITY = PROV['specificEntity'] PROV_ATTR_GENERAL_ENTITY = PROV['generalEntity'] PROV_ATTR_ALTERNATE1 = PROV['alternate1'] PROV_ATTR_ALTERNATE2 = PROV['alternate2'] PROV_ATTR_BUNDLE = PROV['bundle'] PROV_ATTR_INFLUENCEE = PROV['influencee'] PROV_ATTR_INFLUENCER = PROV['influencer'] PROV_ATTR_COLLECTION = PROV['collection'] # Literal properties PROV_ATTR_TIME = PROV['time'] PROV_ATTR_STARTTIME = PROV['startTime'] PROV_ATTR_ENDTIME = PROV['endTime'] PROV_ATTRIBUTE_QNAMES = { PROV_ATTR_ENTITY, PROV_ATTR_ACTIVITY, PROV_ATTR_TRIGGER, PROV_ATTR_INFORMED, PROV_ATTR_INFORMANT, PROV_ATTR_STARTER, PROV_ATTR_ENDER, PROV_ATTR_AGENT, PROV_ATTR_PLAN, PROV_ATTR_DELEGATE, PROV_ATTR_RESPONSIBLE, PROV_ATTR_GENERATED_ENTITY, PROV_ATTR_USED_ENTITY, PROV_ATTR_GENERATION, PROV_ATTR_USAGE, PROV_ATTR_SPECIFIC_ENTITY, PROV_ATTR_GENERAL_ENTITY, PROV_ATTR_ALTERNATE1, PROV_ATTR_ALTERNATE2, PROV_ATTR_BUNDLE, PROV_ATTR_INFLUENCEE, PROV_ATTR_INFLUENCER, PROV_ATTR_COLLECTION } PROV_ATTRIBUTE_LITERALS = { PROV_ATTR_TIME, PROV_ATTR_STARTTIME, PROV_ATTR_ENDTIME } # Set of formal attributes of PROV records PROV_ATTRIBUTES = PROV_ATTRIBUTE_QNAMES | PROV_ATTRIBUTE_LITERALS PROV_RECORD_ATTRIBUTES = list((attr, six.text_type(attr)) for attr in PROV_ATTRIBUTES) PROV_RECORD_IDS_MAP = dict( (PROV_N_MAP[rec_type_id], rec_type_id) for rec_type_id in PROV_N_MAP ) PROV_ID_ATTRIBUTES_MAP = dict( (prov_id, attribute) for (prov_id, attribute) in PROV_RECORD_ATTRIBUTES ) PROV_ATTRIBUTES_ID_MAP = dict( (attribute, prov_id) for (prov_id, attribute) in PROV_RECORD_ATTRIBUTES ) # Extra definition for convenience PROV_TYPE = PROV['type'] PROV_LABEL = PROV['label'] PROV_VALUE = PROV['value'] PROV_LOCATION = PROV['location'] PROV_ROLE = PROV['role'] PROV_QUALIFIEDNAME = PROV['QUALIFIED_NAME'] # XSD DATA TYPES XSD_ANYURI = XSD['anyURI'] XSD_QNAME = XSD['QName'] XSD_DATETIME = XSD['dateTime'] XSD_TIME = XSD['time'] XSD_DATE = XSD['date'] XSD_STRING = XSD['string'] XSD_BOOLEAN = XSD['boolean'] # All XSD Integer types XSD_INTEGER = XSD['integer'] XSD_LONG = XSD['long'] XSD_INT = XSD['int'] XSD_SHORT = XSD['short'] XSD_BYTE = XSD['byte'] XSD_NONNEGATIVEINTEGER = XSD['nonNegativeInteger'] XSD_UNSIGNEDLONG = XSD['unsignedLong'] XSD_UNSIGNEDINT = XSD['unsignedInt'] XSD_UNSIGNEDSHORT = XSD['unsignedShort'] XSD_UNSIGNEDBYTE = XSD['unsignedByte'] XSD_POSITIVEINTEGER = XSD['positiveInteger'] XSD_NONPOSITIVEINTEGER = XSD['nonPositiveInteger'] XSD_NEGATIVEINTEGER = XSD['negativeInteger'] # All XSD real number types XSD_FLOAT = XSD['float'] XSD_DOUBLE = XSD['double'] XSD_DECIMAL = XSD['decimal']
33.584071
75
0.691304
from __future__ import (absolute_import, division, print_function, unicode_literals) __author__ = 'Trung Dong Huynh' __email__ = 'trungdong@donggiang.com' import six mespace XSD = Namespace('xsd', 'http://www.w3.org/2001/XMLSchema#') PROV = Namespace('prov', 'http://www.w3.org/ns/prov#') XSI = Namespace('xsi', 'http://www.w3.org/2001/XMLSchema-instance') PROV_ENTITY = PROV['Entity'] PROV_ACTIVITY = PROV['Activity'] PROV_GENERATION = PROV['Generation'] PROV_USAGE = PROV['Usage'] PROV_COMMUNICATION = PROV['Communication'] PROV_START = PROV['Start'] PROV_END = PROV['End'] PROV_INVALIDATION = PROV['Invalidation'] PROV_DERIVATION = PROV['Derivation'] PROV_AGENT = PROV['Agent'] PROV_ATTRIBUTION = PROV['Attribution'] PROV_ASSOCIATION = PROV['Association'] PROV_DELEGATION = PROV['Delegation'] PROV_INFLUENCE = PROV['Influence'] PROV_BUNDLE = PROV['Bundle'] PROV_ALTERNATE = PROV['Alternate'] PROV_SPECIALIZATION = PROV['Specialization'] PROV_MENTION = PROV['Mention'] PROV_MEMBERSHIP = PROV['Membership'] PROV_N_MAP = { PROV_ENTITY: u'entity', PROV_ACTIVITY: u'activity', PROV_GENERATION: u'wasGeneratedBy', PROV_USAGE: u'used', PROV_COMMUNICATION: u'wasInformedBy', PROV_START: u'wasStartedBy', PROV_END: u'wasEndedBy', PROV_INVALIDATION: u'wasInvalidatedBy', PROV_DERIVATION: u'wasDerivedFrom', PROV_AGENT: u'agent', PROV_ATTRIBUTION: u'wasAttributedTo', PROV_ASSOCIATION: u'wasAssociatedWith', PROV_DELEGATION: u'actedOnBehalfOf', PROV_INFLUENCE: u'wasInfluencedBy', PROV_ALTERNATE: u'alternateOf', PROV_SPECIALIZATION: u'specializationOf', PROV_MENTION: u'mentionOf', PROV_MEMBERSHIP: u'hadMember', PROV_BUNDLE: u'bundle', } ADDITIONAL_N_MAP = { PROV['Revision']: u'wasRevisionOf', PROV['Quotation']: u'wasQuotedFrom', PROV['PrimarySource']: u'hadPrimarySource', PROV['SoftwareAgent']: u'softwareAgent', PROV['Person']: u'person', PROV['Organization']: u'organization', PROV['Plan']: u'plan', PROV['Collection']: u'collection', PROV['EmptyCollection']: u'emptyCollection', } PROV_BASE_CLS = { PROV_ENTITY: PROV_ENTITY, PROV_ACTIVITY: PROV_ACTIVITY, PROV_GENERATION: PROV_GENERATION, PROV_USAGE: PROV_USAGE, PROV_COMMUNICATION: PROV_COMMUNICATION, PROV_START: PROV_START, PROV_END: PROV_END, PROV_INVALIDATION: PROV_INVALIDATION, PROV_DERIVATION: PROV_DERIVATION, PROV['Revision']: PROV_DERIVATION, PROV['Quotation']: PROV_DERIVATION, PROV['PrimarySource']: PROV_DERIVATION, PROV_AGENT: PROV_AGENT, PROV['SoftwareAgent']: PROV_AGENT, PROV['Person']: PROV_AGENT, PROV['Organization']: PROV_AGENT, PROV_ATTRIBUTION: PROV_ATTRIBUTION, PROV_ASSOCIATION: PROV_ASSOCIATION, PROV['Plan']: PROV_ENTITY, PROV_DELEGATION: PROV_DELEGATION, PROV_INFLUENCE: PROV_INFLUENCE, PROV_ALTERNATE: PROV_ALTERNATE, PROV_SPECIALIZATION: PROV_SPECIALIZATION, PROV_MENTION: PROV_MENTION, PROV['Collection']: PROV_ENTITY, PROV['EmptyCollection']: PROV_ENTITY, PROV_MEMBERSHIP: PROV_MEMBERSHIP, PROV_BUNDLE: PROV_ENTITY } PROV_ATTR_ENTITY = PROV['entity'] PROV_ATTR_ACTIVITY = PROV['activity'] PROV_ATTR_TRIGGER = PROV['trigger'] PROV_ATTR_INFORMED = PROV['informed'] PROV_ATTR_INFORMANT = PROV['informant'] PROV_ATTR_STARTER = PROV['starter'] PROV_ATTR_ENDER = PROV['ender'] PROV_ATTR_AGENT = PROV['agent'] PROV_ATTR_PLAN = PROV['plan'] PROV_ATTR_DELEGATE = PROV['delegate'] PROV_ATTR_RESPONSIBLE = PROV['responsible'] PROV_ATTR_GENERATED_ENTITY = PROV['generatedEntity'] PROV_ATTR_USED_ENTITY = PROV['usedEntity'] PROV_ATTR_GENERATION = PROV['generation'] PROV_ATTR_USAGE = PROV['usage'] PROV_ATTR_SPECIFIC_ENTITY = PROV['specificEntity'] PROV_ATTR_GENERAL_ENTITY = PROV['generalEntity'] PROV_ATTR_ALTERNATE1 = PROV['alternate1'] PROV_ATTR_ALTERNATE2 = PROV['alternate2'] PROV_ATTR_BUNDLE = PROV['bundle'] PROV_ATTR_INFLUENCEE = PROV['influencee'] PROV_ATTR_INFLUENCER = PROV['influencer'] PROV_ATTR_COLLECTION = PROV['collection'] # Literal properties PROV_ATTR_TIME = PROV['time'] PROV_ATTR_STARTTIME = PROV['startTime'] PROV_ATTR_ENDTIME = PROV['endTime'] PROV_ATTRIBUTE_QNAMES = { PROV_ATTR_ENTITY, PROV_ATTR_ACTIVITY, PROV_ATTR_TRIGGER, PROV_ATTR_INFORMED, PROV_ATTR_INFORMANT, PROV_ATTR_STARTER, PROV_ATTR_ENDER, PROV_ATTR_AGENT, PROV_ATTR_PLAN, PROV_ATTR_DELEGATE, PROV_ATTR_RESPONSIBLE, PROV_ATTR_GENERATED_ENTITY, PROV_ATTR_USED_ENTITY, PROV_ATTR_GENERATION, PROV_ATTR_USAGE, PROV_ATTR_SPECIFIC_ENTITY, PROV_ATTR_GENERAL_ENTITY, PROV_ATTR_ALTERNATE1, PROV_ATTR_ALTERNATE2, PROV_ATTR_BUNDLE, PROV_ATTR_INFLUENCEE, PROV_ATTR_INFLUENCER, PROV_ATTR_COLLECTION } PROV_ATTRIBUTE_LITERALS = { PROV_ATTR_TIME, PROV_ATTR_STARTTIME, PROV_ATTR_ENDTIME } # Set of formal attributes of PROV records PROV_ATTRIBUTES = PROV_ATTRIBUTE_QNAMES | PROV_ATTRIBUTE_LITERALS PROV_RECORD_ATTRIBUTES = list((attr, six.text_type(attr)) for attr in PROV_ATTRIBUTES) PROV_RECORD_IDS_MAP = dict( (PROV_N_MAP[rec_type_id], rec_type_id) for rec_type_id in PROV_N_MAP ) PROV_ID_ATTRIBUTES_MAP = dict( (prov_id, attribute) for (prov_id, attribute) in PROV_RECORD_ATTRIBUTES ) PROV_ATTRIBUTES_ID_MAP = dict( (attribute, prov_id) for (prov_id, attribute) in PROV_RECORD_ATTRIBUTES ) # Extra definition for convenience PROV_TYPE = PROV['type'] PROV_LABEL = PROV['label'] PROV_VALUE = PROV['value'] PROV_LOCATION = PROV['location'] PROV_ROLE = PROV['role'] PROV_QUALIFIEDNAME = PROV['QUALIFIED_NAME'] # XSD DATA TYPES XSD_ANYURI = XSD['anyURI'] XSD_QNAME = XSD['QName'] XSD_DATETIME = XSD['dateTime'] XSD_TIME = XSD['time'] XSD_DATE = XSD['date'] XSD_STRING = XSD['string'] XSD_BOOLEAN = XSD['boolean'] # All XSD Integer types XSD_INTEGER = XSD['integer'] XSD_LONG = XSD['long'] XSD_INT = XSD['int'] XSD_SHORT = XSD['short'] XSD_BYTE = XSD['byte'] XSD_NONNEGATIVEINTEGER = XSD['nonNegativeInteger'] XSD_UNSIGNEDLONG = XSD['unsignedLong'] XSD_UNSIGNEDINT = XSD['unsignedInt'] XSD_UNSIGNEDSHORT = XSD['unsignedShort'] XSD_UNSIGNEDBYTE = XSD['unsignedByte'] XSD_POSITIVEINTEGER = XSD['positiveInteger'] XSD_NONPOSITIVEINTEGER = XSD['nonPositiveInteger'] XSD_NEGATIVEINTEGER = XSD['negativeInteger'] # All XSD real number types XSD_FLOAT = XSD['float'] XSD_DOUBLE = XSD['double'] XSD_DECIMAL = XSD['decimal']
true
true
1c45639a0e721d5529cabef77a05e804e7bcec90
3,371
py
Python
application/app.py
StephenSpicer/airbnb_app
ea9b92dbd35d508d2f819255d026b299d63285a8
[ "MIT" ]
null
null
null
application/app.py
StephenSpicer/airbnb_app
ea9b92dbd35d508d2f819255d026b299d63285a8
[ "MIT" ]
null
null
null
application/app.py
StephenSpicer/airbnb_app
ea9b92dbd35d508d2f819255d026b299d63285a8
[ "MIT" ]
null
null
null
# Import Statements import pandas as pd from flask import Flask, render_template, request from joblib import load from .predict import get_prediction # Instantiate Application # def create_app(): # app = Flask(__name__) # @app.route('/') # def hello_heroku(): # return "hello heroku" # return app def create_app(): """ Function to deploy heroku application. Contains assorment of functions which control the inputs and outputs of interractive web application. """ app = Flask(__name__) load_model = load('application/finalized_model.sav') # as easy as changing path to /form and make a link to it in main page @app.route('/') def form(): return render_template('form.html') @app.route('/run_model', methods=['POST', 'GET']) def data(): # if user types in /run_model they get this error message if request.method == 'GET': message = f"ERROR: The URL /run_model is accessed directly. Try going to home page '/' to submit form" # if user goes to /form and hits submit, they go to this page! # in here user input gets stored into to_predict, and then to_predict gets run in model if request.method == 'POST': property_type = str(request.values["prop"]) room_type = str(request.values["room_type"]) bathrooms = float(request.values["bathrooms"]) cancellation_policy = str(request.values["cancellation"]) city = str(request.values["city"]) host_since = str(request.values["host_since"]) review_scores_rating = int(request.values["review_rating"]) bedrooms = int(request.values["bedrooms"]) beds = int(request.values["beds"]) # We will be adding a few more dropdowns above # need to get this to print out T/F list amenities = request.form.getlist('feature_checkbox') # basics = to_predict = [property_type, room_type, bathrooms, cancellation_policy, city, host_since, review_scores_rating, bedrooms, beds, amenities] message = model_output(to_predict) return message def model_output(user_input): mod_input = [] all_amenities = [ "instant_bookable", "host_has_profile_pic", "host_identity_verified", "cleaning_fee", "Wireless Internet", "Air conditioning", "Kitchen", "Heating", "Family/kid friendly", "Hair dryer", "Iron", "Shampoo", "Fire extinguisher", "Laptop friendly workspace", "Indoor fireplace", "TV", "Cable TV"] # Append unchanging variables to list first : check indexing there? mod_input.extend(user_input[:9]) input = user_input[9] # For loop through conditional varibles for option in all_amenities: if any(option in s for s in input): mod_input.append(1) else: mod_input.append(0) price='${}'.format(get_prediction(mod_input, load_model)) return render_template('results.html', prediction=price) return app
34.752577
114
0.589143
import pandas as pd from flask import Flask, render_template, request from joblib import load from .predict import get_prediction def create_app(): app = Flask(__name__) load_model = load('application/finalized_model.sav') @app.route('/') def form(): return render_template('form.html') @app.route('/run_model', methods=['POST', 'GET']) def data(): if request.method == 'GET': message = f"ERROR: The URL /run_model is accessed directly. Try going to home page '/' to submit form" if request.method == 'POST': property_type = str(request.values["prop"]) room_type = str(request.values["room_type"]) bathrooms = float(request.values["bathrooms"]) cancellation_policy = str(request.values["cancellation"]) city = str(request.values["city"]) host_since = str(request.values["host_since"]) review_scores_rating = int(request.values["review_rating"]) bedrooms = int(request.values["bedrooms"]) beds = int(request.values["beds"]) amenities = request.form.getlist('feature_checkbox') to_predict = [property_type, room_type, bathrooms, cancellation_policy, city, host_since, review_scores_rating, bedrooms, beds, amenities] message = model_output(to_predict) return message def model_output(user_input): mod_input = [] all_amenities = [ "instant_bookable", "host_has_profile_pic", "host_identity_verified", "cleaning_fee", "Wireless Internet", "Air conditioning", "Kitchen", "Heating", "Family/kid friendly", "Hair dryer", "Iron", "Shampoo", "Fire extinguisher", "Laptop friendly workspace", "Indoor fireplace", "TV", "Cable TV"] mod_input.extend(user_input[:9]) input = user_input[9] for option in all_amenities: if any(option in s for s in input): mod_input.append(1) else: mod_input.append(0) price='${}'.format(get_prediction(mod_input, load_model)) return render_template('results.html', prediction=price) return app
true
true
1c456470d18841deab9b9d0f37410c49dd5f194b
8,894
py
Python
dragonfly/opt/multiobjective_optimiser.py
hase1128/dragonfly
4be7e4c539d3edccc4d243ab9f972b1ffb0d9a5c
[ "MIT" ]
null
null
null
dragonfly/opt/multiobjective_optimiser.py
hase1128/dragonfly
4be7e4c539d3edccc4d243ab9f972b1ffb0d9a5c
[ "MIT" ]
null
null
null
dragonfly/opt/multiobjective_optimiser.py
hase1128/dragonfly
4be7e4c539d3edccc4d243ab9f972b1ffb0d9a5c
[ "MIT" ]
null
null
null
""" Defines a class for Multi-objective Blackbox Optimisation. -- bparia@cs.cmu.edu -- kandasamy@cs.cmu.edu """ # NB: In this file, the acronym MOO/moo refers to multi-objective optimisation. --KK # pylint: disable=abstract-class-little-used # pylint: disable=invalid-name from __future__ import division from argparse import Namespace import numpy as np # Local imports from ..exd.exd_core import ExperimentDesigner, exd_core_args from ..exd.experiment_caller import MultiFunctionCaller, FunctionCaller from ..utils.general_utils import update_pareto_set multiobjective_opt_args = exd_core_args _NO_MF_FOR_MOO_ERR_MSG = 'Multi-fidelity support has not been implemented yet' + \ ' for multi-objective optimisation.' class MultiObjectiveOptimiser(ExperimentDesigner): """ Blackbox Optimiser Class. """ # pylint: disable=attribute-defined-outside-init def __init__(self, multi_func_caller, worker_manager, model=None, options=None, reporter=None): """ Constructor. """ assert isinstance(multi_func_caller, MultiFunctionCaller) and not \ isinstance(multi_func_caller, FunctionCaller) self.multi_func_caller = multi_func_caller # If it is not a list, computing the non-dominated set is equivalent # to computing the maximum. self.domain = self.multi_func_caller.domain super(MultiObjectiveOptimiser, self).__init__(multi_func_caller, worker_manager, model, options, reporter) def _exd_child_set_up(self): """ Set up for the optimisation. """ if self.multi_func_caller.is_mf(): # self.num_fidel_to_opt_calls = 0 raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) self._moo_set_up() self._multi_opt_method_set_up() self.prev_eval_vals = [] # for optimiser, prev_eval_vals def _moo_set_up(self): """ Set up for black-box optimisation. """ # Initialise optimal values and points # (Optimal point for MF problems is not defined) # (Instead a set of pareto optimal points will be maintained) self.curr_pareto_vals = [] self.curr_pareto_points = [] self.curr_true_pareto_vals = [] self.curr_true_pareto_points = [] # Set up history self.history.query_vals = [] self.history.query_true_vals = [] self.history.curr_pareto_vals = [] self.history.curr_pareto_points = [] self.history.curr_true_pareto_vals = [] self.history.curr_true_pareto_points = [] if self.multi_func_caller.is_mf(): # self.history.query_at_fidel_to_opts = [] raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) # Set up attributes to be copied from history self.to_copy_from_qinfo_to_history['val'] = 'query_vals' self.to_copy_from_qinfo_to_history['true_val'] = 'query_true_vals' # Set up previous evaluations self.prev_eval_vals = [] self.prev_eval_true_vals = [] self.history.prev_eval_vals = self.prev_eval_vals self.history.prev_eval_true_vals = self.prev_eval_true_vals def _multi_opt_method_set_up(self): """ Any set up for the specific optimisation method. """ raise NotImplementedError('Implement in Optimisation Method class.') def _get_problem_str(self): """ Description of the problem. """ return 'Multi-objective Optimisation' # Book-keeping ---------------------------------------------------------------- def _exd_child_update_history(self, qinfo): """ Updates to the history specific to optimisation. """ # Update the best point/val # check fidelity if self.multi_func_caller.is_mf(): raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) else: self._update_opt_point_and_val(qinfo) # Now add to history self.history.curr_pareto_vals.append(self.curr_pareto_vals) self.history.curr_pareto_points.append(self.curr_pareto_points) self.history.curr_true_pareto_vals.append(self.curr_true_pareto_vals) self.history.curr_true_pareto_points.append(self.curr_true_pareto_points) # Any method specific updating self._multi_opt_method_update_history(qinfo) def _update_opt_point_and_val(self, qinfo, query_is_at_fidel_to_opt=None): """ Updates the optimum point and value according the data in qinfo. Can be overridden by a child class if you want to do anything differently. """ if query_is_at_fidel_to_opt is not None: if not query_is_at_fidel_to_opt: # if the fidelity queried at is not fidel_to_opt, then return return # Optimise curr_opt_val and curr_true_opt_val self.curr_pareto_vals, self.curr_pareto_points = update_pareto_set( self.curr_pareto_vals, self.curr_pareto_points, qinfo.val, qinfo.point) self.curr_true_pareto_vals, self.curr_true_pareto_points = update_pareto_set( self.curr_true_pareto_vals, self.curr_true_pareto_points, qinfo.true_val, qinfo.point) def _multi_opt_method_update_history(self, qinfo): """ Any updates to the history specific to the method. """ pass # Pass by default. Not necessary to override. def _get_exd_child_header_str(self): """ Header for black box optimisation. """ ret = '#Pareto=<num_pareto_optimal_points_found>' ret += self._get_opt_method_header_str() return ret @classmethod def _get_opt_method_header_str(cls): """ Header for optimisation method. """ return '' def _get_exd_child_report_results_str(self): """ Returns a string describing the progress in optimisation. """ best_val_str = '#Pareto: %d'%(len(self.curr_pareto_vals)) opt_method_str = self._get_opt_method_report_results_str() return best_val_str + opt_method_str + ', ' def _get_opt_method_report_results_str(self): """ Any details to include in a child method when reporting results. Can be overridden by a child class. """ #pylint: disable=no-self-use return '' def _exd_child_handle_prev_evals_in_options(self): """ Handles pre-evaluations. """ ret = 0 for qinfo in self.options.prev_evaluations.qinfos: if not hasattr(qinfo, 'true_val'): qinfo.true_val = [-np.inf] * len(qinfo.val) if self.multi_func_caller.is_mf(): raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) else: self._update_opt_point_and_val(qinfo) self.prev_eval_points.append(qinfo.point) self.prev_eval_vals.append(qinfo.val) self.prev_eval_true_vals.append(qinfo.true_val) ret += 1 return ret def _child_handle_data_loaded_from_file(self, loaded_data_from_file): """ Handles evaluations from file. """ query_points = loaded_data_from_file['points'] num_pts_in_file = len(query_points) query_vals = loaded_data_from_file['vals'] assert num_pts_in_file == len(query_vals) if 'true_vals' in loaded_data_from_file: query_true_vals = loaded_data_from_file['true_vals'] assert num_pts_in_file == len(query_vals) else: query_true_vals = [[-np.inf] * self.multi_func_caller.num_funcs] * len(query_vals) # Multi-fidelity if self.multi_func_caller.is_mf(): raise NotImplementedError('Not implemented multi-fidelity MOO yet.') # Now Iterate through each point for pt, val, true_val in zip(query_points, query_vals, query_true_vals): qinfo = Namespace(point=pt, val=val, true_val=true_val) if self.multi_func_caller.is_mf(): raise NotImplementedError('Not implemented multi-fidelity MOO yet.') else: self._update_opt_point_and_val(qinfo) self.prev_eval_points.append(qinfo.point) self.prev_eval_vals.append(qinfo.val) self.prev_eval_true_vals.append(qinfo.true_val) return num_pts_in_file def _exd_child_get_data_to_save(self): """ Return data to save. """ ret = {'points': self.prev_eval_points + self.history.query_points, 'vals': self.prev_eval_vals + self.history.query_vals, 'true_vals': self.prev_eval_true_vals + self.history.query_true_vals} if self.multi_func_caller.is_mf(): raise NotImplementedError('Not implemented multi-fidelity MOO yet.') num_data_saved = len(ret['points']) return ret, num_data_saved def _child_run_experiments_initialise(self): """ Handles any initialisation before running experiments. """ self._opt_method_optimise_initalise() def _opt_method_optimise_initalise(self): """ Any routine to run for a method just before optimisation routine. """ pass # Pass by default. Not necessary to override. def optimise(self, max_capital): """ Calling optimise with optimise the function. A wrapper for run_experiments from BlackboxExperimenter. """ ret = self.run_experiments(max_capital) return ret def _get_final_return_quantities(self): """ Return the curr_opt_val, curr_opt_point and history. """ return self.curr_pareto_vals, self.curr_pareto_points, self.history
40.798165
88
0.723746
from __future__ import division from argparse import Namespace import numpy as np from ..exd.exd_core import ExperimentDesigner, exd_core_args from ..exd.experiment_caller import MultiFunctionCaller, FunctionCaller from ..utils.general_utils import update_pareto_set multiobjective_opt_args = exd_core_args _NO_MF_FOR_MOO_ERR_MSG = 'Multi-fidelity support has not been implemented yet' + \ ' for multi-objective optimisation.' class MultiObjectiveOptimiser(ExperimentDesigner): def __init__(self, multi_func_caller, worker_manager, model=None, options=None, reporter=None): assert isinstance(multi_func_caller, MultiFunctionCaller) and not \ isinstance(multi_func_caller, FunctionCaller) self.multi_func_caller = multi_func_caller self.domain = self.multi_func_caller.domain super(MultiObjectiveOptimiser, self).__init__(multi_func_caller, worker_manager, model, options, reporter) def _exd_child_set_up(self): if self.multi_func_caller.is_mf(): raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) self._moo_set_up() self._multi_opt_method_set_up() self.prev_eval_vals = [] def _moo_set_up(self): self.curr_pareto_vals = [] self.curr_pareto_points = [] self.curr_true_pareto_vals = [] self.curr_true_pareto_points = [] self.history.query_vals = [] self.history.query_true_vals = [] self.history.curr_pareto_vals = [] self.history.curr_pareto_points = [] self.history.curr_true_pareto_vals = [] self.history.curr_true_pareto_points = [] if self.multi_func_caller.is_mf(): raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) self.to_copy_from_qinfo_to_history['val'] = 'query_vals' self.to_copy_from_qinfo_to_history['true_val'] = 'query_true_vals' self.prev_eval_vals = [] self.prev_eval_true_vals = [] self.history.prev_eval_vals = self.prev_eval_vals self.history.prev_eval_true_vals = self.prev_eval_true_vals def _multi_opt_method_set_up(self): raise NotImplementedError('Implement in Optimisation Method class.') def _get_problem_str(self): return 'Multi-objective Optimisation' def _exd_child_update_history(self, qinfo): if self.multi_func_caller.is_mf(): raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) else: self._update_opt_point_and_val(qinfo) self.history.curr_pareto_vals.append(self.curr_pareto_vals) self.history.curr_pareto_points.append(self.curr_pareto_points) self.history.curr_true_pareto_vals.append(self.curr_true_pareto_vals) self.history.curr_true_pareto_points.append(self.curr_true_pareto_points) self._multi_opt_method_update_history(qinfo) def _update_opt_point_and_val(self, qinfo, query_is_at_fidel_to_opt=None): if query_is_at_fidel_to_opt is not None: if not query_is_at_fidel_to_opt: return self.curr_pareto_vals, self.curr_pareto_points = update_pareto_set( self.curr_pareto_vals, self.curr_pareto_points, qinfo.val, qinfo.point) self.curr_true_pareto_vals, self.curr_true_pareto_points = update_pareto_set( self.curr_true_pareto_vals, self.curr_true_pareto_points, qinfo.true_val, qinfo.point) def _multi_opt_method_update_history(self, qinfo): pass def _get_exd_child_header_str(self): ret = '#Pareto=<num_pareto_optimal_points_found>' ret += self._get_opt_method_header_str() return ret @classmethod def _get_opt_method_header_str(cls): return '' def _get_exd_child_report_results_str(self): best_val_str = '#Pareto: %d'%(len(self.curr_pareto_vals)) opt_method_str = self._get_opt_method_report_results_str() return best_val_str + opt_method_str + ', ' def _get_opt_method_report_results_str(self): return '' def _exd_child_handle_prev_evals_in_options(self): ret = 0 for qinfo in self.options.prev_evaluations.qinfos: if not hasattr(qinfo, 'true_val'): qinfo.true_val = [-np.inf] * len(qinfo.val) if self.multi_func_caller.is_mf(): raise NotImplementedError(_NO_MF_FOR_MOO_ERR_MSG) else: self._update_opt_point_and_val(qinfo) self.prev_eval_points.append(qinfo.point) self.prev_eval_vals.append(qinfo.val) self.prev_eval_true_vals.append(qinfo.true_val) ret += 1 return ret def _child_handle_data_loaded_from_file(self, loaded_data_from_file): query_points = loaded_data_from_file['points'] num_pts_in_file = len(query_points) query_vals = loaded_data_from_file['vals'] assert num_pts_in_file == len(query_vals) if 'true_vals' in loaded_data_from_file: query_true_vals = loaded_data_from_file['true_vals'] assert num_pts_in_file == len(query_vals) else: query_true_vals = [[-np.inf] * self.multi_func_caller.num_funcs] * len(query_vals) if self.multi_func_caller.is_mf(): raise NotImplementedError('Not implemented multi-fidelity MOO yet.') for pt, val, true_val in zip(query_points, query_vals, query_true_vals): qinfo = Namespace(point=pt, val=val, true_val=true_val) if self.multi_func_caller.is_mf(): raise NotImplementedError('Not implemented multi-fidelity MOO yet.') else: self._update_opt_point_and_val(qinfo) self.prev_eval_points.append(qinfo.point) self.prev_eval_vals.append(qinfo.val) self.prev_eval_true_vals.append(qinfo.true_val) return num_pts_in_file def _exd_child_get_data_to_save(self): ret = {'points': self.prev_eval_points + self.history.query_points, 'vals': self.prev_eval_vals + self.history.query_vals, 'true_vals': self.prev_eval_true_vals + self.history.query_true_vals} if self.multi_func_caller.is_mf(): raise NotImplementedError('Not implemented multi-fidelity MOO yet.') num_data_saved = len(ret['points']) return ret, num_data_saved def _child_run_experiments_initialise(self): self._opt_method_optimise_initalise() def _opt_method_optimise_initalise(self): pass def optimise(self, max_capital): ret = self.run_experiments(max_capital) return ret def _get_final_return_quantities(self): return self.curr_pareto_vals, self.curr_pareto_points, self.history
true
true
1c4564ebef61049797c74cdf7ecdeb24f8731ca0
2,471
py
Python
tests/test_marmiton.py
squat-house/recipe-scrapers
72d2f69196f95210d2ea248f3b5cb446f94fd2b2
[ "MIT" ]
2
2020-07-28T15:12:10.000Z
2020-07-30T18:10:33.000Z
tests/test_marmiton.py
bfcarpio/recipe-scrapers
827ec444bc9d422a98c84c05cc4e4bcd3d084d51
[ "MIT" ]
1
2022-01-08T10:49:17.000Z
2022-01-08T10:49:30.000Z
tests/test_marmiton.py
AlexRogalskiy/recipe-scrapers
ff378b3ba4ae7ff4cbc113ca13991f887c1c70e7
[ "MIT" ]
1
2022-01-08T10:49:09.000Z
2022-01-08T10:49:09.000Z
from recipe_scrapers.marmiton import Marmiton from tests import ScraperTest class TestMarmitonScraper(ScraperTest): scraper_class = Marmiton def test_host(self): self.assertEqual("marmiton.org", self.harvester_class.host()) def test_canonical_url(self): self.assertEqual( "https://www.marmiton.org/recettes/recette_ratatouille_23223.aspx", self.harvester_class.canonical_url(), ) def test_title(self): self.assertEqual(self.harvester_class.title(), "Ratatouille") def test_total_time(self): self.assertEqual(80, self.harvester_class.total_time()) def test_yields(self): self.assertEqual("4 personnes", self.harvester_class.yields()) def test_ingredients(self): self.assertCountEqual( [ "350 g d'aubergine", "350 g de courgette", "350 g de poivron de couleur rouge et vert", "350 g d'oignon", "500 g de tomate bien mûres", "3 gousses d'ail", "6 cuillères à soupe d'huile d'olive", "1 brin de thym", "1 feuille de laurier", "poivre", "sel", ], self.harvester_class.ingredients(), ) def test_instructions(self): return self.assertEqual( "Coupez les tomates pelées en quartiers,\n" "les aubergines et les courgettes en rondelles.\n" "Emincez les poivrons en lamelles\n" "et l'oignon en rouelles.\n" "Chauffez 2 cuillères à soupe d'huile dans une poêle\n" "et faites-y fondre les oignons et les poivrons.\n" "Lorsqu'ils sont tendres, ajoutez les tomates, l'ail haché, le thym et le laurier.\n" "Salez, poivrez et laissez mijoter doucement à couvert durant 45 minutes.\n" "Pendant ce temps, préparez les aubergines et les courgettes. " "Faites les cuire séparemment ou non dans l'huile d'olive pendant 15 minutes.\n" "Vérifiez la cuisson des légumes pour qu'ils ne soient plus fermes. " "Ajoutez les alors au mélange de tomates et prolongez la cuisson sur tout petit feu pendant 10 min.\n" "Salez et poivrez si besoin.", self.harvester_class.instructions(), ) def test_ratings(self): self.assertEqual(4.8, self.harvester_class.ratings())
38.015385
114
0.607446
from recipe_scrapers.marmiton import Marmiton from tests import ScraperTest class TestMarmitonScraper(ScraperTest): scraper_class = Marmiton def test_host(self): self.assertEqual("marmiton.org", self.harvester_class.host()) def test_canonical_url(self): self.assertEqual( "https://www.marmiton.org/recettes/recette_ratatouille_23223.aspx", self.harvester_class.canonical_url(), ) def test_title(self): self.assertEqual(self.harvester_class.title(), "Ratatouille") def test_total_time(self): self.assertEqual(80, self.harvester_class.total_time()) def test_yields(self): self.assertEqual("4 personnes", self.harvester_class.yields()) def test_ingredients(self): self.assertCountEqual( [ "350 g d'aubergine", "350 g de courgette", "350 g de poivron de couleur rouge et vert", "350 g d'oignon", "500 g de tomate bien mûres", "3 gousses d'ail", "6 cuillères à soupe d'huile d'olive", "1 brin de thym", "1 feuille de laurier", "poivre", "sel", ], self.harvester_class.ingredients(), ) def test_instructions(self): return self.assertEqual( "Coupez les tomates pelées en quartiers,\n" "les aubergines et les courgettes en rondelles.\n" "Emincez les poivrons en lamelles\n" "et l'oignon en rouelles.\n" "Chauffez 2 cuillères à soupe d'huile dans une poêle\n" "et faites-y fondre les oignons et les poivrons.\n" "Lorsqu'ils sont tendres, ajoutez les tomates, l'ail haché, le thym et le laurier.\n" "Salez, poivrez et laissez mijoter doucement à couvert durant 45 minutes.\n" "Pendant ce temps, préparez les aubergines et les courgettes. " "Faites les cuire séparemment ou non dans l'huile d'olive pendant 15 minutes.\n" "Vérifiez la cuisson des légumes pour qu'ils ne soient plus fermes. " "Ajoutez les alors au mélange de tomates et prolongez la cuisson sur tout petit feu pendant 10 min.\n" "Salez et poivrez si besoin.", self.harvester_class.instructions(), ) def test_ratings(self): self.assertEqual(4.8, self.harvester_class.ratings())
true
true
1c4564ec45018750930b24c198003bce822d9fed
2,333
py
Python
script.py
jornix/Stavanger-school-learning-results
9974cac4ebb91ea51b0437f8b7750feac3049804
[ "MIT" ]
null
null
null
script.py
jornix/Stavanger-school-learning-results
9974cac4ebb91ea51b0437f8b7750feac3049804
[ "MIT" ]
null
null
null
script.py
jornix/Stavanger-school-learning-results
9974cac4ebb91ea51b0437f8b7750feac3049804
[ "MIT" ]
null
null
null
import pandas as pd from matplotlib import pyplot as plt import seaborn as sns # Read csv and store in dataframe df df = pd.read_csv("results.csv") df.drop(["index"], axis=1).reset_index(drop=True) # Separate fifth grade tests femte_trinn = df[ (df["statistikk"] == "Nasjonale prøver 5. trinn") & (pd.isna(df["verdi"]) == False) ].reset_index(drop=True) # Separate the different tests for fifth grade (engelsk, lesing, regning) femte_trinn_engelsk = femte_trinn[ (femte_trinn["indikator_delskar"] == "Engelsk") & (femte_trinn["kjonn"] == "Begge kjønn") ].reset_index(drop=True) femte_trinn_lesing = femte_trinn[ (femte_trinn["indikator_delskar"] == "Lesing") & (femte_trinn["kjonn"] == "Begge kjønn") ].reset_index(drop=True) femte_trinn_regning = femte_trinn[ (femte_trinn["indikator_delskar"] == "Regning") & (femte_trinn["kjonn"] == "Begge kjønn") ].reset_index(drop=True) # Set some seaborn estethic variables sns.set_theme(style="ticks", color_codes=True) sns.set_style("darkgrid") sns.set_context("paper") sns.set_palette("PiYG") # calculate and print boxplots to files fig, axes = plt.subplots(figsize=(10, 15)) fig.suptitle("Nasjonale prøver 5. trinn, spredning i resultater") sns.boxplot(data=femte_trinn_engelsk, x="verdi", y="enhetsnavn", palette="RdYlBu") sns.stripplot( data=femte_trinn_engelsk, x="verdi", y="enhetsnavn", palette="PRGn", hue="periode", ) axes.set_title("Engelsk") plt.savefig("plots/boxplot_femte_trinn_engelsk.png") fig, axes = plt.subplots(figsize=(10, 15)) fig.suptitle("Nasjonale prøver 5. trinn, spredning i resultater") sns.boxplot(data=femte_trinn_lesing, x="verdi", y="enhetsnavn", palette="RdYlBu") sns.stripplot( data=femte_trinn_lesing, x="verdi", y="enhetsnavn", palette="PRGn", hue="periode", ) axes.set_title("Lesing") plt.savefig("plots/boxplot_femte_trinn_lesing.png") fig, axes = plt.subplots(figsize=(10, 15)) fig.suptitle("Nasjonale prøver 5. trinn, spredning i resultater") sns.boxplot(data=femte_trinn_regning, x="verdi", y="enhetsnavn", palette="RdYlBu") sns.stripplot( data=femte_trinn_regning, x="verdi", y="enhetsnavn", palette="PRGn", hue="periode", ) axes.set_title("Regning") plt.savefig("plots/boxplot_femte_trinn_regning.png") # sns.despine(offset=10, trim=True) plt.show()
29.910256
87
0.717531
import pandas as pd from matplotlib import pyplot as plt import seaborn as sns df = pd.read_csv("results.csv") df.drop(["index"], axis=1).reset_index(drop=True) femte_trinn = df[ (df["statistikk"] == "Nasjonale prøver 5. trinn") & (pd.isna(df["verdi"]) == False) ].reset_index(drop=True) femte_trinn_engelsk = femte_trinn[ (femte_trinn["indikator_delskar"] == "Engelsk") & (femte_trinn["kjonn"] == "Begge kjønn") ].reset_index(drop=True) femte_trinn_lesing = femte_trinn[ (femte_trinn["indikator_delskar"] == "Lesing") & (femte_trinn["kjonn"] == "Begge kjønn") ].reset_index(drop=True) femte_trinn_regning = femte_trinn[ (femte_trinn["indikator_delskar"] == "Regning") & (femte_trinn["kjonn"] == "Begge kjønn") ].reset_index(drop=True) sns.set_theme(style="ticks", color_codes=True) sns.set_style("darkgrid") sns.set_context("paper") sns.set_palette("PiYG") fig, axes = plt.subplots(figsize=(10, 15)) fig.suptitle("Nasjonale prøver 5. trinn, spredning i resultater") sns.boxplot(data=femte_trinn_engelsk, x="verdi", y="enhetsnavn", palette="RdYlBu") sns.stripplot( data=femte_trinn_engelsk, x="verdi", y="enhetsnavn", palette="PRGn", hue="periode", ) axes.set_title("Engelsk") plt.savefig("plots/boxplot_femte_trinn_engelsk.png") fig, axes = plt.subplots(figsize=(10, 15)) fig.suptitle("Nasjonale prøver 5. trinn, spredning i resultater") sns.boxplot(data=femte_trinn_lesing, x="verdi", y="enhetsnavn", palette="RdYlBu") sns.stripplot( data=femte_trinn_lesing, x="verdi", y="enhetsnavn", palette="PRGn", hue="periode", ) axes.set_title("Lesing") plt.savefig("plots/boxplot_femte_trinn_lesing.png") fig, axes = plt.subplots(figsize=(10, 15)) fig.suptitle("Nasjonale prøver 5. trinn, spredning i resultater") sns.boxplot(data=femte_trinn_regning, x="verdi", y="enhetsnavn", palette="RdYlBu") sns.stripplot( data=femte_trinn_regning, x="verdi", y="enhetsnavn", palette="PRGn", hue="periode", ) axes.set_title("Regning") plt.savefig("plots/boxplot_femte_trinn_regning.png") plt.show()
true
true
1c4565b7ff36d1855854ec42200d3c17a32a5c55
1,561
py
Python
apps/wagtail/myblog/migrations/0002_auto_20210425_1951.py
aadrm/breakoutwagtail
cf4ce09153adf2b5e14f15ffbc82bda754d427b3
[ "MIT" ]
null
null
null
apps/wagtail/myblog/migrations/0002_auto_20210425_1951.py
aadrm/breakoutwagtail
cf4ce09153adf2b5e14f15ffbc82bda754d427b3
[ "MIT" ]
null
null
null
apps/wagtail/myblog/migrations/0002_auto_20210425_1951.py
aadrm/breakoutwagtail
cf4ce09153adf2b5e14f15ffbc82bda754d427b3
[ "MIT" ]
null
null
null
# Generated by Django 3.1.4 on 2021-04-25 19:51 import apps.wagtail.streams.blocks from django.db import migrations import wagtail.core.blocks import wagtail.core.fields import wagtail.images.blocks class Migration(migrations.Migration): dependencies = [ ('myblog', '0001_initial'), ] operations = [ migrations.AddField( model_name='blogpage', name='body_de', field=wagtail.core.fields.StreamField([('paragraph', wagtail.core.blocks.RichTextBlock()), ('image_text', wagtail.core.blocks.StructBlock([('reverse', wagtail.core.blocks.BooleanBlock(required=False)), ('text', wagtail.core.blocks.RichTextBlock()), ('image', wagtail.images.blocks.ImageChooserBlock())])), ('mymaps', apps.wagtail.streams.blocks.MyMapsBlock()), ('table', apps.wagtail.streams.blocks.CustomTableBlock()), ('spacer', apps.wagtail.streams.blocks.SpacerBlock())], blank=True, null=True), ), migrations.AddField( model_name='blogpage', name='body_en', field=wagtail.core.fields.StreamField([('paragraph', wagtail.core.blocks.RichTextBlock()), ('image_text', wagtail.core.blocks.StructBlock([('reverse', wagtail.core.blocks.BooleanBlock(required=False)), ('text', wagtail.core.blocks.RichTextBlock()), ('image', wagtail.images.blocks.ImageChooserBlock())])), ('mymaps', apps.wagtail.streams.blocks.MyMapsBlock()), ('table', apps.wagtail.streams.blocks.CustomTableBlock()), ('spacer', apps.wagtail.streams.blocks.SpacerBlock())], blank=True, null=True), ), ]
55.75
511
0.695708
import apps.wagtail.streams.blocks from django.db import migrations import wagtail.core.blocks import wagtail.core.fields import wagtail.images.blocks class Migration(migrations.Migration): dependencies = [ ('myblog', '0001_initial'), ] operations = [ migrations.AddField( model_name='blogpage', name='body_de', field=wagtail.core.fields.StreamField([('paragraph', wagtail.core.blocks.RichTextBlock()), ('image_text', wagtail.core.blocks.StructBlock([('reverse', wagtail.core.blocks.BooleanBlock(required=False)), ('text', wagtail.core.blocks.RichTextBlock()), ('image', wagtail.images.blocks.ImageChooserBlock())])), ('mymaps', apps.wagtail.streams.blocks.MyMapsBlock()), ('table', apps.wagtail.streams.blocks.CustomTableBlock()), ('spacer', apps.wagtail.streams.blocks.SpacerBlock())], blank=True, null=True), ), migrations.AddField( model_name='blogpage', name='body_en', field=wagtail.core.fields.StreamField([('paragraph', wagtail.core.blocks.RichTextBlock()), ('image_text', wagtail.core.blocks.StructBlock([('reverse', wagtail.core.blocks.BooleanBlock(required=False)), ('text', wagtail.core.blocks.RichTextBlock()), ('image', wagtail.images.blocks.ImageChooserBlock())])), ('mymaps', apps.wagtail.streams.blocks.MyMapsBlock()), ('table', apps.wagtail.streams.blocks.CustomTableBlock()), ('spacer', apps.wagtail.streams.blocks.SpacerBlock())], blank=True, null=True), ), ]
true
true
1c4565b95bce497665b69de99a26e49f66b582e5
416
py
Python
simple-backend/stave_backend/migrations/0002_document_ontology.py
mylibrar/stave
43145015253d0577dfc757419ad8b4fa06a04042
[ "Apache-2.0" ]
35
2020-01-29T04:21:10.000Z
2021-12-13T01:44:28.000Z
simple-backend/stave_backend/migrations/0002_document_ontology.py
mylibrar/stave
43145015253d0577dfc757419ad8b4fa06a04042
[ "Apache-2.0" ]
86
2020-04-17T16:36:13.000Z
2022-03-25T22:51:34.000Z
simple-backend/stave_backend/migrations/0002_document_ontology.py
mylibrar/stave
43145015253d0577dfc757419ad8b4fa06a04042
[ "Apache-2.0" ]
18
2020-02-04T17:40:02.000Z
2021-06-17T07:11:42.000Z
# Generated by Django 3.0.2 on 2020-01-13 18:22 from django.db import migrations, models class Migration(migrations.Migration): dependencies = [ ('stave_backend', '0001_initial'), ] operations = [ migrations.AddField( model_name='document', name='ontology', field=models.TextField(default=''), preserve_default=False, ), ]
20.8
47
0.586538
from django.db import migrations, models class Migration(migrations.Migration): dependencies = [ ('stave_backend', '0001_initial'), ] operations = [ migrations.AddField( model_name='document', name='ontology', field=models.TextField(default=''), preserve_default=False, ), ]
true
true
1c4565d7e382b201d1238aef00abd33b71ffbf9f
3,402
py
Python
src/tests/config_test.py
dixonwhitmire/lib-kafka
a29ec606278ad1ed8c5ada418e45593fe71dbaec
[ "Apache-2.0" ]
null
null
null
src/tests/config_test.py
dixonwhitmire/lib-kafka
a29ec606278ad1ed8c5ada418e45593fe71dbaec
[ "Apache-2.0" ]
6
2021-11-03T15:17:29.000Z
2021-11-05T14:10:56.000Z
src/tests/config_test.py
dixonwhitmire/lib-kafka
a29ec606278ad1ed8c5ada418e45593fe71dbaec
[ "Apache-2.0" ]
1
2021-11-01T12:21:11.000Z
2021-11-01T12:21:11.000Z
import os import pytest from pydantic import ValidationError from lib_kafka import config as configuration import importlib from tests import resources_directory @pytest.fixture(autouse=True) def reset(): reset_env_vars() def reset_env_vars(): for env_var in ("KAFKA_BROKER_CONFIG_FILE", "KAFKA_TOPIC_CONFIG_FILE"): if env_var in os.environ: del os.environ[env_var] def get_sample_config_path(file_name): return os.path.join(resources_directory, file_name) def test_kafka_settings_success_object(): settings = configuration.KafkaSettings( bootstrap_servers='test_server', group_id='test_group_id', security_protocol='test_protocol', enable_auto_commit=False, ssl_ca_location='test-location' ) assert settings is not None def test_kafka_settings_success_env_file(): os.environ["KAFKA_BROKER_CONFIG_FILE"] = get_sample_config_path('kafka.env') importlib.reload(configuration) settings = configuration.KafkaSettings() assert settings is not None settings_dict = settings.dict(by_alias=True) assert 'bootstrap.servers' in settings_dict.keys() and settings_dict['bootstrap.servers'] == 'localhost:9093' assert 'group.id' in settings_dict.keys() and settings_dict['group.id'] == 'kafka-listener' assert 'security.protocol' in settings_dict.keys() and settings_dict['security.protocol'] == 'PLAINTEXT' assert 'ssl.ca.location' in settings_dict.keys() and settings_dict[ 'ssl.ca.location'] == '/var/app/certs/kafka/tls.crt' assert 'enable.auto.commit' in settings_dict.keys() and not settings_dict['enable.auto.commit'] def test_kafka_settings_failures(): with pytest.raises(ValidationError): test_object = configuration.KafkaSettings( bootstrap_servers='test_server', group_id='test_group_id', security_protocol='test_protocol', ) with pytest.raises(ValidationError): test_object = configuration.KafkaSettings( bootstrap_servers='test_server', group_id='test_group_id', security_protocol='test_protocol', enable_auto_commit=False ) with pytest.raises(ValidationError): test_object = configuration.KafkaSettings( bootstrap_servers='test_server', group_id=32, security_protocol='test_protocol', enable_auto_commit=False, ssl_ca_location='test-location' ) def test_kafka_topics_success_parse(): topics = configuration.KafkaTopics.parse_file(get_sample_config_path('kafka-topic.json')) assert topics is not None assert len(topics.dict()['__root__']) == 3 def test_kafka_topic_success_object(): topic = configuration.KafkaTopic( name='test-topic', replication_factor=2, partitions=2, recreate_topic=False, operation=configuration.OperationEnum.create ) assert topic is not None assert topic.name == 'test-topic' def test_kafka_topic_failure_object(): with pytest.raises(KeyError): topic = configuration.KafkaTopic( name='test-topic', replication_factor='non-int', partitions=2, recreate_topic=False, operation=configuration.OperationEnum.create )
32.4
113
0.683422
import os import pytest from pydantic import ValidationError from lib_kafka import config as configuration import importlib from tests import resources_directory @pytest.fixture(autouse=True) def reset(): reset_env_vars() def reset_env_vars(): for env_var in ("KAFKA_BROKER_CONFIG_FILE", "KAFKA_TOPIC_CONFIG_FILE"): if env_var in os.environ: del os.environ[env_var] def get_sample_config_path(file_name): return os.path.join(resources_directory, file_name) def test_kafka_settings_success_object(): settings = configuration.KafkaSettings( bootstrap_servers='test_server', group_id='test_group_id', security_protocol='test_protocol', enable_auto_commit=False, ssl_ca_location='test-location' ) assert settings is not None def test_kafka_settings_success_env_file(): os.environ["KAFKA_BROKER_CONFIG_FILE"] = get_sample_config_path('kafka.env') importlib.reload(configuration) settings = configuration.KafkaSettings() assert settings is not None settings_dict = settings.dict(by_alias=True) assert 'bootstrap.servers' in settings_dict.keys() and settings_dict['bootstrap.servers'] == 'localhost:9093' assert 'group.id' in settings_dict.keys() and settings_dict['group.id'] == 'kafka-listener' assert 'security.protocol' in settings_dict.keys() and settings_dict['security.protocol'] == 'PLAINTEXT' assert 'ssl.ca.location' in settings_dict.keys() and settings_dict[ 'ssl.ca.location'] == '/var/app/certs/kafka/tls.crt' assert 'enable.auto.commit' in settings_dict.keys() and not settings_dict['enable.auto.commit'] def test_kafka_settings_failures(): with pytest.raises(ValidationError): test_object = configuration.KafkaSettings( bootstrap_servers='test_server', group_id='test_group_id', security_protocol='test_protocol', ) with pytest.raises(ValidationError): test_object = configuration.KafkaSettings( bootstrap_servers='test_server', group_id='test_group_id', security_protocol='test_protocol', enable_auto_commit=False ) with pytest.raises(ValidationError): test_object = configuration.KafkaSettings( bootstrap_servers='test_server', group_id=32, security_protocol='test_protocol', enable_auto_commit=False, ssl_ca_location='test-location' ) def test_kafka_topics_success_parse(): topics = configuration.KafkaTopics.parse_file(get_sample_config_path('kafka-topic.json')) assert topics is not None assert len(topics.dict()['__root__']) == 3 def test_kafka_topic_success_object(): topic = configuration.KafkaTopic( name='test-topic', replication_factor=2, partitions=2, recreate_topic=False, operation=configuration.OperationEnum.create ) assert topic is not None assert topic.name == 'test-topic' def test_kafka_topic_failure_object(): with pytest.raises(KeyError): topic = configuration.KafkaTopic( name='test-topic', replication_factor='non-int', partitions=2, recreate_topic=False, operation=configuration.OperationEnum.create )
true
true
1c4565e0dbfa4053de453a8497b1789732532024
1,386
py
Python
beorn_lib/version.py
PAntoine/beorn_lib
a5bb8859acfb136f33559b6ddbf3bb20f61bd310
[ "MIT" ]
null
null
null
beorn_lib/version.py
PAntoine/beorn_lib
a5bb8859acfb136f33559b6ddbf3bb20f61bd310
[ "MIT" ]
null
null
null
beorn_lib/version.py
PAntoine/beorn_lib
a5bb8859acfb136f33559b6ddbf3bb20f61bd310
[ "MIT" ]
null
null
null
#!/usr/bin/env python # -*- coding: utf-8 -*- #--------------------------------------------------------------------------------- # # ,--. # | |-. ,---. ,---. ,--.--.,--,--, # | .-. '| .-. :| .-. || .--'| \ # | `-' |\ --.' '-' '| | | || | # `---' `----' `---' `--' `--''--' # # file: version # desc: This file contains the versions of the library. # # author: Peter Antoine # date: 23/05/2015 #--------------------------------------------------------------------------------- # Copyright (c) 2015 Peter Antoine # All rights Reserved. # Released Under the MIT Licence #--------------------------------------------------------------------------------- #--------------------------------------------------------------------------------- # Python Standard Header #--------------------------------------------------------------------------------- __author__ = "Peter Antoine" __copyright__ = "Copyright 2014-2021, Peter Antoine" __credits__ = ["Peter Antoine"] __license__ = "MIT" __version__ = "1.5.0" __maintainer__ = "Peter Antoine" __email__ = "github@peterantoine.me.uk" __url__ = "https://github.com/PAntoine/BeornLib" __status__ = "Development" # vim: ts=4 sw=4 noexpandtab nocin ai
37.459459
82
0.328283
# `---' `----' `---' `--' `--''--' __author__ = "Peter Antoine" __copyright__ = "Copyright 2014-2021, Peter Antoine" __credits__ = ["Peter Antoine"] __license__ = "MIT" __version__ = "1.5.0" __maintainer__ = "Peter Antoine" __email__ = "github@peterantoine.me.uk" __url__ = "https://github.com/PAntoine/BeornLib" __status__ = "Development"
true
true
1c456664268f1c7c8973969844fb625e7b99c69c
6,122
py
Python
dmwmclient/restclient.py
FernandoGarzon/dmwmclient
aa69978b430f6626864718ddfa21951f2bb41d06
[ "BSD-3-Clause" ]
1
2022-02-01T16:06:15.000Z
2022-02-01T16:06:15.000Z
dmwmclient/restclient.py
FernandoGarzon/dmwmclient
aa69978b430f6626864718ddfa21951f2bb41d06
[ "BSD-3-Clause" ]
3
2020-03-04T23:34:39.000Z
2020-04-03T22:19:44.000Z
dmwmclient/restclient.py
nsmith-/dmwmclient
726a9400f5270e0521dc9d2c1bffed3c0af410a2
[ "BSD-3-Clause" ]
4
2020-03-17T15:39:10.000Z
2021-06-10T22:51:11.000Z
import os import logging import json import httpx import asyncio from lxml import etree from . import __version__ logger = logging.getLogger(__name__) def locate_proxycert(): """Find a user proxy""" path = os.getenv("X509_USER_PROXY") if path is not None: return path path = "/tmp/x509up_u%d" % os.getuid() if os.path.exists(path): return path return None def _defaultcert(): """Find a suitable user certificate from the usual locations Preference is given to original user certificate over a proxy as this is necessary for use with CERN SSO. """ path = ( os.path.expanduser("~/.globus/usercert.pem"), os.path.expanduser("~/.globus/userkey.pem"), ) if os.path.exists(path[0]) and os.path.exists(path[1]): return path path = locate_proxycert() if path is not None: return path raise RuntimeError("Could not identify an appropriate default user certificate") class RESTClient: defaults = { # Location of user x509 certificate, key pair "usercert": _defaultcert(), # Location of trusted x509 certificates "certdir": os.getenv("X509_CERT_DIR", "/etc/grid-security/certificates"), } def __init__(self, usercert=None, certdir=None): if usercert is None: usercert = RESTClient.defaults["usercert"] if certdir is None: certdir = RESTClient.defaults["certdir"] certdir = os.path.expanduser(certdir) self._ssoevents = {} self._client = httpx.AsyncClient( cert=usercert, verify=certdir, timeout=httpx.Timeout(10.0, read_timeout=30.0), headers=httpx.Headers({"User-Agent": f"python-dmwmclient/{__version__}"}), ) async def cern_sso_check(self, host): """Check if this host already has an SSO action in progress, and wait for it""" try: await self._ssoevents[host].wait() return True except KeyError: pass return False async def cern_sso_follow(self, result, host): """Follow CERN SSO redirect, returning the result of the original request""" html = etree.HTML(result.content) links = [ link for link in html.xpath("//a") if link.text == "Sign in using your CERN Certificate" ] if len(links) == 1: link = links.pop() logger.debug("Running first-time CERN SSO sign-in routine") self._ssoevents[host] = asyncio.Event() url = result.url.join(link.attrib["href"]) result = await self._client.get(url) if not result.status_code == 200: logger.debug("Return content:\n" + result.text) raise IOError( "HTTP status code %d received while following SSO link to %r" % (result.status_code, url) ) html = etree.HTML(result.content) url = result.url.join(html.xpath("body/form")[0].attrib["action"]) data = { el.attrib["name"]: el.attrib["value"] for el in html.xpath("body/form/input") } result = await self._client.post(url, data=data) if not result.status_code == 200: logger.debug("Return content:\n" + result.text) raise IOError( "HTTP status code %d received while posting to SSO link %r" % (result.status_code, url) ) logger.debug( "Received SSO cookie for %s: %r" % (host, dict(result.history[0].cookies)) ) self._ssoevents[host].set() del self._ssoevents[host] return result form = html.xpath("body/form") if len(form) == 1: logger.debug("Following CERN SSO redirect") url = result.url.join(form[0].attrib["action"]) data = { el.attrib["name"]: el.attrib["value"] for el in html.xpath("body/form/input") } result = await self._client.post(url, data=data) logger.debug( "Received SSO cookie for %s: %r" % (host, dict(result.history[0].cookies)) ) return result logger.debug("Invalid SSO login page content:\n" + result.text) raise RuntimeError( "Could not parse CERN SSO login page (no sign-in link or auto-redirect found)" ) def build_request(self, **params): return self._client.build_request(**params) async def send(self, request, timeout=None, retries=1): await self.cern_sso_check(request.url.host) # Looking forward to https://github.com/encode/httpx/pull/784 while retries > 0: try: result = await self._client.send(request, timeout=timeout) if result.status_code == 200 and result.url.host == "login.cern.ch": if await self.cern_sso_check(request.url.host): self._client.cookies.set_cookie_header(request) continue result = await self.cern_sso_follow(result, request.url.host) return result except httpx.TimeoutException: logging.warning( "Timeout encountered while executing request %r" % request ) retries -= 1 raise IOError( "Exhausted %d retries while executing request %r" % (retries, request) ) async def getjson(self, url, params=None, timeout=None, retries=1): request = self.build_request(method="GET", url=url, params=params) result = await self.send(request, timeout=timeout, retries=retries) try: return result.json() except json.JSONDecodeError: logging.debug("Result content: {result.text}") raise IOError(f"Failed to decode json for request {request}")
37.329268
90
0.571219
import os import logging import json import httpx import asyncio from lxml import etree from . import __version__ logger = logging.getLogger(__name__) def locate_proxycert(): path = os.getenv("X509_USER_PROXY") if path is not None: return path path = "/tmp/x509up_u%d" % os.getuid() if os.path.exists(path): return path return None def _defaultcert(): path = ( os.path.expanduser("~/.globus/usercert.pem"), os.path.expanduser("~/.globus/userkey.pem"), ) if os.path.exists(path[0]) and os.path.exists(path[1]): return path path = locate_proxycert() if path is not None: return path raise RuntimeError("Could not identify an appropriate default user certificate") class RESTClient: defaults = { "usercert": _defaultcert(), "certdir": os.getenv("X509_CERT_DIR", "/etc/grid-security/certificates"), } def __init__(self, usercert=None, certdir=None): if usercert is None: usercert = RESTClient.defaults["usercert"] if certdir is None: certdir = RESTClient.defaults["certdir"] certdir = os.path.expanduser(certdir) self._ssoevents = {} self._client = httpx.AsyncClient( cert=usercert, verify=certdir, timeout=httpx.Timeout(10.0, read_timeout=30.0), headers=httpx.Headers({"User-Agent": f"python-dmwmclient/{__version__}"}), ) async def cern_sso_check(self, host): try: await self._ssoevents[host].wait() return True except KeyError: pass return False async def cern_sso_follow(self, result, host): html = etree.HTML(result.content) links = [ link for link in html.xpath("//a") if link.text == "Sign in using your CERN Certificate" ] if len(links) == 1: link = links.pop() logger.debug("Running first-time CERN SSO sign-in routine") self._ssoevents[host] = asyncio.Event() url = result.url.join(link.attrib["href"]) result = await self._client.get(url) if not result.status_code == 200: logger.debug("Return content:\n" + result.text) raise IOError( "HTTP status code %d received while following SSO link to %r" % (result.status_code, url) ) html = etree.HTML(result.content) url = result.url.join(html.xpath("body/form")[0].attrib["action"]) data = { el.attrib["name"]: el.attrib["value"] for el in html.xpath("body/form/input") } result = await self._client.post(url, data=data) if not result.status_code == 200: logger.debug("Return content:\n" + result.text) raise IOError( "HTTP status code %d received while posting to SSO link %r" % (result.status_code, url) ) logger.debug( "Received SSO cookie for %s: %r" % (host, dict(result.history[0].cookies)) ) self._ssoevents[host].set() del self._ssoevents[host] return result form = html.xpath("body/form") if len(form) == 1: logger.debug("Following CERN SSO redirect") url = result.url.join(form[0].attrib["action"]) data = { el.attrib["name"]: el.attrib["value"] for el in html.xpath("body/form/input") } result = await self._client.post(url, data=data) logger.debug( "Received SSO cookie for %s: %r" % (host, dict(result.history[0].cookies)) ) return result logger.debug("Invalid SSO login page content:\n" + result.text) raise RuntimeError( "Could not parse CERN SSO login page (no sign-in link or auto-redirect found)" ) def build_request(self, **params): return self._client.build_request(**params) async def send(self, request, timeout=None, retries=1): await self.cern_sso_check(request.url.host) while retries > 0: try: result = await self._client.send(request, timeout=timeout) if result.status_code == 200 and result.url.host == "login.cern.ch": if await self.cern_sso_check(request.url.host): self._client.cookies.set_cookie_header(request) continue result = await self.cern_sso_follow(result, request.url.host) return result except httpx.TimeoutException: logging.warning( "Timeout encountered while executing request %r" % request ) retries -= 1 raise IOError( "Exhausted %d retries while executing request %r" % (retries, request) ) async def getjson(self, url, params=None, timeout=None, retries=1): request = self.build_request(method="GET", url=url, params=params) result = await self.send(request, timeout=timeout, retries=retries) try: return result.json() except json.JSONDecodeError: logging.debug("Result content: {result.text}") raise IOError(f"Failed to decode json for request {request}")
true
true
1c4566b1e1aee1b8f0aa8bfb88df64b92879f477
7,636
py
Python
sdk/python/pulumi_azure_native/network/v20180301/get_profile.py
sebtelko/pulumi-azure-native
711ec021b5c73da05611c56c8a35adb0ce3244e4
[ "Apache-2.0" ]
null
null
null
sdk/python/pulumi_azure_native/network/v20180301/get_profile.py
sebtelko/pulumi-azure-native
711ec021b5c73da05611c56c8a35adb0ce3244e4
[ "Apache-2.0" ]
null
null
null
sdk/python/pulumi_azure_native/network/v20180301/get_profile.py
sebtelko/pulumi-azure-native
711ec021b5c73da05611c56c8a35adb0ce3244e4
[ "Apache-2.0" ]
null
null
null
# coding=utf-8 # *** WARNING: this file was generated by the Pulumi SDK Generator. *** # *** Do not edit by hand unless you're certain you know what you are doing! *** import warnings import pulumi import pulumi.runtime from typing import Any, Mapping, Optional, Sequence, Union, overload from ... import _utilities from . import outputs __all__ = [ 'GetProfileResult', 'AwaitableGetProfileResult', 'get_profile', ] @pulumi.output_type class GetProfileResult: """ Class representing a Traffic Manager profile. """ def __init__(__self__, dns_config=None, endpoints=None, id=None, location=None, monitor_config=None, name=None, profile_status=None, tags=None, traffic_routing_method=None, traffic_view_enrollment_status=None, type=None): if dns_config and not isinstance(dns_config, dict): raise TypeError("Expected argument 'dns_config' to be a dict") pulumi.set(__self__, "dns_config", dns_config) if endpoints and not isinstance(endpoints, list): raise TypeError("Expected argument 'endpoints' to be a list") pulumi.set(__self__, "endpoints", endpoints) if id and not isinstance(id, str): raise TypeError("Expected argument 'id' to be a str") pulumi.set(__self__, "id", id) if location and not isinstance(location, str): raise TypeError("Expected argument 'location' to be a str") pulumi.set(__self__, "location", location) if monitor_config and not isinstance(monitor_config, dict): raise TypeError("Expected argument 'monitor_config' to be a dict") pulumi.set(__self__, "monitor_config", monitor_config) if name and not isinstance(name, str): raise TypeError("Expected argument 'name' to be a str") pulumi.set(__self__, "name", name) if profile_status and not isinstance(profile_status, str): raise TypeError("Expected argument 'profile_status' to be a str") pulumi.set(__self__, "profile_status", profile_status) if tags and not isinstance(tags, dict): raise TypeError("Expected argument 'tags' to be a dict") pulumi.set(__self__, "tags", tags) if traffic_routing_method and not isinstance(traffic_routing_method, str): raise TypeError("Expected argument 'traffic_routing_method' to be a str") pulumi.set(__self__, "traffic_routing_method", traffic_routing_method) if traffic_view_enrollment_status and not isinstance(traffic_view_enrollment_status, str): raise TypeError("Expected argument 'traffic_view_enrollment_status' to be a str") pulumi.set(__self__, "traffic_view_enrollment_status", traffic_view_enrollment_status) if type and not isinstance(type, str): raise TypeError("Expected argument 'type' to be a str") pulumi.set(__self__, "type", type) @property @pulumi.getter(name="dnsConfig") def dns_config(self) -> Optional['outputs.DnsConfigResponse']: """ The DNS settings of the Traffic Manager profile. """ return pulumi.get(self, "dns_config") @property @pulumi.getter def endpoints(self) -> Optional[Sequence['outputs.EndpointResponse']]: """ The list of endpoints in the Traffic Manager profile. """ return pulumi.get(self, "endpoints") @property @pulumi.getter def id(self) -> Optional[str]: """ Fully qualified resource Id for the resource. Ex - /subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/trafficManagerProfiles/{resourceName} """ return pulumi.get(self, "id") @property @pulumi.getter def location(self) -> Optional[str]: """ The Azure Region where the resource lives """ return pulumi.get(self, "location") @property @pulumi.getter(name="monitorConfig") def monitor_config(self) -> Optional['outputs.MonitorConfigResponse']: """ The endpoint monitoring settings of the Traffic Manager profile. """ return pulumi.get(self, "monitor_config") @property @pulumi.getter def name(self) -> Optional[str]: """ The name of the resource """ return pulumi.get(self, "name") @property @pulumi.getter(name="profileStatus") def profile_status(self) -> Optional[str]: """ The status of the Traffic Manager profile. """ return pulumi.get(self, "profile_status") @property @pulumi.getter def tags(self) -> Optional[Mapping[str, str]]: """ Resource tags. """ return pulumi.get(self, "tags") @property @pulumi.getter(name="trafficRoutingMethod") def traffic_routing_method(self) -> Optional[str]: """ The traffic routing method of the Traffic Manager profile. """ return pulumi.get(self, "traffic_routing_method") @property @pulumi.getter(name="trafficViewEnrollmentStatus") def traffic_view_enrollment_status(self) -> Optional[str]: """ Indicates whether Traffic View is 'Enabled' or 'Disabled' for the Traffic Manager profile. Null, indicates 'Disabled'. Enabling this feature will increase the cost of the Traffic Manage profile. """ return pulumi.get(self, "traffic_view_enrollment_status") @property @pulumi.getter def type(self) -> Optional[str]: """ The type of the resource. Ex- Microsoft.Network/trafficManagerProfiles. """ return pulumi.get(self, "type") class AwaitableGetProfileResult(GetProfileResult): # pylint: disable=using-constant-test def __await__(self): if False: yield self return GetProfileResult( dns_config=self.dns_config, endpoints=self.endpoints, id=self.id, location=self.location, monitor_config=self.monitor_config, name=self.name, profile_status=self.profile_status, tags=self.tags, traffic_routing_method=self.traffic_routing_method, traffic_view_enrollment_status=self.traffic_view_enrollment_status, type=self.type) def get_profile(profile_name: Optional[str] = None, resource_group_name: Optional[str] = None, opts: Optional[pulumi.InvokeOptions] = None) -> AwaitableGetProfileResult: """ Class representing a Traffic Manager profile. :param str profile_name: The name of the Traffic Manager profile. :param str resource_group_name: The name of the resource group containing the Traffic Manager profile. """ __args__ = dict() __args__['profileName'] = profile_name __args__['resourceGroupName'] = resource_group_name if opts is None: opts = pulumi.InvokeOptions() if opts.version is None: opts.version = _utilities.get_version() __ret__ = pulumi.runtime.invoke('azure-native:network/v20180301:getProfile', __args__, opts=opts, typ=GetProfileResult).value return AwaitableGetProfileResult( dns_config=__ret__.dns_config, endpoints=__ret__.endpoints, id=__ret__.id, location=__ret__.location, monitor_config=__ret__.monitor_config, name=__ret__.name, profile_status=__ret__.profile_status, tags=__ret__.tags, traffic_routing_method=__ret__.traffic_routing_method, traffic_view_enrollment_status=__ret__.traffic_view_enrollment_status, type=__ret__.type)
38.761421
225
0.667234
import warnings import pulumi import pulumi.runtime from typing import Any, Mapping, Optional, Sequence, Union, overload from ... import _utilities from . import outputs __all__ = [ 'GetProfileResult', 'AwaitableGetProfileResult', 'get_profile', ] @pulumi.output_type class GetProfileResult: def __init__(__self__, dns_config=None, endpoints=None, id=None, location=None, monitor_config=None, name=None, profile_status=None, tags=None, traffic_routing_method=None, traffic_view_enrollment_status=None, type=None): if dns_config and not isinstance(dns_config, dict): raise TypeError("Expected argument 'dns_config' to be a dict") pulumi.set(__self__, "dns_config", dns_config) if endpoints and not isinstance(endpoints, list): raise TypeError("Expected argument 'endpoints' to be a list") pulumi.set(__self__, "endpoints", endpoints) if id and not isinstance(id, str): raise TypeError("Expected argument 'id' to be a str") pulumi.set(__self__, "id", id) if location and not isinstance(location, str): raise TypeError("Expected argument 'location' to be a str") pulumi.set(__self__, "location", location) if monitor_config and not isinstance(monitor_config, dict): raise TypeError("Expected argument 'monitor_config' to be a dict") pulumi.set(__self__, "monitor_config", monitor_config) if name and not isinstance(name, str): raise TypeError("Expected argument 'name' to be a str") pulumi.set(__self__, "name", name) if profile_status and not isinstance(profile_status, str): raise TypeError("Expected argument 'profile_status' to be a str") pulumi.set(__self__, "profile_status", profile_status) if tags and not isinstance(tags, dict): raise TypeError("Expected argument 'tags' to be a dict") pulumi.set(__self__, "tags", tags) if traffic_routing_method and not isinstance(traffic_routing_method, str): raise TypeError("Expected argument 'traffic_routing_method' to be a str") pulumi.set(__self__, "traffic_routing_method", traffic_routing_method) if traffic_view_enrollment_status and not isinstance(traffic_view_enrollment_status, str): raise TypeError("Expected argument 'traffic_view_enrollment_status' to be a str") pulumi.set(__self__, "traffic_view_enrollment_status", traffic_view_enrollment_status) if type and not isinstance(type, str): raise TypeError("Expected argument 'type' to be a str") pulumi.set(__self__, "type", type) @property @pulumi.getter(name="dnsConfig") def dns_config(self) -> Optional['outputs.DnsConfigResponse']: return pulumi.get(self, "dns_config") @property @pulumi.getter def endpoints(self) -> Optional[Sequence['outputs.EndpointResponse']]: return pulumi.get(self, "endpoints") @property @pulumi.getter def id(self) -> Optional[str]: return pulumi.get(self, "id") @property @pulumi.getter def location(self) -> Optional[str]: return pulumi.get(self, "location") @property @pulumi.getter(name="monitorConfig") def monitor_config(self) -> Optional['outputs.MonitorConfigResponse']: return pulumi.get(self, "monitor_config") @property @pulumi.getter def name(self) -> Optional[str]: return pulumi.get(self, "name") @property @pulumi.getter(name="profileStatus") def profile_status(self) -> Optional[str]: return pulumi.get(self, "profile_status") @property @pulumi.getter def tags(self) -> Optional[Mapping[str, str]]: return pulumi.get(self, "tags") @property @pulumi.getter(name="trafficRoutingMethod") def traffic_routing_method(self) -> Optional[str]: return pulumi.get(self, "traffic_routing_method") @property @pulumi.getter(name="trafficViewEnrollmentStatus") def traffic_view_enrollment_status(self) -> Optional[str]: return pulumi.get(self, "traffic_view_enrollment_status") @property @pulumi.getter def type(self) -> Optional[str]: return pulumi.get(self, "type") class AwaitableGetProfileResult(GetProfileResult): # pylint: disable=using-constant-test def __await__(self): if False: yield self return GetProfileResult( dns_config=self.dns_config, endpoints=self.endpoints, id=self.id, location=self.location, monitor_config=self.monitor_config, name=self.name, profile_status=self.profile_status, tags=self.tags, traffic_routing_method=self.traffic_routing_method, traffic_view_enrollment_status=self.traffic_view_enrollment_status, type=self.type) def get_profile(profile_name: Optional[str] = None, resource_group_name: Optional[str] = None, opts: Optional[pulumi.InvokeOptions] = None) -> AwaitableGetProfileResult: __args__ = dict() __args__['profileName'] = profile_name __args__['resourceGroupName'] = resource_group_name if opts is None: opts = pulumi.InvokeOptions() if opts.version is None: opts.version = _utilities.get_version() __ret__ = pulumi.runtime.invoke('azure-native:network/v20180301:getProfile', __args__, opts=opts, typ=GetProfileResult).value return AwaitableGetProfileResult( dns_config=__ret__.dns_config, endpoints=__ret__.endpoints, id=__ret__.id, location=__ret__.location, monitor_config=__ret__.monitor_config, name=__ret__.name, profile_status=__ret__.profile_status, tags=__ret__.tags, traffic_routing_method=__ret__.traffic_routing_method, traffic_view_enrollment_status=__ret__.traffic_view_enrollment_status, type=__ret__.type)
true
true
1c45678f9f69f1c3e03546028ce022e51687f2b5
48,532
py
Python
hytra/core/hypothesesgraph.py
m-novikov/hytra
0dc28deaa2571fa8bea63ca178f0e53cc1cd7508
[ "MIT" ]
null
null
null
hytra/core/hypothesesgraph.py
m-novikov/hytra
0dc28deaa2571fa8bea63ca178f0e53cc1cd7508
[ "MIT" ]
null
null
null
hytra/core/hypothesesgraph.py
m-novikov/hytra
0dc28deaa2571fa8bea63ca178f0e53cc1cd7508
[ "MIT" ]
null
null
null
import logging import copy import networkx as nx import numpy as np from sklearn.neighbors import KDTree import hytra.core.jsongraph from hytra.core.jsongraph import negLog, listify from hytra.util.progressbar import DefaultProgressVisitor logger = logging.getLogger(__name__) def getTraxelFeatureVector(traxel, featureName, maxNumDimensions=3): """ extract a feature vector from a traxel """ result = [] for i in range(maxNumDimensions): try: result.append(traxel.get_feature_value(str(featureName), i)) except: if i == 0: logger.error( f"Error when accessing feature {featureName}[{i}] for " f"traxel (Id={traxel.Id},Timestep={traxel.Timestep})" ) logger.error(traxel.print_available_features()) raise Exception else: logger.error( f"Error: Classifier was trained with less merger than maxNumObjects {maxNumDimensions}." ) raise Exception return result class NodeMap: """ To access per node features of the hypotheses graph, this node map provides the same interface as pgmlink's NodeMaps """ def __init__(self, graph: nx.DiGraph, attributeName): assert isinstance(graph, nx.DiGraph), "Expecting the graph to be directed" self.__graph = graph self.__attributeName = attributeName def __getitem__(self, key): return self.__graph.nodes[key][self.__attributeName] class HypothesesGraph: """ Replacement for pgmlink's hypotheses graph, with a similar API so it can be used as drop-in replacement. Internally it uses [networkx](http://networkx.github.io/) to construct the graph. Use the insertEnergies() method to populate the nodes and arcs with the energies for different configurations (according to DPCT's JSON style'), derived from given probability generation functions. **Notes:** `self._graph.node`'s are indexed by tuples (int(timestep), int(id)), and contain either a single `'traxel'` attribute, or a list of traxels in `'tracklet'`. Nodes also get a unique ID assigned once they are added to the graph. """ def __init__(self): self._graph = nx.DiGraph() self.withTracklets = False self.allowLengthOneTracks = True self._nextNodeUuid = 0 self.progressVisitor = DefaultProgressVisitor() def nodeIterator(self): return self._graph.nodes() def arcIterator(self): return self._graph.edges() def countNodes(self): return self._graph.number_of_nodes() def countArcs(self): return self._graph.number_of_edges() def hasNode(self, node): return self._graph.has_node(node) def hasEdge(self, u, v): return self._graph.has_edge(u, v) @staticmethod def source(edge): return edge[0] @staticmethod def target(edge): return edge[1] def _findNearestNeighbors( self, kdtreeObjectPair, traxel, numNeighbors, maxNeighborDist ): """ Return a list of object IDs which are the 'numNeighbors' closest elements in the kdtree less than maxNeighborDist away of the traxel. """ kdtree, objectIdList = kdtreeObjectPair if len(objectIdList) <= numNeighbors: return objectIdList distances, neighbors = kdtree.query( [self._extractCenter(traxel)], k=numNeighbors, return_distance=True ) return [ objectIdList[index] for distance, index in zip(distances[0], neighbors[0]) if distance < maxNeighborDist ] def _extractCenter(self, traxel): try: # python probabilityGenerator if "com" in traxel.Features: return traxel.Features["com"] else: return traxel.Features["RegionCenter"] except: # C++ pgmlink probabilityGenerator try: return getTraxelFeatureVector(traxel, "com") except: try: return getTraxelFeatureVector(traxel, "RegionCenter") except: raise ValueError( "given traxel (t={},id={}) does not have " '"com" or "RegionCenter"'.format(traxel.Timestep, traxel.Id) ) def _traxelMightDivide(self, traxel, divisionThreshold): assert "divProb" in traxel.Features return traxel.Features["divProb"][0] > divisionThreshold def _buildFrameKdTree(self, traxelDict): """ Collect the centers of all traxels and their ids of this frame's traxels. Then build a kdtree and return (kdtree, listOfObjectIdsInFrame), where the second argument is needed to decode the object id of the nearest neighbors in _findNearestNeighbors(). """ objectIdList = [] features = [] for obj, traxel in traxelDict.items(): if obj == 0: continue objectIdList.append(obj) features.append(list(self._extractCenter(traxel))) return (KDTree(features, metric="euclidean"), objectIdList) def _addNodesForFrame(self, frame, traxelDict): """ Insert nodes for all objects in this frame, with the attribute "traxel" """ for obj, traxel in traxelDict.items(): if obj == 0: continue self._graph.add_node((frame, obj), traxel=traxel, id=self._nextNodeUuid) self._nextNodeUuid += 1 def addNodeFromTraxel(self, traxel, **kwargs): """ Insert a single node specified by a traxel. All keyword arguments are passed to the node as well. """ assert traxel is not None assert not self.withTracklets self._graph.add_node( (traxel.Timestep, traxel.Id), traxel=traxel, id=self._nextNodeUuid, **kwargs ) self._nextNodeUuid += 1 def buildFromProbabilityGenerator( self, probabilityGenerator, maxNeighborDist=200, numNearestNeighbors=1, forwardBackwardCheck=True, withDivisions=True, divisionThreshold=0.1, skipLinks=1, ): """ Takes a python probabilityGenerator containing traxel features and finds probable links between frames. Builds a kdTree with the 'numNearestneighbors' for each frame and adds the nodes. In the same iteration, it adds a number of 'skipLinks' between the nodes separated by 'skipLinks' frames. """ assert probabilityGenerator is not None assert len(probabilityGenerator.TraxelsPerFrame) > 0 assert skipLinks > 0 def checkNodeWhileAddingLinks(frame, obj): if (frame, obj) not in self._graph: logger.warning( "Adding node ({}, {}) when setting up links".format(frame, obj) ) kdTreeFrames = [None] * (skipLinks + 1) # len(probabilityGenerator.TraxelsPerFrame.keys()) is NOT an indicator for the total number of frames, # because an empty frame does not create a key in the dictionary. E.g. for one frame in the middle of the # dataset, we won't access the last one. # Idea: take the max key in the dict. Remember, frame numbering starts with 0. frameMax = max(probabilityGenerator.TraxelsPerFrame.keys()) frameMin = min(probabilityGenerator.TraxelsPerFrame.keys()) numFrames = frameMax - frameMin + 1 self.progressVisitor.showState("Probability Generator") countFrames = 0 for frame in range(numFrames): countFrames += 1 self.progressVisitor.showProgress(countFrames / float(numFrames)) if frame > 0: del kdTreeFrames[0] # this is the current frame if ( frame + skipLinks < numFrames and frameMin + frame + skipLinks in probabilityGenerator.TraxelsPerFrame.keys() ): kdTreeFrames.append( self._buildFrameKdTree( probabilityGenerator.TraxelsPerFrame[ frameMin + frame + skipLinks ] ) ) self._addNodesForFrame( frameMin + frame + skipLinks, probabilityGenerator.TraxelsPerFrame[ frameMin + frame + skipLinks ], ) else: for i in range(0, skipLinks + 1): if ( frameMin + frame + i in probabilityGenerator.TraxelsPerFrame.keys() ): # empty frame kdTreeFrames[i] = self._buildFrameKdTree( probabilityGenerator.TraxelsPerFrame[frameMin + frame + i] ) self._addNodesForFrame( frameMin + frame + i, probabilityGenerator.TraxelsPerFrame[frameMin + frame + i], ) # find forward links if ( frameMin + frame in probabilityGenerator.TraxelsPerFrame.keys() ): # 'frame' could be empty for obj, traxel in probabilityGenerator.TraxelsPerFrame[ frameMin + frame ].items(): divisionPreservingNumNearestNeighbors = numNearestNeighbors if ( divisionPreservingNumNearestNeighbors < 2 and withDivisions and self._traxelMightDivide(traxel, divisionThreshold) ): divisionPreservingNumNearestNeighbors = 2 for i in range(1, skipLinks + 1): if ( frame + i < numFrames and frameMin + frame + i in probabilityGenerator.TraxelsPerFrame.keys() ): neighbors = self._findNearestNeighbors( kdTreeFrames[i], traxel, divisionPreservingNumNearestNeighbors, maxNeighborDist, ) # type(neighbors) is list for n in neighbors: edge_start = (frameMin + frame, obj) edge_end = (frameMin + frame + i, n) checkNodeWhileAddingLinks(*edge_start) checkNodeWhileAddingLinks(*edge_end) self._graph.add_edge(edge_start, edge_end) self._graph.edges[edge_start, edge_end][ "src" ] = self._graph.nodes[edge_start]["id"] self._graph.edges[edge_start, edge_end][ "dest" ] = self._graph.nodes[edge_end]["id"] # find backward links if forwardBackwardCheck: for i in range(1, skipLinks + 1): if frame + i < numFrames: if ( frameMin + frame + i in probabilityGenerator.TraxelsPerFrame.keys() ): # empty frame for obj, traxel in probabilityGenerator.TraxelsPerFrame[ frameMin + frame + i ].items(): if kdTreeFrames[0] is not None: neighbors = self._findNearestNeighbors( kdTreeFrames[0], traxel, numNearestNeighbors, maxNeighborDist, ) for n in neighbors: edge_start = (frameMin + frame, n) edge_end = (frameMin + frame + i, obj) checkNodeWhileAddingLinks(*edge_start) checkNodeWhileAddingLinks(*edge_end) self._graph.add_edge(edge_start, edge_end) self._graph.edges[edge_start, edge_end][ "src" ] = self._graph.nodes[edge_start]["id"] self._graph.edges[edge_start, edge_end][ "dest" ] = self._graph.nodes[edge_end]["id"] def generateTrackletGraph(self): """ **Return** a new hypotheses graph where chains of detections with only one possible incoming/outgoing transition are contracted into one node in the graph. The returned graph will have `withTracklets` set to `True`! The `'tracklet'` node map contains a list of traxels that each node represents. """ logger.info("generating tracklet graph...") tracklet_graph = copy.copy(self) tracklet_graph._graph = tracklet_graph._graph.copy() tracklet_graph.withTracklets = True tracklet_graph.referenceTraxelGraph = self tracklet_graph.progressVisitor = self.progressVisitor self.progressVisitor.showState("Initializing Tracklet Graph") # initialize tracklet map to contain a list of only one traxel per node countNodes = 0 numNodes = tracklet_graph.countNodes() for node in tracklet_graph._graph.nodes(): countNodes += 1 self.progressVisitor.showProgress(countNodes / float(numNodes)) tracklet_graph._graph.nodes[node]["tracklet"] = [ tracklet_graph._graph.nodes[node]["traxel"] ] del tracklet_graph._graph.nodes[node]["traxel"] # set up a list of links that indicates whether the target's in- and source's out-degree # are one, meaning the edge can be contracted links_to_be_contracted = [] node_remapping = {} self.progressVisitor.showState("Finding Tracklets in Graph") countEdges = 0 numEdges = tracklet_graph.countArcs() for edge in tracklet_graph._graph.edges(): countEdges += 1 self.progressVisitor.showProgress(countEdges / float(numEdges)) if ( tracklet_graph._graph.out_degree(edge[0]) == 1 and tracklet_graph._graph.in_degree(edge[1]) == 1 ): links_to_be_contracted.append(edge) for i in [0, 1]: node_remapping[edge[i]] = edge[i] # apply edge contraction self.progressVisitor.showState("Contracting Edges in Tracklet Graph") countLinks = 0 numLinks = len(links_to_be_contracted) for edge in links_to_be_contracted: countLinks += 1 self.progressVisitor.showProgress(countLinks / float(numLinks)) src = node_remapping[edge[0]] dest = node_remapping[edge[1]] if ( tracklet_graph._graph.in_degree(src) == 0 and tracklet_graph._graph.out_degree(dest) == 0 ): # if this tracklet would contract to a single node without incoming or outgoing edges, # then do NOT contract, as our tracking cannot handle length-one-tracks continue tracklet_graph._graph.nodes[src]["tracklet"].extend( tracklet_graph._graph.nodes[dest]["tracklet"] ) # duplicate out arcs with new source for out_edge in tracklet_graph._graph.out_edges(dest): tracklet_graph._graph.add_edge(src, out_edge[1]) # adjust node remapping to point to new source for all contracted traxels for t in tracklet_graph._graph.nodes[dest]["tracklet"]: node_remapping[(t.Timestep, t.Id)] = src tracklet_graph._graph.remove_node(dest) logger.info( "tracklet graph has {} nodes and {} edges (before {},{})".format( tracklet_graph.countNodes(), tracklet_graph.countArcs(), self.countNodes(), self.countArcs(), ) ) return tracklet_graph def getNodeTraxelMap(self): return NodeMap(self._graph, "traxel") def getNodeTrackletMap(self): return NodeMap(self._graph, "tracklet") def insertEnergies( self, maxNumObjects, detectionProbabilityFunc, transitionProbabilityFunc, boundaryCostMultiplierFunc, divisionProbabilityFunc, skipLinksBias, ): """ Insert energies for detections, divisions and links into the hypotheses graph, by transforming the probabilities for certain events (given by the `*ProbabilityFunc`-functions per traxel) into energies. If the given graph contained tracklets (`self.withTracklets is True`), then also the probabilities over all contained traxels will be accumulated for those nodes in the graph. The energies are stored in the networkx graph under the following attribute names (to match the format for solvers): * detection energies: `self._graph.nodes[n]['features']` * division energies: `self._graph.nodes[n]['divisionFeatures']` * appearance energies: `self._graph.nodes[n]['appearanceFeatures']` * disappearance energies: `self._graph.nodes[n]['disappearanceFeatures']` * transition energies: `self._graph.edges[src][dest]['features']` * additionally we also store the timestep (range for traxels) per node as `timestep` attribute ** Parameters: ** * `maxNumObjects`: the max number of objects per detections * `detectionProbabilityFunc`: should take a traxel and return its detection probabilities ([prob0objects, prob1object,...]) * `transitionProbabilityFunc`: should take two traxels and return this link's probabilities ([prob0objectsInTransition, prob1objectsInTransition,...]) * `boundaryCostMultiplierFunc`: should take a traxel and a boolean that is true if we are seeking for an appearance cost multiplier, false for disappearance, and return a scalar multiplier between 0 and 1 for the appearance/disappearance cost that depends on the traxel's distance to the spacial and time boundary * `divisionProbabilityFunc`: should take a traxel and return its division probabilities ([probNoDiv, probDiv]) """ numElements = self._graph.number_of_nodes() + self._graph.number_of_edges() self.progressVisitor.showState("Inserting energies") # insert detection probabilities for all detections (and some also get a div probability) countElements = 0 for n in self._graph.nodes(): countElements += 1 if not self.withTracklets: # only one traxel, but make it a list so everything below works the same traxels = [self._graph.nodes[n]["traxel"]] else: traxels = self._graph.nodes[n]["tracklet"] # accumulate features over all contained traxels previousTraxel = None detectionFeatures = np.zeros(maxNumObjects + 1) for t in traxels: detectionFeatures += np.array(negLog(detectionProbabilityFunc(t))) if previousTraxel is not None: detectionFeatures += np.array( negLog(transitionProbabilityFunc(previousTraxel, t)) ) previousTraxel = t detectionFeatures = listify(list(detectionFeatures)) # division only if probability is big enough divisionFeatures = divisionProbabilityFunc(traxels[-1]) if divisionFeatures is not None: divisionFeatures = listify(negLog(divisionFeatures)) # appearance/disappearance appearanceFeatures = listify( [0.0] + [boundaryCostMultiplierFunc(traxels[0], True)] * maxNumObjects ) disappearanceFeatures = listify( [0.0] + [boundaryCostMultiplierFunc(traxels[-1], False)] * maxNumObjects ) self._graph.nodes[n]["features"] = detectionFeatures if divisionFeatures is not None: self._graph.nodes[n]["divisionFeatures"] = divisionFeatures self._graph.nodes[n]["appearanceFeatures"] = appearanceFeatures self._graph.nodes[n]["disappearanceFeatures"] = disappearanceFeatures self._graph.nodes[n]["timestep"] = [ traxels[0].Timestep, traxels[-1].Timestep, ] self.progressVisitor.showProgress(countElements / float(numElements)) # insert transition probabilities for all links for a in self._graph.edges(): countElements += 1 self.progressVisitor.showProgress(countElements / float(numElements)) if not self.withTracklets: srcTraxel = self._graph.nodes[self.source(a)]["traxel"] destTraxel = self._graph.nodes[self.target(a)]["traxel"] else: srcTraxel = self._graph.nodes[self.source(a)]["tracklet"][ -1 ] # src is last of the traxels in source tracklet destTraxel = self._graph.nodes[self.target(a)]["tracklet"][ 0 ] # dest is first of traxels in destination tracklet features = listify(negLog(transitionProbabilityFunc(srcTraxel, destTraxel))) # add feature for additional Frames. Since we do not want these edges to be primarily taken, we add a bias to the edge. Now: hard coded, future: parameter frame_gap = destTraxel.Timestep - srcTraxel.Timestep # 1. method if frame_gap > 1: features[1][0] = features[1][0] + skipLinksBias * frame_gap # # 2. method # # introduce a new energies like: [[6], [15]] -> [[6, 23], [15, 23]] for first links and # # [[6], [15]] -> [[23, 6], [23, 15]] for second links, and so on for 3rd order links # # !!! this will introduce a new weight in the weight.json file. For the 2nd link, comes in 2nd row and so on. # # drawback: did not manage to adjust parameter to get sensible results. # for feat in features: # for i in range(frame_gap): # feat.append(23) # if frame_gap > 1: # feat[frame_gap-1], feat[0] = feat[0], feat[frame_gap-1] self._graph.edges[a[0], a[1]]["src"] = self._graph.nodes[a[0]]["id"] self._graph.edges[a[0], a[1]]["dest"] = self._graph.nodes[a[1]]["id"] self._graph.edges[a[0], a[1]]["features"] = features def getMappingsBetweenUUIDsAndTraxels(self): """ Extract the mapping from UUID to traxel and vice versa from the networkx graph. ** Returns: a tuple of ** * `traxelIdPerTimestepToUniqueIdMap`: a dictionary of the structure `{str(timestep):{str(labelimageId):int(uuid), str(labelimageId):int(uuid), ...}, str(nextTimestep):{}, ...}` * `uuidToTraxelMap`: a dictionary with keys = int(uuid), values = list(of timestep-Id-tuples (int(Timestep), int(Id))) """ uuidToTraxelMap = {} traxelIdPerTimestepToUniqueIdMap = {} for n in self._graph.nodes(): uuid = self._graph.nodes[n]["id"] traxels = [] if self.withTracklets: traxels = self._graph.nodes[n]["tracklet"] else: traxels = [self._graph.nodes[n]["traxel"]] uuidToTraxelMap[uuid] = [(t.Timestep, t.Id) for t in traxels] for t in uuidToTraxelMap[uuid]: traxelIdPerTimestepToUniqueIdMap.setdefault(str(t[0]), {})[ str(t[1]) ] = uuid # sort the list of traxels per UUID by their timesteps for v in uuidToTraxelMap.values(): v.sort(key=lambda timestepIdTuple: timestepIdTuple[0]) return traxelIdPerTimestepToUniqueIdMap, uuidToTraxelMap def toTrackingGraph(self, noFeatures=False): """ Create a dictionary representation of this graph which can be passed to the solvers directly. The resulting graph (=model) is wrapped within a `hytra.jsongraph.JsonTrackingGraph` structure for convenience. If `noFeatures` is `True`, then only the structure of the graph will be exported. """ requiredNodeAttribs = ["id"] requiredLinkAttribs = ["src", "dest"] if not noFeatures: requiredNodeAttribs.append("features") requiredLinkAttribs.append("features") def translateNodeToDict(n): result = {} attrs = self._graph.nodes[n] for k in [ "id", "features", "appearanceFeatures", "disappearanceFeatures", "divisionFeatures", "timestep", ]: if k in attrs: result[k] = attrs[k] elif k in requiredNodeAttribs: raise ValueError( "Cannot use graph nodes without assigned ID and features, run insertEnergies() first" ) return result def translateLinkToDict(l): result = {} attrs = self._graph.edges[l[0], l[1]] for k in ["src", "dest", "features"]: if k in attrs: result[k] = attrs[k] elif k in requiredLinkAttribs: raise ValueError( "Cannot use graph links without source, target, and features, run insertEnergies() first" ) return result traxelIdPerTimestepToUniqueIdMap, _ = self.getMappingsBetweenUUIDsAndTraxels() model = { "segmentationHypotheses": [ translateNodeToDict(n) for n in self._graph.nodes() ], "linkingHypotheses": [translateLinkToDict(e) for e in self._graph.edges()], "divisionHypotheses": [], "traxelToUniqueId": traxelIdPerTimestepToUniqueIdMap, "settings": { "statesShareWeights": True, "allowPartialMergerAppearance": False, "requireSeparateChildrenOfDivision": True, "optimizerEpGap": 0.01, "optimizerVerbose": True, "optimizerNumThreads": 1, }, } # extract exclusion sets: exclusions = set([]) for n in self._graph.nodes(): if self.withTracklets: traxel = self._graph.nodes[n]["tracklet"][0] else: traxel = self._graph.nodes[n]["traxel"] if traxel.conflictingTraxelIds is not None: if self.withTracklets: logger.error( "Exclusion constraints do not work with tracklets yet!" ) conflictingIds = [ traxelIdPerTimestepToUniqueIdMap[str(traxel.Timestep)][str(i)] for i in traxel.conflictingTraxelIds ] myId = traxelIdPerTimestepToUniqueIdMap[str(traxel.Timestep)][ str(traxel.Id) ] for ci in conflictingIds: # insert pairwise exclusion constraints only, and always put the lower id first if ci < myId: exclusions.add((ci, myId)) else: exclusions.add((myId, ci)) model["exclusions"] = [list(t) for t in exclusions] # TODO: this recomputes the uuidToTraxelMap even though we have it already... trackingGraph = hytra.core.jsongraph.JsonTrackingGraph( model=model, progressVisitor=self.progressVisitor ) return trackingGraph def insertSolution(self, resultDictionary): """ Add solution values to nodes and arcs from dictionary representation of solution. The resulting graph (=model) gets an additional property "value" that represents the number of objects inside a detection/arc Additionally a division indicator is saved in the node property "divisionValue". The link also gets a new attribute: the gap that is covered. E.g. 1, if consecutive timeframes, 2 if link skipping one timeframe. """ assert isinstance(self._graph, nx.DiGraph), "Expecting the graph to be directed" _, uuidToTraxelMap = self.getMappingsBetweenUUIDsAndTraxels() if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self # reset all values for n in traxelgraph._graph.nodes(): traxelgraph._graph.nodes[n]["value"] = 0 traxelgraph._graph.nodes[n]["divisionValue"] = False for e in traxelgraph._graph.edges(): traxelgraph._graph.edges[e[0], e[1]]["value"] = 0 # store values from dict for detection in resultDictionary["detectionResults"]: traxels = uuidToTraxelMap[detection["id"]] for traxel in traxels: traxelgraph._graph.nodes[traxel]["value"] = detection["value"] for internal_edge in zip(traxels, traxels[1:]): traxelgraph._graph.edges[internal_edge[0], internal_edge[1]][ "value" ] = detection["value"] if ( "linkingResults" in resultDictionary and resultDictionary["linkingResults"] is not None ): for link in resultDictionary["linkingResults"]: source, dest = ( uuidToTraxelMap[link["src"]][-1], uuidToTraxelMap[link["dest"]][0], ) if (source in traxelgraph._graph.predecessors(dest)) and ( dest in traxelgraph._graph.neighbors(source) ): traxelgraph._graph.edges[source, dest]["value"] = link["value"] traxelgraph._graph.edges[source, dest]["gap"] = dest[0] - source[0] if ( "divisionResults" in resultDictionary and resultDictionary["divisionResults"] is not None ): for division in resultDictionary["divisionResults"]: traxelgraph._graph.nodes[uuidToTraxelMap[division["id"]][-1]][ "divisionValue" ] = division["value"] def getSolutionDictionary(self): """ Return the solution encoded in the `value` and `divisionValue` attributes of nodes and edges as a python dictionary in the style that can be saved to JSON or sent to our solvers as ground truths. """ resultDictionary = {} if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self detectionList = [] divisionList = [] linkList = [] def checkAttributeValue(element, attribName, default): if attribName in element: return element[attribName] else: return default for n in traxelgraph._graph.nodes(): newDetection = {} newDetection["id"] = traxelgraph._graph.nodes[n]["id"] newDetection["value"] = checkAttributeValue( traxelgraph._graph.nodes[n], "value", 0 ) detectionList.append(newDetection) if "divisionValue" in traxelgraph._graph.nodes[n]: newDivsion = {} newDivsion["id"] = traxelgraph._graph.nodes[n]["id"] newDivsion["value"] = checkAttributeValue( traxelgraph._graph.nodes[n], "divisionValue", False ) divisionList.append(newDivsion) for a in traxelgraph.arcIterator(): newLink = {} src = self.source(a) dest = self.target(a) newLink["src"] = traxelgraph._graph.nodes[src]["id"] newLink["dest"] = traxelgraph._graph.nodes[dest]["id"] newLink["value"] = checkAttributeValue( traxelgraph._graph.edges[src, dest], "value", 0 ) newLink["gap"] = checkAttributeValue( traxelgraph._graph.edges[src, dest], "gap", 1 ) linkList.append(newLink) resultDictionary["detectionResults"] = detectionList resultDictionary["linkingResults"] = linkList resultDictionary["divisionResults"] = divisionList return resultDictionary def countIncomingObjects(self, node): """ Once a solution was written to the graph, this returns the number of incoming objects of a node, and the number of active incoming edges. If the latter is greater than 1, this shows that we have a merger. """ numberOfIncomingObject = 0 numberOfIncomingEdges = 0 for in_edge in self._graph.in_edges(node): if "value" in self._graph.edges[in_edge[0], node]: numberOfIncomingObject += self._graph.edges[in_edge[0], node]["value"] numberOfIncomingEdges += 1 return numberOfIncomingObject, numberOfIncomingEdges def countOutgoingObjects(self, node): """ Once a solution was written to the graph, this returns the number of outgoing objects of a node, and the number of active outgoing edges. If the latter is greater than 1, this shows that we have a merger splitting up, or a division. """ numberOfOutgoingObject = 0 numberOfOutgoingEdges = 0 for out_edge in self._graph.out_edges(node): if ( "value" in self._graph.edges[node, out_edge[1]] and self._graph.edges[node, out_edge[1]]["value"] > 0 ): numberOfOutgoingObject += self._graph.edges[node, out_edge[1]]["value"] numberOfOutgoingEdges += 1 return numberOfOutgoingObject, numberOfOutgoingEdges def computeLineage(self, firstTrackId=2, firstLineageId=2, skipLinks=1): """ computes lineage and track id for every node in the graph """ update_queue = [] # start lineages / tracks at 2, because 0 means background=black, 1 means misdetection in ilastik max_lineage_id = firstLineageId max_track_id = firstTrackId if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self self.progressVisitor.showState("Compute lineage") # find start of lineages numElements = 2 * traxelgraph.countNodes() countElements = 0 for n in traxelgraph.nodeIterator(): countElements += 1 self.progressVisitor.showProgress(countElements / float(numElements)) if ( traxelgraph.countIncomingObjects(n)[0] == 0 and "value" in traxelgraph._graph.nodes[n] and traxelgraph._graph.nodes[n]["value"] > 0 and ( self.allowLengthOneTracks or traxelgraph.countOutgoingObjects(n)[0] > 0 ) ): # found start of a track update_queue.append((n, max_lineage_id, max_track_id)) max_lineage_id += 1 max_track_id += 1 else: traxelgraph._graph.nodes[n]["lineageId"] = None traxelgraph._graph.nodes[n]["trackId"] = None while len(update_queue) > 0: countElements += 1 current_node, lineage_id, track_id = update_queue.pop() self.progressVisitor.showProgress(countElements / float(numElements)) # if we did not run merger resolving, it can happen that we reach a node several times, # and would propagate the new lineage+track IDs to all descendants again! We simply # stop propagating in that case and just use the lineageID that reached the node first. if ( traxelgraph._graph.nodes[current_node].get("lineageId", None) is not None and traxelgraph._graph.nodes[current_node].get("trackId", None) is not None ): logger.debug("Several tracks are merging here, stopping a later one") continue # set a new trackID traxelgraph._graph.nodes[current_node]["lineageId"] = lineage_id traxelgraph._graph.nodes[current_node]["trackId"] = track_id numberOfOutgoingObject, numberOfOutgoingEdges = traxelgraph.countOutgoingObjects( current_node ) if numberOfOutgoingObject != numberOfOutgoingEdges: logger.warning( "running lineage computation on unresolved graphs depends on a race condition" ) if ( "divisionValue" in traxelgraph._graph.nodes[current_node] and traxelgraph._graph.nodes[current_node]["divisionValue"] ): assert traxelgraph.countOutgoingObjects(current_node)[1] == 2 traxelgraph._graph.nodes[current_node]["children"] = [] for a in traxelgraph._graph.out_edges(current_node): if ( "value" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["value"] > 0 ): traxelgraph._graph.nodes[a[1]]["gap"] = skipLinks traxelgraph._graph.nodes[current_node]["children"].append(a[1]) traxelgraph._graph.nodes[a[1]]["parent"] = current_node update_queue.append( (traxelgraph.target(a), lineage_id, max_track_id) ) max_track_id += 1 else: if traxelgraph.countOutgoingObjects(current_node)[1] > 1: logger.debug( "Found merger splitting into several objects, propagating lineage and track to all descendants!" ) for a in traxelgraph._graph.out_edges(current_node): if ( "value" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["value"] > 0 ): if ( "gap" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["gap"] == 1 ) or "gap" not in traxelgraph._graph.edges[current_node, a[1]]: traxelgraph._graph.nodes[a[1]]["gap"] = 1 update_queue.append( (traxelgraph.target(a), lineage_id, track_id) ) if ( "gap" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["gap"] > 1 ): traxelgraph._graph.nodes[a[1]]["gap"] = skipLinks traxelgraph._graph.nodes[a[1]]["gap_parent"] = current_node update_queue.append( (traxelgraph.target(a), lineage_id, max_track_id) ) max_track_id += 1 def pruneGraphToSolution(self, distanceToSolution=0): """ creates a new pruned HypothesesGraph that around the result. Assumes that value==0 corresponds to unlabeled parts of the graph. distanceToSolution determines how many negative examples are included distanceToSolution = 0: only include negative edges that connect used objects distanceToSolution = 1: additionally include edges that connect used objects with unlabeled objects """ prunedGraph = HypothesesGraph() for n in self.nodeIterator(): if "value" in self._graph.nodes[n] and self._graph.nodes[n]["value"] > 0: prunedGraph._graph.add_node(n, **self._graph.nodes[n]) for e in self.arcIterator(): src = self.source(e) dest = self.target(e) if distanceToSolution == 0: if src in prunedGraph._graph and dest in prunedGraph._graph: prunedGraph._graph.add_edge( src, dest, **self._graph.edges[src, dest] ) # TODO: can be optimized by looping over the pruned graph nodes(might sacrifice readability) for distance in range(1, distanceToSolution + 1): for e in self.arcIterator(): src = self.source(e) dest = self.target(e) if src in prunedGraph._graph or dest in prunedGraph._graph: prunedGraph._graph.add_node(src, **self._graph.nodes[src]) prunedGraph._graph.add_node(dest, **self._graph.nodes[dest]) prunedGraph._graph.add_edge( src, dest, **self._graph.edges[src, dest] ) # in case a node is NOT an appearance and # has all the incoming edges with value 0, we remove all these incoming edges # # in case a node is NOT a disappearance and # has all the outgoing edges with value 0, we remove all these outgoing edges withAppearanceFeatures = True withDisappearanceFeatures = True withFeatures = True correctAppearanceFeatureLength = True correctDisappearanceFeatureLength = True correctFeatureLength = True maxNumObjects = None maxNumObjectsAppearance = None maxNumObjectsDisappearance = None for n in self.nodeIterator(): try: maxNumObjectsApp = len(self._graph.nodes[n]["appearanceFeatures"]) - 1 if maxNumObjectsAppearance is None: maxNumObjectsAppearance = maxNumObjectsApp elif not maxNumObjectsApp == maxNumObjectsAppearance: correctAppearanceFeatureLength = False logger.info( "Appearance/disappearance features have different lengths!" ) except: withAppearanceFeatures = False logger.info("There are no appearance features in node properties!") break try: maxNumObjectsDis = ( len(self._graph.nodes[n]["disappearanceFeatures"]) - 1 ) if maxNumObjectsDisappearance is None: maxNumObjectsDisappearance = maxNumObjectsDis elif not maxNumObjectsDis == maxNumObjectsDisappearance: correctDisappearanceFeatureLength = False logger.info("Disappearance features have different lengths!") except: withDisappearanceFeatures = False logger.info("There are no disappearance features in node properties!") break if withAppearanceFeatures and withDisappearanceFeatures: if ( correctAppearanceFeatureLength and correctDisappearanceFeatureLength and maxNumObjectsAppearance == maxNumObjectsDisappearance ): maxNumObjects = maxNumObjectsAppearance else: correctFeatureLength = False logger.info( "Appearance and disappearance features have different lengths!" ) else: withFeatures = False if withFeatures and correctFeatureLength: for n in self.nodeIterator(): if not ( "appearance" in self._graph.nodes[n].keys() and self._graph.nodes[n]["appearance"] ): allArcsWithValueZero = True in_edges = self._graph.in_edges(n) for edge in list(in_edges): if ( "value" in self._graph.edges[edge[0]][edge[1]].keys() and not self._graph.edges[edge[0]][edge[1]]["value"] == 0 ): allArcsWithValueZero = False break self._graph.nodes[n]["appearanceFeatures"] = listify( [0.0] + [0.0] * maxNumObjects ) if allArcsWithValueZero: if not in_edges == []: self._graph.remove_edges_from(in_edges) if not ( "disappearance" in self._graph.nodes[n].keys() and self._graph.nodes[n]["disappearance"] ): allArcsWithValueZero = True out_edges = self._graph.out_edges(n) for edge in list(out_edges): if ( "value" in self._graph.edges[edge[0]][edge[1]].keys() and not self._graph.edges[edge[0]][edge[1]]["value"] == 0 ): allArcsWithValueZero = False break self._graph.nodes[n]["disappearanceFeatures"] = listify( [0.0] + [0.0] * maxNumObjects ) if allArcsWithValueZero: if not out_edges == []: self._graph.remove_edges_from(out_edges) return prunedGraph def _getNodeAttribute(self, timestep, objectId, attribute): """ return some attribute of a certain node specified by timestep and objectId """ try: return self._graph.nodes[(int(timestep), int(objectId))][attribute] except KeyError: logger.error( attribute + " not found in graph node properties, call computeLineage() first!" ) raise def getLineageId(self, timestep, objectId): """ return the lineage Id of a certain node specified by timestep and objectId """ if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self return traxelgraph._getNodeAttribute(timestep, objectId, "lineageId") def getTrackId(self, timestep, objectId): """ return the track Id of a certain node specified by timestep and objectId """ if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self return traxelgraph._getNodeAttribute(timestep, objectId, "trackId")
43.643885
166
0.557879
import logging import copy import networkx as nx import numpy as np from sklearn.neighbors import KDTree import hytra.core.jsongraph from hytra.core.jsongraph import negLog, listify from hytra.util.progressbar import DefaultProgressVisitor logger = logging.getLogger(__name__) def getTraxelFeatureVector(traxel, featureName, maxNumDimensions=3): result = [] for i in range(maxNumDimensions): try: result.append(traxel.get_feature_value(str(featureName), i)) except: if i == 0: logger.error( f"Error when accessing feature {featureName}[{i}] for " f"traxel (Id={traxel.Id},Timestep={traxel.Timestep})" ) logger.error(traxel.print_available_features()) raise Exception else: logger.error( f"Error: Classifier was trained with less merger than maxNumObjects {maxNumDimensions}." ) raise Exception return result class NodeMap: def __init__(self, graph: nx.DiGraph, attributeName): assert isinstance(graph, nx.DiGraph), "Expecting the graph to be directed" self.__graph = graph self.__attributeName = attributeName def __getitem__(self, key): return self.__graph.nodes[key][self.__attributeName] class HypothesesGraph: def __init__(self): self._graph = nx.DiGraph() self.withTracklets = False self.allowLengthOneTracks = True self._nextNodeUuid = 0 self.progressVisitor = DefaultProgressVisitor() def nodeIterator(self): return self._graph.nodes() def arcIterator(self): return self._graph.edges() def countNodes(self): return self._graph.number_of_nodes() def countArcs(self): return self._graph.number_of_edges() def hasNode(self, node): return self._graph.has_node(node) def hasEdge(self, u, v): return self._graph.has_edge(u, v) @staticmethod def source(edge): return edge[0] @staticmethod def target(edge): return edge[1] def _findNearestNeighbors( self, kdtreeObjectPair, traxel, numNeighbors, maxNeighborDist ): kdtree, objectIdList = kdtreeObjectPair if len(objectIdList) <= numNeighbors: return objectIdList distances, neighbors = kdtree.query( [self._extractCenter(traxel)], k=numNeighbors, return_distance=True ) return [ objectIdList[index] for distance, index in zip(distances[0], neighbors[0]) if distance < maxNeighborDist ] def _extractCenter(self, traxel): try: if "com" in traxel.Features: return traxel.Features["com"] else: return traxel.Features["RegionCenter"] except: try: return getTraxelFeatureVector(traxel, "com") except: try: return getTraxelFeatureVector(traxel, "RegionCenter") except: raise ValueError( "given traxel (t={},id={}) does not have " '"com" or "RegionCenter"'.format(traxel.Timestep, traxel.Id) ) def _traxelMightDivide(self, traxel, divisionThreshold): assert "divProb" in traxel.Features return traxel.Features["divProb"][0] > divisionThreshold def _buildFrameKdTree(self, traxelDict): objectIdList = [] features = [] for obj, traxel in traxelDict.items(): if obj == 0: continue objectIdList.append(obj) features.append(list(self._extractCenter(traxel))) return (KDTree(features, metric="euclidean"), objectIdList) def _addNodesForFrame(self, frame, traxelDict): for obj, traxel in traxelDict.items(): if obj == 0: continue self._graph.add_node((frame, obj), traxel=traxel, id=self._nextNodeUuid) self._nextNodeUuid += 1 def addNodeFromTraxel(self, traxel, **kwargs): assert traxel is not None assert not self.withTracklets self._graph.add_node( (traxel.Timestep, traxel.Id), traxel=traxel, id=self._nextNodeUuid, **kwargs ) self._nextNodeUuid += 1 def buildFromProbabilityGenerator( self, probabilityGenerator, maxNeighborDist=200, numNearestNeighbors=1, forwardBackwardCheck=True, withDivisions=True, divisionThreshold=0.1, skipLinks=1, ): assert probabilityGenerator is not None assert len(probabilityGenerator.TraxelsPerFrame) > 0 assert skipLinks > 0 def checkNodeWhileAddingLinks(frame, obj): if (frame, obj) not in self._graph: logger.warning( "Adding node ({}, {}) when setting up links".format(frame, obj) ) kdTreeFrames = [None] * (skipLinks + 1) # Idea: take the max key in the dict. Remember, frame numbering starts with 0. frameMax = max(probabilityGenerator.TraxelsPerFrame.keys()) frameMin = min(probabilityGenerator.TraxelsPerFrame.keys()) numFrames = frameMax - frameMin + 1 self.progressVisitor.showState("Probability Generator") countFrames = 0 for frame in range(numFrames): countFrames += 1 self.progressVisitor.showProgress(countFrames / float(numFrames)) if frame > 0: del kdTreeFrames[0] # this is the current frame if ( frame + skipLinks < numFrames and frameMin + frame + skipLinks in probabilityGenerator.TraxelsPerFrame.keys() ): kdTreeFrames.append( self._buildFrameKdTree( probabilityGenerator.TraxelsPerFrame[ frameMin + frame + skipLinks ] ) ) self._addNodesForFrame( frameMin + frame + skipLinks, probabilityGenerator.TraxelsPerFrame[ frameMin + frame + skipLinks ], ) else: for i in range(0, skipLinks + 1): if ( frameMin + frame + i in probabilityGenerator.TraxelsPerFrame.keys() ): # empty frame kdTreeFrames[i] = self._buildFrameKdTree( probabilityGenerator.TraxelsPerFrame[frameMin + frame + i] ) self._addNodesForFrame( frameMin + frame + i, probabilityGenerator.TraxelsPerFrame[frameMin + frame + i], ) # find forward links if ( frameMin + frame in probabilityGenerator.TraxelsPerFrame.keys() ): # 'frame' could be empty for obj, traxel in probabilityGenerator.TraxelsPerFrame[ frameMin + frame ].items(): divisionPreservingNumNearestNeighbors = numNearestNeighbors if ( divisionPreservingNumNearestNeighbors < 2 and withDivisions and self._traxelMightDivide(traxel, divisionThreshold) ): divisionPreservingNumNearestNeighbors = 2 for i in range(1, skipLinks + 1): if ( frame + i < numFrames and frameMin + frame + i in probabilityGenerator.TraxelsPerFrame.keys() ): neighbors = self._findNearestNeighbors( kdTreeFrames[i], traxel, divisionPreservingNumNearestNeighbors, maxNeighborDist, ) # type(neighbors) is list for n in neighbors: edge_start = (frameMin + frame, obj) edge_end = (frameMin + frame + i, n) checkNodeWhileAddingLinks(*edge_start) checkNodeWhileAddingLinks(*edge_end) self._graph.add_edge(edge_start, edge_end) self._graph.edges[edge_start, edge_end][ "src" ] = self._graph.nodes[edge_start]["id"] self._graph.edges[edge_start, edge_end][ "dest" ] = self._graph.nodes[edge_end]["id"] # find backward links if forwardBackwardCheck: for i in range(1, skipLinks + 1): if frame + i < numFrames: if ( frameMin + frame + i in probabilityGenerator.TraxelsPerFrame.keys() ): # empty frame for obj, traxel in probabilityGenerator.TraxelsPerFrame[ frameMin + frame + i ].items(): if kdTreeFrames[0] is not None: neighbors = self._findNearestNeighbors( kdTreeFrames[0], traxel, numNearestNeighbors, maxNeighborDist, ) for n in neighbors: edge_start = (frameMin + frame, n) edge_end = (frameMin + frame + i, obj) checkNodeWhileAddingLinks(*edge_start) checkNodeWhileAddingLinks(*edge_end) self._graph.add_edge(edge_start, edge_end) self._graph.edges[edge_start, edge_end][ "src" ] = self._graph.nodes[edge_start]["id"] self._graph.edges[edge_start, edge_end][ "dest" ] = self._graph.nodes[edge_end]["id"] def generateTrackletGraph(self): logger.info("generating tracklet graph...") tracklet_graph = copy.copy(self) tracklet_graph._graph = tracklet_graph._graph.copy() tracklet_graph.withTracklets = True tracklet_graph.referenceTraxelGraph = self tracklet_graph.progressVisitor = self.progressVisitor self.progressVisitor.showState("Initializing Tracklet Graph") # initialize tracklet map to contain a list of only one traxel per node countNodes = 0 numNodes = tracklet_graph.countNodes() for node in tracklet_graph._graph.nodes(): countNodes += 1 self.progressVisitor.showProgress(countNodes / float(numNodes)) tracklet_graph._graph.nodes[node]["tracklet"] = [ tracklet_graph._graph.nodes[node]["traxel"] ] del tracklet_graph._graph.nodes[node]["traxel"] # set up a list of links that indicates whether the target's in- and source's out-degree # are one, meaning the edge can be contracted links_to_be_contracted = [] node_remapping = {} self.progressVisitor.showState("Finding Tracklets in Graph") countEdges = 0 numEdges = tracklet_graph.countArcs() for edge in tracklet_graph._graph.edges(): countEdges += 1 self.progressVisitor.showProgress(countEdges / float(numEdges)) if ( tracklet_graph._graph.out_degree(edge[0]) == 1 and tracklet_graph._graph.in_degree(edge[1]) == 1 ): links_to_be_contracted.append(edge) for i in [0, 1]: node_remapping[edge[i]] = edge[i] # apply edge contraction self.progressVisitor.showState("Contracting Edges in Tracklet Graph") countLinks = 0 numLinks = len(links_to_be_contracted) for edge in links_to_be_contracted: countLinks += 1 self.progressVisitor.showProgress(countLinks / float(numLinks)) src = node_remapping[edge[0]] dest = node_remapping[edge[1]] if ( tracklet_graph._graph.in_degree(src) == 0 and tracklet_graph._graph.out_degree(dest) == 0 ): # if this tracklet would contract to a single node without incoming or outgoing edges, # then do NOT contract, as our tracking cannot handle length-one-tracks continue tracklet_graph._graph.nodes[src]["tracklet"].extend( tracklet_graph._graph.nodes[dest]["tracklet"] ) # duplicate out arcs with new source for out_edge in tracklet_graph._graph.out_edges(dest): tracklet_graph._graph.add_edge(src, out_edge[1]) # adjust node remapping to point to new source for all contracted traxels for t in tracklet_graph._graph.nodes[dest]["tracklet"]: node_remapping[(t.Timestep, t.Id)] = src tracklet_graph._graph.remove_node(dest) logger.info( "tracklet graph has {} nodes and {} edges (before {},{})".format( tracklet_graph.countNodes(), tracklet_graph.countArcs(), self.countNodes(), self.countArcs(), ) ) return tracklet_graph def getNodeTraxelMap(self): return NodeMap(self._graph, "traxel") def getNodeTrackletMap(self): return NodeMap(self._graph, "tracklet") def insertEnergies( self, maxNumObjects, detectionProbabilityFunc, transitionProbabilityFunc, boundaryCostMultiplierFunc, divisionProbabilityFunc, skipLinksBias, ): numElements = self._graph.number_of_nodes() + self._graph.number_of_edges() self.progressVisitor.showState("Inserting energies") # insert detection probabilities for all detections (and some also get a div probability) countElements = 0 for n in self._graph.nodes(): countElements += 1 if not self.withTracklets: # only one traxel, but make it a list so everything below works the same traxels = [self._graph.nodes[n]["traxel"]] else: traxels = self._graph.nodes[n]["tracklet"] # accumulate features over all contained traxels previousTraxel = None detectionFeatures = np.zeros(maxNumObjects + 1) for t in traxels: detectionFeatures += np.array(negLog(detectionProbabilityFunc(t))) if previousTraxel is not None: detectionFeatures += np.array( negLog(transitionProbabilityFunc(previousTraxel, t)) ) previousTraxel = t detectionFeatures = listify(list(detectionFeatures)) # division only if probability is big enough divisionFeatures = divisionProbabilityFunc(traxels[-1]) if divisionFeatures is not None: divisionFeatures = listify(negLog(divisionFeatures)) # appearance/disappearance appearanceFeatures = listify( [0.0] + [boundaryCostMultiplierFunc(traxels[0], True)] * maxNumObjects ) disappearanceFeatures = listify( [0.0] + [boundaryCostMultiplierFunc(traxels[-1], False)] * maxNumObjects ) self._graph.nodes[n]["features"] = detectionFeatures if divisionFeatures is not None: self._graph.nodes[n]["divisionFeatures"] = divisionFeatures self._graph.nodes[n]["appearanceFeatures"] = appearanceFeatures self._graph.nodes[n]["disappearanceFeatures"] = disappearanceFeatures self._graph.nodes[n]["timestep"] = [ traxels[0].Timestep, traxels[-1].Timestep, ] self.progressVisitor.showProgress(countElements / float(numElements)) # insert transition probabilities for all links for a in self._graph.edges(): countElements += 1 self.progressVisitor.showProgress(countElements / float(numElements)) if not self.withTracklets: srcTraxel = self._graph.nodes[self.source(a)]["traxel"] destTraxel = self._graph.nodes[self.target(a)]["traxel"] else: srcTraxel = self._graph.nodes[self.source(a)]["tracklet"][ -1 ] # src is last of the traxels in source tracklet destTraxel = self._graph.nodes[self.target(a)]["tracklet"][ 0 ] # dest is first of traxels in destination tracklet features = listify(negLog(transitionProbabilityFunc(srcTraxel, destTraxel))) # add feature for additional Frames. Since we do not want these edges to be primarily taken, we add a bias to the edge. Now: hard coded, future: parameter frame_gap = destTraxel.Timestep - srcTraxel.Timestep # 1. method if frame_gap > 1: features[1][0] = features[1][0] + skipLinksBias * frame_gap # # 2. method # # introduce a new energies like: [[6], [15]] -> [[6, 23], [15, 23]] for first links and # # [[6], [15]] -> [[23, 6], [23, 15]] for second links, and so on for 3rd order links # # !!! this will introduce a new weight in the weight.json file. For the 2nd link, comes in 2nd row and so on. # # drawback: did not manage to adjust parameter to get sensible results. # for feat in features: # for i in range(frame_gap): # feat.append(23) # if frame_gap > 1: # feat[frame_gap-1], feat[0] = feat[0], feat[frame_gap-1] self._graph.edges[a[0], a[1]]["src"] = self._graph.nodes[a[0]]["id"] self._graph.edges[a[0], a[1]]["dest"] = self._graph.nodes[a[1]]["id"] self._graph.edges[a[0], a[1]]["features"] = features def getMappingsBetweenUUIDsAndTraxels(self): uuidToTraxelMap = {} traxelIdPerTimestepToUniqueIdMap = {} for n in self._graph.nodes(): uuid = self._graph.nodes[n]["id"] traxels = [] if self.withTracklets: traxels = self._graph.nodes[n]["tracklet"] else: traxels = [self._graph.nodes[n]["traxel"]] uuidToTraxelMap[uuid] = [(t.Timestep, t.Id) for t in traxels] for t in uuidToTraxelMap[uuid]: traxelIdPerTimestepToUniqueIdMap.setdefault(str(t[0]), {})[ str(t[1]) ] = uuid # sort the list of traxels per UUID by their timesteps for v in uuidToTraxelMap.values(): v.sort(key=lambda timestepIdTuple: timestepIdTuple[0]) return traxelIdPerTimestepToUniqueIdMap, uuidToTraxelMap def toTrackingGraph(self, noFeatures=False): requiredNodeAttribs = ["id"] requiredLinkAttribs = ["src", "dest"] if not noFeatures: requiredNodeAttribs.append("features") requiredLinkAttribs.append("features") def translateNodeToDict(n): result = {} attrs = self._graph.nodes[n] for k in [ "id", "features", "appearanceFeatures", "disappearanceFeatures", "divisionFeatures", "timestep", ]: if k in attrs: result[k] = attrs[k] elif k in requiredNodeAttribs: raise ValueError( "Cannot use graph nodes without assigned ID and features, run insertEnergies() first" ) return result def translateLinkToDict(l): result = {} attrs = self._graph.edges[l[0], l[1]] for k in ["src", "dest", "features"]: if k in attrs: result[k] = attrs[k] elif k in requiredLinkAttribs: raise ValueError( "Cannot use graph links without source, target, and features, run insertEnergies() first" ) return result traxelIdPerTimestepToUniqueIdMap, _ = self.getMappingsBetweenUUIDsAndTraxels() model = { "segmentationHypotheses": [ translateNodeToDict(n) for n in self._graph.nodes() ], "linkingHypotheses": [translateLinkToDict(e) for e in self._graph.edges()], "divisionHypotheses": [], "traxelToUniqueId": traxelIdPerTimestepToUniqueIdMap, "settings": { "statesShareWeights": True, "allowPartialMergerAppearance": False, "requireSeparateChildrenOfDivision": True, "optimizerEpGap": 0.01, "optimizerVerbose": True, "optimizerNumThreads": 1, }, } # extract exclusion sets: exclusions = set([]) for n in self._graph.nodes(): if self.withTracklets: traxel = self._graph.nodes[n]["tracklet"][0] else: traxel = self._graph.nodes[n]["traxel"] if traxel.conflictingTraxelIds is not None: if self.withTracklets: logger.error( "Exclusion constraints do not work with tracklets yet!" ) conflictingIds = [ traxelIdPerTimestepToUniqueIdMap[str(traxel.Timestep)][str(i)] for i in traxel.conflictingTraxelIds ] myId = traxelIdPerTimestepToUniqueIdMap[str(traxel.Timestep)][ str(traxel.Id) ] for ci in conflictingIds: # insert pairwise exclusion constraints only, and always put the lower id first if ci < myId: exclusions.add((ci, myId)) else: exclusions.add((myId, ci)) model["exclusions"] = [list(t) for t in exclusions] # TODO: this recomputes the uuidToTraxelMap even though we have it already... trackingGraph = hytra.core.jsongraph.JsonTrackingGraph( model=model, progressVisitor=self.progressVisitor ) return trackingGraph def insertSolution(self, resultDictionary): assert isinstance(self._graph, nx.DiGraph), "Expecting the graph to be directed" _, uuidToTraxelMap = self.getMappingsBetweenUUIDsAndTraxels() if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self # reset all values for n in traxelgraph._graph.nodes(): traxelgraph._graph.nodes[n]["value"] = 0 traxelgraph._graph.nodes[n]["divisionValue"] = False for e in traxelgraph._graph.edges(): traxelgraph._graph.edges[e[0], e[1]]["value"] = 0 # store values from dict for detection in resultDictionary["detectionResults"]: traxels = uuidToTraxelMap[detection["id"]] for traxel in traxels: traxelgraph._graph.nodes[traxel]["value"] = detection["value"] for internal_edge in zip(traxels, traxels[1:]): traxelgraph._graph.edges[internal_edge[0], internal_edge[1]][ "value" ] = detection["value"] if ( "linkingResults" in resultDictionary and resultDictionary["linkingResults"] is not None ): for link in resultDictionary["linkingResults"]: source, dest = ( uuidToTraxelMap[link["src"]][-1], uuidToTraxelMap[link["dest"]][0], ) if (source in traxelgraph._graph.predecessors(dest)) and ( dest in traxelgraph._graph.neighbors(source) ): traxelgraph._graph.edges[source, dest]["value"] = link["value"] traxelgraph._graph.edges[source, dest]["gap"] = dest[0] - source[0] if ( "divisionResults" in resultDictionary and resultDictionary["divisionResults"] is not None ): for division in resultDictionary["divisionResults"]: traxelgraph._graph.nodes[uuidToTraxelMap[division["id"]][-1]][ "divisionValue" ] = division["value"] def getSolutionDictionary(self): resultDictionary = {} if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self detectionList = [] divisionList = [] linkList = [] def checkAttributeValue(element, attribName, default): if attribName in element: return element[attribName] else: return default for n in traxelgraph._graph.nodes(): newDetection = {} newDetection["id"] = traxelgraph._graph.nodes[n]["id"] newDetection["value"] = checkAttributeValue( traxelgraph._graph.nodes[n], "value", 0 ) detectionList.append(newDetection) if "divisionValue" in traxelgraph._graph.nodes[n]: newDivsion = {} newDivsion["id"] = traxelgraph._graph.nodes[n]["id"] newDivsion["value"] = checkAttributeValue( traxelgraph._graph.nodes[n], "divisionValue", False ) divisionList.append(newDivsion) for a in traxelgraph.arcIterator(): newLink = {} src = self.source(a) dest = self.target(a) newLink["src"] = traxelgraph._graph.nodes[src]["id"] newLink["dest"] = traxelgraph._graph.nodes[dest]["id"] newLink["value"] = checkAttributeValue( traxelgraph._graph.edges[src, dest], "value", 0 ) newLink["gap"] = checkAttributeValue( traxelgraph._graph.edges[src, dest], "gap", 1 ) linkList.append(newLink) resultDictionary["detectionResults"] = detectionList resultDictionary["linkingResults"] = linkList resultDictionary["divisionResults"] = divisionList return resultDictionary def countIncomingObjects(self, node): numberOfIncomingObject = 0 numberOfIncomingEdges = 0 for in_edge in self._graph.in_edges(node): if "value" in self._graph.edges[in_edge[0], node]: numberOfIncomingObject += self._graph.edges[in_edge[0], node]["value"] numberOfIncomingEdges += 1 return numberOfIncomingObject, numberOfIncomingEdges def countOutgoingObjects(self, node): numberOfOutgoingObject = 0 numberOfOutgoingEdges = 0 for out_edge in self._graph.out_edges(node): if ( "value" in self._graph.edges[node, out_edge[1]] and self._graph.edges[node, out_edge[1]]["value"] > 0 ): numberOfOutgoingObject += self._graph.edges[node, out_edge[1]]["value"] numberOfOutgoingEdges += 1 return numberOfOutgoingObject, numberOfOutgoingEdges def computeLineage(self, firstTrackId=2, firstLineageId=2, skipLinks=1): update_queue = [] # start lineages / tracks at 2, because 0 means background=black, 1 means misdetection in ilastik max_lineage_id = firstLineageId max_track_id = firstTrackId if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self self.progressVisitor.showState("Compute lineage") # find start of lineages numElements = 2 * traxelgraph.countNodes() countElements = 0 for n in traxelgraph.nodeIterator(): countElements += 1 self.progressVisitor.showProgress(countElements / float(numElements)) if ( traxelgraph.countIncomingObjects(n)[0] == 0 and "value" in traxelgraph._graph.nodes[n] and traxelgraph._graph.nodes[n]["value"] > 0 and ( self.allowLengthOneTracks or traxelgraph.countOutgoingObjects(n)[0] > 0 ) ): # found start of a track update_queue.append((n, max_lineage_id, max_track_id)) max_lineage_id += 1 max_track_id += 1 else: traxelgraph._graph.nodes[n]["lineageId"] = None traxelgraph._graph.nodes[n]["trackId"] = None while len(update_queue) > 0: countElements += 1 current_node, lineage_id, track_id = update_queue.pop() self.progressVisitor.showProgress(countElements / float(numElements)) # if we did not run merger resolving, it can happen that we reach a node several times, # and would propagate the new lineage+track IDs to all descendants again! We simply # stop propagating in that case and just use the lineageID that reached the node first. if ( traxelgraph._graph.nodes[current_node].get("lineageId", None) is not None and traxelgraph._graph.nodes[current_node].get("trackId", None) is not None ): logger.debug("Several tracks are merging here, stopping a later one") continue # set a new trackID traxelgraph._graph.nodes[current_node]["lineageId"] = lineage_id traxelgraph._graph.nodes[current_node]["trackId"] = track_id numberOfOutgoingObject, numberOfOutgoingEdges = traxelgraph.countOutgoingObjects( current_node ) if numberOfOutgoingObject != numberOfOutgoingEdges: logger.warning( "running lineage computation on unresolved graphs depends on a race condition" ) if ( "divisionValue" in traxelgraph._graph.nodes[current_node] and traxelgraph._graph.nodes[current_node]["divisionValue"] ): assert traxelgraph.countOutgoingObjects(current_node)[1] == 2 traxelgraph._graph.nodes[current_node]["children"] = [] for a in traxelgraph._graph.out_edges(current_node): if ( "value" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["value"] > 0 ): traxelgraph._graph.nodes[a[1]]["gap"] = skipLinks traxelgraph._graph.nodes[current_node]["children"].append(a[1]) traxelgraph._graph.nodes[a[1]]["parent"] = current_node update_queue.append( (traxelgraph.target(a), lineage_id, max_track_id) ) max_track_id += 1 else: if traxelgraph.countOutgoingObjects(current_node)[1] > 1: logger.debug( "Found merger splitting into several objects, propagating lineage and track to all descendants!" ) for a in traxelgraph._graph.out_edges(current_node): if ( "value" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["value"] > 0 ): if ( "gap" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["gap"] == 1 ) or "gap" not in traxelgraph._graph.edges[current_node, a[1]]: traxelgraph._graph.nodes[a[1]]["gap"] = 1 update_queue.append( (traxelgraph.target(a), lineage_id, track_id) ) if ( "gap" in traxelgraph._graph.edges[current_node, a[1]] and traxelgraph._graph.edges[current_node, a[1]]["gap"] > 1 ): traxelgraph._graph.nodes[a[1]]["gap"] = skipLinks traxelgraph._graph.nodes[a[1]]["gap_parent"] = current_node update_queue.append( (traxelgraph.target(a), lineage_id, max_track_id) ) max_track_id += 1 def pruneGraphToSolution(self, distanceToSolution=0): prunedGraph = HypothesesGraph() for n in self.nodeIterator(): if "value" in self._graph.nodes[n] and self._graph.nodes[n]["value"] > 0: prunedGraph._graph.add_node(n, **self._graph.nodes[n]) for e in self.arcIterator(): src = self.source(e) dest = self.target(e) if distanceToSolution == 0: if src in prunedGraph._graph and dest in prunedGraph._graph: prunedGraph._graph.add_edge( src, dest, **self._graph.edges[src, dest] ) # TODO: can be optimized by looping over the pruned graph nodes(might sacrifice readability) for distance in range(1, distanceToSolution + 1): for e in self.arcIterator(): src = self.source(e) dest = self.target(e) if src in prunedGraph._graph or dest in prunedGraph._graph: prunedGraph._graph.add_node(src, **self._graph.nodes[src]) prunedGraph._graph.add_node(dest, **self._graph.nodes[dest]) prunedGraph._graph.add_edge( src, dest, **self._graph.edges[src, dest] ) # in case a node is NOT an appearance and # has all the incoming edges with value 0, we remove all these incoming edges # # in case a node is NOT a disappearance and # has all the outgoing edges with value 0, we remove all these outgoing edges withAppearanceFeatures = True withDisappearanceFeatures = True withFeatures = True correctAppearanceFeatureLength = True correctDisappearanceFeatureLength = True correctFeatureLength = True maxNumObjects = None maxNumObjectsAppearance = None maxNumObjectsDisappearance = None for n in self.nodeIterator(): try: maxNumObjectsApp = len(self._graph.nodes[n]["appearanceFeatures"]) - 1 if maxNumObjectsAppearance is None: maxNumObjectsAppearance = maxNumObjectsApp elif not maxNumObjectsApp == maxNumObjectsAppearance: correctAppearanceFeatureLength = False logger.info( "Appearance/disappearance features have different lengths!" ) except: withAppearanceFeatures = False logger.info("There are no appearance features in node properties!") break try: maxNumObjectsDis = ( len(self._graph.nodes[n]["disappearanceFeatures"]) - 1 ) if maxNumObjectsDisappearance is None: maxNumObjectsDisappearance = maxNumObjectsDis elif not maxNumObjectsDis == maxNumObjectsDisappearance: correctDisappearanceFeatureLength = False logger.info("Disappearance features have different lengths!") except: withDisappearanceFeatures = False logger.info("There are no disappearance features in node properties!") break if withAppearanceFeatures and withDisappearanceFeatures: if ( correctAppearanceFeatureLength and correctDisappearanceFeatureLength and maxNumObjectsAppearance == maxNumObjectsDisappearance ): maxNumObjects = maxNumObjectsAppearance else: correctFeatureLength = False logger.info( "Appearance and disappearance features have different lengths!" ) else: withFeatures = False if withFeatures and correctFeatureLength: for n in self.nodeIterator(): if not ( "appearance" in self._graph.nodes[n].keys() and self._graph.nodes[n]["appearance"] ): allArcsWithValueZero = True in_edges = self._graph.in_edges(n) for edge in list(in_edges): if ( "value" in self._graph.edges[edge[0]][edge[1]].keys() and not self._graph.edges[edge[0]][edge[1]]["value"] == 0 ): allArcsWithValueZero = False break self._graph.nodes[n]["appearanceFeatures"] = listify( [0.0] + [0.0] * maxNumObjects ) if allArcsWithValueZero: if not in_edges == []: self._graph.remove_edges_from(in_edges) if not ( "disappearance" in self._graph.nodes[n].keys() and self._graph.nodes[n]["disappearance"] ): allArcsWithValueZero = True out_edges = self._graph.out_edges(n) for edge in list(out_edges): if ( "value" in self._graph.edges[edge[0]][edge[1]].keys() and not self._graph.edges[edge[0]][edge[1]]["value"] == 0 ): allArcsWithValueZero = False break self._graph.nodes[n]["disappearanceFeatures"] = listify( [0.0] + [0.0] * maxNumObjects ) if allArcsWithValueZero: if not out_edges == []: self._graph.remove_edges_from(out_edges) return prunedGraph def _getNodeAttribute(self, timestep, objectId, attribute): try: return self._graph.nodes[(int(timestep), int(objectId))][attribute] except KeyError: logger.error( attribute + " not found in graph node properties, call computeLineage() first!" ) raise def getLineageId(self, timestep, objectId): if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self return traxelgraph._getNodeAttribute(timestep, objectId, "lineageId") def getTrackId(self, timestep, objectId): if self.withTracklets: traxelgraph = self.referenceTraxelGraph else: traxelgraph = self return traxelgraph._getNodeAttribute(timestep, objectId, "trackId")
true
true
1c4567adc8fd9e1e995c1211c7aa015c0a2da7ee
4,059
py
Python
blockchain_client.py
JB1984/TheBlock
0e0b00034424d7453651b5efc2ef71a13f3719c4
[ "MIT" ]
null
null
null
blockchain_client.py
JB1984/TheBlock
0e0b00034424d7453651b5efc2ef71a13f3719c4
[ "MIT" ]
6
2018-09-14T21:00:41.000Z
2018-09-27T11:05:52.000Z
blockchain_client.py
JB1984/TheBlock
0e0b00034424d7453651b5efc2ef71a13f3719c4
[ "MIT" ]
null
null
null
from collections import OrderedDict import binascii import base64 import json import Crypto import Crypto.Random from Crypto.Hash import SHA from Crypto.PublicKey import RSA from Crypto.Signature import PKCS1_v1_5 import requests from flask import Flask, jsonify, request, render_template class Transaction: def __init__(self, sender_address, sender_private_key, recipient_address, value, note, picture): self.sender_address = sender_address self.sender_private_key = sender_private_key self.recipient_address = recipient_address self.value = value self.note = note self.picture = picture def __getattr__(self, attr): return self.data[attr] def to_dict(self): return OrderedDict({'sender_address': self.sender_address, 'recipient_address': self.recipient_address, 'value': self.value, 'note': self.note, 'picture': self.picture}) def sign_transaction(self): private_key = self.sender_private_key signer = PKCS1_v1_5.new(private_key) h = SHA.new(str(self.to_dict()).encode('utf8')) return binascii.hexlify(signer.sign(h)).decode('ascii') app = Flask(__name__) @app.route('/') def index(): return render_template('./indexClient.html') @app.route('/make/transaction') def make_transaction(): return render_template('./make_transaction.html') @app.route('/view/transactions') def view_transaction(): return render_template('./view_transactions.html') @app.route('/view/wallet_balance') def view_wallet_balance(): return render_template('./view_wallet_balance.html') @app.route('/wallet/new', methods=['GET']) def new_wallet(): random_gen = Crypto.Random.new().read private_key = RSA.generate(1024, random_gen) public_key = private_key.publickey() response = { 'private_key': binascii.hexlify(private_key.exportKey(format='DER')).decode('ascii'), 'public_key': binascii.hexlify(public_key.exportKey(format='DER')).decode('ascii') } #Save the generated key to the computer for use later f = open("private.pem", "wb") f.write(private_key.exportKey('PEM')) f.close() return jsonify(response), 200 @app.route('/generate/transaction', methods=['POST']) def generate_transaction(): p = open("private.pem", "r") priKey = RSA.import_key(p.read()) pubKey = priKey.publickey() sender_address = binascii.hexlify(pubKey.exportKey(format='DER')).decode('ascii') sender_private_key = priKey recipient_address = request.form['recipient_address'] value = request.form['amount'] note = request.form['note'] if request.form['picture'] != "": with open(request.form['picture'], "rb") as imageFile: pictureString = base64.b64encode(imageFile.read()) pictureString1 = str(pictureString) print(pictureString) print(pictureString1) else: pictureString1 = "" transaction = Transaction(sender_address, sender_private_key, recipient_address, value, note, pictureString1) response = {'transaction': transaction.to_dict(), 'signature': transaction.sign_transaction()} return jsonify(response), 200 @app.route('/get_pub_key', methods=['GET']) def get_pub_key(): p = open("private.pem", "r") priKey = RSA.import_key(p.read()) pubKey = priKey.publickey() sender_address = binascii.hexlify(pubKey.exportKey(format='DER')).decode('ascii') response = {'pub_key': sender_address} return jsonify(response), 200 if __name__ == '__main__': from argparse import ArgumentParser parser = ArgumentParser() parser.add_argument('-p', '--port', default=8080, type=int, help='port to listen on') args = parser.parse_args() port = args.port app.run(host='0.0.0.0', port=port)
29.845588
114
0.649914
from collections import OrderedDict import binascii import base64 import json import Crypto import Crypto.Random from Crypto.Hash import SHA from Crypto.PublicKey import RSA from Crypto.Signature import PKCS1_v1_5 import requests from flask import Flask, jsonify, request, render_template class Transaction: def __init__(self, sender_address, sender_private_key, recipient_address, value, note, picture): self.sender_address = sender_address self.sender_private_key = sender_private_key self.recipient_address = recipient_address self.value = value self.note = note self.picture = picture def __getattr__(self, attr): return self.data[attr] def to_dict(self): return OrderedDict({'sender_address': self.sender_address, 'recipient_address': self.recipient_address, 'value': self.value, 'note': self.note, 'picture': self.picture}) def sign_transaction(self): private_key = self.sender_private_key signer = PKCS1_v1_5.new(private_key) h = SHA.new(str(self.to_dict()).encode('utf8')) return binascii.hexlify(signer.sign(h)).decode('ascii') app = Flask(__name__) @app.route('/') def index(): return render_template('./indexClient.html') @app.route('/make/transaction') def make_transaction(): return render_template('./make_transaction.html') @app.route('/view/transactions') def view_transaction(): return render_template('./view_transactions.html') @app.route('/view/wallet_balance') def view_wallet_balance(): return render_template('./view_wallet_balance.html') @app.route('/wallet/new', methods=['GET']) def new_wallet(): random_gen = Crypto.Random.new().read private_key = RSA.generate(1024, random_gen) public_key = private_key.publickey() response = { 'private_key': binascii.hexlify(private_key.exportKey(format='DER')).decode('ascii'), 'public_key': binascii.hexlify(public_key.exportKey(format='DER')).decode('ascii') } f = open("private.pem", "wb") f.write(private_key.exportKey('PEM')) f.close() return jsonify(response), 200 @app.route('/generate/transaction', methods=['POST']) def generate_transaction(): p = open("private.pem", "r") priKey = RSA.import_key(p.read()) pubKey = priKey.publickey() sender_address = binascii.hexlify(pubKey.exportKey(format='DER')).decode('ascii') sender_private_key = priKey recipient_address = request.form['recipient_address'] value = request.form['amount'] note = request.form['note'] if request.form['picture'] != "": with open(request.form['picture'], "rb") as imageFile: pictureString = base64.b64encode(imageFile.read()) pictureString1 = str(pictureString) print(pictureString) print(pictureString1) else: pictureString1 = "" transaction = Transaction(sender_address, sender_private_key, recipient_address, value, note, pictureString1) response = {'transaction': transaction.to_dict(), 'signature': transaction.sign_transaction()} return jsonify(response), 200 @app.route('/get_pub_key', methods=['GET']) def get_pub_key(): p = open("private.pem", "r") priKey = RSA.import_key(p.read()) pubKey = priKey.publickey() sender_address = binascii.hexlify(pubKey.exportKey(format='DER')).decode('ascii') response = {'pub_key': sender_address} return jsonify(response), 200 if __name__ == '__main__': from argparse import ArgumentParser parser = ArgumentParser() parser.add_argument('-p', '--port', default=8080, type=int, help='port to listen on') args = parser.parse_args() port = args.port app.run(host='0.0.0.0', port=port)
true
true
1c4567eaf684081be1c5f842fe292f61cc1719a8
1,370
py
Python
dataloader/dataloaders.py
misads/cv_template
9976ee0ada449a494d26f896c598610f233edc10
[ "MIT" ]
69
2020-09-01T11:23:48.000Z
2022-03-26T08:42:16.000Z
dataloader/dataloaders.py
misads/cv_template
9976ee0ada449a494d26f896c598610f233edc10
[ "MIT" ]
3
2021-02-16T09:22:09.000Z
2022-01-02T07:54:39.000Z
dataloader/dataloaders.py
misads/cv_template
9976ee0ada449a494d26f896c598610f233edc10
[ "MIT" ]
15
2020-07-07T06:37:33.000Z
2022-03-21T07:37:33.000Z
# encoding=utf-8 from dataloader.image_list import ListTrainValDataset, ListTestDataset from dataloader.transforms import get_transform from torch.utils.data import DataLoader from options import opt import pdb import os ################### TEST_DATASET_HAS_OPEN = False # 有没有开放测试集 ################### train_list = os.path.join('datasets', opt.dataset, 'train.txt') val_list = os.path.join('datasets', opt.dataset, 'val.txt') max_size = 128 if opt.debug else None # transforms transform = get_transform(opt.transform) train_transform = transform.train_transform val_transform = transform.val_transform # datasets和dataloaders train_dataset = ListTrainValDataset(train_list, transforms=train_transform, max_size=max_size) train_dataloader = DataLoader(train_dataset, batch_size=opt.batch_size, shuffle=True, num_workers=opt.workers, drop_last=True) val_dataset = ListTrainValDataset(val_list, transforms=val_transform, max_size=max_size) val_dataloader = DataLoader(val_dataset, batch_size=1, shuffle=False, num_workers=opt.workers//2) if TEST_DATASET_HAS_OPEN: test_list = os.path.join('datasets', opt.dataset, 'test.txt') # 还没有 test_dataset = ListTestDataset(test_list, scale=opt.scale, max_size=max_size, norm=opt.norm_input) test_dataloader = DataLoader(test_dataset, batch_size=1, shuffle=False, num_workers=1) else: test_dataloader = None
35.128205
126
0.783212
from dataloader.image_list import ListTrainValDataset, ListTestDataset from dataloader.transforms import get_transform from torch.utils.data import DataLoader from options import opt import pdb import os = ListTrainValDataset(train_list, transforms=train_transform, max_size=max_size) train_dataloader = DataLoader(train_dataset, batch_size=opt.batch_size, shuffle=True, num_workers=opt.workers, drop_last=True) val_dataset = ListTrainValDataset(val_list, transforms=val_transform, max_size=max_size) val_dataloader = DataLoader(val_dataset, batch_size=1, shuffle=False, num_workers=opt.workers//2) if TEST_DATASET_HAS_OPEN: test_list = os.path.join('datasets', opt.dataset, 'test.txt') test_dataset = ListTestDataset(test_list, scale=opt.scale, max_size=max_size, norm=opt.norm_input) test_dataloader = DataLoader(test_dataset, batch_size=1, shuffle=False, num_workers=1) else: test_dataloader = None
true
true
1c45681e99e7576cdadf4d81110b8dbc5fa1dd25
4,730
py
Python
graph_objs/ohlc/_line.py
wwwidonja/changed_plotly
1bda35a438539a97c84a3ab3952e95e8848467bd
[ "MIT" ]
null
null
null
graph_objs/ohlc/_line.py
wwwidonja/changed_plotly
1bda35a438539a97c84a3ab3952e95e8848467bd
[ "MIT" ]
null
null
null
graph_objs/ohlc/_line.py
wwwidonja/changed_plotly
1bda35a438539a97c84a3ab3952e95e8848467bd
[ "MIT" ]
null
null
null
from plotly.basedatatypes import BaseTraceHierarchyType as _BaseTraceHierarchyType import copy as _copy class Line(_BaseTraceHierarchyType): # class properties # -------------------- _parent_path_str = "ohlc" _path_str = "ohlc.line" _valid_props = {"dash", "width"} # dash # ---- @property def dash(self): """ Sets the dash style of lines. Set to a dash type string ("solid", "dot", "dash", "longdash", "dashdot", or "longdashdot") or a dash length list in px (eg "5px,10px,2px,2px"). Note that this style setting can also be set per direction via `increasing.line.dash` and `decreasing.line.dash`. The 'dash' property is an enumeration that may be specified as: - One of the following dash styles: ['solid', 'dot', 'dash', 'longdash', 'dashdot', 'longdashdot'] - A string containing a dash length list in pixels or percentages (e.g. '5px 10px 2px 2px', '5, 10, 2, 2', '10% 20% 40%', etc.) Returns ------- str """ return self["dash"] @dash.setter def dash(self, val): self["dash"] = val # width # ----- @property def width(self): """ [object Object] Note that this style setting can also be set per direction via `increasing.line.width` and `decreasing.line.width`. The 'width' property is a number and may be specified as: - An int or float in the interval [0, inf] Returns ------- int|float """ return self["width"] @width.setter def width(self, val): self["width"] = val # Self properties description # --------------------------- @property def _prop_descriptions(self): return """\ dash Sets the dash style of lines. Set to a dash type string ("solid", "dot", "dash", "longdash", "dashdot", or "longdashdot") or a dash length list in px (eg "5px,10px,2px,2px"). Note that this style setting can also be set per direction via `increasing.line.dash` and `decreasing.line.dash`. width [object Object] Note that this style setting can also be set per direction via `increasing.line.width` and `decreasing.line.width`. """ def __init__(self, arg=None, dash=None, width=None, **kwargs): """ Construct a new Line object Parameters ---------- arg dict of properties compatible with this constructor or an instance of :class:`new_plotly.graph_objs.ohlc.Line` dash Sets the dash style of lines. Set to a dash type string ("solid", "dot", "dash", "longdash", "dashdot", or "longdashdot") or a dash length list in px (eg "5px,10px,2px,2px"). Note that this style setting can also be set per direction via `increasing.line.dash` and `decreasing.line.dash`. width [object Object] Note that this style setting can also be set per direction via `increasing.line.width` and `decreasing.line.width`. Returns ------- Line """ super(Line, self).__init__("line") if "_parent" in kwargs: self._parent = kwargs["_parent"] return # Validate arg # ------------ if arg is None: arg = {} elif isinstance(arg, self.__class__): arg = arg.to_plotly_json() elif isinstance(arg, dict): arg = _copy.copy(arg) else: raise ValueError( """\ The first argument to the new_plotly.graph_objs.ohlc.Line constructor must be a dict or an instance of :class:`new_plotly.graph_objs.ohlc.Line`""" ) # Handle skip_invalid # ------------------- self._skip_invalid = kwargs.pop("skip_invalid", False) self._validate = kwargs.pop("_validate", True) # Populate data dict with properties # ---------------------------------- _v = arg.pop("dash", None) _v = dash if dash is not None else _v if _v is not None: self["dash"] = _v _v = arg.pop("width", None) _v = width if width is not None else _v if _v is not None: self["width"] = _v # Process unknown kwargs # ---------------------- self._process_kwargs(**dict(arg, **kwargs)) # Reset skip_invalid # ------------------ self._skip_invalid = False
31.324503
82
0.532981
from plotly.basedatatypes import BaseTraceHierarchyType as _BaseTraceHierarchyType import copy as _copy class Line(_BaseTraceHierarchyType): _parent_path_str = "ohlc" _path_str = "ohlc.line" _valid_props = {"dash", "width"} @property def dash(self): return self["dash"] @dash.setter def dash(self, val): self["dash"] = val @property def width(self): return self["width"] @width.setter def width(self, val): self["width"] = val @property def _prop_descriptions(self): return """\ dash Sets the dash style of lines. Set to a dash type string ("solid", "dot", "dash", "longdash", "dashdot", or "longdashdot") or a dash length list in px (eg "5px,10px,2px,2px"). Note that this style setting can also be set per direction via `increasing.line.dash` and `decreasing.line.dash`. width [object Object] Note that this style setting can also be set per direction via `increasing.line.width` and `decreasing.line.width`. """ def __init__(self, arg=None, dash=None, width=None, **kwargs): super(Line, self).__init__("line") if "_parent" in kwargs: self._parent = kwargs["_parent"] return if arg is None: arg = {} elif isinstance(arg, self.__class__): arg = arg.to_plotly_json() elif isinstance(arg, dict): arg = _copy.copy(arg) else: raise ValueError( """\ The first argument to the new_plotly.graph_objs.ohlc.Line constructor must be a dict or an instance of :class:`new_plotly.graph_objs.ohlc.Line`""" ) self._skip_invalid = kwargs.pop("skip_invalid", False) self._validate = kwargs.pop("_validate", True) _v = arg.pop("dash", None) _v = dash if dash is not None else _v if _v is not None: self["dash"] = _v _v = arg.pop("width", None) _v = width if width is not None else _v if _v is not None: self["width"] = _v self._process_kwargs(**dict(arg, **kwargs)) self._skip_invalid = False
true
true
1c45687ed1e1d1996e74a33c71010180e5f720d1
6,785
py
Python
Localization/particle_filter/particle_filter.py
MerdanBay/PythonRobotics
71de5d038f348d347d7b5dc00c914d523cd59f92
[ "MIT" ]
1
2021-12-02T01:45:01.000Z
2021-12-02T01:45:01.000Z
Localization/particle_filter/particle_filter.py
MerdanBay/PythonRobotics
71de5d038f348d347d7b5dc00c914d523cd59f92
[ "MIT" ]
null
null
null
Localization/particle_filter/particle_filter.py
MerdanBay/PythonRobotics
71de5d038f348d347d7b5dc00c914d523cd59f92
[ "MIT" ]
1
2022-01-14T11:11:24.000Z
2022-01-14T11:11:24.000Z
""" Particle Filter localization sample author: Atsushi Sakai (@Atsushi_twi) """ import sys import os sys.path.append(os.path.dirname(os.path.abspath(__file__)) + "/../utils/") import math import matplotlib.pyplot as plt import numpy as np from utils.angle import rot_mat_2d # Estimation parameter of PF Q = np.diag([0.2]) ** 2 # range error R = np.diag([2.0, np.deg2rad(40.0)]) ** 2 # input error # Simulation parameter Q_sim = np.diag([0.2]) ** 2 R_sim = np.diag([1.0, np.deg2rad(30.0)]) ** 2 DT = 0.1 # time tick [s] SIM_TIME = 50.0 # simulation time [s] MAX_RANGE = 20.0 # maximum observation range # Particle filter parameter NP = 100 # Number of Particle NTh = NP / 2.0 # Number of particle for re-sampling show_animation = True def calc_input(): v = 1.0 # [m/s] yaw_rate = 0.1 # [rad/s] u = np.array([[v, yaw_rate]]).T return u def observation(x_true, xd, u, rf_id): x_true = motion_model(x_true, u) # add noise to gps x-y z = np.zeros((0, 3)) for i in range(len(rf_id[:, 0])): dx = x_true[0, 0] - rf_id[i, 0] dy = x_true[1, 0] - rf_id[i, 1] d = math.hypot(dx, dy) if d <= MAX_RANGE: dn = d + np.random.randn() * Q_sim[0, 0] ** 0.5 # add noise zi = np.array([[dn, rf_id[i, 0], rf_id[i, 1]]]) z = np.vstack((z, zi)) # add noise to input ud1 = u[0, 0] + np.random.randn() * R_sim[0, 0] ** 0.5 ud2 = u[1, 0] + np.random.randn() * R_sim[1, 1] ** 0.5 ud = np.array([[ud1, ud2]]).T xd = motion_model(xd, ud) return x_true, z, xd, ud def motion_model(x, u): F = np.array([[1.0, 0, 0, 0], [0, 1.0, 0, 0], [0, 0, 1.0, 0], [0, 0, 0, 0]]) B = np.array([[DT * math.cos(x[2, 0]), 0], [DT * math.sin(x[2, 0]), 0], [0.0, DT], [1.0, 0.0]]) x = F.dot(x) + B.dot(u) return x def gauss_likelihood(x, sigma): p = 1.0 / math.sqrt(2.0 * math.pi * sigma ** 2) * \ math.exp(-x ** 2 / (2 * sigma ** 2)) return p def calc_covariance(x_est, px, pw): """ calculate covariance matrix see ipynb doc """ cov = np.zeros((3, 3)) n_particle = px.shape[1] for i in range(n_particle): dx = (px[:, i:i + 1] - x_est)[0:3] cov += pw[0, i] * dx @ dx.T cov *= 1.0 / (1.0 - pw @ pw.T) return cov def pf_localization(px, pw, z, u): """ Localization with Particle filter """ for ip in range(NP): x = np.array([px[:, ip]]).T w = pw[0, ip] # Predict with random input sampling ud1 = u[0, 0] + np.random.randn() * R[0, 0] ** 0.5 ud2 = u[1, 0] + np.random.randn() * R[1, 1] ** 0.5 ud = np.array([[ud1, ud2]]).T x = motion_model(x, ud) # Calc Importance Weight for i in range(len(z[:, 0])): dx = x[0, 0] - z[i, 1] dy = x[1, 0] - z[i, 2] pre_z = math.hypot(dx, dy) dz = pre_z - z[i, 0] w = w * gauss_likelihood(dz, math.sqrt(Q[0, 0])) px[:, ip] = x[:, 0] pw[0, ip] = w pw = pw / pw.sum() # normalize x_est = px.dot(pw.T) p_est = calc_covariance(x_est, px, pw) N_eff = 1.0 / (pw.dot(pw.T))[0, 0] # Effective particle number if N_eff < NTh: px, pw = re_sampling(px, pw) return x_est, p_est, px, pw def re_sampling(px, pw): """ low variance re-sampling """ w_cum = np.cumsum(pw) base = np.arange(0.0, 1.0, 1 / NP) re_sample_id = base + np.random.uniform(0, 1 / NP) indexes = [] ind = 0 for ip in range(NP): while re_sample_id[ip] > w_cum[ind]: ind += 1 indexes.append(ind) px = px[:, indexes] pw = np.zeros((1, NP)) + 1.0 / NP # init weight return px, pw def plot_covariance_ellipse(x_est, p_est): # pragma: no cover p_xy = p_est[0:2, 0:2] eig_val, eig_vec = np.linalg.eig(p_xy) if eig_val[0] >= eig_val[1]: big_ind = 0 small_ind = 1 else: big_ind = 1 small_ind = 0 t = np.arange(0, 2 * math.pi + 0.1, 0.1) # eig_val[big_ind] or eiq_val[small_ind] were occasionally negative # numbers extremely close to 0 (~10^-20), catch these cases and set the # respective variable to 0 try: a = math.sqrt(eig_val[big_ind]) except ValueError: a = 0 try: b = math.sqrt(eig_val[small_ind]) except ValueError: b = 0 x = [a * math.cos(it) for it in t] y = [b * math.sin(it) for it in t] angle = math.atan2(eig_vec[1, big_ind], eig_vec[0, big_ind]) fx = rot_mat_2d(angle) @ np.array([[x, y]]) px = np.array(fx[:, 0] + x_est[0, 0]).flatten() py = np.array(fx[:, 1] + x_est[1, 0]).flatten() plt.plot(px, py, "--r") def main(): print(__file__ + " start!!") time = 0.0 # RF_ID positions [x, y] rf_id = np.array([[10.0, 0.0], [10.0, 10.0], [0.0, 15.0], [-5.0, 20.0]]) # State Vector [x y yaw v]' x_est = np.zeros((4, 1)) x_true = np.zeros((4, 1)) px = np.zeros((4, NP)) # Particle store pw = np.zeros((1, NP)) + 1.0 / NP # Particle weight x_dr = np.zeros((4, 1)) # Dead reckoning # history h_x_est = x_est h_x_true = x_true h_x_dr = x_true while SIM_TIME >= time: time += DT u = calc_input() x_true, z, x_dr, ud = observation(x_true, x_dr, u, rf_id) x_est, PEst, px, pw = pf_localization(px, pw, z, ud) # store data history h_x_est = np.hstack((h_x_est, x_est)) h_x_dr = np.hstack((h_x_dr, x_dr)) h_x_true = np.hstack((h_x_true, x_true)) if show_animation: plt.cla() # for stopping simulation with the esc key. plt.gcf().canvas.mpl_connect( 'key_release_event', lambda event: [exit(0) if event.key == 'escape' else None]) for i in range(len(z[:, 0])): plt.plot([x_true[0, 0], z[i, 1]], [x_true[1, 0], z[i, 2]], "-k") plt.plot(rf_id[:, 0], rf_id[:, 1], "*k") plt.plot(px[0, :], px[1, :], ".r") plt.plot(np.array(h_x_true[0, :]).flatten(), np.array(h_x_true[1, :]).flatten(), "-b") plt.plot(np.array(h_x_dr[0, :]).flatten(), np.array(h_x_dr[1, :]).flatten(), "-k") plt.plot(np.array(h_x_est[0, :]).flatten(), np.array(h_x_est[1, :]).flatten(), "-r") plot_covariance_ellipse(x_est, PEst) plt.axis("equal") plt.grid(True) plt.pause(0.001) if __name__ == '__main__': main()
25.700758
80
0.506853
import sys import os sys.path.append(os.path.dirname(os.path.abspath(__file__)) + "/../utils/") import math import matplotlib.pyplot as plt import numpy as np from utils.angle import rot_mat_2d Q = np.diag([0.2]) ** 2 R = np.diag([2.0, np.deg2rad(40.0)]) ** 2 Q_sim = np.diag([0.2]) ** 2 R_sim = np.diag([1.0, np.deg2rad(30.0)]) ** 2 DT = 0.1 SIM_TIME = 50.0 MAX_RANGE = 20.0 NP = 100 NTh = NP / 2.0 show_animation = True def calc_input(): v = 1.0 yaw_rate = 0.1 u = np.array([[v, yaw_rate]]).T return u def observation(x_true, xd, u, rf_id): x_true = motion_model(x_true, u) z = np.zeros((0, 3)) for i in range(len(rf_id[:, 0])): dx = x_true[0, 0] - rf_id[i, 0] dy = x_true[1, 0] - rf_id[i, 1] d = math.hypot(dx, dy) if d <= MAX_RANGE: dn = d + np.random.randn() * Q_sim[0, 0] ** 0.5 zi = np.array([[dn, rf_id[i, 0], rf_id[i, 1]]]) z = np.vstack((z, zi)) ud1 = u[0, 0] + np.random.randn() * R_sim[0, 0] ** 0.5 ud2 = u[1, 0] + np.random.randn() * R_sim[1, 1] ** 0.5 ud = np.array([[ud1, ud2]]).T xd = motion_model(xd, ud) return x_true, z, xd, ud def motion_model(x, u): F = np.array([[1.0, 0, 0, 0], [0, 1.0, 0, 0], [0, 0, 1.0, 0], [0, 0, 0, 0]]) B = np.array([[DT * math.cos(x[2, 0]), 0], [DT * math.sin(x[2, 0]), 0], [0.0, DT], [1.0, 0.0]]) x = F.dot(x) + B.dot(u) return x def gauss_likelihood(x, sigma): p = 1.0 / math.sqrt(2.0 * math.pi * sigma ** 2) * \ math.exp(-x ** 2 / (2 * sigma ** 2)) return p def calc_covariance(x_est, px, pw): cov = np.zeros((3, 3)) n_particle = px.shape[1] for i in range(n_particle): dx = (px[:, i:i + 1] - x_est)[0:3] cov += pw[0, i] * dx @ dx.T cov *= 1.0 / (1.0 - pw @ pw.T) return cov def pf_localization(px, pw, z, u): for ip in range(NP): x = np.array([px[:, ip]]).T w = pw[0, ip] ud1 = u[0, 0] + np.random.randn() * R[0, 0] ** 0.5 ud2 = u[1, 0] + np.random.randn() * R[1, 1] ** 0.5 ud = np.array([[ud1, ud2]]).T x = motion_model(x, ud) for i in range(len(z[:, 0])): dx = x[0, 0] - z[i, 1] dy = x[1, 0] - z[i, 2] pre_z = math.hypot(dx, dy) dz = pre_z - z[i, 0] w = w * gauss_likelihood(dz, math.sqrt(Q[0, 0])) px[:, ip] = x[:, 0] pw[0, ip] = w pw = pw / pw.sum() x_est = px.dot(pw.T) p_est = calc_covariance(x_est, px, pw) N_eff = 1.0 / (pw.dot(pw.T))[0, 0] if N_eff < NTh: px, pw = re_sampling(px, pw) return x_est, p_est, px, pw def re_sampling(px, pw): w_cum = np.cumsum(pw) base = np.arange(0.0, 1.0, 1 / NP) re_sample_id = base + np.random.uniform(0, 1 / NP) indexes = [] ind = 0 for ip in range(NP): while re_sample_id[ip] > w_cum[ind]: ind += 1 indexes.append(ind) px = px[:, indexes] pw = np.zeros((1, NP)) + 1.0 / NP return px, pw def plot_covariance_ellipse(x_est, p_est): p_xy = p_est[0:2, 0:2] eig_val, eig_vec = np.linalg.eig(p_xy) if eig_val[0] >= eig_val[1]: big_ind = 0 small_ind = 1 else: big_ind = 1 small_ind = 0 t = np.arange(0, 2 * math.pi + 0.1, 0.1) try: a = math.sqrt(eig_val[big_ind]) except ValueError: a = 0 try: b = math.sqrt(eig_val[small_ind]) except ValueError: b = 0 x = [a * math.cos(it) for it in t] y = [b * math.sin(it) for it in t] angle = math.atan2(eig_vec[1, big_ind], eig_vec[0, big_ind]) fx = rot_mat_2d(angle) @ np.array([[x, y]]) px = np.array(fx[:, 0] + x_est[0, 0]).flatten() py = np.array(fx[:, 1] + x_est[1, 0]).flatten() plt.plot(px, py, "--r") def main(): print(__file__ + " start!!") time = 0.0 rf_id = np.array([[10.0, 0.0], [10.0, 10.0], [0.0, 15.0], [-5.0, 20.0]]) x_est = np.zeros((4, 1)) x_true = np.zeros((4, 1)) px = np.zeros((4, NP)) # Particle store pw = np.zeros((1, NP)) + 1.0 / NP # Particle weight x_dr = np.zeros((4, 1)) # Dead reckoning # history h_x_est = x_est h_x_true = x_true h_x_dr = x_true while SIM_TIME >= time: time += DT u = calc_input() x_true, z, x_dr, ud = observation(x_true, x_dr, u, rf_id) x_est, PEst, px, pw = pf_localization(px, pw, z, ud) # store data history h_x_est = np.hstack((h_x_est, x_est)) h_x_dr = np.hstack((h_x_dr, x_dr)) h_x_true = np.hstack((h_x_true, x_true)) if show_animation: plt.cla() # for stopping simulation with the esc key. plt.gcf().canvas.mpl_connect( 'key_release_event', lambda event: [exit(0) if event.key == 'escape' else None]) for i in range(len(z[:, 0])): plt.plot([x_true[0, 0], z[i, 1]], [x_true[1, 0], z[i, 2]], "-k") plt.plot(rf_id[:, 0], rf_id[:, 1], "*k") plt.plot(px[0, :], px[1, :], ".r") plt.plot(np.array(h_x_true[0, :]).flatten(), np.array(h_x_true[1, :]).flatten(), "-b") plt.plot(np.array(h_x_dr[0, :]).flatten(), np.array(h_x_dr[1, :]).flatten(), "-k") plt.plot(np.array(h_x_est[0, :]).flatten(), np.array(h_x_est[1, :]).flatten(), "-r") plot_covariance_ellipse(x_est, PEst) plt.axis("equal") plt.grid(True) plt.pause(0.001) if __name__ == '__main__': main()
true
true
1c45694042710f3d8d3724815e70347ae2585bff
1,850
py
Python
thedoctor/tests/test_integration.py
hhuuggoo/thedoctor
84c11377dc16ef8208480cd2745ce1ffc5614865
[ "BSD-2-Clause" ]
37
2015-02-24T21:59:04.000Z
2021-07-13T19:04:34.000Z
thedoctor/tests/test_integration.py
hhuuggoo/thedoctor
84c11377dc16ef8208480cd2745ce1ffc5614865
[ "BSD-2-Clause" ]
1
2015-03-23T20:23:41.000Z
2015-03-23T21:09:58.000Z
thedoctor/tests/test_integration.py
hhuuggoo/thedoctor
84c11377dc16ef8208480cd2745ce1ffc5614865
[ "BSD-2-Clause" ]
7
2015-03-17T17:18:27.000Z
2020-07-30T13:05:42.000Z
from .utils import raises from .. import ValidationError from .. import validate from ..validators import dict_validator, true def test_integration(): @validate(a=int, b=int) def func(a, b): return (a, b) assert func(1, 2) == (1, 2) assert raises(ValidationError, func, 1, 'a') @validate(a=int) def func(a, b): return (a, b) assert func(1, 'a') == (1, 'a') assert raises(ValidationError, func, 'a', 1) def test_return_validator(): def return_validator(result): if result != 3: raise ValidationError('not 3') @validate(_return=[int, return_validator]) def func(a, b): return a + b assert raises(ValidationError, func, 1, 3) assert raises(ValidationError, func, 'a', 'b') assert func(1, 2) == 3 def sums_to_3(all_args): if all_args['a'] + all_args['b'] != 3: raise ValidationError('not sum to 3') @validate(_all=sums_to_3) def func(a, b): return a + b assert raises(ValidationError, func, 1, 3) assert func(1, 2) == 3 def test_lambda_validator(): @validate(_all=lambda x: true(x['a'] + x['b'] == 3, "must sum to 3")) def func(a, b): return a + b assert raises(ValidationError, func, 1, 3) assert func(1, 2) == 3 def instance_method_test(): class Test(object): @validate(_return=lambda x: true(x % 2 == 0, "return must be even"), a=int, b=int) def func(self, a, b): return a + b t = Test() assert raises(ValidationError, t.func, 1, 2) t.func(2, 4) def dict_validator_integration_test(): @validate(x=dict_validator( {'name': lambda x: true(x == 'sally', 'must be sally')})) def func(x): return x assert raises(ValidationError, func, {'name': 'bob'}) func({'name': 'sally'})
26.428571
76
0.584324
from .utils import raises from .. import ValidationError from .. import validate from ..validators import dict_validator, true def test_integration(): @validate(a=int, b=int) def func(a, b): return (a, b) assert func(1, 2) == (1, 2) assert raises(ValidationError, func, 1, 'a') @validate(a=int) def func(a, b): return (a, b) assert func(1, 'a') == (1, 'a') assert raises(ValidationError, func, 'a', 1) def test_return_validator(): def return_validator(result): if result != 3: raise ValidationError('not 3') @validate(_return=[int, return_validator]) def func(a, b): return a + b assert raises(ValidationError, func, 1, 3) assert raises(ValidationError, func, 'a', 'b') assert func(1, 2) == 3 def sums_to_3(all_args): if all_args['a'] + all_args['b'] != 3: raise ValidationError('not sum to 3') @validate(_all=sums_to_3) def func(a, b): return a + b assert raises(ValidationError, func, 1, 3) assert func(1, 2) == 3 def test_lambda_validator(): @validate(_all=lambda x: true(x['a'] + x['b'] == 3, "must sum to 3")) def func(a, b): return a + b assert raises(ValidationError, func, 1, 3) assert func(1, 2) == 3 def instance_method_test(): class Test(object): @validate(_return=lambda x: true(x % 2 == 0, "return must be even"), a=int, b=int) def func(self, a, b): return a + b t = Test() assert raises(ValidationError, t.func, 1, 2) t.func(2, 4) def dict_validator_integration_test(): @validate(x=dict_validator( {'name': lambda x: true(x == 'sally', 'must be sally')})) def func(x): return x assert raises(ValidationError, func, {'name': 'bob'}) func({'name': 'sally'})
true
true
1c45697bb34e4558711a296700d158a28ef349c2
1,054
py
Python
onnxruntime/__init__.py
NonStatic2014/onnxruntime
bdfd46082a152e9605199b4f01664fc76f97a346
[ "MIT" ]
null
null
null
onnxruntime/__init__.py
NonStatic2014/onnxruntime
bdfd46082a152e9605199b4f01664fc76f97a346
[ "MIT" ]
10
2019-03-25T21:47:46.000Z
2019-04-30T02:33:05.000Z
onnxruntime/__init__.py
NonStatic2014/onnxruntime
bdfd46082a152e9605199b4f01664fc76f97a346
[ "MIT" ]
1
2019-04-09T16:15:51.000Z
2019-04-09T16:15:51.000Z
# ------------------------------------------------------------------------- # Copyright (c) Microsoft Corporation. All rights reserved. # Licensed under the MIT License. # -------------------------------------------------------------------------- """ ONNX Runtime enables high-performance evaluation of trained machine learning (ML) models while keeping resource usage low. Building on Microsoft's dedication to the `Open Neural Network Exchange (ONNX) <https://onnx.ai/>`_ community, it supports traditional ML models as well as Deep Learning algorithms in the `ONNX-ML format <https://github.com/onnx/onnx/blob/master/docs/IR.md>`_. """ __version__ = "0.5.0" __author__ = "Microsoft" from onnxruntime.capi._pybind_state import get_all_providers, get_available_providers, get_device, RunOptions, SessionOptions, set_default_logger_severity, NodeArg, ModelMetadata, GraphOptimizationLevel, ExecutionMode from onnxruntime.capi.session import InferenceSession from onnxruntime.capi import onnxruntime_validation onnxruntime_validation.check_distro_info()
47.909091
217
0.701139
__version__ = "0.5.0" __author__ = "Microsoft" from onnxruntime.capi._pybind_state import get_all_providers, get_available_providers, get_device, RunOptions, SessionOptions, set_default_logger_severity, NodeArg, ModelMetadata, GraphOptimizationLevel, ExecutionMode from onnxruntime.capi.session import InferenceSession from onnxruntime.capi import onnxruntime_validation onnxruntime_validation.check_distro_info()
true
true
1c4569ce9ebd3c7cda1043c0df205b8a956f5f5e
3,842
py
Python
image_train.py
to0mi1/image-categorization-based-cifar10
96218f2f60faf424b26112559a170a05463113bb
[ "MIT" ]
1
2019-04-16T08:42:32.000Z
2019-04-16T08:42:32.000Z
image_train.py
to0mi1/image-categorization-based-cifar10
96218f2f60faf424b26112559a170a05463113bb
[ "MIT" ]
null
null
null
image_train.py
to0mi1/image-categorization-based-cifar10
96218f2f60faf424b26112559a170a05463113bb
[ "MIT" ]
null
null
null
# -*- coding: utf-8 -*- """ モデルを作成しトレーニングを行う """ import os from keras.models import Sequential from keras.layers import Conv2D, MaxPooling2D, Dense, Dropout, Activation, Flatten from keras.utils import plot_model from keras.preprocessing.image import ImageDataGenerator from keras.utils import plot_model from keras.preprocessing import image from keras.callbacks import EarlyStopping # パラメータ定義 activation = 'relu' optimizer = 'Adam' nb_epoch = 30 batch_size = 16 # 訓練・検証用データの格納ディレクトリ train_path = './train' valid_path = './valid' # 学習結果を格納するディレクトリを作成する if not os.path.exists('./result'): os.mkdir('./result') result_dir = './result' # 画像を分類するクラスを定義する classes = ['buri', 'katsuo', 'kuromaguro', 'maaji', 'NG'] nb_classes = len (classes) def image_train(): print('Start model building') model = Sequential() model.add(Conv2D(32, (3, 3), padding="same", input_shape=(150, 150, 3))) model.add(Activation(activation)) model.add(Conv2D(32, (3, 3), padding="same")) model.add(Activation(activation)) model.add(MaxPooling2D(pool_size=(2, 2))) model.add(Dropout(0.25)) model.add(Conv2D(64, (3, 3), padding='same')) model.add(Activation(activation)) model.add(Conv2D(64, (3, 3), padding="same")) model.add(Activation(activation)) model.add(MaxPooling2D(pool_size=(2, 2))) model.add(Dropout(0.25)) model.add(Flatten()) model.add(Dense(512)) model.add(Activation(activation)) model.add(Dropout(0.5)) model.add(Dense(nb_classes)) model.add(Activation('softmax')) model.summary() model.compile(loss='binary_crossentropy', optimizer=optimizer, metrics=['accuracy']) # モデルをファイルに保存する model_json = model.to_json() with open(os.path.join(result_dir, 'model.json'), 'w') as f: f.write(model_json) print('start training.') # 訓練データの作成 train_datagen = ImageDataGenerator( #zca_whitening= True, # ZCA白色化を適用します rotation_range=40, # 画像をランダムに回転する回転範囲 width_shift_range=0.2, # ランダムに水平シフトする範囲 height_shift_range=0.2, # ランダムに垂直シフトする範囲 shear_range=0.2, # シアー強度(反時計回りのシアー角度(ラジアン)) zoom_range=0.2, # ランダムにズームする範囲.浮動小数点数が与えられた場合 horizontal_flip=True, # 水平方向に入力をランダムに反転します rescale=1.0 / 255) # Noneか0ならば,適用しない.それ以外であれば,(他の変換を行う前に) 与えられた値をデータに積算する train_generator = train_datagen.flow_from_directory( train_path, target_size=(150, 150), batch_size=batch_size, classes=classes, class_mode='categorical') # 検証用データの生成定義 validation_datagen = ImageDataGenerator(rescale=1.0 / 255) validation_generator = validation_datagen.flow_from_directory( valid_path, target_size=(150, 150), batch_size=batch_size, classes=classes, class_mode='categorical') steps_per_epoch = train_generator.samples validation_steps = validation_generator.samples print('steps_per_epoch is set to %s' % steps_per_epoch) print('validation_steps is set to %s' % validation_steps) # 訓練の早期終了 es_cb = EarlyStopping(monitor='val_loss', patience=2, verbose=1, mode='auto') # 訓練開始 history = model.fit_generator(generator=train_generator, steps_per_epoch=steps_per_epoch, verbose=1, callbacks=[es_cb], validation_data=validation_generator, validation_steps=validation_steps, epochs=nb_epoch) print('Training Complete.') model.save_weights(os.path.join(result_dir, 'weight.h5')) # plot_model(model, to_file=os.path.join(result_dir, filename_prefix + '_model.png'), show_shapes=True) if __name__ == '__main__': image_train()
30.736
107
0.656689
import os from keras.models import Sequential from keras.layers import Conv2D, MaxPooling2D, Dense, Dropout, Activation, Flatten from keras.utils import plot_model from keras.preprocessing.image import ImageDataGenerator from keras.utils import plot_model from keras.preprocessing import image from keras.callbacks import EarlyStopping activation = 'relu' optimizer = 'Adam' nb_epoch = 30 batch_size = 16 train_path = './train' valid_path = './valid' if not os.path.exists('./result'): os.mkdir('./result') result_dir = './result' classes = ['buri', 'katsuo', 'kuromaguro', 'maaji', 'NG'] nb_classes = len (classes) def image_train(): print('Start model building') model = Sequential() model.add(Conv2D(32, (3, 3), padding="same", input_shape=(150, 150, 3))) model.add(Activation(activation)) model.add(Conv2D(32, (3, 3), padding="same")) model.add(Activation(activation)) model.add(MaxPooling2D(pool_size=(2, 2))) model.add(Dropout(0.25)) model.add(Conv2D(64, (3, 3), padding='same')) model.add(Activation(activation)) model.add(Conv2D(64, (3, 3), padding="same")) model.add(Activation(activation)) model.add(MaxPooling2D(pool_size=(2, 2))) model.add(Dropout(0.25)) model.add(Flatten()) model.add(Dense(512)) model.add(Activation(activation)) model.add(Dropout(0.5)) model.add(Dense(nb_classes)) model.add(Activation('softmax')) model.summary() model.compile(loss='binary_crossentropy', optimizer=optimizer, metrics=['accuracy']) model_json = model.to_json() with open(os.path.join(result_dir, 'model.json'), 'w') as f: f.write(model_json) print('start training.') train_datagen = ImageDataGenerator( ion_range=40, width_shift_range=0.2, height_shift_range=0.2, shear_range=0.2, zoom_range=0.2, horizontal_flip=True, rescale=1.0 / 255) train_generator = train_datagen.flow_from_directory( train_path, target_size=(150, 150), batch_size=batch_size, classes=classes, class_mode='categorical') validation_datagen = ImageDataGenerator(rescale=1.0 / 255) validation_generator = validation_datagen.flow_from_directory( valid_path, target_size=(150, 150), batch_size=batch_size, classes=classes, class_mode='categorical') steps_per_epoch = train_generator.samples validation_steps = validation_generator.samples print('steps_per_epoch is set to %s' % steps_per_epoch) print('validation_steps is set to %s' % validation_steps) es_cb = EarlyStopping(monitor='val_loss', patience=2, verbose=1, mode='auto') history = model.fit_generator(generator=train_generator, steps_per_epoch=steps_per_epoch, verbose=1, callbacks=[es_cb], validation_data=validation_generator, validation_steps=validation_steps, epochs=nb_epoch) print('Training Complete.') model.save_weights(os.path.join(result_dir, 'weight.h5')) if __name__ == '__main__': image_train()
true
true
1c456a5b82ba05659c5a11cb9ea95320d3f81903
2,818
py
Python
test/functional/rpc_getblockfilter.py
CallMeMisterOwl/bitcoin
9d2895157ec0ff6e356f40c5fe84d3007fc991c1
[ "MIT" ]
2
2020-08-16T16:27:01.000Z
2020-08-20T06:19:32.000Z
test/functional/rpc_getblockfilter.py
CallMeMisterOwl/bitcoin
9d2895157ec0ff6e356f40c5fe84d3007fc991c1
[ "MIT" ]
1
2022-01-08T14:38:57.000Z
2022-01-08T14:38:57.000Z
test/functional/rpc_getblockfilter.py
CallMeMisterOwl/bitcoin
9d2895157ec0ff6e356f40c5fe84d3007fc991c1
[ "MIT" ]
1
2022-02-19T19:33:46.000Z
2022-02-19T19:33:46.000Z
#!/usr/bin/env python3 # Copyright (c) 2018-2020 The Bitcoin Core developers # Distributed under the MIT software license, see the accompanying # file COPYING or http://www.opensource.org/licenses/mit-license.php. """Test the getblockfilter RPC.""" from test_framework.test_framework import BitcoinTestFramework from test_framework.util import ( assert_equal, assert_is_hex_string, assert_raises_rpc_error, ) FILTER_TYPES = ["basic"] class GetBlockFilterTest(BitcoinTestFramework): def set_test_params(self): self.setup_clean_chain = True self.num_nodes = 2 self.extra_args = [["-blockfilterindex"], []] def run_test(self): # Create two chains by disconnecting nodes 0 & 1, mining, then reconnecting self.disconnect_nodes(0, 1) self.generate(self.nodes[0], 3, sync_fun=self.no_op) self.generate(self.nodes[1], 4, sync_fun=self.no_op) assert_equal(self.nodes[0].getblockcount(), 3) chain0_hashes = [self.nodes[0].getblockhash(block_height) for block_height in range(4)] # Reorg node 0 to a new chain self.connect_nodes(0, 1) self.sync_blocks() assert_equal(self.nodes[0].getblockcount(), 4) chain1_hashes = [self.nodes[0].getblockhash(block_height) for block_height in range(4)] # Test getblockfilter returns a filter for all blocks and filter types on active chain for block_hash in chain1_hashes: for filter_type in FILTER_TYPES: result = self.nodes[0].getblockfilter(block_hash, filter_type) assert_is_hex_string(result['filter']) # Test getblockfilter returns a filter for all blocks and filter types on stale chain for block_hash in chain0_hashes: for filter_type in FILTER_TYPES: result = self.nodes[0].getblockfilter(block_hash, filter_type) assert_is_hex_string(result['filter']) # Test getblockfilter with unknown block bad_block_hash = "0123456789abcdef" * 4 assert_raises_rpc_error(-5, "Block not found", self.nodes[0].getblockfilter, bad_block_hash, "basic") # Test getblockfilter with undefined filter type genesis_hash = self.nodes[0].getblockhash(0) assert_raises_rpc_error(-5, "Unknown filtertype", self.nodes[0].getblockfilter, genesis_hash, "unknown") # Test getblockfilter fails on node without compact block filter index self.restart_node(0, extra_args=["-blockfilterindex=0"]) for filter_type in FILTER_TYPES: assert_raises_rpc_error(-1, "Index is not enabled for filtertype {}".format(filter_type), self.nodes[0].getblockfilter, genesis_hash, filter_type) if __name__ == '__main__': GetBlockFilterTest().main()
43.353846
112
0.688077
from test_framework.test_framework import BitcoinTestFramework from test_framework.util import ( assert_equal, assert_is_hex_string, assert_raises_rpc_error, ) FILTER_TYPES = ["basic"] class GetBlockFilterTest(BitcoinTestFramework): def set_test_params(self): self.setup_clean_chain = True self.num_nodes = 2 self.extra_args = [["-blockfilterindex"], []] def run_test(self): self.disconnect_nodes(0, 1) self.generate(self.nodes[0], 3, sync_fun=self.no_op) self.generate(self.nodes[1], 4, sync_fun=self.no_op) assert_equal(self.nodes[0].getblockcount(), 3) chain0_hashes = [self.nodes[0].getblockhash(block_height) for block_height in range(4)] self.connect_nodes(0, 1) self.sync_blocks() assert_equal(self.nodes[0].getblockcount(), 4) chain1_hashes = [self.nodes[0].getblockhash(block_height) for block_height in range(4)] for block_hash in chain1_hashes: for filter_type in FILTER_TYPES: result = self.nodes[0].getblockfilter(block_hash, filter_type) assert_is_hex_string(result['filter']) for block_hash in chain0_hashes: for filter_type in FILTER_TYPES: result = self.nodes[0].getblockfilter(block_hash, filter_type) assert_is_hex_string(result['filter']) bad_block_hash = "0123456789abcdef" * 4 assert_raises_rpc_error(-5, "Block not found", self.nodes[0].getblockfilter, bad_block_hash, "basic") genesis_hash = self.nodes[0].getblockhash(0) assert_raises_rpc_error(-5, "Unknown filtertype", self.nodes[0].getblockfilter, genesis_hash, "unknown") self.restart_node(0, extra_args=["-blockfilterindex=0"]) for filter_type in FILTER_TYPES: assert_raises_rpc_error(-1, "Index is not enabled for filtertype {}".format(filter_type), self.nodes[0].getblockfilter, genesis_hash, filter_type) if __name__ == '__main__': GetBlockFilterTest().main()
true
true
1c456aa4cb7c1dda13e25217b75d8708106ea6d2
14,192
py
Python
sdk/python/pulumi_azure_nextgen/securityinsights/v20190101preview/get_incident.py
pulumi/pulumi-azure-nextgen
452736b0a1cf584c2d4c04666e017af6e9b2c15c
[ "Apache-2.0" ]
31
2020-09-21T09:41:01.000Z
2021-02-26T13:21:59.000Z
sdk/python/pulumi_azure_nextgen/securityinsights/v20190101preview/get_incident.py
pulumi/pulumi-azure-nextgen
452736b0a1cf584c2d4c04666e017af6e9b2c15c
[ "Apache-2.0" ]
231
2020-09-21T09:38:45.000Z
2021-03-01T11:16:03.000Z
sdk/python/pulumi_azure_nextgen/securityinsights/v20190101preview/get_incident.py
pulumi/pulumi-azure-nextgen
452736b0a1cf584c2d4c04666e017af6e9b2c15c
[ "Apache-2.0" ]
4
2020-09-29T14:14:59.000Z
2021-02-10T20:38:16.000Z
# coding=utf-8 # *** WARNING: this file was generated by the Pulumi SDK Generator. *** # *** Do not edit by hand unless you're certain you know what you are doing! *** import warnings import pulumi import pulumi.runtime from typing import Any, Mapping, Optional, Sequence, Union from ... import _utilities, _tables from . import outputs __all__ = [ 'GetIncidentResult', 'AwaitableGetIncidentResult', 'get_incident', ] @pulumi.output_type class GetIncidentResult: """ Represents an incident in Azure Security Insights. """ def __init__(__self__, additional_data=None, classification=None, classification_comment=None, classification_reason=None, created_time_utc=None, description=None, etag=None, first_activity_time_utc=None, id=None, incident_number=None, incident_url=None, labels=None, last_activity_time_utc=None, last_modified_time_utc=None, name=None, owner=None, provider_incident_id=None, provider_name=None, related_analytic_rule_ids=None, severity=None, status=None, title=None, type=None): if additional_data and not isinstance(additional_data, dict): raise TypeError("Expected argument 'additional_data' to be a dict") pulumi.set(__self__, "additional_data", additional_data) if classification and not isinstance(classification, str): raise TypeError("Expected argument 'classification' to be a str") pulumi.set(__self__, "classification", classification) if classification_comment and not isinstance(classification_comment, str): raise TypeError("Expected argument 'classification_comment' to be a str") pulumi.set(__self__, "classification_comment", classification_comment) if classification_reason and not isinstance(classification_reason, str): raise TypeError("Expected argument 'classification_reason' to be a str") pulumi.set(__self__, "classification_reason", classification_reason) if created_time_utc and not isinstance(created_time_utc, str): raise TypeError("Expected argument 'created_time_utc' to be a str") pulumi.set(__self__, "created_time_utc", created_time_utc) if description and not isinstance(description, str): raise TypeError("Expected argument 'description' to be a str") pulumi.set(__self__, "description", description) if etag and not isinstance(etag, str): raise TypeError("Expected argument 'etag' to be a str") pulumi.set(__self__, "etag", etag) if first_activity_time_utc and not isinstance(first_activity_time_utc, str): raise TypeError("Expected argument 'first_activity_time_utc' to be a str") pulumi.set(__self__, "first_activity_time_utc", first_activity_time_utc) if id and not isinstance(id, str): raise TypeError("Expected argument 'id' to be a str") pulumi.set(__self__, "id", id) if incident_number and not isinstance(incident_number, int): raise TypeError("Expected argument 'incident_number' to be a int") pulumi.set(__self__, "incident_number", incident_number) if incident_url and not isinstance(incident_url, str): raise TypeError("Expected argument 'incident_url' to be a str") pulumi.set(__self__, "incident_url", incident_url) if labels and not isinstance(labels, list): raise TypeError("Expected argument 'labels' to be a list") pulumi.set(__self__, "labels", labels) if last_activity_time_utc and not isinstance(last_activity_time_utc, str): raise TypeError("Expected argument 'last_activity_time_utc' to be a str") pulumi.set(__self__, "last_activity_time_utc", last_activity_time_utc) if last_modified_time_utc and not isinstance(last_modified_time_utc, str): raise TypeError("Expected argument 'last_modified_time_utc' to be a str") pulumi.set(__self__, "last_modified_time_utc", last_modified_time_utc) if name and not isinstance(name, str): raise TypeError("Expected argument 'name' to be a str") pulumi.set(__self__, "name", name) if owner and not isinstance(owner, dict): raise TypeError("Expected argument 'owner' to be a dict") pulumi.set(__self__, "owner", owner) if provider_incident_id and not isinstance(provider_incident_id, str): raise TypeError("Expected argument 'provider_incident_id' to be a str") pulumi.set(__self__, "provider_incident_id", provider_incident_id) if provider_name and not isinstance(provider_name, str): raise TypeError("Expected argument 'provider_name' to be a str") pulumi.set(__self__, "provider_name", provider_name) if related_analytic_rule_ids and not isinstance(related_analytic_rule_ids, list): raise TypeError("Expected argument 'related_analytic_rule_ids' to be a list") pulumi.set(__self__, "related_analytic_rule_ids", related_analytic_rule_ids) if severity and not isinstance(severity, str): raise TypeError("Expected argument 'severity' to be a str") pulumi.set(__self__, "severity", severity) if status and not isinstance(status, str): raise TypeError("Expected argument 'status' to be a str") pulumi.set(__self__, "status", status) if title and not isinstance(title, str): raise TypeError("Expected argument 'title' to be a str") pulumi.set(__self__, "title", title) if type and not isinstance(type, str): raise TypeError("Expected argument 'type' to be a str") pulumi.set(__self__, "type", type) @property @pulumi.getter(name="additionalData") def additional_data(self) -> 'outputs.IncidentAdditionalDataResponse': """ Additional data on the incident """ return pulumi.get(self, "additional_data") @property @pulumi.getter def classification(self) -> Optional[str]: """ The reason the incident was closed """ return pulumi.get(self, "classification") @property @pulumi.getter(name="classificationComment") def classification_comment(self) -> Optional[str]: """ Describes the reason the incident was closed """ return pulumi.get(self, "classification_comment") @property @pulumi.getter(name="classificationReason") def classification_reason(self) -> Optional[str]: """ The classification reason the incident was closed with """ return pulumi.get(self, "classification_reason") @property @pulumi.getter(name="createdTimeUtc") def created_time_utc(self) -> str: """ The time the incident was created """ return pulumi.get(self, "created_time_utc") @property @pulumi.getter def description(self) -> Optional[str]: """ The description of the incident """ return pulumi.get(self, "description") @property @pulumi.getter def etag(self) -> Optional[str]: """ Etag of the azure resource """ return pulumi.get(self, "etag") @property @pulumi.getter(name="firstActivityTimeUtc") def first_activity_time_utc(self) -> Optional[str]: """ The time of the first activity in the incident """ return pulumi.get(self, "first_activity_time_utc") @property @pulumi.getter def id(self) -> str: """ Azure resource Id """ return pulumi.get(self, "id") @property @pulumi.getter(name="incidentNumber") def incident_number(self) -> int: """ A sequential number """ return pulumi.get(self, "incident_number") @property @pulumi.getter(name="incidentUrl") def incident_url(self) -> str: """ The deep-link url to the incident in Azure portal """ return pulumi.get(self, "incident_url") @property @pulumi.getter def labels(self) -> Optional[Sequence['outputs.IncidentLabelResponse']]: """ List of labels relevant to this incident """ return pulumi.get(self, "labels") @property @pulumi.getter(name="lastActivityTimeUtc") def last_activity_time_utc(self) -> Optional[str]: """ The time of the last activity in the incident """ return pulumi.get(self, "last_activity_time_utc") @property @pulumi.getter(name="lastModifiedTimeUtc") def last_modified_time_utc(self) -> str: """ The last time the incident was updated """ return pulumi.get(self, "last_modified_time_utc") @property @pulumi.getter def name(self) -> str: """ Azure resource name """ return pulumi.get(self, "name") @property @pulumi.getter def owner(self) -> Optional['outputs.IncidentOwnerInfoResponse']: """ Describes a user that the incident is assigned to """ return pulumi.get(self, "owner") @property @pulumi.getter(name="providerIncidentId") def provider_incident_id(self) -> Optional[str]: """ The incident ID assigned by the incident provider """ return pulumi.get(self, "provider_incident_id") @property @pulumi.getter(name="providerName") def provider_name(self) -> Optional[str]: """ The name of the source provider that generated the incident """ return pulumi.get(self, "provider_name") @property @pulumi.getter(name="relatedAnalyticRuleIds") def related_analytic_rule_ids(self) -> Sequence[str]: """ List of resource ids of Analytic rules related to the incident """ return pulumi.get(self, "related_analytic_rule_ids") @property @pulumi.getter def severity(self) -> str: """ The severity of the incident """ return pulumi.get(self, "severity") @property @pulumi.getter def status(self) -> str: """ The status of the incident """ return pulumi.get(self, "status") @property @pulumi.getter def title(self) -> str: """ The title of the incident """ return pulumi.get(self, "title") @property @pulumi.getter def type(self) -> str: """ Azure resource type """ return pulumi.get(self, "type") class AwaitableGetIncidentResult(GetIncidentResult): # pylint: disable=using-constant-test def __await__(self): if False: yield self return GetIncidentResult( additional_data=self.additional_data, classification=self.classification, classification_comment=self.classification_comment, classification_reason=self.classification_reason, created_time_utc=self.created_time_utc, description=self.description, etag=self.etag, first_activity_time_utc=self.first_activity_time_utc, id=self.id, incident_number=self.incident_number, incident_url=self.incident_url, labels=self.labels, last_activity_time_utc=self.last_activity_time_utc, last_modified_time_utc=self.last_modified_time_utc, name=self.name, owner=self.owner, provider_incident_id=self.provider_incident_id, provider_name=self.provider_name, related_analytic_rule_ids=self.related_analytic_rule_ids, severity=self.severity, status=self.status, title=self.title, type=self.type) def get_incident(incident_id: Optional[str] = None, operational_insights_resource_provider: Optional[str] = None, resource_group_name: Optional[str] = None, workspace_name: Optional[str] = None, opts: Optional[pulumi.InvokeOptions] = None) -> AwaitableGetIncidentResult: """ Represents an incident in Azure Security Insights. :param str incident_id: Incident ID :param str operational_insights_resource_provider: The namespace of workspaces resource provider- Microsoft.OperationalInsights. :param str resource_group_name: The name of the resource group within the user's subscription. The name is case insensitive. :param str workspace_name: The name of the workspace. """ __args__ = dict() __args__['incidentId'] = incident_id __args__['operationalInsightsResourceProvider'] = operational_insights_resource_provider __args__['resourceGroupName'] = resource_group_name __args__['workspaceName'] = workspace_name if opts is None: opts = pulumi.InvokeOptions() if opts.version is None: opts.version = _utilities.get_version() __ret__ = pulumi.runtime.invoke('azure-nextgen:securityinsights/v20190101preview:getIncident', __args__, opts=opts, typ=GetIncidentResult).value return AwaitableGetIncidentResult( additional_data=__ret__.additional_data, classification=__ret__.classification, classification_comment=__ret__.classification_comment, classification_reason=__ret__.classification_reason, created_time_utc=__ret__.created_time_utc, description=__ret__.description, etag=__ret__.etag, first_activity_time_utc=__ret__.first_activity_time_utc, id=__ret__.id, incident_number=__ret__.incident_number, incident_url=__ret__.incident_url, labels=__ret__.labels, last_activity_time_utc=__ret__.last_activity_time_utc, last_modified_time_utc=__ret__.last_modified_time_utc, name=__ret__.name, owner=__ret__.owner, provider_incident_id=__ret__.provider_incident_id, provider_name=__ret__.provider_name, related_analytic_rule_ids=__ret__.related_analytic_rule_ids, severity=__ret__.severity, status=__ret__.status, title=__ret__.title, type=__ret__.type)
39.532033
483
0.666995
import warnings import pulumi import pulumi.runtime from typing import Any, Mapping, Optional, Sequence, Union from ... import _utilities, _tables from . import outputs __all__ = [ 'GetIncidentResult', 'AwaitableGetIncidentResult', 'get_incident', ] @pulumi.output_type class GetIncidentResult: def __init__(__self__, additional_data=None, classification=None, classification_comment=None, classification_reason=None, created_time_utc=None, description=None, etag=None, first_activity_time_utc=None, id=None, incident_number=None, incident_url=None, labels=None, last_activity_time_utc=None, last_modified_time_utc=None, name=None, owner=None, provider_incident_id=None, provider_name=None, related_analytic_rule_ids=None, severity=None, status=None, title=None, type=None): if additional_data and not isinstance(additional_data, dict): raise TypeError("Expected argument 'additional_data' to be a dict") pulumi.set(__self__, "additional_data", additional_data) if classification and not isinstance(classification, str): raise TypeError("Expected argument 'classification' to be a str") pulumi.set(__self__, "classification", classification) if classification_comment and not isinstance(classification_comment, str): raise TypeError("Expected argument 'classification_comment' to be a str") pulumi.set(__self__, "classification_comment", classification_comment) if classification_reason and not isinstance(classification_reason, str): raise TypeError("Expected argument 'classification_reason' to be a str") pulumi.set(__self__, "classification_reason", classification_reason) if created_time_utc and not isinstance(created_time_utc, str): raise TypeError("Expected argument 'created_time_utc' to be a str") pulumi.set(__self__, "created_time_utc", created_time_utc) if description and not isinstance(description, str): raise TypeError("Expected argument 'description' to be a str") pulumi.set(__self__, "description", description) if etag and not isinstance(etag, str): raise TypeError("Expected argument 'etag' to be a str") pulumi.set(__self__, "etag", etag) if first_activity_time_utc and not isinstance(first_activity_time_utc, str): raise TypeError("Expected argument 'first_activity_time_utc' to be a str") pulumi.set(__self__, "first_activity_time_utc", first_activity_time_utc) if id and not isinstance(id, str): raise TypeError("Expected argument 'id' to be a str") pulumi.set(__self__, "id", id) if incident_number and not isinstance(incident_number, int): raise TypeError("Expected argument 'incident_number' to be a int") pulumi.set(__self__, "incident_number", incident_number) if incident_url and not isinstance(incident_url, str): raise TypeError("Expected argument 'incident_url' to be a str") pulumi.set(__self__, "incident_url", incident_url) if labels and not isinstance(labels, list): raise TypeError("Expected argument 'labels' to be a list") pulumi.set(__self__, "labels", labels) if last_activity_time_utc and not isinstance(last_activity_time_utc, str): raise TypeError("Expected argument 'last_activity_time_utc' to be a str") pulumi.set(__self__, "last_activity_time_utc", last_activity_time_utc) if last_modified_time_utc and not isinstance(last_modified_time_utc, str): raise TypeError("Expected argument 'last_modified_time_utc' to be a str") pulumi.set(__self__, "last_modified_time_utc", last_modified_time_utc) if name and not isinstance(name, str): raise TypeError("Expected argument 'name' to be a str") pulumi.set(__self__, "name", name) if owner and not isinstance(owner, dict): raise TypeError("Expected argument 'owner' to be a dict") pulumi.set(__self__, "owner", owner) if provider_incident_id and not isinstance(provider_incident_id, str): raise TypeError("Expected argument 'provider_incident_id' to be a str") pulumi.set(__self__, "provider_incident_id", provider_incident_id) if provider_name and not isinstance(provider_name, str): raise TypeError("Expected argument 'provider_name' to be a str") pulumi.set(__self__, "provider_name", provider_name) if related_analytic_rule_ids and not isinstance(related_analytic_rule_ids, list): raise TypeError("Expected argument 'related_analytic_rule_ids' to be a list") pulumi.set(__self__, "related_analytic_rule_ids", related_analytic_rule_ids) if severity and not isinstance(severity, str): raise TypeError("Expected argument 'severity' to be a str") pulumi.set(__self__, "severity", severity) if status and not isinstance(status, str): raise TypeError("Expected argument 'status' to be a str") pulumi.set(__self__, "status", status) if title and not isinstance(title, str): raise TypeError("Expected argument 'title' to be a str") pulumi.set(__self__, "title", title) if type and not isinstance(type, str): raise TypeError("Expected argument 'type' to be a str") pulumi.set(__self__, "type", type) @property @pulumi.getter(name="additionalData") def additional_data(self) -> 'outputs.IncidentAdditionalDataResponse': return pulumi.get(self, "additional_data") @property @pulumi.getter def classification(self) -> Optional[str]: return pulumi.get(self, "classification") @property @pulumi.getter(name="classificationComment") def classification_comment(self) -> Optional[str]: return pulumi.get(self, "classification_comment") @property @pulumi.getter(name="classificationReason") def classification_reason(self) -> Optional[str]: return pulumi.get(self, "classification_reason") @property @pulumi.getter(name="createdTimeUtc") def created_time_utc(self) -> str: return pulumi.get(self, "created_time_utc") @property @pulumi.getter def description(self) -> Optional[str]: return pulumi.get(self, "description") @property @pulumi.getter def etag(self) -> Optional[str]: return pulumi.get(self, "etag") @property @pulumi.getter(name="firstActivityTimeUtc") def first_activity_time_utc(self) -> Optional[str]: return pulumi.get(self, "first_activity_time_utc") @property @pulumi.getter def id(self) -> str: return pulumi.get(self, "id") @property @pulumi.getter(name="incidentNumber") def incident_number(self) -> int: return pulumi.get(self, "incident_number") @property @pulumi.getter(name="incidentUrl") def incident_url(self) -> str: return pulumi.get(self, "incident_url") @property @pulumi.getter def labels(self) -> Optional[Sequence['outputs.IncidentLabelResponse']]: return pulumi.get(self, "labels") @property @pulumi.getter(name="lastActivityTimeUtc") def last_activity_time_utc(self) -> Optional[str]: return pulumi.get(self, "last_activity_time_utc") @property @pulumi.getter(name="lastModifiedTimeUtc") def last_modified_time_utc(self) -> str: return pulumi.get(self, "last_modified_time_utc") @property @pulumi.getter def name(self) -> str: return pulumi.get(self, "name") @property @pulumi.getter def owner(self) -> Optional['outputs.IncidentOwnerInfoResponse']: return pulumi.get(self, "owner") @property @pulumi.getter(name="providerIncidentId") def provider_incident_id(self) -> Optional[str]: return pulumi.get(self, "provider_incident_id") @property @pulumi.getter(name="providerName") def provider_name(self) -> Optional[str]: return pulumi.get(self, "provider_name") @property @pulumi.getter(name="relatedAnalyticRuleIds") def related_analytic_rule_ids(self) -> Sequence[str]: return pulumi.get(self, "related_analytic_rule_ids") @property @pulumi.getter def severity(self) -> str: return pulumi.get(self, "severity") @property @pulumi.getter def status(self) -> str: return pulumi.get(self, "status") @property @pulumi.getter def title(self) -> str: return pulumi.get(self, "title") @property @pulumi.getter def type(self) -> str: return pulumi.get(self, "type") class AwaitableGetIncidentResult(GetIncidentResult): # pylint: disable=using-constant-test def __await__(self): if False: yield self return GetIncidentResult( additional_data=self.additional_data, classification=self.classification, classification_comment=self.classification_comment, classification_reason=self.classification_reason, created_time_utc=self.created_time_utc, description=self.description, etag=self.etag, first_activity_time_utc=self.first_activity_time_utc, id=self.id, incident_number=self.incident_number, incident_url=self.incident_url, labels=self.labels, last_activity_time_utc=self.last_activity_time_utc, last_modified_time_utc=self.last_modified_time_utc, name=self.name, owner=self.owner, provider_incident_id=self.provider_incident_id, provider_name=self.provider_name, related_analytic_rule_ids=self.related_analytic_rule_ids, severity=self.severity, status=self.status, title=self.title, type=self.type) def get_incident(incident_id: Optional[str] = None, operational_insights_resource_provider: Optional[str] = None, resource_group_name: Optional[str] = None, workspace_name: Optional[str] = None, opts: Optional[pulumi.InvokeOptions] = None) -> AwaitableGetIncidentResult: __args__ = dict() __args__['incidentId'] = incident_id __args__['operationalInsightsResourceProvider'] = operational_insights_resource_provider __args__['resourceGroupName'] = resource_group_name __args__['workspaceName'] = workspace_name if opts is None: opts = pulumi.InvokeOptions() if opts.version is None: opts.version = _utilities.get_version() __ret__ = pulumi.runtime.invoke('azure-nextgen:securityinsights/v20190101preview:getIncident', __args__, opts=opts, typ=GetIncidentResult).value return AwaitableGetIncidentResult( additional_data=__ret__.additional_data, classification=__ret__.classification, classification_comment=__ret__.classification_comment, classification_reason=__ret__.classification_reason, created_time_utc=__ret__.created_time_utc, description=__ret__.description, etag=__ret__.etag, first_activity_time_utc=__ret__.first_activity_time_utc, id=__ret__.id, incident_number=__ret__.incident_number, incident_url=__ret__.incident_url, labels=__ret__.labels, last_activity_time_utc=__ret__.last_activity_time_utc, last_modified_time_utc=__ret__.last_modified_time_utc, name=__ret__.name, owner=__ret__.owner, provider_incident_id=__ret__.provider_incident_id, provider_name=__ret__.provider_name, related_analytic_rule_ids=__ret__.related_analytic_rule_ids, severity=__ret__.severity, status=__ret__.status, title=__ret__.title, type=__ret__.type)
true
true
1c456b4651c14bf62f1b981a4373ef3876f9cc4a
10,375
py
Python
python/tvm/relay/analysis.py
Checkmate50/tvm
0293f42232ac2506c9cf8914410282c54ee4c0ed
[ "Apache-2.0" ]
null
null
null
python/tvm/relay/analysis.py
Checkmate50/tvm
0293f42232ac2506c9cf8914410282c54ee4c0ed
[ "Apache-2.0" ]
null
null
null
python/tvm/relay/analysis.py
Checkmate50/tvm
0293f42232ac2506c9cf8914410282c54ee4c0ed
[ "Apache-2.0" ]
null
null
null
# Licensed to the Apache Software Foundation (ASF) under one # or more contributor license agreements. See the NOTICE file # distributed with this work for additional information # regarding copyright ownership. The ASF licenses this file # to you under the Apache License, Version 2.0 (the # "License"); you may not use this file except in compliance # with the License. You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, # software distributed under the License is distributed on an # "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY # KIND, either express or implied. See the License for the # specific language governing permissions and limitations # under the License. # pylint: disable=no-else-return # pylint: disable=unidiomatic-typecheck """ This file contains the set of passes for Relay, which exposes an interface for configuring the passes and scripting them in Python. """ from . import _analysis from . import _make from .expr import Expr from .ty import Type from .module import Module from .feature import Feature def post_order_visit(expr, fvisit): """Recursively visit the ir in post DFS order node, apply fvisit. Each node is guaranteed to be visited only once. Parameters ---------- expr : tvm.relay.Expr The input expression. fvisit : function The visitor function to be applied. """ return _analysis.post_order_visit(expr, fvisit) def well_formed(expr): """Check that each Var is only bound once (well formed). Parameters ---------- expr : tvm.relay.Expr The input expression Returns ------- well_form : bool Whether the input expression is well formed """ return _analysis.well_formed(expr) def check_kind(t, mod=None): """Check that the type is well kinded and return the kind. For example, this mean type cannot has tensor of tensor, or is a tuple type of 2 shapes. Parameters ---------- t : tvm.relay.Type The type to check mod : Optional[tvm.relay.Module] The global module. Returns ------- kind : Kind the kind of t Examples -------- .. code:: python assert check_kind(relay.TupleType([relay.TypeParam('tp1', relay.Kind.Shape)])) == Shape assert check_kind(relay.TupleType([relay.TypeParam('tp1', relay.Kind.Type)])) == Type """ if mod is not None: return _analysis.check_kind(t, mod) else: return _analysis.check_kind(t) def check_constant(expr): """Check whether an expression is constant Parameters ---------- expr : tvm.relay.Expr The input expression Returns ------- result : bool Whether the expression is constant. """ return _analysis.check_constant(expr) def free_vars(expr): """Get free Vars from expression expr in Post DFS order. Parameters ---------- expr : tvm.relay.Expr The input expression Returns ------- free : List[tvm.relay.Var] The list of free variables in post DFS order. Note ---- The fact that Vars are post-DFS ordred are useful in neural networks: usually this means weights of previous are ordered first. """ return _analysis.free_vars(expr) def bound_vars(expr): """Get bound vars from expression expr in post-DFS order. Parameters ---------- expr : tvm.relay.Expr The input expression Returns ------- free : List[tvm.relay.Var] The list of bound variables in post-DFS order. """ return _analysis.bound_vars(expr) def all_vars(expr): """Get all vars from expression expr in post-DFS order. Parameters ---------- expr : tvm.relay.Expr The input expression Returns ------- free : List[tvm.relay.Var] The list of all variables in post-DFS order. """ return _analysis.all_vars(expr) def free_type_vars(expr, mod=None): """Get free type variables from expression/type e Parameters ---------- expr : Union[tvm.relay.Expr,tvm.relay.Type] The input expression/type mod : Optional[tvm.relay.Module] The global module Returns ------- free : List[tvm.relay.TypeVar] The list of free type variables in post-DFS order """ use_mod = mod if mod is not None else Module() return _analysis.free_type_vars(expr, use_mod) def bound_type_vars(expr, mod=None): """Get bound type variables from expression/type e Parameters ---------- expr : Union[tvm.relay.Expr,tvm.relay.Type] The input expression/type mod : Optional[tvm.relay.Module] The global module Returns ------- free : List[tvm.relay.TypeVar] The list of bound type variables in post-DFS order """ use_mod = mod if mod is not None else Module() return _analysis.bound_type_vars(expr, use_mod) def all_type_vars(expr, mod=None): """Get all type variables from expression/type e Parameters ---------- expr : Union[tvm.relay.Expr,tvm.relay.Type] The input expression/type mod : Optional[tvm.relay.Module] The global module Returns ------- free : List[tvm.relay.TypeVar] The list of all type variables in post-DFS order """ use_mod = mod if mod is not None else Module() return _analysis.all_type_vars(expr, use_mod) def alpha_equal(lhs, rhs): """Compare two Relay expr for structural equivalence (alpha equivalence). Parameters ---------- lhs : tvm.relay.Expr One of the input Expression. rhs : tvm.relay.Expr One of the input Expression. Returns ------- result : bool True iff lhs is alpha equal to rhs. """ return bool(_make._alpha_equal(lhs, rhs)) def assert_alpha_equal(lhs, rhs): """Assert that two Relay expr is structurally equivalent. (alpha equivalence). Parameters ---------- lhs : tvm.relay.Expr One of the input Expression. rhs : tvm.relay.Expr One of the input Expression. """ _make._assert_alpha_equal(lhs, rhs) def graph_equal(lhs, rhs): """Compare two Relay expr for data-flow equivalence. The difference between this and alpha-equality is that variables are not expected to match between lhs and rhs; they are treated as sources and are mapped between each other. Parameters ---------- lhs : tvm.relay.Expr One of the input Expression. rhs : tvm.relay.Expr One of the input Expression. Returns ------- result : bool True iff lhs is data-flow equivalent to rhs. """ return bool(_make._graph_equal(lhs, rhs)) def assert_graph_equal(lhs, rhs): """Compare two Relay expr for data-flow equivalence. The difference between this and alpha-equality is that variables are not expected to match between lhs and rhs; they are treated as sources and are mapped between each other. Parameters ---------- lhs : tvm.relay.Expr One of the input Expression. rhs : tvm.relay.Expr One of the input Expression. """ _make._assert_graph_equal(lhs, rhs) def collect_device_info(expr): """Collect the device allocation map for the given expression. The device ids are propagated from the `device_copy` operators. Parameters ---------- expr : tvm.relay.Expr The input expression. Returns ------- ret : Dict[tvm.relay.expr, int] A dictionary mapping tvm.relay.Expr to device type. """ return _analysis.CollectDeviceInfo(expr) def collect_device_annotation_ops(expr): """Collect the device annotation ops for the given expression. Parameters ---------- expr : tvm.relay.Expr The input expression. Returns ------- ret : Dict[tvm.relay.expr, int] A dictionary mapping tvm.relay.Expr to device type where the keys are annotation expressions. """ return _analysis.CollectDeviceAnnotationOps(expr) def get_total_mac_number(expr): """ Count the number of MACs (multiply-accumulate) of a model Parameters ---------- expr : tvm.relay.Expr The input expression. Returns ------- result : int64 The number of MACs (multiply-accumulate) of a model """ return _analysis.GetTotalMacNumber(expr) def missing_gradient_check(expr): """ Check if there is a missing gradient and print it. Parameters ---------- expr : tvm.relay.Expr The input expression. """ _analysis.missing_gradient_check(expr) def unmatched_cases(match, mod=None): """ Finds cases that the match expression does not catch, if any. Parameters ---------- match : tvm.relay.Match The match expression mod : Optional[tvm.relay.Module] The module (defaults to an empty module) Returns ------- missing_patterns : [tvm.relay.Pattern] Patterns that the match expression does not catch. """ return _analysis.unmatched_cases(match, mod) def detect_feature(a, b=None): """ Detect the feature used in a relay program. Parameters ---------- a : Union[tvm.relay.Expr, tvm.relay.Module] The input expression or module. b : Optional[Union[tvm.relay.Expr, tvm.relay.Module]] The input expression or module. The two arguments cannot both be expression or module. Returns ------- features : Set[Feature] Features used in the program. """ if isinstance(a, Module): a, b = b, a return set([Feature(int(x)) for x in _analysis.detect_feature(a, b)]) def structural_hash(value): """Hash a Relay expression structurally. Parameters ---------- expr : Union[tvm.relay.Expr, tvm.relay.Type] The expression to hash. Returns ------- result : int The hash value """ if isinstance(value, Expr): return int(_analysis._expr_hash(value)) elif isinstance(value, Type): return int(_analysis._type_hash(value)) else: msg = ("found value of type {0} expected" + "relay.Expr or relay.Type").format(type(value)) raise TypeError(msg)
24.585308
95
0.64212
from . import _analysis from . import _make from .expr import Expr from .ty import Type from .module import Module from .feature import Feature def post_order_visit(expr, fvisit): return _analysis.post_order_visit(expr, fvisit) def well_formed(expr): return _analysis.well_formed(expr) def check_kind(t, mod=None): if mod is not None: return _analysis.check_kind(t, mod) else: return _analysis.check_kind(t) def check_constant(expr): return _analysis.check_constant(expr) def free_vars(expr): return _analysis.free_vars(expr) def bound_vars(expr): return _analysis.bound_vars(expr) def all_vars(expr): return _analysis.all_vars(expr) def free_type_vars(expr, mod=None): use_mod = mod if mod is not None else Module() return _analysis.free_type_vars(expr, use_mod) def bound_type_vars(expr, mod=None): use_mod = mod if mod is not None else Module() return _analysis.bound_type_vars(expr, use_mod) def all_type_vars(expr, mod=None): use_mod = mod if mod is not None else Module() return _analysis.all_type_vars(expr, use_mod) def alpha_equal(lhs, rhs): return bool(_make._alpha_equal(lhs, rhs)) def assert_alpha_equal(lhs, rhs): _make._assert_alpha_equal(lhs, rhs) def graph_equal(lhs, rhs): return bool(_make._graph_equal(lhs, rhs)) def assert_graph_equal(lhs, rhs): _make._assert_graph_equal(lhs, rhs) def collect_device_info(expr): return _analysis.CollectDeviceInfo(expr) def collect_device_annotation_ops(expr): return _analysis.CollectDeviceAnnotationOps(expr) def get_total_mac_number(expr): return _analysis.GetTotalMacNumber(expr) def missing_gradient_check(expr): _analysis.missing_gradient_check(expr) def unmatched_cases(match, mod=None): return _analysis.unmatched_cases(match, mod) def detect_feature(a, b=None): if isinstance(a, Module): a, b = b, a return set([Feature(int(x)) for x in _analysis.detect_feature(a, b)]) def structural_hash(value): if isinstance(value, Expr): return int(_analysis._expr_hash(value)) elif isinstance(value, Type): return int(_analysis._type_hash(value)) else: msg = ("found value of type {0} expected" + "relay.Expr or relay.Type").format(type(value)) raise TypeError(msg)
true
true
1c456c74c2cf7a473b376d5f287a9bb1a2b9f3b9
5,363
py
Python
netbox/utilities/forms/widgets.py
letic/netbox
0930745e16330edf00da081150b079d5ed6ecc02
[ "Apache-2.0" ]
2
2021-07-08T03:58:12.000Z
2022-02-11T21:50:46.000Z
netbox/utilities/forms/widgets.py
letic/netbox
0930745e16330edf00da081150b079d5ed6ecc02
[ "Apache-2.0" ]
25
2019-09-17T19:40:50.000Z
2022-03-11T04:01:55.000Z
netbox/utilities/forms/widgets.py
letic/netbox
0930745e16330edf00da081150b079d5ed6ecc02
[ "Apache-2.0" ]
1
2022-02-11T21:50:58.000Z
2022-02-11T21:50:58.000Z
import json from django import forms from django.conf import settings from django.contrib.postgres.forms import SimpleArrayField from utilities.choices import ColorChoices from .utils import add_blank_choice, parse_numeric_range __all__ = ( 'APISelect', 'APISelectMultiple', 'BulkEditNullBooleanSelect', 'ColorSelect', 'ContentTypeSelect', 'DatePicker', 'DateTimePicker', 'NumericArrayField', 'SelectWithDisabled', 'SelectWithPK', 'SlugWidget', 'SmallTextarea', 'StaticSelect2', 'StaticSelect2Multiple', 'TimePicker', ) class SmallTextarea(forms.Textarea): """ Subclass used for rendering a smaller textarea element. """ pass class SlugWidget(forms.TextInput): """ Subclass TextInput and add a slug regeneration button next to the form field. """ template_name = 'widgets/sluginput.html' class ColorSelect(forms.Select): """ Extends the built-in Select widget to colorize each <option>. """ option_template_name = 'widgets/colorselect_option.html' def __init__(self, *args, **kwargs): kwargs['choices'] = add_blank_choice(ColorChoices) super().__init__(*args, **kwargs) self.attrs['class'] = 'netbox-select2-color-picker' class BulkEditNullBooleanSelect(forms.NullBooleanSelect): """ A Select widget for NullBooleanFields """ def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) # Override the built-in choice labels self.choices = ( ('1', '---------'), ('2', 'Yes'), ('3', 'No'), ) self.attrs['class'] = 'netbox-select2-static' class SelectWithDisabled(forms.Select): """ Modified the stock Select widget to accept choices using a dict() for a label. The dict for each option must include 'label' (string) and 'disabled' (boolean). """ option_template_name = 'widgets/selectwithdisabled_option.html' class StaticSelect2(SelectWithDisabled): """ A static <select> form widget using the Select2 library. """ def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'netbox-select2-static' class StaticSelect2Multiple(StaticSelect2, forms.SelectMultiple): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['data-multiple'] = 1 class SelectWithPK(StaticSelect2): """ Include the primary key of each option in the option label (e.g. "Router7 (4721)"). """ option_template_name = 'widgets/select_option_with_pk.html' class ContentTypeSelect(StaticSelect2): """ Appends an `api-value` attribute equal to the slugified model name for each ContentType. For example: <option value="37" api-value="console-server-port">console server port</option> This attribute can be used to reference the relevant API endpoint for a particular ContentType. """ option_template_name = 'widgets/select_contenttype.html' class NumericArrayField(SimpleArrayField): def to_python(self, value): if not value: return [] if isinstance(value, str): value = ','.join([str(n) for n in parse_numeric_range(value)]) return super().to_python(value) class APISelect(SelectWithDisabled): """ A select widget populated via an API call :param api_url: API endpoint URL. Required if not set automatically by the parent field. """ def __init__(self, api_url=None, full=False, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'netbox-select2-api' if api_url: self.attrs['data-url'] = '/{}{}'.format(settings.BASE_PATH, api_url.lstrip('/')) # Inject BASE_PATH def add_query_param(self, name, value): """ Add details for an additional query param in the form of a data-* JSON-encoded list attribute. :param name: The name of the query param :param value: The value of the query param """ key = f'data-query-param-{name}' values = json.loads(self.attrs.get(key, '[]')) if type(value) in (list, tuple): values.extend([str(v) for v in value]) else: values.append(str(value)) self.attrs[key] = json.dumps(values) class APISelectMultiple(APISelect, forms.SelectMultiple): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['data-multiple'] = 1 class DatePicker(forms.TextInput): """ Date picker using Flatpickr. """ def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'date-picker' self.attrs['placeholder'] = 'YYYY-MM-DD' class DateTimePicker(forms.TextInput): """ DateTime picker using Flatpickr. """ def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'datetime-picker' self.attrs['placeholder'] = 'YYYY-MM-DD hh:mm:ss' class TimePicker(forms.TextInput): """ Time picker using Flatpickr. """ def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'time-picker' self.attrs['placeholder'] = 'hh:mm:ss'
28.078534
120
0.641618
import json from django import forms from django.conf import settings from django.contrib.postgres.forms import SimpleArrayField from utilities.choices import ColorChoices from .utils import add_blank_choice, parse_numeric_range __all__ = ( 'APISelect', 'APISelectMultiple', 'BulkEditNullBooleanSelect', 'ColorSelect', 'ContentTypeSelect', 'DatePicker', 'DateTimePicker', 'NumericArrayField', 'SelectWithDisabled', 'SelectWithPK', 'SlugWidget', 'SmallTextarea', 'StaticSelect2', 'StaticSelect2Multiple', 'TimePicker', ) class SmallTextarea(forms.Textarea): pass class SlugWidget(forms.TextInput): template_name = 'widgets/sluginput.html' class ColorSelect(forms.Select): option_template_name = 'widgets/colorselect_option.html' def __init__(self, *args, **kwargs): kwargs['choices'] = add_blank_choice(ColorChoices) super().__init__(*args, **kwargs) self.attrs['class'] = 'netbox-select2-color-picker' class BulkEditNullBooleanSelect(forms.NullBooleanSelect): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.choices = ( ('1', '---------'), ('2', 'Yes'), ('3', 'No'), ) self.attrs['class'] = 'netbox-select2-static' class SelectWithDisabled(forms.Select): option_template_name = 'widgets/selectwithdisabled_option.html' class StaticSelect2(SelectWithDisabled): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'netbox-select2-static' class StaticSelect2Multiple(StaticSelect2, forms.SelectMultiple): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['data-multiple'] = 1 class SelectWithPK(StaticSelect2): option_template_name = 'widgets/select_option_with_pk.html' class ContentTypeSelect(StaticSelect2): option_template_name = 'widgets/select_contenttype.html' class NumericArrayField(SimpleArrayField): def to_python(self, value): if not value: return [] if isinstance(value, str): value = ','.join([str(n) for n in parse_numeric_range(value)]) return super().to_python(value) class APISelect(SelectWithDisabled): def __init__(self, api_url=None, full=False, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'netbox-select2-api' if api_url: self.attrs['data-url'] = '/{}{}'.format(settings.BASE_PATH, api_url.lstrip('/')) def add_query_param(self, name, value): key = f'data-query-param-{name}' values = json.loads(self.attrs.get(key, '[]')) if type(value) in (list, tuple): values.extend([str(v) for v in value]) else: values.append(str(value)) self.attrs[key] = json.dumps(values) class APISelectMultiple(APISelect, forms.SelectMultiple): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['data-multiple'] = 1 class DatePicker(forms.TextInput): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'date-picker' self.attrs['placeholder'] = 'YYYY-MM-DD' class DateTimePicker(forms.TextInput): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'datetime-picker' self.attrs['placeholder'] = 'YYYY-MM-DD hh:mm:ss' class TimePicker(forms.TextInput): def __init__(self, *args, **kwargs): super().__init__(*args, **kwargs) self.attrs['class'] = 'time-picker' self.attrs['placeholder'] = 'hh:mm:ss'
true
true
1c456cd394ed39fe157a450029b8b5c2dcc40bd1
598
py
Python
src/modax/training/.ipynb_checkpoints/utils-checkpoint.py
GJBoth/modax
c7e1c128d4dd48b776f8ec4fa724c2e4b6e13c82
[ "MIT" ]
2
2021-12-10T14:36:37.000Z
2022-02-10T11:47:03.000Z
src/modax/training/.ipynb_checkpoints/utils-checkpoint.py
GJBoth/modax
c7e1c128d4dd48b776f8ec4fa724c2e4b6e13c82
[ "MIT" ]
null
null
null
src/modax/training/.ipynb_checkpoints/utils-checkpoint.py
GJBoth/modax
c7e1c128d4dd48b776f8ec4fa724c2e4b6e13c82
[ "MIT" ]
2
2020-12-22T14:49:13.000Z
2021-04-09T08:52:08.000Z
from jax import jit, value_and_grad from functools import partial import jax.profiler def create_update(loss_fn, loss_fn_args): def step(opt, state, loss_fn, loss_fn_args): grad_fn = value_and_grad(loss_fn, argnums=0, has_aux=True) (loss, (updated_state, metrics, output)), grad = grad_fn( opt.target, state, *loss_fn_args ) opt = opt.apply_gradient(grad) jax.profiler.save_device_memory_profile(f"memory.prof") return (opt, updated_state), metrics, output return jit(partial(step, loss_fn=loss_fn, loss_fn_args=loss_fn_args))
35.176471
73
0.704013
from jax import jit, value_and_grad from functools import partial import jax.profiler def create_update(loss_fn, loss_fn_args): def step(opt, state, loss_fn, loss_fn_args): grad_fn = value_and_grad(loss_fn, argnums=0, has_aux=True) (loss, (updated_state, metrics, output)), grad = grad_fn( opt.target, state, *loss_fn_args ) opt = opt.apply_gradient(grad) jax.profiler.save_device_memory_profile(f"memory.prof") return (opt, updated_state), metrics, output return jit(partial(step, loss_fn=loss_fn, loss_fn_args=loss_fn_args))
true
true
1c456f4aeae0fd4829f9f0818a661eb6433b1c8e
399
py
Python
tests/multidl/downloaders/test_local_file_downloader.py
gazay/chiliad
771b3d0f7004f2a03094bad7bcc0103715a6c73f
[ "MIT" ]
16
2018-02-12T23:47:26.000Z
2021-07-23T12:43:05.000Z
tests/multidl/downloaders/test_local_file_downloader.py
gazay/chiliad
771b3d0f7004f2a03094bad7bcc0103715a6c73f
[ "MIT" ]
6
2017-10-14T15:36:52.000Z
2022-02-13T17:17:17.000Z
tests/multidl/downloaders/test_local_file_downloader.py
gazay/chiliad
771b3d0f7004f2a03094bad7bcc0103715a6c73f
[ "MIT" ]
6
2018-05-11T00:16:00.000Z
2021-05-03T02:02:55.000Z
# -*- coding: utf-8 -*- import pytest from multidl.downloaders.local_file_downloader import LocalFileDownloader @pytest.mark.parametrize('url, expected', [ ('file:///dir/file1.txt', 'file1.txt'), ('file:///file2.txt', 'file2.txt'), ]) def test_get_file_name(tmpdir, url, expected): downloader = LocalFileDownloader(url, str(tmpdir)) assert downloader.get_file_name() == expected
26.6
73
0.704261
import pytest from multidl.downloaders.local_file_downloader import LocalFileDownloader @pytest.mark.parametrize('url, expected', [ ('file:///dir/file1.txt', 'file1.txt'), ('file:///file2.txt', 'file2.txt'), ]) def test_get_file_name(tmpdir, url, expected): downloader = LocalFileDownloader(url, str(tmpdir)) assert downloader.get_file_name() == expected
true
true
1c456f6f57902768c2181ef37ffa76b83cb79aad
2,283
py
Python
src/demo/worker_flags.py
Ravi-0809/question-generation
9065a3b47293b8a69a0548af1f6bedd4a4aa7f9c
[ "MIT" ]
212
2018-08-15T11:06:35.000Z
2021-11-21T10:21:55.000Z
src/demo/worker_flags.py
Ravi-0809/question-generation
9065a3b47293b8a69a0548af1f6bedd4a4aa7f9c
[ "MIT" ]
44
2018-10-15T12:50:31.000Z
2020-11-13T18:02:03.000Z
src/demo/worker_flags.py
Ravi-0809/question-generation
9065a3b47293b8a69a0548af1f6bedd4a4aa7f9c
[ "MIT" ]
51
2018-08-17T18:17:43.000Z
2021-03-04T06:14:52.000Z
class FlagsObject(object): pass FLAGS = FlagsObject() # config FLAGS.testing = False FLAGS.model_type = 'RL-S2S' FLAGS.restore = False FLAGS.restore_path = None FLAGS.policy_gradient = False FLAGS.glove_vocab = False FLAGS.embedding_loss = False FLAGS.latent_switch = False FLAGS.combine_vocab = False FLAGS.lr_schedule = False FLAGS.eval_freq = 1000 FLAGS.num_epochs = 25 FLAGS.batch_size = 64 FLAGS.eval_batch_size = 16 FLAGS.data_path = '../data/' FLAGS.log_dir = '../logs/' FLAGS.model_dir = '../models/' # hyperparams FLAGS.filter_window_size_before = 1 FLAGS.filter_window_size_after = 1 FLAGS.filter_max_tokens = 100 FLAGS.max_context_len = 203 FLAGS.max_copy_size = 203 FLAGS.embedding_size = 200 FLAGS.context_encoder_units = 768 FLAGS.answer_encoder_units = 768 FLAGS.full_context_encoding = True FLAGS.decoder_units = 768 FLAGS.switch_units = 128 FLAGS.ctxt_encoder_depth = 1 FLAGS.ans_encoder_depth = 1 FLAGS.vocab_size = 2000 FLAGS.learning_rate = 2e-4 FLAGS.opt_type = "adam" FLAGS.entropy_weight = 0.01 FLAGS.suppression_weight = 0.01 FLAGS.dropout_rate = 0.3 FLAGS.context_as_set = True FLAGS.copy_priority = False FLAGS.smart_copy = True FLAGS.separate_copy_mech = False FLAGS.begin_ans_feat = False FLAGS.maxout_pointer = False FLAGS.loc_embeddings = False FLAGS.out_vocab_cpu = False FLAGS.advanced_condition_encoding = False FLAGS.disable_copy = False FLAGS.disable_shortlist = False FLAGS.length_penalty = 0.05 FLAGS.pg_burnin = 200 FLAGS.pg_dropout = False FLAGS.lm_weight = 0.25 FLAGS.qa_weight = 0.5 FLAGS.bleu_weight = 0.0 FLAGS.pg_ml_weight = 1 FLAGS.disc_weight = 0.0 FLAGS.disc_train = False # QA - MPCM hparams FLAGS.qa_vocab_size = 20000 FLAGS.qa_encoder_units = 100 FLAGS.qa_match_units = 100 FLAGS.qa_num_epochs = 20 FLAGS.qa_batch_size = 32 FLAGS.qa_learning_rate = 1e-4 # LM hparams FLAGS.lm_vocab_size = 20000 FLAGS.lm_units = 384 FLAGS.lm_num_epochs = 25 FLAGS.lm_dropout = 0.3 # eval params FLAGS.beam_width = 16 # FLAGS.num_dev_samples = 4691 FLAGS.num_dev_samples = 10570 # FLAGS.num_eval_samples = 5609 FLAGS.num_eval_samples = 11877 FLAGS.eval_on_dev = True FLAGS.eval_on_test = False FLAGS.eval_model_id = "" FLAGS.eval_metrics = True FLAGS.diverse_bs = False FLAGS.beam_groups = 1 FLAGS.beam_diversity = 0.5
19.852174
41
0.782742
class FlagsObject(object): pass FLAGS = FlagsObject() FLAGS.testing = False FLAGS.model_type = 'RL-S2S' FLAGS.restore = False FLAGS.restore_path = None FLAGS.policy_gradient = False FLAGS.glove_vocab = False FLAGS.embedding_loss = False FLAGS.latent_switch = False FLAGS.combine_vocab = False FLAGS.lr_schedule = False FLAGS.eval_freq = 1000 FLAGS.num_epochs = 25 FLAGS.batch_size = 64 FLAGS.eval_batch_size = 16 FLAGS.data_path = '../data/' FLAGS.log_dir = '../logs/' FLAGS.model_dir = '../models/' FLAGS.filter_window_size_before = 1 FLAGS.filter_window_size_after = 1 FLAGS.filter_max_tokens = 100 FLAGS.max_context_len = 203 FLAGS.max_copy_size = 203 FLAGS.embedding_size = 200 FLAGS.context_encoder_units = 768 FLAGS.answer_encoder_units = 768 FLAGS.full_context_encoding = True FLAGS.decoder_units = 768 FLAGS.switch_units = 128 FLAGS.ctxt_encoder_depth = 1 FLAGS.ans_encoder_depth = 1 FLAGS.vocab_size = 2000 FLAGS.learning_rate = 2e-4 FLAGS.opt_type = "adam" FLAGS.entropy_weight = 0.01 FLAGS.suppression_weight = 0.01 FLAGS.dropout_rate = 0.3 FLAGS.context_as_set = True FLAGS.copy_priority = False FLAGS.smart_copy = True FLAGS.separate_copy_mech = False FLAGS.begin_ans_feat = False FLAGS.maxout_pointer = False FLAGS.loc_embeddings = False FLAGS.out_vocab_cpu = False FLAGS.advanced_condition_encoding = False FLAGS.disable_copy = False FLAGS.disable_shortlist = False FLAGS.length_penalty = 0.05 FLAGS.pg_burnin = 200 FLAGS.pg_dropout = False FLAGS.lm_weight = 0.25 FLAGS.qa_weight = 0.5 FLAGS.bleu_weight = 0.0 FLAGS.pg_ml_weight = 1 FLAGS.disc_weight = 0.0 FLAGS.disc_train = False FLAGS.qa_vocab_size = 20000 FLAGS.qa_encoder_units = 100 FLAGS.qa_match_units = 100 FLAGS.qa_num_epochs = 20 FLAGS.qa_batch_size = 32 FLAGS.qa_learning_rate = 1e-4 FLAGS.lm_vocab_size = 20000 FLAGS.lm_units = 384 FLAGS.lm_num_epochs = 25 FLAGS.lm_dropout = 0.3 FLAGS.beam_width = 16 FLAGS.num_dev_samples = 10570 FLAGS.num_eval_samples = 11877 FLAGS.eval_on_dev = True FLAGS.eval_on_test = False FLAGS.eval_model_id = "" FLAGS.eval_metrics = True FLAGS.diverse_bs = False FLAGS.beam_groups = 1 FLAGS.beam_diversity = 0.5
true
true
1c4572039e05249fc64e7f7a9e3e39836024d635
9,745
py
Python
theseus/geometry/so2.py
jeffin07/theseus
3498bbddf9cca740c2703d0c1aa3a78a7264cb15
[ "MIT" ]
236
2021-12-03T15:59:29.000Z
2022-03-30T23:18:33.000Z
theseus/geometry/so2.py
jeffin07/theseus
3498bbddf9cca740c2703d0c1aa3a78a7264cb15
[ "MIT" ]
85
2021-12-06T07:04:11.000Z
2022-03-31T20:29:26.000Z
theseus/geometry/so2.py
jeffin07/theseus
3498bbddf9cca740c2703d0c1aa3a78a7264cb15
[ "MIT" ]
12
2021-12-03T22:02:44.000Z
2022-03-20T14:58:27.000Z
# Copyright (c) Meta Platforms, Inc. and affiliates. # # This source code is licensed under the MIT license found in the # LICENSE file in the root directory of this source tree. from typing import List, Optional, Tuple, Union, cast import torch import theseus.constants from .lie_group import LieGroup from .point_types import Point2 class SO2(LieGroup): def __init__( self, theta: Optional[torch.Tensor] = None, data: Optional[torch.Tensor] = None, name: Optional[str] = None, dtype: Optional[torch.dtype] = None, ): if theta is not None and data is not None: raise ValueError("Please provide only one of theta or data.") if theta is not None: dtype = theta.dtype super().__init__(data=data, name=name, dtype=dtype) if theta is not None: if theta.ndim == 1: theta = theta.unsqueeze(1) if theta.ndim != 2 or theta.shape[1] != 1: raise ValueError( "Argument theta must be have ndim = 1, or ndim=2 and shape[1] = 1." ) self.update_from_angle(theta) @staticmethod def rand( *size: int, generator: Optional[torch.Generator] = None, dtype: Optional[torch.dtype] = None, device: Optional[torch.device] = None, requires_grad: bool = False, ) -> "SO2": if len(size) != 1: raise ValueError("The size should be 1D.") return SO2.exp_map( 2 * theseus.constants.PI * torch.rand( size[0], 1, generator=generator, dtype=dtype, device=device, requires_grad=requires_grad, ) - theseus.constants.PI ) @staticmethod def randn( *size: int, generator: Optional[torch.Generator] = None, dtype: Optional[torch.dtype] = None, device: Optional[torch.device] = None, requires_grad: bool = False, ) -> "SO2": if len(size) != 1: raise ValueError("The size should be 1D.") return SO2.exp_map( theseus.constants.PI * torch.randn( size[0], 1, generator=generator, dtype=dtype, device=device, requires_grad=requires_grad, ) ) @staticmethod def _init_data() -> torch.Tensor: # type: ignore return torch.tensor([1.0, 0.0]).view(1, 2) def update_from_angle(self, theta: torch.Tensor): self.update(torch.cat([theta.cos(), theta.sin()], dim=1)) def dof(self) -> int: return 1 def __repr__(self) -> str: return f"SO2(data={self.data}, name={self.name})" def __str__(self) -> str: with torch.no_grad(): theta = torch.atan2(self[:, 1:], self[:, 0:1]) return f"SO2(theta={theta}, name={self.name})" def theta(self) -> torch.Tensor: return self.log_map() def _adjoint_impl(self) -> torch.Tensor: return torch.ones(self.shape[0], 1, 1, device=self.device, dtype=self.dtype) def _project_impl( self, euclidean_grad: torch.Tensor, is_sparse: bool = False ) -> torch.Tensor: self._project_check(euclidean_grad, is_sparse) temp = torch.stack((-self[:, 1], self[:, 0]), dim=1) if is_sparse: return torch.einsum("i...k,i...k->i...", euclidean_grad, temp).unsqueeze(-1) else: return torch.einsum("...k,...k", euclidean_grad, temp).unsqueeze(-1) @staticmethod def exp_map( tangent_vector: torch.Tensor, jacobians: Optional[List[torch.Tensor]] = None ) -> "SO2": so2 = SO2(dtype=tangent_vector.dtype) so2.update_from_angle(tangent_vector) if jacobians is not None: SO2._check_jacobians_list(jacobians) jacobians.append( torch.ones( tangent_vector.shape[0], 1, 1, dtype=tangent_vector.dtype, device=tangent_vector.device, ) ) return so2 def _log_map_impl( self, jacobians: Optional[List[torch.Tensor]] = None ) -> torch.Tensor: if jacobians is not None: SO2._check_jacobians_list(jacobians) jacobians.append( torch.ones( self.shape[0], 1, 1, dtype=self.dtype, device=self.device, ) ) cosine, sine = self.to_cos_sin() return torch.atan2(sine, cosine).unsqueeze(1) def _compose_impl(self, so2_2: LieGroup) -> "SO2": so2_2 = cast(SO2, so2_2) cos_1, sin_1 = self.to_cos_sin() cos_2, sin_2 = so2_2.to_cos_sin() new_cos = cos_1 * cos_2 - sin_1 * sin_2 new_sin = sin_1 * cos_2 + cos_1 * sin_2 return SO2(data=torch.stack([new_cos, new_sin], dim=1)) def _inverse_impl(self, get_jacobian: bool = False) -> "SO2": cosine, sine = self.to_cos_sin() return SO2(data=torch.stack([cosine, -sine], dim=1)) def _rotate_shape_check(self, point: Union[Point2, torch.Tensor]): err_msg = ( f"SO2 can only transform vectors of shape [{self.shape[0]}, 2] or [1, 2], " f"but the input has shape {point.shape}." ) if isinstance(point, torch.Tensor): if not point.ndim == 2 or point.shape[1] != 2: raise ValueError(err_msg) elif point.dof() != 2: raise ValueError(err_msg) if ( point.shape[0] != self.shape[0] and point.shape[0] != 1 and self.shape[0] != 1 ): raise ValueError( "Input point batch size is not broadcastable with group batch size." ) @staticmethod def _rotate_from_cos_sin( point: Union[Point2, torch.Tensor], cosine: torch.Tensor, sine: torch.Tensor, ) -> Point2: batch_size = max(point.shape[0], cosine.shape[0]) if isinstance(point, torch.Tensor): if point.ndim != 2 or point.shape[1] != 2: raise ValueError( f"Point tensor must have shape batch_size x 2, " f"but received {point.shape}." ) point_data = point else: point_data = point.data px, py = point_data[:, 0], point_data[:, 1] new_point_data = torch.empty( batch_size, 2, device=cosine.device, dtype=cosine.dtype ) new_point_data[:, 0] = cosine * px - sine * py new_point_data[:, 1] = sine * px + cosine * py return Point2(data=new_point_data) def rotate( self, point: Union[Point2, torch.Tensor], jacobians: Optional[List[torch.Tensor]] = None, ) -> Point2: self._rotate_shape_check(point) cosine, sine = self.to_cos_sin() ret = SO2._rotate_from_cos_sin(point, cosine, sine) if jacobians is not None: self._check_jacobians_list(jacobians) Jrot = torch.stack([-ret.y(), ret.x()], dim=1).view(-1, 2, 1) Jpnt = self.to_matrix().expand(ret.shape[0], -1, -1) jacobians.extend([Jrot, Jpnt]) return ret def unrotate( self, point: Union[Point2, torch.Tensor], jacobians: Optional[List[torch.Tensor]] = None, ) -> Point2: self._rotate_shape_check(point) cosine, sine = self.to_cos_sin() ret = SO2._rotate_from_cos_sin(point, cosine, -sine) if jacobians is not None: self._check_jacobians_list(jacobians) Jrot = torch.stack([ret.y(), -ret.x()], dim=1).view(-1, 2, 1) Jpnt = self.to_matrix().transpose(2, 1).expand(ret.shape[0], -1, -1) jacobians.extend([Jrot, Jpnt]) return ret def to_cos_sin(self) -> Tuple[torch.Tensor, torch.Tensor]: return self[:, 0], self[:, 1] def to_matrix(self) -> torch.Tensor: matrix = torch.empty(self.shape[0], 2, 2).to( device=self.device, dtype=self.dtype ) cosine, sine = self.to_cos_sin() matrix[:, 0, 0] = cosine matrix[:, 0, 1] = -sine matrix[:, 1, 0] = sine matrix[:, 1, 1] = cosine return matrix @staticmethod def hat(tangent_vector: torch.Tensor) -> torch.Tensor: matrix = torch.zeros(tangent_vector.shape[0], 2, 2).to( dtype=tangent_vector.dtype, device=tangent_vector.device, ) matrix[:, 0, 1] = -tangent_vector.view(-1) matrix[:, 1, 0] = tangent_vector.view(-1) return matrix @staticmethod def vee(matrix: torch.Tensor) -> torch.Tensor: _check = matrix.ndim == 3 and matrix.shape[1:] == (2, 2) _check &= matrix[:, 0, 0].abs().max().item() < theseus.constants.EPS _check &= matrix[:, 1, 1].abs().max().item() < theseus.constants.EPS _check &= torch.allclose(matrix[:, 0, 1], -matrix[:, 1, 0]) if not _check: raise ValueError("Invalid hat matrix for SO2.") return matrix[:, 1, 0].clone().view(-1, 1) def _copy_impl(self, new_name: Optional[str] = None) -> "SO2": return SO2(data=self.data.clone(), name=new_name) # only added to avoid casting downstream def copy(self, new_name: Optional[str] = None) -> "SO2": return cast(SO2, super().copy(new_name=new_name)) rand_so2 = SO2.rand randn_so2 = SO2.randn
33.719723
88
0.548794
from typing import List, Optional, Tuple, Union, cast import torch import theseus.constants from .lie_group import LieGroup from .point_types import Point2 class SO2(LieGroup): def __init__( self, theta: Optional[torch.Tensor] = None, data: Optional[torch.Tensor] = None, name: Optional[str] = None, dtype: Optional[torch.dtype] = None, ): if theta is not None and data is not None: raise ValueError("Please provide only one of theta or data.") if theta is not None: dtype = theta.dtype super().__init__(data=data, name=name, dtype=dtype) if theta is not None: if theta.ndim == 1: theta = theta.unsqueeze(1) if theta.ndim != 2 or theta.shape[1] != 1: raise ValueError( "Argument theta must be have ndim = 1, or ndim=2 and shape[1] = 1." ) self.update_from_angle(theta) @staticmethod def rand( *size: int, generator: Optional[torch.Generator] = None, dtype: Optional[torch.dtype] = None, device: Optional[torch.device] = None, requires_grad: bool = False, ) -> "SO2": if len(size) != 1: raise ValueError("The size should be 1D.") return SO2.exp_map( 2 * theseus.constants.PI * torch.rand( size[0], 1, generator=generator, dtype=dtype, device=device, requires_grad=requires_grad, ) - theseus.constants.PI ) @staticmethod def randn( *size: int, generator: Optional[torch.Generator] = None, dtype: Optional[torch.dtype] = None, device: Optional[torch.device] = None, requires_grad: bool = False, ) -> "SO2": if len(size) != 1: raise ValueError("The size should be 1D.") return SO2.exp_map( theseus.constants.PI * torch.randn( size[0], 1, generator=generator, dtype=dtype, device=device, requires_grad=requires_grad, ) ) @staticmethod def _init_data() -> torch.Tensor: return torch.tensor([1.0, 0.0]).view(1, 2) def update_from_angle(self, theta: torch.Tensor): self.update(torch.cat([theta.cos(), theta.sin()], dim=1)) def dof(self) -> int: return 1 def __repr__(self) -> str: return f"SO2(data={self.data}, name={self.name})" def __str__(self) -> str: with torch.no_grad(): theta = torch.atan2(self[:, 1:], self[:, 0:1]) return f"SO2(theta={theta}, name={self.name})" def theta(self) -> torch.Tensor: return self.log_map() def _adjoint_impl(self) -> torch.Tensor: return torch.ones(self.shape[0], 1, 1, device=self.device, dtype=self.dtype) def _project_impl( self, euclidean_grad: torch.Tensor, is_sparse: bool = False ) -> torch.Tensor: self._project_check(euclidean_grad, is_sparse) temp = torch.stack((-self[:, 1], self[:, 0]), dim=1) if is_sparse: return torch.einsum("i...k,i...k->i...", euclidean_grad, temp).unsqueeze(-1) else: return torch.einsum("...k,...k", euclidean_grad, temp).unsqueeze(-1) @staticmethod def exp_map( tangent_vector: torch.Tensor, jacobians: Optional[List[torch.Tensor]] = None ) -> "SO2": so2 = SO2(dtype=tangent_vector.dtype) so2.update_from_angle(tangent_vector) if jacobians is not None: SO2._check_jacobians_list(jacobians) jacobians.append( torch.ones( tangent_vector.shape[0], 1, 1, dtype=tangent_vector.dtype, device=tangent_vector.device, ) ) return so2 def _log_map_impl( self, jacobians: Optional[List[torch.Tensor]] = None ) -> torch.Tensor: if jacobians is not None: SO2._check_jacobians_list(jacobians) jacobians.append( torch.ones( self.shape[0], 1, 1, dtype=self.dtype, device=self.device, ) ) cosine, sine = self.to_cos_sin() return torch.atan2(sine, cosine).unsqueeze(1) def _compose_impl(self, so2_2: LieGroup) -> "SO2": so2_2 = cast(SO2, so2_2) cos_1, sin_1 = self.to_cos_sin() cos_2, sin_2 = so2_2.to_cos_sin() new_cos = cos_1 * cos_2 - sin_1 * sin_2 new_sin = sin_1 * cos_2 + cos_1 * sin_2 return SO2(data=torch.stack([new_cos, new_sin], dim=1)) def _inverse_impl(self, get_jacobian: bool = False) -> "SO2": cosine, sine = self.to_cos_sin() return SO2(data=torch.stack([cosine, -sine], dim=1)) def _rotate_shape_check(self, point: Union[Point2, torch.Tensor]): err_msg = ( f"SO2 can only transform vectors of shape [{self.shape[0]}, 2] or [1, 2], " f"but the input has shape {point.shape}." ) if isinstance(point, torch.Tensor): if not point.ndim == 2 or point.shape[1] != 2: raise ValueError(err_msg) elif point.dof() != 2: raise ValueError(err_msg) if ( point.shape[0] != self.shape[0] and point.shape[0] != 1 and self.shape[0] != 1 ): raise ValueError( "Input point batch size is not broadcastable with group batch size." ) @staticmethod def _rotate_from_cos_sin( point: Union[Point2, torch.Tensor], cosine: torch.Tensor, sine: torch.Tensor, ) -> Point2: batch_size = max(point.shape[0], cosine.shape[0]) if isinstance(point, torch.Tensor): if point.ndim != 2 or point.shape[1] != 2: raise ValueError( f"Point tensor must have shape batch_size x 2, " f"but received {point.shape}." ) point_data = point else: point_data = point.data px, py = point_data[:, 0], point_data[:, 1] new_point_data = torch.empty( batch_size, 2, device=cosine.device, dtype=cosine.dtype ) new_point_data[:, 0] = cosine * px - sine * py new_point_data[:, 1] = sine * px + cosine * py return Point2(data=new_point_data) def rotate( self, point: Union[Point2, torch.Tensor], jacobians: Optional[List[torch.Tensor]] = None, ) -> Point2: self._rotate_shape_check(point) cosine, sine = self.to_cos_sin() ret = SO2._rotate_from_cos_sin(point, cosine, sine) if jacobians is not None: self._check_jacobians_list(jacobians) Jrot = torch.stack([-ret.y(), ret.x()], dim=1).view(-1, 2, 1) Jpnt = self.to_matrix().expand(ret.shape[0], -1, -1) jacobians.extend([Jrot, Jpnt]) return ret def unrotate( self, point: Union[Point2, torch.Tensor], jacobians: Optional[List[torch.Tensor]] = None, ) -> Point2: self._rotate_shape_check(point) cosine, sine = self.to_cos_sin() ret = SO2._rotate_from_cos_sin(point, cosine, -sine) if jacobians is not None: self._check_jacobians_list(jacobians) Jrot = torch.stack([ret.y(), -ret.x()], dim=1).view(-1, 2, 1) Jpnt = self.to_matrix().transpose(2, 1).expand(ret.shape[0], -1, -1) jacobians.extend([Jrot, Jpnt]) return ret def to_cos_sin(self) -> Tuple[torch.Tensor, torch.Tensor]: return self[:, 0], self[:, 1] def to_matrix(self) -> torch.Tensor: matrix = torch.empty(self.shape[0], 2, 2).to( device=self.device, dtype=self.dtype ) cosine, sine = self.to_cos_sin() matrix[:, 0, 0] = cosine matrix[:, 0, 1] = -sine matrix[:, 1, 0] = sine matrix[:, 1, 1] = cosine return matrix @staticmethod def hat(tangent_vector: torch.Tensor) -> torch.Tensor: matrix = torch.zeros(tangent_vector.shape[0], 2, 2).to( dtype=tangent_vector.dtype, device=tangent_vector.device, ) matrix[:, 0, 1] = -tangent_vector.view(-1) matrix[:, 1, 0] = tangent_vector.view(-1) return matrix @staticmethod def vee(matrix: torch.Tensor) -> torch.Tensor: _check = matrix.ndim == 3 and matrix.shape[1:] == (2, 2) _check &= matrix[:, 0, 0].abs().max().item() < theseus.constants.EPS _check &= matrix[:, 1, 1].abs().max().item() < theseus.constants.EPS _check &= torch.allclose(matrix[:, 0, 1], -matrix[:, 1, 0]) if not _check: raise ValueError("Invalid hat matrix for SO2.") return matrix[:, 1, 0].clone().view(-1, 1) def _copy_impl(self, new_name: Optional[str] = None) -> "SO2": return SO2(data=self.data.clone(), name=new_name) def copy(self, new_name: Optional[str] = None) -> "SO2": return cast(SO2, super().copy(new_name=new_name)) rand_so2 = SO2.rand randn_so2 = SO2.randn
true
true
1c457240e1e5b43e46789912d1b54ae8e79edea8
1,095
py
Python
clients/python-blueplanet/generated/app/openapi_server/test/test_pal_park_area_controller.py
cliffano/pokeapi-clients
92af296c68c3e94afac52642ae22057faaf071ee
[ "MIT" ]
null
null
null
clients/python-blueplanet/generated/app/openapi_server/test/test_pal_park_area_controller.py
cliffano/pokeapi-clients
92af296c68c3e94afac52642ae22057faaf071ee
[ "MIT" ]
null
null
null
clients/python-blueplanet/generated/app/openapi_server/test/test_pal_park_area_controller.py
cliffano/pokeapi-clients
92af296c68c3e94afac52642ae22057faaf071ee
[ "MIT" ]
null
null
null
# coding: utf-8 from __future__ import absolute_import from flask import json from six import BytesIO from openapi_server.test import BaseTestCase class TestPalParkAreaController(BaseTestCase): """PalParkAreaController integration test stubs""" def test_pal_park_area_list(self): """Test case for pal_park_area_list """ query_string = [('limit', 56), ('offset', 56)] response = self.client.open( '/api/v2/pal-park-area/', method='GET', query_string=query_string) self.assert200(response, 'Response body is : ' + response.data.decode('utf-8')) def test_pal_park_area_read(self): """Test case for pal_park_area_read """ response = self.client.open( '/api/v2/pal-park-area/{id}'.format(id=56), method='GET') self.assert200(response, 'Response body is : ' + response.data.decode('utf-8')) if __name__ == '__main__': import unittest unittest.main()
25.465116
77
0.584475
from __future__ import absolute_import from flask import json from six import BytesIO from openapi_server.test import BaseTestCase class TestPalParkAreaController(BaseTestCase): def test_pal_park_area_list(self): query_string = [('limit', 56), ('offset', 56)] response = self.client.open( '/api/v2/pal-park-area/', method='GET', query_string=query_string) self.assert200(response, 'Response body is : ' + response.data.decode('utf-8')) def test_pal_park_area_read(self): response = self.client.open( '/api/v2/pal-park-area/{id}'.format(id=56), method='GET') self.assert200(response, 'Response body is : ' + response.data.decode('utf-8')) if __name__ == '__main__': import unittest unittest.main()
true
true
1c45730c64130865dfab642c09670520f0db3188
5,508
py
Python
gammagl/layers/conv/hetero_wrapper.py
BUPT-GAMMA/GammaGL
2b9f32e1ac3533cb75a063243e8a2fa654466d18
[ "Apache-2.0" ]
null
null
null
gammagl/layers/conv/hetero_wrapper.py
BUPT-GAMMA/GammaGL
2b9f32e1ac3533cb75a063243e8a2fa654466d18
[ "Apache-2.0" ]
null
null
null
gammagl/layers/conv/hetero_wrapper.py
BUPT-GAMMA/GammaGL
2b9f32e1ac3533cb75a063243e8a2fa654466d18
[ "Apache-2.0" ]
null
null
null
import tensorlayerx as tlx import gammagl.mpops as mpops import warnings from collections import defaultdict from typing import Dict, Optional def group(xs, aggr): if len(xs) == 0: return None elif aggr is None: return tlx.stack(xs, axis=1) elif len(xs) == 1: return xs[0] else: out = tlx.stack(xs, axis=0) out = getattr(tlx, 'reduce_'+aggr)(out, dim=0) out = out[0] if isinstance(out, tuple) else out return out class HeteroConv(tlx.nn.Module): r"""A generic wrapper for computing graph convolution on heterogeneous graphs. This layer will pass messages from source nodes to target nodes based on the bipartite GNN layer given for a specific edge type. If multiple relations point to the same destination, their results will be aggregated according to :attr:`aggr`. .. code:: python >>> hetero_conv = HeteroConv({ ('paper', 'cites', 'paper'): GCNConv(64, 16), ('author', 'writes', 'paper'): SAGEConv((128, 64), 64), ('paper', 'written_by', 'author'): GATConv((64, 128), 64), }, aggr='sum') >>> out_dict = hetero_conv(x_dict, edge_index_dict) >>> print(list(out_dict.keys())) ['paper', 'author'] Parameters ---------- convs: Dict[Tuple[str, str, str], Module] A dictionary holding a bipartite :class:`~torch_geometric.nn.conv.MessagePassing` layer for each individual edge type. aggr: string, optional The aggregation scheme to use for grouping node embeddings generated by different relations. (:obj:`"sum"`, :obj:`"mean"`, :obj:`"min"`, :obj:`"max"`, :obj:`None`). (default: :obj:`"sum"`) """ def __init__(self, convs: dict, aggr: Optional[str] = "sum"): super().__init__() src_node_types = set([key[0] for key in convs.keys()]) dst_node_types = set([key[-1] for key in convs.keys()]) if len(src_node_types - dst_node_types) > 0: warnings.warn( f"There exist node types ({src_node_types - dst_node_types}) " f"whose representations do not get updated during message " f"passing as they do not occur as destination type in any " f"edge type. This may lead to unexpected behaviour.") self.convs = ModuleDict({'__'.join(k): v for k, v in convs.items()}) self.aggr = aggr def reset_parameters(self): for conv in self.convs.values(): conv.reset_parameters() def forward( self, x_dict, edge_index_dict, *args_dict, **kwargs_dict, ): r""" Parameters ---------- x_dict: Dict[str, Tensor] A dictionary holding node feature information for each individual node type. edge_index_dict: Dict[Tuple[str, str, str], Tensor] A dictionary holding graph connectivity information for each individual edge type. *args_dict: optional Additional forward arguments of invididual :class:`torch_geometric.nn.conv.MessagePassing` layers. **kwargs_dict: optional Additional forward arguments of individual :class:`torch_geometric.nn.conv.MessagePassing` layers. For example, if a specific GNN layer at edge type :obj:`edge_type` expects edge attributes :obj:`edge_attr` as a forward argument, then you can pass them to :meth:`~torch_geometric.nn.conv.HeteroConv.forward` via :obj:`edge_attr_dict = { edge_type: edge_attr }`. """ out_dict = defaultdict(list) for edge_type, edge_index in edge_index_dict.items(): src, rel, dst = edge_type str_edge_type = '__'.join(edge_type) if str_edge_type not in self.convs: continue args = [] for value_dict in args_dict: if edge_type in value_dict: args.append(value_dict[edge_type]) elif src == dst and src in value_dict: args.append(value_dict[src]) elif src in value_dict or dst in value_dict: args.append( (value_dict.get(src, None), value_dict.get(dst, None))) kwargs = {} for arg, value_dict in kwargs_dict.items(): arg = arg[:-5] # `{*}_dict` if edge_type in value_dict: kwargs[arg] = value_dict[edge_type] elif src == dst and src in value_dict: kwargs[arg] = value_dict[src] elif src in value_dict or dst in value_dict: kwargs[arg] = (value_dict.get(src, None), value_dict.get(dst, None)) conv = self.convs[str_edge_type] if src == dst: out = conv(x_dict[src], edge_index, *args, **kwargs) else: out = conv((x_dict[src], x_dict[dst]), edge_index, *args, **kwargs) out_dict[dst].append(out) for key, value in out_dict.items(): out_dict[key] = group(value, self.aggr) return out_dict def __repr__(self) -> str: return f'{self.__class__.__name__}(num_relations={len(self.convs)})'
37.469388
79
0.564089
import tensorlayerx as tlx import gammagl.mpops as mpops import warnings from collections import defaultdict from typing import Dict, Optional def group(xs, aggr): if len(xs) == 0: return None elif aggr is None: return tlx.stack(xs, axis=1) elif len(xs) == 1: return xs[0] else: out = tlx.stack(xs, axis=0) out = getattr(tlx, 'reduce_'+aggr)(out, dim=0) out = out[0] if isinstance(out, tuple) else out return out class HeteroConv(tlx.nn.Module): def __init__(self, convs: dict, aggr: Optional[str] = "sum"): super().__init__() src_node_types = set([key[0] for key in convs.keys()]) dst_node_types = set([key[-1] for key in convs.keys()]) if len(src_node_types - dst_node_types) > 0: warnings.warn( f"There exist node types ({src_node_types - dst_node_types}) " f"whose representations do not get updated during message " f"passing as they do not occur as destination type in any " f"edge type. This may lead to unexpected behaviour.") self.convs = ModuleDict({'__'.join(k): v for k, v in convs.items()}) self.aggr = aggr def reset_parameters(self): for conv in self.convs.values(): conv.reset_parameters() def forward( self, x_dict, edge_index_dict, *args_dict, **kwargs_dict, ): out_dict = defaultdict(list) for edge_type, edge_index in edge_index_dict.items(): src, rel, dst = edge_type str_edge_type = '__'.join(edge_type) if str_edge_type not in self.convs: continue args = [] for value_dict in args_dict: if edge_type in value_dict: args.append(value_dict[edge_type]) elif src == dst and src in value_dict: args.append(value_dict[src]) elif src in value_dict or dst in value_dict: args.append( (value_dict.get(src, None), value_dict.get(dst, None))) kwargs = {} for arg, value_dict in kwargs_dict.items(): arg = arg[:-5] if edge_type in value_dict: kwargs[arg] = value_dict[edge_type] elif src == dst and src in value_dict: kwargs[arg] = value_dict[src] elif src in value_dict or dst in value_dict: kwargs[arg] = (value_dict.get(src, None), value_dict.get(dst, None)) conv = self.convs[str_edge_type] if src == dst: out = conv(x_dict[src], edge_index, *args, **kwargs) else: out = conv((x_dict[src], x_dict[dst]), edge_index, *args, **kwargs) out_dict[dst].append(out) for key, value in out_dict.items(): out_dict[key] = group(value, self.aggr) return out_dict def __repr__(self) -> str: return f'{self.__class__.__name__}(num_relations={len(self.convs)})'
true
true
1c45736df60cd6ec7b8c468f4bdacbfcf5d93fef
10,202
py
Python
9_export_fbx_bitbucket_stable/fbx_deformer.py
makehumancommunity/community-plugins-fbx
1f78be1723063cee0ae83232587431ab0f2e9894
[ "MIT" ]
1
2020-04-17T16:32:06.000Z
2020-04-17T16:32:06.000Z
9_export_fbx_bitbucket_stable/fbx_deformer.py
makehumancommunity/community-plugins-fbx
1f78be1723063cee0ae83232587431ab0f2e9894
[ "MIT" ]
null
null
null
9_export_fbx_bitbucket_stable/fbx_deformer.py
makehumancommunity/community-plugins-fbx
1f78be1723063cee0ae83232587431ab0f2e9894
[ "MIT" ]
5
2019-06-01T07:04:17.000Z
2022-02-21T14:14:51.000Z
#!/usr/bin/python2.7 # -*- coding: utf-8 -*- """ **Project Name:** MakeHuman **Product Home Page:** http://www.makehuman.org/ **Code Home Page:** https://bitbucket.org/MakeHuman/makehuman/ **Authors:** Thomas Larsson, Jonas Hauquier **Copyright(c):** MakeHuman Team 2001-2017 **Licensing:** AGPL3 This file is part of MakeHuman (www.makehuman.org). This program is free software: you can redistribute it and/or modify it under the terms of the GNU Affero General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Affero General Public License for more details. You should have received a copy of the GNU Affero General Public License along with this program. If not, see <http://www.gnu.org/licenses/>. Abstract -------- Fbx mesh """ import transformations as tm from .fbx_utils import * #-------------------------------------------------------------------- # Object definitions #-------------------------------------------------------------------- def getObjectCounts(meshes): """ Count the total number of vertex groups and shapes required for all specified meshes. """ nVertexGroups = 0 for mesh in meshes: if mesh.vertexWeights is None: continue for weights in mesh.vertexWeights.data: if weights: nVertexGroups += 1 nShapes = 0 for mesh in meshes: if hasattr(mesh, 'shapes') and mesh.shapes is not None: for key,shape in mesh.shapes: if shape: nShapes += 1 return nVertexGroups, nShapes def countObjects(meshes, skel): """ Count the total number of vertex groups and shapes combined, as required for all specified meshes. If no skeleton rig is attached to the mesh, no vertex groups for bone weights are required. """ nVertexGroups, nShapes = getObjectCounts(meshes) if skel: return (nVertexGroups + 1 + 2*nShapes) else: return 2*nShapes def writeObjectDefs(fp, meshes, skel, config): nVertexGroups, nShapes = getObjectCounts(meshes) count = countObjects(meshes, skel) if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Definitions') if count > 0: fbx_binary.fbx_template_generate(elem, "Deformer", count) if skel: fbx_binary.fbx_template_generate(elem, "Pose", 1) return if count > 0: fp.write( ' ObjectType: "Deformer" {\n' + ' Count: %d' % count + """ } """) if skel: fp.write(""" ObjectType: "Pose" { Count: 1 } """) #-------------------------------------------------------------------- # Object properties #-------------------------------------------------------------------- def writeObjectProps(fp, meshes, skel, config): if skel: writeBindPose(fp, meshes, skel, config) for mesh in meshes: writeDeformer(fp, mesh.name, config) for bone in skel.getBones(): try: weights = mesh.vertexWeights.data[bone.name] except KeyError: continue writeSubDeformer(fp, mesh.name, bone, weights, config) for mesh in meshes: # TODO support binary FBX shapekey export if hasattr(mesh, 'shapes') and mesh.shapes is not None: for sname,shape in mesh.shapes: writeShapeGeometry(fp, mesh.name, sname, shape, config) writeShapeDeformer(fp, mesh.name, sname) writeShapeSubDeformer(fp, mesh.name, sname) def writeShapeGeometry(fp, name, sname, shape, config): id,key = getId("Geometry::%s_%sShape" % (name, sname)) nVerts = len(shape.verts) fp.write( ' Geometry: %d, "%s", "Shape" {\n' % (id, key) + ' version: 100\n' + ' Indexes: *%d {\n' % nVerts + ' a: ') string = "".join( ['%d,' % vn for vn in shape.verts] ) fp.write(string[:-1]) fp.write('\n' + ' }\n' + ' Vertices: *%d {\n' % (3*nVerts) + ' a: ') target = config.scale * shape.data + config.offset string = "".join( ["%.4f,%.4f,%.4f," % tuple(dr) for dr in target] ) fp.write(string[:-1]) # Must use normals for shapekeys fp.write('\n' + ' }\n' + ' Normals: *%d {\n' % (3*nVerts) + ' a: ') string = nVerts * "0,0,0," fp.write(string[:-1]) fp.write('\n' + ' }\n' + ' }\n') def writeShapeDeformer(fp, name, sname): id,key = getId("Deformer::%s_%sShape" % (name, sname)) fp.write( ' Deformer: %d, "%s", "BlendShape" {\n' % (id, key) + ' Version: 100\n' + ' }\n') def writeShapeSubDeformer(fp, name, sname, shape): sid,skey = getId("SubDeformer::%s_%sShape" % (name, sname)) fp.write( ' Deformer: %d, "%s", "BlendShapeChannel" {' % (sid, skey) + """ version: 100 deformpercent: 0.0 FullWeights: *1 { a: 100 } } """) def writeDeformer(fp, name, config): id,key = getId("Deformer::%s" % name) properties = [ ("MHName", "p_string", "%sSkin" % name, False, True) ] if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Objects') fbx_binary.fbx_data_deformer(elem, key, id, properties) return import fbx_utils fp.write( ' Deformer: %d, "%s", "Skin" {' % (id, key) + """ Version: 101 Properties70: { """ + fbx_utils.get_ascii_properties(properties, indent=3) + """ } Link_DeformAcuracy: 50 } """) def writeSubDeformer(fp, name, bone, weights, config): id,key = getId("SubDeformer::%s_%s" % (bone.name, name)) bindmat,bindinv = bone.getBindMatrix(config.offset) if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Objects') fbx_binary.fbx_data_subdeformer(elem, key, id, weights[0], weights[1], bindmat, bindinv) return nVertexWeights = len(weights[0]) indexString = ','.join(["%d" % vn for vn in weights[0]]) weightString = ','.join(["%4f" % w for w in weights[1]]) fp.write( ' Deformer: %d, "%s", "Cluster" {\n' % (id, key) + ' Version: 100\n' + ' UserData: "", ""\n' + ' Indexes: *%d {\n' % nVertexWeights + ' a: %s\n' % indexString + ' } \n' + ' Weights: *%d {\n' % nVertexWeights + ' a: %s\n' % weightString + ' }\n') writeMatrix(fp, 'Transform', bindmat) writeMatrix(fp, 'TransformLink', bindinv) fp.write(' }\n') def writeBindPose(fp, meshes, skel, config): id,key = getId("Pose::" + skel.name) nBones = skel.getBoneCount() nMeshes = len(meshes) # Skeleton bind matrix skelbindmat = tm.rotation_matrix(math.pi/2, (1,0,0)) count = 1 + nMeshes + nBones if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Objects') pelem = fbx_binary.fbx_data_bindpose_element(elem, key, id, count) else: fp.write( ' Pose: %d, "%s", "BindPose" {\n' % (id, key)+ ' Type: "BindPose"\n' + ' Version: 100\n' + ' NbPoseNodes: %d\n' % count) startLinking() key = "Model::%s" % skel.name if config.binary: id,_ = getId(key) fbx_binary.fbx_data_pose_node_element(pelem, key, id, skelbindmat) else: poseNode(fp, key, skelbindmat) for mesh in meshes: key = "Model::%sMesh" % mesh.name if config.binary: id,_ = getId(key) fbx_binary.fbx_data_pose_node_element(pelem, key, id, skelbindmat) else: poseNode(fp, key, skelbindmat) for bone in skel.getBones(): key = "Model::%s" % bone.name bindmat,_ = bone.getBindMatrix(config.offset) if config.binary: id,_ = getId(key) fbx_binary.fbx_data_pose_node_element(pelem, key, id, bindmat) else: poseNode(fp, key, bindmat) stopLinking() if not config.binary: fp.write(' }\n') def poseNode(fp, key, matrix): pid,_ = getId(key) matrix[:3,3] = 0 fp.write( ' PoseNode: {\n' + ' Node: %d\n' % pid) writeMatrix(fp, 'Matrix', matrix, " ") fp.write(' }\n') #-------------------------------------------------------------------- # Links #-------------------------------------------------------------------- def writeLinks(fp, meshes, skel, config): if skel: for mesh in meshes: ooLink(fp, 'Deformer::%s' % mesh.name, 'Geometry::%s' % mesh.name, config) for bone in skel.getBones(): subdef = 'SubDeformer::%s_%s' % (bone.name, mesh.name) try: getId(subdef) except NameError: continue ooLink(fp, subdef, 'Deformer::%s' % mesh.name, config) ooLink(fp, 'Model::%s' % bone.name, subdef, config) for mesh in meshes: if hasattr(mesh, 'shapes') and mesh.shapes is not None: for sname, shape in mesh.shapes: deform = "Deformer::%s_%sShape" % (mesh.name, sname) subdef = "SubDeformer::%s_%sShape" % (mesh.name, sname) ooLink(fp, "Geometry::%s_%sShape" % (mesh.name, sname), subdef) ooLink(fp, subdef, deform) ooLink(fp, deform, "Geometry::%s" % mesh.name)
29.917889
96
0.525387
import transformations as tm from .fbx_utils import * def getObjectCounts(meshes): nVertexGroups = 0 for mesh in meshes: if mesh.vertexWeights is None: continue for weights in mesh.vertexWeights.data: if weights: nVertexGroups += 1 nShapes = 0 for mesh in meshes: if hasattr(mesh, 'shapes') and mesh.shapes is not None: for key,shape in mesh.shapes: if shape: nShapes += 1 return nVertexGroups, nShapes def countObjects(meshes, skel): nVertexGroups, nShapes = getObjectCounts(meshes) if skel: return (nVertexGroups + 1 + 2*nShapes) else: return 2*nShapes def writeObjectDefs(fp, meshes, skel, config): nVertexGroups, nShapes = getObjectCounts(meshes) count = countObjects(meshes, skel) if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Definitions') if count > 0: fbx_binary.fbx_template_generate(elem, "Deformer", count) if skel: fbx_binary.fbx_template_generate(elem, "Pose", 1) return if count > 0: fp.write( ' ObjectType: "Deformer" {\n' + ' Count: %d' % count + """ } """) if skel: fp.write(""" ObjectType: "Pose" { Count: 1 } """) def writeObjectProps(fp, meshes, skel, config): if skel: writeBindPose(fp, meshes, skel, config) for mesh in meshes: writeDeformer(fp, mesh.name, config) for bone in skel.getBones(): try: weights = mesh.vertexWeights.data[bone.name] except KeyError: continue writeSubDeformer(fp, mesh.name, bone, weights, config) for mesh in meshes: if hasattr(mesh, 'shapes') and mesh.shapes is not None: for sname,shape in mesh.shapes: writeShapeGeometry(fp, mesh.name, sname, shape, config) writeShapeDeformer(fp, mesh.name, sname) writeShapeSubDeformer(fp, mesh.name, sname) def writeShapeGeometry(fp, name, sname, shape, config): id,key = getId("Geometry::%s_%sShape" % (name, sname)) nVerts = len(shape.verts) fp.write( ' Geometry: %d, "%s", "Shape" {\n' % (id, key) + ' version: 100\n' + ' Indexes: *%d {\n' % nVerts + ' a: ') string = "".join( ['%d,' % vn for vn in shape.verts] ) fp.write(string[:-1]) fp.write('\n' + ' }\n' + ' Vertices: *%d {\n' % (3*nVerts) + ' a: ') target = config.scale * shape.data + config.offset string = "".join( ["%.4f,%.4f,%.4f," % tuple(dr) for dr in target] ) fp.write(string[:-1]) fp.write('\n' + ' }\n' + ' Normals: *%d {\n' % (3*nVerts) + ' a: ') string = nVerts * "0,0,0," fp.write(string[:-1]) fp.write('\n' + ' }\n' + ' }\n') def writeShapeDeformer(fp, name, sname): id,key = getId("Deformer::%s_%sShape" % (name, sname)) fp.write( ' Deformer: %d, "%s", "BlendShape" {\n' % (id, key) + ' Version: 100\n' + ' }\n') def writeShapeSubDeformer(fp, name, sname, shape): sid,skey = getId("SubDeformer::%s_%sShape" % (name, sname)) fp.write( ' Deformer: %d, "%s", "BlendShapeChannel" {' % (sid, skey) + """ version: 100 deformpercent: 0.0 FullWeights: *1 { a: 100 } } """) def writeDeformer(fp, name, config): id,key = getId("Deformer::%s" % name) properties = [ ("MHName", "p_string", "%sSkin" % name, False, True) ] if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Objects') fbx_binary.fbx_data_deformer(elem, key, id, properties) return import fbx_utils fp.write( ' Deformer: %d, "%s", "Skin" {' % (id, key) + """ Version: 101 Properties70: { """ + fbx_utils.get_ascii_properties(properties, indent=3) + """ } Link_DeformAcuracy: 50 } """) def writeSubDeformer(fp, name, bone, weights, config): id,key = getId("SubDeformer::%s_%s" % (bone.name, name)) bindmat,bindinv = bone.getBindMatrix(config.offset) if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Objects') fbx_binary.fbx_data_subdeformer(elem, key, id, weights[0], weights[1], bindmat, bindinv) return nVertexWeights = len(weights[0]) indexString = ','.join(["%d" % vn for vn in weights[0]]) weightString = ','.join(["%4f" % w for w in weights[1]]) fp.write( ' Deformer: %d, "%s", "Cluster" {\n' % (id, key) + ' Version: 100\n' + ' UserData: "", ""\n' + ' Indexes: *%d {\n' % nVertexWeights + ' a: %s\n' % indexString + ' } \n' + ' Weights: *%d {\n' % nVertexWeights + ' a: %s\n' % weightString + ' }\n') writeMatrix(fp, 'Transform', bindmat) writeMatrix(fp, 'TransformLink', bindinv) fp.write(' }\n') def writeBindPose(fp, meshes, skel, config): id,key = getId("Pose::" + skel.name) nBones = skel.getBoneCount() nMeshes = len(meshes) skelbindmat = tm.rotation_matrix(math.pi/2, (1,0,0)) count = 1 + nMeshes + nBones if config.binary: from . import fbx_binary elem = fbx_binary.get_child_element(fp, 'Objects') pelem = fbx_binary.fbx_data_bindpose_element(elem, key, id, count) else: fp.write( ' Pose: %d, "%s", "BindPose" {\n' % (id, key)+ ' Type: "BindPose"\n' + ' Version: 100\n' + ' NbPoseNodes: %d\n' % count) startLinking() key = "Model::%s" % skel.name if config.binary: id,_ = getId(key) fbx_binary.fbx_data_pose_node_element(pelem, key, id, skelbindmat) else: poseNode(fp, key, skelbindmat) for mesh in meshes: key = "Model::%sMesh" % mesh.name if config.binary: id,_ = getId(key) fbx_binary.fbx_data_pose_node_element(pelem, key, id, skelbindmat) else: poseNode(fp, key, skelbindmat) for bone in skel.getBones(): key = "Model::%s" % bone.name bindmat,_ = bone.getBindMatrix(config.offset) if config.binary: id,_ = getId(key) fbx_binary.fbx_data_pose_node_element(pelem, key, id, bindmat) else: poseNode(fp, key, bindmat) stopLinking() if not config.binary: fp.write(' }\n') def poseNode(fp, key, matrix): pid,_ = getId(key) matrix[:3,3] = 0 fp.write( ' PoseNode: {\n' + ' Node: %d\n' % pid) writeMatrix(fp, 'Matrix', matrix, " ") fp.write(' }\n') def writeLinks(fp, meshes, skel, config): if skel: for mesh in meshes: ooLink(fp, 'Deformer::%s' % mesh.name, 'Geometry::%s' % mesh.name, config) for bone in skel.getBones(): subdef = 'SubDeformer::%s_%s' % (bone.name, mesh.name) try: getId(subdef) except NameError: continue ooLink(fp, subdef, 'Deformer::%s' % mesh.name, config) ooLink(fp, 'Model::%s' % bone.name, subdef, config) for mesh in meshes: if hasattr(mesh, 'shapes') and mesh.shapes is not None: for sname, shape in mesh.shapes: deform = "Deformer::%s_%sShape" % (mesh.name, sname) subdef = "SubDeformer::%s_%sShape" % (mesh.name, sname) ooLink(fp, "Geometry::%s_%sShape" % (mesh.name, sname), subdef) ooLink(fp, subdef, deform) ooLink(fp, deform, "Geometry::%s" % mesh.name)
true
true
1c4573e4d03b690f34aa54ed5a53a2890c2dddaf
1,030
py
Python
src/data/425.py
NULLCT/LOMC
79a16474a8f21310e0fb47e536d527dd5dc6d655
[ "MIT" ]
null
null
null
src/data/425.py
NULLCT/LOMC
79a16474a8f21310e0fb47e536d527dd5dc6d655
[ "MIT" ]
null
null
null
src/data/425.py
NULLCT/LOMC
79a16474a8f21310e0fb47e536d527dd5dc6d655
[ "MIT" ]
null
null
null
import sys def main(): sys.setrecursionlimit(1000000) N, Q = [int(x) for x in input().split()] # 隣接リスト形式でグラフをつくる # 重み付きの場合は、[行き先, weight]をそれぞれの行に持たせれば良い。 graph = [[] for i in range(N)] for i in range(N - 1): a, b = [int(x) for x in input().split()] graph[a - 1].append(b - 1) graph[b - 1].append(a - 1) queries = [] for i in range(Q): c, d = [int(x) for x in input().split()] queries.append([c - 1, d - 1]) distances = [-1 for x in range(N)] distances[0] = 0 dfs(graph, distances, 0) for query in queries: if (distances[query[0]] - distances[query[1]]) % 2 == 0: print("Town") else: print("Road") def dfs(graph, distances, current_node): next_nodes = graph[current_node] for next_node in next_nodes: if distances[next_node] < 0: distances[next_node] = distances[current_node] + 1 dfs(graph, distances, next_node) if __name__ == "__main__": main()
23.953488
64
0.551456
import sys def main(): sys.setrecursionlimit(1000000) N, Q = [int(x) for x in input().split()] graph = [[] for i in range(N)] for i in range(N - 1): a, b = [int(x) for x in input().split()] graph[a - 1].append(b - 1) graph[b - 1].append(a - 1) queries = [] for i in range(Q): c, d = [int(x) for x in input().split()] queries.append([c - 1, d - 1]) distances = [-1 for x in range(N)] distances[0] = 0 dfs(graph, distances, 0) for query in queries: if (distances[query[0]] - distances[query[1]]) % 2 == 0: print("Town") else: print("Road") def dfs(graph, distances, current_node): next_nodes = graph[current_node] for next_node in next_nodes: if distances[next_node] < 0: distances[next_node] = distances[current_node] + 1 dfs(graph, distances, next_node) if __name__ == "__main__": main()
true
true
1c4574061d4be29467fa53f9afe975e345de3bfa
3,268
py
Python
pyInstaller/dash/dash/resources.py
rianawillers/dash-lineplot
b72c3e4799d39bdc33bbcae2202fdefd6f4af00e
[ "MIT" ]
2
2021-09-17T14:23:28.000Z
2021-09-17T22:12:50.000Z
pyInstaller/dash/dash/resources.py
rianawillers/dash-lineplot
b72c3e4799d39bdc33bbcae2202fdefd6f4af00e
[ "MIT" ]
null
null
null
pyInstaller/dash/dash/resources.py
rianawillers/dash-lineplot
b72c3e4799d39bdc33bbcae2202fdefd6f4af00e
[ "MIT" ]
17
2019-11-21T14:11:29.000Z
2019-11-21T15:26:23.000Z
import json import warnings import os from .development.base_component import ComponentRegistry from . import exceptions class Resources: def __init__(self, resource_name): self._resources = [] self.resource_name = resource_name def append_resource(self, resource): self._resources.append(resource) def _filter_resources(self, all_resources, dev_bundles=False): filtered_resources = [] for s in all_resources: filtered_resource = {} if 'dynamic' in s: filtered_resource['dynamic'] = s['dynamic'] if 'namespace' in s: filtered_resource['namespace'] = s['namespace'] if 'external_url' in s and not self.config.serve_locally: filtered_resource['external_url'] = s['external_url'] elif 'dev_package_path' in s and dev_bundles: filtered_resource['relative_package_path'] = ( s['dev_package_path'] ) elif 'relative_package_path' in s: filtered_resource['relative_package_path'] = ( s['relative_package_path'] ) elif 'absolute_path' in s: filtered_resource['absolute_path'] = s['absolute_path'] elif 'asset_path' in s: info = os.stat(s['filepath']) filtered_resource['asset_path'] = s['asset_path'] filtered_resource['ts'] = info.st_mtime elif self.config.serve_locally: warnings.warn( 'A local version of {} is not available'.format( s['external_url'] ) ) continue else: raise exceptions.ResourceException( '{} does not have a ' 'relative_package_path, absolute_path, or an ' 'external_url.'.format( json.dumps(filtered_resource) ) ) filtered_resources.append(filtered_resource) return filtered_resources def get_all_resources(self, dev_bundles=False): lib_resources = ComponentRegistry.get_resources(self.resource_name) all_resources = lib_resources + self._resources return self._filter_resources(all_resources, dev_bundles) # pylint: disable=too-few-public-methods class _Config: def __init__(self, serve_locally): self.serve_locally = serve_locally class Css: def __init__(self, serve_locally): self._resources = Resources('_css_dist') self._resources.config = self.config = _Config(serve_locally) def append_css(self, stylesheet): self._resources.append_resource(stylesheet) def get_all_css(self): return self._resources.get_all_resources() class Scripts: def __init__(self, serve_locally): self._resources = Resources('_js_dist') self._resources.config = self.config = _Config(serve_locally) def append_script(self, script): self._resources.append_resource(script) def get_all_scripts(self, dev_bundles=False): return self._resources.get_all_resources(dev_bundles)
34.041667
75
0.604651
import json import warnings import os from .development.base_component import ComponentRegistry from . import exceptions class Resources: def __init__(self, resource_name): self._resources = [] self.resource_name = resource_name def append_resource(self, resource): self._resources.append(resource) def _filter_resources(self, all_resources, dev_bundles=False): filtered_resources = [] for s in all_resources: filtered_resource = {} if 'dynamic' in s: filtered_resource['dynamic'] = s['dynamic'] if 'namespace' in s: filtered_resource['namespace'] = s['namespace'] if 'external_url' in s and not self.config.serve_locally: filtered_resource['external_url'] = s['external_url'] elif 'dev_package_path' in s and dev_bundles: filtered_resource['relative_package_path'] = ( s['dev_package_path'] ) elif 'relative_package_path' in s: filtered_resource['relative_package_path'] = ( s['relative_package_path'] ) elif 'absolute_path' in s: filtered_resource['absolute_path'] = s['absolute_path'] elif 'asset_path' in s: info = os.stat(s['filepath']) filtered_resource['asset_path'] = s['asset_path'] filtered_resource['ts'] = info.st_mtime elif self.config.serve_locally: warnings.warn( 'A local version of {} is not available'.format( s['external_url'] ) ) continue else: raise exceptions.ResourceException( '{} does not have a ' 'relative_package_path, absolute_path, or an ' 'external_url.'.format( json.dumps(filtered_resource) ) ) filtered_resources.append(filtered_resource) return filtered_resources def get_all_resources(self, dev_bundles=False): lib_resources = ComponentRegistry.get_resources(self.resource_name) all_resources = lib_resources + self._resources return self._filter_resources(all_resources, dev_bundles) class _Config: def __init__(self, serve_locally): self.serve_locally = serve_locally class Css: def __init__(self, serve_locally): self._resources = Resources('_css_dist') self._resources.config = self.config = _Config(serve_locally) def append_css(self, stylesheet): self._resources.append_resource(stylesheet) def get_all_css(self): return self._resources.get_all_resources() class Scripts: def __init__(self, serve_locally): self._resources = Resources('_js_dist') self._resources.config = self.config = _Config(serve_locally) def append_script(self, script): self._resources.append_resource(script) def get_all_scripts(self, dev_bundles=False): return self._resources.get_all_resources(dev_bundles)
true
true
1c45743ca4e65273720ebd7ad9326b42e0788bfd
1,734
py
Python
mergesort.py
maurendeviia/pythoncharmers
b5775d0f51a6f2e5dc0365345e0436dea4c72c14
[ "MIT" ]
37
2020-10-01T15:20:12.000Z
2021-10-04T14:17:06.000Z
mergesort.py
maurendeviia/pythoncharmers
b5775d0f51a6f2e5dc0365345e0436dea4c72c14
[ "MIT" ]
27
2020-10-01T12:32:41.000Z
2021-10-04T11:05:34.000Z
mergesort.py
maurendeviia/pythoncharmers
b5775d0f51a6f2e5dc0365345e0436dea4c72c14
[ "MIT" ]
57
2020-10-01T11:24:26.000Z
2022-02-16T05:09:50.000Z
# Python program for implementation of MergeSort # Merges two subarrays of arr[]. # First subarray is arr[l..m] # Second subarray is arr[m+1..r] def merge(arr, l, m, r): n1 = m - l + 1 n2 = r- m # create temp arrays L = [0] * (n1) R = [0] * (n2) # Copy data to temp arrays L[] and R[] for i in range(0 , n1): L[i] = arr[l + i] for j in range(0 , n2): R[j] = arr[m + 1 + j] # Merge the temp arrays back into arr[l..r] i = 0 # Initial index of first subarray j = 0 # Initial index of second subarray k = l # Initial index of merged subarray while i < n1 and j < n2 : if L[i] <= R[j]: arr[k] = L[i] i += 1 else: arr[k] = R[j] j += 1 k += 1 # Copy the remaining elements of L[], if there # are any while i < n1: arr[k] = L[i] i += 1 k += 1 # Copy the remaining elements of R[], if there # are any while j < n2: arr[k] = R[j] j += 1 k += 1 # l is for left index and r is right index of the # sub-array of arr to be sorted def mergeSort(arr,l,r): if l < r: # Same as (l+r)//2, but avoids overflow for # large l and h m = (l+(r-1))//2 # Sort first and second halves mergeSort(arr, l, m) mergeSort(arr, m+1, r) merge(arr, l, m, r) # Driver code to test above arr = [12, 11, 13, 5, 6, 7] n = len(arr) print ("Given array is") for i in range(n): print ("%d" %arr[i]), mergeSort(arr,0,n-1) print ("\n\nSorted array is") for i in range(n): print ("%d" %arr[i]),
23.12
52
0.474625
def merge(arr, l, m, r): n1 = m - l + 1 n2 = r- m L = [0] * (n1) R = [0] * (n2) for i in range(0 , n1): L[i] = arr[l + i] for j in range(0 , n2): R[j] = arr[m + 1 + j] i = 0 j = 0 k = l while i < n1 and j < n2 : if L[i] <= R[j]: arr[k] = L[i] i += 1 else: arr[k] = R[j] j += 1 k += 1 while i < n1: arr[k] = L[i] i += 1 k += 1 while j < n2: arr[k] = R[j] j += 1 k += 1 def mergeSort(arr,l,r): if l < r: m = (l+(r-1))//2 mergeSort(arr, l, m) mergeSort(arr, m+1, r) merge(arr, l, m, r) arr = [12, 11, 13, 5, 6, 7] n = len(arr) print ("Given array is") for i in range(n): print ("%d" %arr[i]), mergeSort(arr,0,n-1) print ("\n\nSorted array is") for i in range(n): print ("%d" %arr[i]),
true
true
1c4574486b85926786807ba74806c14f69cb0642
716
py
Python
test/ie.py
napoler/Terry-toolkit
8b1a607fb6d27801b0441b67f7eb0962794a728a
[ "MIT" ]
null
null
null
test/ie.py
napoler/Terry-toolkit
8b1a607fb6d27801b0441b67f7eb0962794a728a
[ "MIT" ]
14
2019-11-15T14:28:22.000Z
2022-02-10T00:24:28.000Z
test/ie.py
napoler/Terry-toolkit
8b1a607fb6d27801b0441b67f7eb0962794a728a
[ "MIT" ]
1
2020-04-15T12:58:00.000Z
2020-04-15T12:58:00.000Z
#encoding=utf-8 from __future__ import unicode_literals import sys sys.path.append("../") import Terry_toolkit as tkit t= tkit.Text() text=""" 柯基犬是个十足的小狗子 """ # li = t.summary(text=text) # print(li) # li = t.get_keyphrases(text=text) # print(li) # li = t.sentence_segmentation(text=text) # print(li) # li = t.participle(text=text,dotype='words_all_filters') # print(li) ie=tkit.TripleIE(model_path='/mnt/data/dev/model/ltp/ltp_data_v3.4.0') s=ie.get(text) # print(s) # for item in s: if item==None: pass else: print(item[0],item[1],item[2]) # extractor = tkit.TripleExtractor() # svos = extractor.triples_main(text) # # print(svos) # for item in svos: # print("".join(item))
16.272727
70
0.666201
from __future__ import unicode_literals import sys sys.path.append("../") import Terry_toolkit as tkit t= tkit.Text() text=""" 柯基犬是个十足的小狗子 """ ie=tkit.TripleIE(model_path='/mnt/data/dev/model/ltp/ltp_data_v3.4.0') s=ie.get(text) for item in s: if item==None: pass else: print(item[0],item[1],item[2])
true
true
1c45754bd696bde5b9f6046fcb305c9e2b18fb6e
8,617
py
Python
make_knockoffs.py
wfbradley/snpko
abc77349d702915519518eacdf919f06579413d0
[ "MIT" ]
null
null
null
make_knockoffs.py
wfbradley/snpko
abc77349d702915519518eacdf919f06579413d0
[ "MIT" ]
null
null
null
make_knockoffs.py
wfbradley/snpko
abc77349d702915519518eacdf919f06579413d0
[ "MIT" ]
null
null
null
#!/usr/bin/env python import pandas as pd import os import numpy as np import SNPknock.fastphase as fp from SNPknock import knockoffHMM from joblib import Parallel, delayed import utils_snpko as utils logger = utils.logger def make_knockoff(chromosome=None, grouped_by_chromosome=None, df_SNP=None, df_geno_experiment=None, df_geno_ensembl=None, SNP_to_wild_type=None, cache_dir=None, path_to_fp=None, em_iterations=25, random_seed=123): # assert chromosome!=None and grouped_by_chromosome!=None and df_SNP!=None assert chromosome is not None assert grouped_by_chromosome is not None assert df_SNP is not None logger.debug("################") logger.debug("Chromosome %2d #" % chromosome) logger.debug("################") num_experiment_people = len(df_geno_experiment) num_ensembl_people = len(df_geno_ensembl) indices = grouped_by_chromosome.groups[chromosome] df_SNP_chromo = df_SNP.iloc[indices].sort_values('chromosome_position') SNPs_on_chromosome = df_SNP_chromo['SNP'].values X_experiment = np.empty((num_experiment_people, len(SNPs_on_chromosome))) X_ensembl = np.empty((num_ensembl_people, len(SNPs_on_chromosome))) for X, df in [ (X_experiment, df_geno_experiment), (X_ensembl, df_geno_ensembl)]: for j, SNP in enumerate(SNPs_on_chromosome): X[:, j] = utils.genotype_to_nonwild_type_count( df[SNP].values, SNP_to_wild_type[SNP]) out_path = '%s/chrom_%d' % (cache_dir, chromosome) # If all relevant files are found in cache, skip EM recomputation; otherwise, # redo the whole thing. target_file_suffix_list = [ 'alphahat.txt', 'finallikelihoods', 'origchars', 'rhat.txt', 'thetahat.txt'] already_in_cache = True for suffix in target_file_suffix_list: target_path = os.path.join( cache_dir, 'chrom_%d_%s' % (chromosome, suffix)) if not os.path.exists(target_path): already_in_cache = False break if already_in_cache: logger.debug("Found chrom %d HMM in cache" % chromosome) else: # Write array to file Xfp_file = '%s/X_%d.inp' % (cache_dir, chromosome) fp.writeX(X_ensembl, Xfp_file) # Run fastPhase on data (which runs EM) fp.runFastPhase(path_to_fp, Xfp_file, out_path, K=12, numit=em_iterations) # Read in fastPhase results (i.e., HMM parameters) from file: r_file = out_path + "_rhat.txt" alpha_file = out_path + "_alphahat.txt" theta_file = out_path + "_thetahat.txt" # Why is X_ensembl[0, :] in the function arguments below? hmm = fp.loadFit(r_file, theta_file, alpha_file, X_ensembl[0, :]) # Actually produce the knockoffs knockoffs = knockoffHMM(hmm["pInit"], hmm["Q"], hmm[ "pEmit"], seed=random_seed) X_knockoffs = knockoffs.sample(X_experiment) return(X_knockoffs, X_experiment, SNPs_on_chromosome) def make_all_knockoffs(args): ''' For each chromosome, independently: Sort SNPs according to position on genome. Train HMM parameters with EM on ENSEMBL data. Generate knockoffs of experimentals SNP data. For now, we ignore sex of persons, although that is available in ENSEMBL ''' logger.info("####################################") logger.info("Fitting HMM and generating knockoffs") path_to_fp = os.path.join(args.fastPHASE_path, 'fastPHASE') if not(os.path.exists(path_to_fp)): logger.info("Cannot find fastPHASE at %s" % path_to_fp) raise Exception cache_dir = os.path.join(args.working_dir, 'fastphase_cache') utils.safe_mkdir(cache_dir) df_geno_ensembl = pd.read_csv(os.path.join( (args.working_dir), 'pruned_ensembl.csv')) # SNP,wild_type,chromosome,chromosome_position df_SNP = pd.read_csv(os.path.join( (args.working_dir), 'pruned_SNP_facts.csv')) df_wild = pd.read_csv(os.path.join(args.working_dir, 'wild_types.csv')) SNP_to_wild_type = dict( zip(df_wild['SNP'].values, df_wild['wild_type'].values)) chromosome_list = np.sort(np.unique(df_SNP['chromosome'])) for chromosome in chromosome_list: assert chromosome in np.arange(1, 24) df_geno_experiment = pd.read_csv(os.path.join( (args.working_dir), 'pruned_experiment.csv')) # Make sure we have the same SNPs everywhere. assert (set([c for c in df_geno_ensembl.columns if c.startswith('rs')]) == set([c for c in df_geno_experiment.columns if c.startswith('rs')])) for SNP in df_SNP.SNP.values: assert SNP in df_geno_ensembl.columns grouped_by_chromosome = df_SNP.groupby('chromosome') num_experiment_people = len(df_geno_experiment) knockoff_SNP_list = [] utils.safe_mkdir(os.path.join(args.working_dir, 'knockoffs')) em_iterations = 500 logger.info('Number of EM iterations: %d' % em_iterations) for knockoff_trial_count in xrange(args.num_knockoff_trials): random_seed = knockoff_trial_count + args.random_seed if ((args.num_knockoff_trials <= 20) or knockoff_trial_count % ((args.num_knockoff_trials) // 20) == 0): logger.info("Knockoff sampling %d of %d" % ( knockoff_trial_count, args.num_knockoff_trials)) if False: # Serial version; code preserved for debugging purposes for chromosome in chromosome_list: knockoff_SNP_list.append( make_knockoff( chromosome=chromosome, grouped_by_chromosome=grouped_by_chromosome, df_SNP=df_SNP, df_geno_experiment=df_geno_experiment, df_geno_ensembl=df_geno_ensembl, SNP_to_wild_type=SNP_to_wild_type, cache_dir=cache_dir, path_to_fp=path_to_fp, em_iterations=em_iterations, random_seed=random_seed)) else: knockoff_SNP_list = Parallel(n_jobs=args.num_workers)( delayed(make_knockoff)( chromosome=i, grouped_by_chromosome=grouped_by_chromosome, df_SNP=df_SNP, df_geno_experiment=df_geno_experiment, df_geno_ensembl=df_geno_ensembl, SNP_to_wild_type=SNP_to_wild_type, cache_dir=cache_dir, path_to_fp=path_to_fp, em_iterations=em_iterations, random_seed=random_seed) for i in chromosome_list) # Stitch results for each chromosome back together into a single dataframe # Knockoff results SNP_columns = [ x for x in df_geno_ensembl.columns if x.startswith('rs')] df_knockoffs = pd.DataFrame( columns=SNP_columns, index=np.arange(num_experiment_people)) # Matched experimental observations + knockoffs in one dataframe matched_columns = [] data_labels = [] for field in df_geno_experiment.columns: if field.startswith('rs'): matched_columns.append(field) matched_columns.append(field + '_knockoff') elif field.startswith(args.data_prefix): data_labels.append(field) else: continue df_matched = pd.DataFrame(columns=matched_columns + data_labels, index=np.arange(num_experiment_people)) for (X_knockoffs, X_experiment, SNPs_on_chromosome) in knockoff_SNP_list: for i in xrange(num_experiment_people): for j, SNP in enumerate(SNPs_on_chromosome): df_knockoffs[SNP].values[i] = X_knockoffs[i, j] df_matched[SNP].values[i] = int(X_experiment[i, j]) df_matched[ SNP + '_knockoff'].values[i] = int(X_knockoffs[i, j]) for data_label in data_labels: df_matched[data_label] = df_geno_experiment[data_label] # Sanity check that all fields are filled in. for field in df_knockoffs: for i in xrange(num_experiment_people): assert pd.notnull(df_knockoffs[field].values[i]) df_matched.to_csv(os.path.join((args.working_dir), 'knockoffs', 'knockoffs_%03d.csv' % knockoff_trial_count), index=False) logger.info("Done making knockoffs!!!") if __name__ == '__main__': args = utils.parse_arguments() utils.initialize_logger(args) make_all_knockoffs(args)
40.455399
101
0.646049
import pandas as pd import os import numpy as np import SNPknock.fastphase as fp from SNPknock import knockoffHMM from joblib import Parallel, delayed import utils_snpko as utils logger = utils.logger def make_knockoff(chromosome=None, grouped_by_chromosome=None, df_SNP=None, df_geno_experiment=None, df_geno_ensembl=None, SNP_to_wild_type=None, cache_dir=None, path_to_fp=None, em_iterations=25, random_seed=123): assert chromosome is not None assert grouped_by_chromosome is not None assert df_SNP is not None logger.debug("################") logger.debug("Chromosome %2d #" % chromosome) logger.debug("################") num_experiment_people = len(df_geno_experiment) num_ensembl_people = len(df_geno_ensembl) indices = grouped_by_chromosome.groups[chromosome] df_SNP_chromo = df_SNP.iloc[indices].sort_values('chromosome_position') SNPs_on_chromosome = df_SNP_chromo['SNP'].values X_experiment = np.empty((num_experiment_people, len(SNPs_on_chromosome))) X_ensembl = np.empty((num_ensembl_people, len(SNPs_on_chromosome))) for X, df in [ (X_experiment, df_geno_experiment), (X_ensembl, df_geno_ensembl)]: for j, SNP in enumerate(SNPs_on_chromosome): X[:, j] = utils.genotype_to_nonwild_type_count( df[SNP].values, SNP_to_wild_type[SNP]) out_path = '%s/chrom_%d' % (cache_dir, chromosome) target_file_suffix_list = [ 'alphahat.txt', 'finallikelihoods', 'origchars', 'rhat.txt', 'thetahat.txt'] already_in_cache = True for suffix in target_file_suffix_list: target_path = os.path.join( cache_dir, 'chrom_%d_%s' % (chromosome, suffix)) if not os.path.exists(target_path): already_in_cache = False break if already_in_cache: logger.debug("Found chrom %d HMM in cache" % chromosome) else: Xfp_file = '%s/X_%d.inp' % (cache_dir, chromosome) fp.writeX(X_ensembl, Xfp_file) fp.runFastPhase(path_to_fp, Xfp_file, out_path, K=12, numit=em_iterations) r_file = out_path + "_rhat.txt" alpha_file = out_path + "_alphahat.txt" theta_file = out_path + "_thetahat.txt" hmm = fp.loadFit(r_file, theta_file, alpha_file, X_ensembl[0, :]) knockoffs = knockoffHMM(hmm["pInit"], hmm["Q"], hmm[ "pEmit"], seed=random_seed) X_knockoffs = knockoffs.sample(X_experiment) return(X_knockoffs, X_experiment, SNPs_on_chromosome) def make_all_knockoffs(args): logger.info("####################################") logger.info("Fitting HMM and generating knockoffs") path_to_fp = os.path.join(args.fastPHASE_path, 'fastPHASE') if not(os.path.exists(path_to_fp)): logger.info("Cannot find fastPHASE at %s" % path_to_fp) raise Exception cache_dir = os.path.join(args.working_dir, 'fastphase_cache') utils.safe_mkdir(cache_dir) df_geno_ensembl = pd.read_csv(os.path.join( (args.working_dir), 'pruned_ensembl.csv')) df_SNP = pd.read_csv(os.path.join( (args.working_dir), 'pruned_SNP_facts.csv')) df_wild = pd.read_csv(os.path.join(args.working_dir, 'wild_types.csv')) SNP_to_wild_type = dict( zip(df_wild['SNP'].values, df_wild['wild_type'].values)) chromosome_list = np.sort(np.unique(df_SNP['chromosome'])) for chromosome in chromosome_list: assert chromosome in np.arange(1, 24) df_geno_experiment = pd.read_csv(os.path.join( (args.working_dir), 'pruned_experiment.csv')) assert (set([c for c in df_geno_ensembl.columns if c.startswith('rs')]) == set([c for c in df_geno_experiment.columns if c.startswith('rs')])) for SNP in df_SNP.SNP.values: assert SNP in df_geno_ensembl.columns grouped_by_chromosome = df_SNP.groupby('chromosome') num_experiment_people = len(df_geno_experiment) knockoff_SNP_list = [] utils.safe_mkdir(os.path.join(args.working_dir, 'knockoffs')) em_iterations = 500 logger.info('Number of EM iterations: %d' % em_iterations) for knockoff_trial_count in xrange(args.num_knockoff_trials): random_seed = knockoff_trial_count + args.random_seed if ((args.num_knockoff_trials <= 20) or knockoff_trial_count % ((args.num_knockoff_trials) // 20) == 0): logger.info("Knockoff sampling %d of %d" % ( knockoff_trial_count, args.num_knockoff_trials)) if False: for chromosome in chromosome_list: knockoff_SNP_list.append( make_knockoff( chromosome=chromosome, grouped_by_chromosome=grouped_by_chromosome, df_SNP=df_SNP, df_geno_experiment=df_geno_experiment, df_geno_ensembl=df_geno_ensembl, SNP_to_wild_type=SNP_to_wild_type, cache_dir=cache_dir, path_to_fp=path_to_fp, em_iterations=em_iterations, random_seed=random_seed)) else: knockoff_SNP_list = Parallel(n_jobs=args.num_workers)( delayed(make_knockoff)( chromosome=i, grouped_by_chromosome=grouped_by_chromosome, df_SNP=df_SNP, df_geno_experiment=df_geno_experiment, df_geno_ensembl=df_geno_ensembl, SNP_to_wild_type=SNP_to_wild_type, cache_dir=cache_dir, path_to_fp=path_to_fp, em_iterations=em_iterations, random_seed=random_seed) for i in chromosome_list) SNP_columns = [ x for x in df_geno_ensembl.columns if x.startswith('rs')] df_knockoffs = pd.DataFrame( columns=SNP_columns, index=np.arange(num_experiment_people)) matched_columns = [] data_labels = [] for field in df_geno_experiment.columns: if field.startswith('rs'): matched_columns.append(field) matched_columns.append(field + '_knockoff') elif field.startswith(args.data_prefix): data_labels.append(field) else: continue df_matched = pd.DataFrame(columns=matched_columns + data_labels, index=np.arange(num_experiment_people)) for (X_knockoffs, X_experiment, SNPs_on_chromosome) in knockoff_SNP_list: for i in xrange(num_experiment_people): for j, SNP in enumerate(SNPs_on_chromosome): df_knockoffs[SNP].values[i] = X_knockoffs[i, j] df_matched[SNP].values[i] = int(X_experiment[i, j]) df_matched[ SNP + '_knockoff'].values[i] = int(X_knockoffs[i, j]) for data_label in data_labels: df_matched[data_label] = df_geno_experiment[data_label] for field in df_knockoffs: for i in xrange(num_experiment_people): assert pd.notnull(df_knockoffs[field].values[i]) df_matched.to_csv(os.path.join((args.working_dir), 'knockoffs', 'knockoffs_%03d.csv' % knockoff_trial_count), index=False) logger.info("Done making knockoffs!!!") if __name__ == '__main__': args = utils.parse_arguments() utils.initialize_logger(args) make_all_knockoffs(args)
true
true
1c45754f10176c7ca4335379fbf3a06ceffc08ee
13,895
py
Python
robots/login.py
sicekit/sicekit
30d6b665ed083893792579f6640c897e932b4ff0
[ "MIT" ]
11
2015-04-13T15:40:00.000Z
2021-11-09T14:55:25.000Z
robots/login.py
sicekit/sicekit
30d6b665ed083893792579f6640c897e932b4ff0
[ "MIT" ]
null
null
null
robots/login.py
sicekit/sicekit
30d6b665ed083893792579f6640c897e932b4ff0
[ "MIT" ]
4
2016-06-07T06:39:39.000Z
2019-05-11T09:34:20.000Z
#!/usr/bin/python # -*- coding: utf-8 -*- """ Script to log the robot in to a wiki account. Suggestion is to make a special account to use for robot use only. Make sure this robot account is well known on your home wikipedia before using. Parameters: -all Try to log in on all sites where a username is defined in user-config.py. -pass Useful in combination with -all when you have accounts for several sites and use the same password for all of them. Asks you for the password, then logs in on all given sites. -pass:XXXX Uses XXXX as password. Be careful if you use this parameter because your password will be shown on your screen, and will probably be saved in your command line history. This is NOT RECOMMENDED for use on computers where others have either physical or remote access. Use -pass instead. -sysop Log in with your sysop account. -force Ignores if the user is already logged in, and tries to log in. -v -v Shows http requests made when logging in. This might leak (doubly private data (password, session id), so make sure to check the verbose) output. Using -log is recommended: this will output a lot of data If not given as parameter, the script will ask for your username and password (password entry will be hidden), log in to your home wiki using this combination, and store the resulting cookies (containing your password hash, so keep it secured!) in a file in the login-data subdirectory. All scripts in this library will be looking for this cookie file and will use the login information if it is present. To log out, throw away the XX-login.data file that is created in the login-data subdirectory. """ # # (C) Rob W.W. Hooft, 2003 # # Distributed under the terms of the MIT license. # __version__='$Id: login.py 7034 2009-07-09 10:11:29Z alexsh $' import re import urllib2 import wikipedia, config # On some wikis you are only allowed to run a bot if there is a link to # the bot's user page in a specific list. botList = { 'wikipedia': { 'en': u'Wikipedia:Registered bots', # Disabled because they are now using a template system which # we can't check with our current code. #'simple': u'Wikipedia:Bots', }, 'gentoo': { 'en': u'Help:Bots', } } class LoginManager: def __init__(self, password = None, sysop = False, site = None, username=None, verbose=False): self.site = site or wikipedia.getSite() if username: self.username=username # perform writeback. if site.family.name not in config.usernames: config.usernames[site.family.name]={} config.usernames[site.family.name][self.site.lang]=username else: if sysop: try: self.username = config.sysopnames[self.site.family.name][self.site.lang] except: raise wikipedia.NoUsername(u'ERROR: Sysop username for %s:%s is undefined.\nIf you have a sysop account for that site, please add such a line to user-config.py:\n\nsysopnames[\'%s\'][\'%s\'] = \'myUsername\'' % (self.site.family.name, self.site.lang, self.site.family.name, self.site.lang)) else: try: self.username = config.usernames[self.site.family.name][self.site.lang] except: raise wikipedia.NoUsername(u'ERROR: Username for %s:%s is undefined.\nIf you have an account for that site, please add such a line to user-config.py:\n\nusernames[\'%s\'][\'%s\'] = \'myUsername\'' % (self.site.family.name, self.site.lang, self.site.family.name, self.site.lang)) self.password = password self.verbose = verbose if getattr(config, 'password_file', ''): self.readPassword() def botAllowed(self): """ Checks whether the bot is listed on a specific page to comply with the policy on the respective wiki. """ if self.site.family.name in botList and self.site.language() in botList[self.site.family.name]: botListPageTitle = wikipedia.translate(self.site.language(), botList) botListPage = wikipedia.Page(self.site, botListPageTitle) for linkedPage in botListPage.linkedPages(): if linkedPage.titleWithoutNamespace() == self.username: return True return False else: # No bot policies on other return True def getCookie(self, api = config.use_api_login, remember=True, captcha = None): """ Login to the site. remember Remember login (default: True) captchaId A dictionary containing the captcha id and answer, if any Returns cookie data if succesful, None otherwise. """ if api: predata = { 'action': 'login', 'lgname': self.username.encode(self.site.encoding()), 'lgpassword': self.password, 'lgdomain': self.site.family.ldapDomain, } address = self.site.api_address() else: predata = { "wpName": self.username.encode(self.site.encoding()), "wpPassword": self.password, "wpDomain": self.site.family.ldapDomain, # VistaPrint fix "wpLoginattempt": "Aanmelden & Inschrijven", # dutch button label seems to work for all wikis "wpRemember": str(int(bool(remember))), "wpSkipCookieCheck": '1' } if captcha: predata["wpCaptchaId"] = captcha['id'] predata["wpCaptchaWord"] = captcha['answer'] login_address = self.site.login_address() address = login_address + '&action=submit' if self.site.hostname() in config.authenticate.keys(): headers = { "Content-type": "application/x-www-form-urlencoded", "User-agent": wikipedia.useragent } data = self.site.urlEncode(predata) if self.verbose: fakepredata = predata fakepredata['wpPassword'] = u'XXXX' wikipedia.output(u"urllib2.urlopen(urllib2.Request('%s', %s, %s)):" % (self.site.protocol() + '://' + self.site.hostname() + address, self.site.urlEncode(fakepredata), headers)) response = urllib2.urlopen(urllib2.Request(self.site.protocol() + '://' + self.site.hostname() + address, data, headers)) data = response.read() if self.verbose: fakedata = re.sub(r"(session|Token)=..........", r"session=XXXXXXXXXX", data) trans = config.transliterate config.transliterate = False #transliteration breaks for some reason wikipedia.output(fakedata.decode(self.site.encoding())) config.transliterate = trans wikipedia.cj.save(wikipedia.COOKIEFILE) return "Ok" else: response, data = self.site.postData(address, self.site.urlEncode(predata)) if self.verbose: fakepredata = predata fakepredata['wpPassword'] = fakepredata['lgpassword'] = u'XXXXX' wikipedia.output(u"self.site.postData(%s, %s)" % (address, self.site.urlEncode(fakepredata))) fakeresponsemsg = re.sub(r"(session|Token)=..........", r"session=XXXXXXXXXX", response.msg.__str__()) wikipedia.output(u"%s/%s\n%s" % (response.status, response.reason, fakeresponsemsg)) wikipedia.output(u"%s" % data) Reat=re.compile(': (.*?);') L = [] for eat in response.msg.getallmatchingheaders('set-cookie'): m = Reat.search(eat) if m: L.append(m.group(1)) got_token = got_user = False for Ldata in L: if 'Token=' in Ldata: got_token = True if 'User=' in Ldata or 'UserName=' in Ldata: got_user = True if got_token and got_user: return "\n".join(L) elif not captcha: solve = self.site.solveCaptcha(data) if solve: return self.getCookie(api = api, remember = remember, captcha = solve) return None def storecookiedata(self, data): """ Stores cookie data. The argument data is the raw data, as returned by getCookie(). Returns nothing.""" filename = wikipedia.config.datafilepath('login-data', '%s-%s-%s-login.data' % (self.site.family.name, self.site.lang, self.username)) f = open(filename, 'w') f.write(data) f.close() def readPassword(self): """ Reads passwords from a file. DO NOT FORGET TO REMOVE READ ACCESS FOR OTHER USERS!!! Use chmod 600 password-file. All lines below should be valid Python tuples in the form (code, family, username, password) or (username, password) to set a default password for an username. Default usernames should occur above specific usernames. Example: ("my_username", "my_default_password") ("my_sysop_user", "my_sysop_password") ("en", "wikipedia", "my_en_user", "my_en_pass") """ file = open(wikipedia.config.datafilepath(config.password_file)) for line in file: if not line.strip(): continue entry = eval(line) if len(entry) == 2: #for default userinfo if entry[0] == self.username: self.password = entry[1] elif len(entry) == 4: #for userinfo included code and family if entry[0] == self.site.lang and \ entry[1] == self.site.family.name and \ entry[2] == self.username: self.password = entry[3] file.close() def login(self, api = config.use_api_login, retry = False): if not self.password: # As we don't want the password to appear on the screen, we set # password = True self.password = wikipedia.input(u'Password for user %s on %s:' % (self.username, self.site), password = True) self.password = self.password.encode(self.site.encoding()) wikipedia.output(u"Logging in to %s as %s" % (self.site, self.username)) try: cookiedata = self.getCookie(api = api) except NotImplementedError: wikipedia.output('API disabled because this site does not support.') config.use_api_login = api = False cookiedata = self.getCookie(api = api) if cookiedata: self.storecookiedata(cookiedata) wikipedia.output(u"Should be logged in now") # Show a warning according to the local bot policy if not self.botAllowed(): wikipedia.output(u'*** Your username is not listed on [[%s]].\n*** Please make sure you are allowed to use the robot before actually using it!' % botList[self.site.family.name][self.site.lang]) return True else: wikipedia.output(u"Login failed. Wrong password or CAPTCHA answer?") if api: wikipedia.output(u"API login failed, retrying using standard webpage.") return self.login(api = False, retry = retry) if retry: self.password = None return self.login(api = api, retry = True) else: return False def showCaptchaWindow(self, url): pass def main(): username = password = None sysop = False logall = False forceLogin = False verbose = False for arg in wikipedia.handleArgs(): if arg.startswith("-pass"): if len(arg) == 5: password = wikipedia.input(u'Password for all accounts:', password = True) else: password = arg[6:] elif arg == "-sysop": sysop = True elif arg == "-all": logall = True elif arg == "-force": forceLogin = True else: wikipedia.showHelp('login') return if wikipedia.verbose > 1: wikipedia.output(u"WARNING: Using -v -v on login.py might leak private data. When sharing, please double check your password is not readable and log out your bots session.") verbose = True # only use this verbose when running from login.py if logall: if sysop: namedict = config.sysopnames else: namedict = config.usernames for familyName in namedict.iterkeys(): for lang in namedict[familyName].iterkeys(): try: site = wikipedia.getSite( code=lang, fam=familyName ) if not forceLogin and site.loggedInAs(sysop = sysop) is not None: wikipedia.output(u'Already logged in on %s' % site) else: loginMan = LoginManager(password, sysop = sysop, site = site, verbose=verbose) loginMan.login() except wikipedia.NoSuchSite: wikipedia.output(lang+ u'.' + familyName + u' is not a valid site, please remove it from your config') else: loginMan = LoginManager(password, sysop = sysop, verbose=verbose) loginMan.login() if __name__ == "__main__": try: main() finally: wikipedia.stopme()
42.362805
310
0.580784
__version__='$Id: login.py 7034 2009-07-09 10:11:29Z alexsh $' import re import urllib2 import wikipedia, config botList = { 'wikipedia': { 'en': u'Wikipedia:Registered bots', # Disabled because they are now using a template system which # we can't check with our current code. }, 'gentoo': { 'en': u'Help:Bots', } } class LoginManager: def __init__(self, password = None, sysop = False, site = None, username=None, verbose=False): self.site = site or wikipedia.getSite() if username: self.username=username if site.family.name not in config.usernames: config.usernames[site.family.name]={} config.usernames[site.family.name][self.site.lang]=username else: if sysop: try: self.username = config.sysopnames[self.site.family.name][self.site.lang] except: raise wikipedia.NoUsername(u'ERROR: Sysop username for %s:%s is undefined.\nIf you have a sysop account for that site, please add such a line to user-config.py:\n\nsysopnames[\'%s\'][\'%s\'] = \'myUsername\'' % (self.site.family.name, self.site.lang, self.site.family.name, self.site.lang)) else: try: self.username = config.usernames[self.site.family.name][self.site.lang] except: raise wikipedia.NoUsername(u'ERROR: Username for %s:%s is undefined.\nIf you have an account for that site, please add such a line to user-config.py:\n\nusernames[\'%s\'][\'%s\'] = \'myUsername\'' % (self.site.family.name, self.site.lang, self.site.family.name, self.site.lang)) self.password = password self.verbose = verbose if getattr(config, 'password_file', ''): self.readPassword() def botAllowed(self): if self.site.family.name in botList and self.site.language() in botList[self.site.family.name]: botListPageTitle = wikipedia.translate(self.site.language(), botList) botListPage = wikipedia.Page(self.site, botListPageTitle) for linkedPage in botListPage.linkedPages(): if linkedPage.titleWithoutNamespace() == self.username: return True return False else: return True def getCookie(self, api = config.use_api_login, remember=True, captcha = None): if api: predata = { 'action': 'login', 'lgname': self.username.encode(self.site.encoding()), 'lgpassword': self.password, 'lgdomain': self.site.family.ldapDomain, } address = self.site.api_address() else: predata = { "wpName": self.username.encode(self.site.encoding()), "wpPassword": self.password, "wpDomain": self.site.family.ldapDomain, "wpLoginattempt": "Aanmelden & Inschrijven", "wpRemember": str(int(bool(remember))), "wpSkipCookieCheck": '1' } if captcha: predata["wpCaptchaId"] = captcha['id'] predata["wpCaptchaWord"] = captcha['answer'] login_address = self.site.login_address() address = login_address + '&action=submit' if self.site.hostname() in config.authenticate.keys(): headers = { "Content-type": "application/x-www-form-urlencoded", "User-agent": wikipedia.useragent } data = self.site.urlEncode(predata) if self.verbose: fakepredata = predata fakepredata['wpPassword'] = u'XXXX' wikipedia.output(u"urllib2.urlopen(urllib2.Request('%s', %s, %s)):" % (self.site.protocol() + '://' + self.site.hostname() + address, self.site.urlEncode(fakepredata), headers)) response = urllib2.urlopen(urllib2.Request(self.site.protocol() + '://' + self.site.hostname() + address, data, headers)) data = response.read() if self.verbose: fakedata = re.sub(r"(session|Token)=..........", r"session=XXXXXXXXXX", data) trans = config.transliterate config.transliterate = False wikipedia.output(fakedata.decode(self.site.encoding())) config.transliterate = trans wikipedia.cj.save(wikipedia.COOKIEFILE) return "Ok" else: response, data = self.site.postData(address, self.site.urlEncode(predata)) if self.verbose: fakepredata = predata fakepredata['wpPassword'] = fakepredata['lgpassword'] = u'XXXXX' wikipedia.output(u"self.site.postData(%s, %s)" % (address, self.site.urlEncode(fakepredata))) fakeresponsemsg = re.sub(r"(session|Token)=..........", r"session=XXXXXXXXXX", response.msg.__str__()) wikipedia.output(u"%s/%s\n%s" % (response.status, response.reason, fakeresponsemsg)) wikipedia.output(u"%s" % data) Reat=re.compile(': (.*?);') L = [] for eat in response.msg.getallmatchingheaders('set-cookie'): m = Reat.search(eat) if m: L.append(m.group(1)) got_token = got_user = False for Ldata in L: if 'Token=' in Ldata: got_token = True if 'User=' in Ldata or 'UserName=' in Ldata: got_user = True if got_token and got_user: return "\n".join(L) elif not captcha: solve = self.site.solveCaptcha(data) if solve: return self.getCookie(api = api, remember = remember, captcha = solve) return None def storecookiedata(self, data): filename = wikipedia.config.datafilepath('login-data', '%s-%s-%s-login.data' % (self.site.family.name, self.site.lang, self.username)) f = open(filename, 'w') f.write(data) f.close() def readPassword(self): file = open(wikipedia.config.datafilepath(config.password_file)) for line in file: if not line.strip(): continue entry = eval(line) if len(entry) == 2: if entry[0] == self.username: self.password = entry[1] elif len(entry) == 4: if entry[0] == self.site.lang and \ entry[1] == self.site.family.name and \ entry[2] == self.username: self.password = entry[3] file.close() def login(self, api = config.use_api_login, retry = False): if not self.password: # password = True self.password = wikipedia.input(u'Password for user %s on %s:' % (self.username, self.site), password = True) self.password = self.password.encode(self.site.encoding()) wikipedia.output(u"Logging in to %s as %s" % (self.site, self.username)) try: cookiedata = self.getCookie(api = api) except NotImplementedError: wikipedia.output('API disabled because this site does not support.') config.use_api_login = api = False cookiedata = self.getCookie(api = api) if cookiedata: self.storecookiedata(cookiedata) wikipedia.output(u"Should be logged in now") # Show a warning according to the local bot policy if not self.botAllowed(): wikipedia.output(u'*** Your username is not listed on [[%s]].\n*** Please make sure you are allowed to use the robot before actually using it!' % botList[self.site.family.name][self.site.lang]) return True else: wikipedia.output(u"Login failed. Wrong password or CAPTCHA answer?") if api: wikipedia.output(u"API login failed, retrying using standard webpage.") return self.login(api = False, retry = retry) if retry: self.password = None return self.login(api = api, retry = True) else: return False def showCaptchaWindow(self, url): pass def main(): username = password = None sysop = False logall = False forceLogin = False verbose = False for arg in wikipedia.handleArgs(): if arg.startswith("-pass"): if len(arg) == 5: password = wikipedia.input(u'Password for all accounts:', password = True) else: password = arg[6:] elif arg == "-sysop": sysop = True elif arg == "-all": logall = True elif arg == "-force": forceLogin = True else: wikipedia.showHelp('login') return if wikipedia.verbose > 1: wikipedia.output(u"WARNING: Using -v -v on login.py might leak private data. When sharing, please double check your password is not readable and log out your bots session.") verbose = True # only use this verbose when running from login.py if logall: if sysop: namedict = config.sysopnames else: namedict = config.usernames for familyName in namedict.iterkeys(): for lang in namedict[familyName].iterkeys(): try: site = wikipedia.getSite( code=lang, fam=familyName ) if not forceLogin and site.loggedInAs(sysop = sysop) is not None: wikipedia.output(u'Already logged in on %s' % site) else: loginMan = LoginManager(password, sysop = sysop, site = site, verbose=verbose) loginMan.login() except wikipedia.NoSuchSite: wikipedia.output(lang+ u'.' + familyName + u' is not a valid site, please remove it from your config') else: loginMan = LoginManager(password, sysop = sysop, verbose=verbose) loginMan.login() if __name__ == "__main__": try: main() finally: wikipedia.stopme()
true
true
1c4576baa0e49856245c1d52cad14c426975599c
15,984
py
Python
tfx/orchestration/metadata_test.py
romiosarkar6991/tfx-romio
0703c1dd037c676e1d438c2e5ce831decfc9eed9
[ "Apache-2.0" ]
1
2019-10-10T06:06:12.000Z
2019-10-10T06:06:12.000Z
tfx/orchestration/metadata_test.py
romiosarkar6991/tfx-romio
0703c1dd037c676e1d438c2e5ce831decfc9eed9
[ "Apache-2.0" ]
null
null
null
tfx/orchestration/metadata_test.py
romiosarkar6991/tfx-romio
0703c1dd037c676e1d438c2e5ce831decfc9eed9
[ "Apache-2.0" ]
1
2019-10-06T03:39:58.000Z
2019-10-06T03:39:58.000Z
# Copyright 2019 Google LLC. All Rights Reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """Tests for tfx.orchestration.metadata.""" from __future__ import absolute_import from __future__ import division from __future__ import print_function # Standard Imports import mock import tensorflow as tf from ml_metadata.proto import metadata_store_pb2 from tfx import types from tfx.orchestration import data_types from tfx.orchestration import metadata from tfx.types import standard_artifacts from tfx.types.artifact import ArtifactState class MetadataTest(tf.test.TestCase): def setUp(self): super(MetadataTest, self).setUp() self._connection_config = metadata_store_pb2.ConnectionConfig() self._connection_config.sqlite.SetInParent() self._component_info = data_types.ComponentInfo( component_type='a.b.c', component_id='my_component') self._component_info2 = data_types.ComponentInfo( component_type='a.b.d', component_id='my_component_2') self._pipeline_info = data_types.PipelineInfo( pipeline_name='my_pipeline', pipeline_root='/tmp', run_id='my_run_id') self._pipeline_info2 = data_types.PipelineInfo( pipeline_name='my_pipeline', pipeline_root='/tmp', run_id='my_run_id2') self._pipeline_info3 = data_types.PipelineInfo( pipeline_name='my_pipeline2', pipeline_root='/tmp', run_id='my_run_id') self._pipeline_info4 = data_types.PipelineInfo( pipeline_name='my_pipeline2', pipeline_root='/tmp', run_id='my_run_id2') def testEmptyArtifact(self): with metadata.Metadata(connection_config=self._connection_config) as m: m.publish_artifacts([]) eid = m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info) m.publish_execution(eid, {}, {}) [execution] = m.store.get_executions_by_id([eid]) self.assertProtoEquals( """ id: 1 type_id: 1 properties { key: "state" value { string_value: "complete" } } properties { key: "pipeline_name" value { string_value: "my_pipeline" } } properties { key: "pipeline_root" value { string_value: "/tmp" } } properties { key: "run_id" value { string_value: "my_run_id" } } properties { key: "component_id" value { string_value: "my_component" } }""", execution) def testArtifact(self): with metadata.Metadata(connection_config=self._connection_config) as m: self.assertListEqual([], m.get_all_artifacts()) # Test publish artifact. artifact = standard_artifacts.Examples() artifact.uri = 'uri' m.publish_artifacts([artifact]) [artifact] = m.store.get_artifacts() self.assertProtoEquals( """id: 1 type_id: 1 uri: "uri" properties { key: "split" value { string_value: "" } } properties { key: "state" value { string_value: "published" } } properties { key: "type_name" value { string_value: "ExamplesPath" } }""", artifact) # Test get artifact. self.assertListEqual([artifact], m.get_all_artifacts()) self.assertListEqual([artifact], m.get_artifacts_by_uri('uri')) self.assertListEqual([artifact], m.get_artifacts_by_type('ExamplesPath')) # Test artifact state. m.check_artifact_state(artifact, ArtifactState.PUBLISHED) m.update_artifact_state(artifact, ArtifactState.DELETED) m.check_artifact_state(artifact, ArtifactState.DELETED) self.assertRaises(RuntimeError, m.check_artifact_state, artifact, ArtifactState.PUBLISHED) def testExecution(self): with metadata.Metadata(connection_config=self._connection_config) as m: context_id = m.register_run_context_if_not_exists(self._pipeline_info) # Test prepare_execution. exec_properties = {'arg_one': 1} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info, run_context_id=context_id) [execution] = m.store.get_executions_by_context(context_id) self.assertProtoEquals( """ id: 1 type_id: 2 properties { key: "state" value { string_value: "new" } } properties { key: "pipeline_name" value { string_value: "my_pipeline" } } properties { key: "pipeline_root" value { string_value: "/tmp" } } properties { key: "run_id" value { string_value: "my_run_id" } } properties { key: "component_id" value { string_value: "my_component" } } properties { key: "arg_one" value { string_value: "1" } }""", execution) # Test publish_execution. input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = standard_artifacts.Examples() input_dict = {'input': [input_artifact]} output_dict = {'output': [output_artifact]} m.publish_execution(eid, input_dict, output_dict) # Make sure artifacts in output_dict are published. self.assertEqual(ArtifactState.PUBLISHED, output_artifact.state) # Make sure execution state are changed. [execution] = m.store.get_executions_by_id([eid]) self.assertEqual(metadata.EXECUTION_STATE_COMPLETE, execution.properties['state'].string_value) # Make sure events are published. events = m.store.get_events_by_execution_ids([eid]) self.assertEqual(2, len(events)) self.assertEqual(input_artifact.id, events[0].artifact_id) self.assertEqual(metadata_store_pb2.Event.INPUT, events[0].type) self.assertProtoEquals( """ steps { key: "input" } steps { index: 0 }""", events[0].path) self.assertEqual(output_artifact.id, events[1].artifact_id) self.assertEqual(metadata_store_pb2.Event.OUTPUT, events[1].type) self.assertProtoEquals( """ steps { key: "output" } steps { index: 0 }""", events[1].path) def testFetchPreviousResult(self): with metadata.Metadata(connection_config=self._connection_config) as m: # Create an 'previous' execution. exec_properties = {'log_root': 'path'} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info) input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = standard_artifacts.Examples() input_artifacts = {'input': [input_artifact]} output_artifacts = {'output': [output_artifact]} m.publish_execution(eid, input_artifacts, output_artifacts) # Test previous_run. self.assertEqual( None, m.previous_execution( input_artifacts=input_artifacts, exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info)) self.assertEqual( None, m.previous_execution( input_artifacts={}, exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info)) self.assertEqual( None, m.previous_execution( input_artifacts=input_artifacts, exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=data_types.ComponentInfo( component_id='unique', component_type='a.b.c'))) self.assertEqual( eid, m.previous_execution( input_artifacts=input_artifacts, exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info)) # Test fetch_previous_result_artifacts. new_output_artifact = standard_artifacts.Examples() self.assertNotEqual(ArtifactState.PUBLISHED, new_output_artifact.state) new_output_dict = {'output': [new_output_artifact]} updated_output_dict = m.fetch_previous_result_artifacts( new_output_dict, eid) previous_artifact = output_artifacts['output'][-1].artifact current_artifact = updated_output_dict['output'][-1].artifact self.assertEqual(ArtifactState.PUBLISHED, current_artifact.properties['state'].string_value) self.assertEqual(previous_artifact.id, current_artifact.id) self.assertEqual(previous_artifact.type_id, current_artifact.type_id) def testGetCachedExecutionIds(self): with metadata.Metadata(connection_config=self._connection_config) as m: mock_store = mock.Mock() mock_store.get_events_by_execution_ids.side_effect = [ [ metadata_store_pb2.Event( artifact_id=1, type=metadata_store_pb2.Event.INPUT) ], [ metadata_store_pb2.Event( artifact_id=1, type=metadata_store_pb2.Event.INPUT), metadata_store_pb2.Event( artifact_id=2, type=metadata_store_pb2.Event.INPUT), metadata_store_pb2.Event( artifact_id=3, type=metadata_store_pb2.Event.INPUT) ], [ metadata_store_pb2.Event( artifact_id=1, type=metadata_store_pb2.Event.INPUT), metadata_store_pb2.Event( artifact_id=2, type=metadata_store_pb2.Event.INPUT), ], ] m._store = mock_store input_one = standard_artifacts.Examples() input_one.id = 1 input_two = standard_artifacts.Examples() input_two.id = 2 input_dict = { 'input_one': [input_one], 'input_two': [input_two], } self.assertEqual(1, m._get_cached_execution_id(input_dict, [3, 2, 1])) def testSearchArtifacts(self): with metadata.Metadata(connection_config=self._connection_config) as m: exec_properties = {'log_root': 'path'} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info) input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = types.Artifact(type_name='MyOutputArtifact') output_artifact.uri = 'my/uri' input_dict = {'input': [input_artifact]} output_dict = {'output': [output_artifact]} m.publish_execution(eid, input_dict, output_dict) [artifact] = m.search_artifacts( artifact_name='output', pipeline_name=self._pipeline_info.pipeline_name, run_id=self._pipeline_info.run_id, producer_component_id=self._component_info.component_id) self.assertEqual(artifact.uri, output_artifact.uri) def testPublishSkippedExecution(self): with metadata.Metadata(connection_config=self._connection_config) as m: exec_properties = {'log_root': 'path'} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info) input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = types.Artifact(type_name='MyOutputArtifact') output_artifact.uri = 'my/uri' [published_artifact] = m.publish_artifacts([output_artifact]) output_artifact.artifact = published_artifact input_dict = {'input': [input_artifact]} output_dict = {'output': [output_artifact]} m.publish_execution( eid, input_dict, output_dict, state=metadata.EXECUTION_STATE_CACHED) def testGetExecutionStates(self): with metadata.Metadata(connection_config=self._connection_config) as m: context_id = m.register_run_context_if_not_exists(self._pipeline_info) context_id2 = m.register_run_context_if_not_exists(self._pipeline_info2) self.assertListEqual( [self._pipeline_info.run_id, self._pipeline_info2.run_id], m.get_all_runs('my_pipeline')) eid = m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info, run_context_id=context_id) m.publish_execution(eid, {}, {}) m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info2, run_context_id=context_id) m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info2, component_info=self._component_info, run_context_id=context_id2) states = m.get_execution_states(self._pipeline_info) self.assertDictEqual( { self._component_info.component_id: metadata.EXECUTION_STATE_COMPLETE, self._component_info2.component_id: metadata.EXECUTION_STATE_NEW, }, states) def testContext(self): with metadata.Metadata(connection_config=self._connection_config) as m: cid1 = m.register_run_context_if_not_exists(self._pipeline_info) cid2 = m.register_run_context_if_not_exists(self._pipeline_info2) cid3 = m.register_run_context_if_not_exists(self._pipeline_info3) context_type = m.store.get_context_type('run') self.assertProtoEquals( """ id: 1 name: 'run' properties { key: "pipeline_name" value: STRING } properties { key: "run_id" value: STRING } """, context_type) [context] = m.store.get_contexts_by_id([cid1]) self.assertProtoEquals( """ id: 1 type_id: 1 name: 'my_pipeline.my_run_id' properties { key: "pipeline_name" value { string_value: "my_pipeline" } } properties { key: "run_id" value { string_value: "my_run_id" } } """, context) self.assertEqual( cid1, m.register_run_context_if_not_exists(self._pipeline_info)) self.assertEqual(cid1, m._get_run_context_id(self._pipeline_info)) self.assertEqual(cid2, m._get_run_context_id(self._pipeline_info2)) self.assertEqual(cid3, m._get_run_context_id(self._pipeline_info3)) self.assertEqual(None, m._get_run_context_id(self._pipeline_info4)) if __name__ == '__main__': tf.test.main()
35.52
80
0.635385
from __future__ import absolute_import from __future__ import division from __future__ import print_function import mock import tensorflow as tf from ml_metadata.proto import metadata_store_pb2 from tfx import types from tfx.orchestration import data_types from tfx.orchestration import metadata from tfx.types import standard_artifacts from tfx.types.artifact import ArtifactState class MetadataTest(tf.test.TestCase): def setUp(self): super(MetadataTest, self).setUp() self._connection_config = metadata_store_pb2.ConnectionConfig() self._connection_config.sqlite.SetInParent() self._component_info = data_types.ComponentInfo( component_type='a.b.c', component_id='my_component') self._component_info2 = data_types.ComponentInfo( component_type='a.b.d', component_id='my_component_2') self._pipeline_info = data_types.PipelineInfo( pipeline_name='my_pipeline', pipeline_root='/tmp', run_id='my_run_id') self._pipeline_info2 = data_types.PipelineInfo( pipeline_name='my_pipeline', pipeline_root='/tmp', run_id='my_run_id2') self._pipeline_info3 = data_types.PipelineInfo( pipeline_name='my_pipeline2', pipeline_root='/tmp', run_id='my_run_id') self._pipeline_info4 = data_types.PipelineInfo( pipeline_name='my_pipeline2', pipeline_root='/tmp', run_id='my_run_id2') def testEmptyArtifact(self): with metadata.Metadata(connection_config=self._connection_config) as m: m.publish_artifacts([]) eid = m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info) m.publish_execution(eid, {}, {}) [execution] = m.store.get_executions_by_id([eid]) self.assertProtoEquals( """ id: 1 type_id: 1 properties { key: "state" value { string_value: "complete" } } properties { key: "pipeline_name" value { string_value: "my_pipeline" } } properties { key: "pipeline_root" value { string_value: "/tmp" } } properties { key: "run_id" value { string_value: "my_run_id" } } properties { key: "component_id" value { string_value: "my_component" } }""", execution) def testArtifact(self): with metadata.Metadata(connection_config=self._connection_config) as m: self.assertListEqual([], m.get_all_artifacts()) artifact = standard_artifacts.Examples() artifact.uri = 'uri' m.publish_artifacts([artifact]) [artifact] = m.store.get_artifacts() self.assertProtoEquals( """id: 1 type_id: 1 uri: "uri" properties { key: "split" value { string_value: "" } } properties { key: "state" value { string_value: "published" } } properties { key: "type_name" value { string_value: "ExamplesPath" } }""", artifact) self.assertListEqual([artifact], m.get_all_artifacts()) self.assertListEqual([artifact], m.get_artifacts_by_uri('uri')) self.assertListEqual([artifact], m.get_artifacts_by_type('ExamplesPath')) m.check_artifact_state(artifact, ArtifactState.PUBLISHED) m.update_artifact_state(artifact, ArtifactState.DELETED) m.check_artifact_state(artifact, ArtifactState.DELETED) self.assertRaises(RuntimeError, m.check_artifact_state, artifact, ArtifactState.PUBLISHED) def testExecution(self): with metadata.Metadata(connection_config=self._connection_config) as m: context_id = m.register_run_context_if_not_exists(self._pipeline_info) exec_properties = {'arg_one': 1} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info, run_context_id=context_id) [execution] = m.store.get_executions_by_context(context_id) self.assertProtoEquals( """ id: 1 type_id: 2 properties { key: "state" value { string_value: "new" } } properties { key: "pipeline_name" value { string_value: "my_pipeline" } } properties { key: "pipeline_root" value { string_value: "/tmp" } } properties { key: "run_id" value { string_value: "my_run_id" } } properties { key: "component_id" value { string_value: "my_component" } } properties { key: "arg_one" value { string_value: "1" } }""", execution) input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = standard_artifacts.Examples() input_dict = {'input': [input_artifact]} output_dict = {'output': [output_artifact]} m.publish_execution(eid, input_dict, output_dict) self.assertEqual(ArtifactState.PUBLISHED, output_artifact.state) [execution] = m.store.get_executions_by_id([eid]) self.assertEqual(metadata.EXECUTION_STATE_COMPLETE, execution.properties['state'].string_value) events = m.store.get_events_by_execution_ids([eid]) self.assertEqual(2, len(events)) self.assertEqual(input_artifact.id, events[0].artifact_id) self.assertEqual(metadata_store_pb2.Event.INPUT, events[0].type) self.assertProtoEquals( """ steps { key: "input" } steps { index: 0 }""", events[0].path) self.assertEqual(output_artifact.id, events[1].artifact_id) self.assertEqual(metadata_store_pb2.Event.OUTPUT, events[1].type) self.assertProtoEquals( """ steps { key: "output" } steps { index: 0 }""", events[1].path) def testFetchPreviousResult(self): with metadata.Metadata(connection_config=self._connection_config) as m: exec_properties = {'log_root': 'path'} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info) input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = standard_artifacts.Examples() input_artifacts = {'input': [input_artifact]} output_artifacts = {'output': [output_artifact]} m.publish_execution(eid, input_artifacts, output_artifacts) self.assertEqual( None, m.previous_execution( input_artifacts=input_artifacts, exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info)) self.assertEqual( None, m.previous_execution( input_artifacts={}, exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info)) self.assertEqual( None, m.previous_execution( input_artifacts=input_artifacts, exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=data_types.ComponentInfo( component_id='unique', component_type='a.b.c'))) self.assertEqual( eid, m.previous_execution( input_artifacts=input_artifacts, exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info)) new_output_artifact = standard_artifacts.Examples() self.assertNotEqual(ArtifactState.PUBLISHED, new_output_artifact.state) new_output_dict = {'output': [new_output_artifact]} updated_output_dict = m.fetch_previous_result_artifacts( new_output_dict, eid) previous_artifact = output_artifacts['output'][-1].artifact current_artifact = updated_output_dict['output'][-1].artifact self.assertEqual(ArtifactState.PUBLISHED, current_artifact.properties['state'].string_value) self.assertEqual(previous_artifact.id, current_artifact.id) self.assertEqual(previous_artifact.type_id, current_artifact.type_id) def testGetCachedExecutionIds(self): with metadata.Metadata(connection_config=self._connection_config) as m: mock_store = mock.Mock() mock_store.get_events_by_execution_ids.side_effect = [ [ metadata_store_pb2.Event( artifact_id=1, type=metadata_store_pb2.Event.INPUT) ], [ metadata_store_pb2.Event( artifact_id=1, type=metadata_store_pb2.Event.INPUT), metadata_store_pb2.Event( artifact_id=2, type=metadata_store_pb2.Event.INPUT), metadata_store_pb2.Event( artifact_id=3, type=metadata_store_pb2.Event.INPUT) ], [ metadata_store_pb2.Event( artifact_id=1, type=metadata_store_pb2.Event.INPUT), metadata_store_pb2.Event( artifact_id=2, type=metadata_store_pb2.Event.INPUT), ], ] m._store = mock_store input_one = standard_artifacts.Examples() input_one.id = 1 input_two = standard_artifacts.Examples() input_two.id = 2 input_dict = { 'input_one': [input_one], 'input_two': [input_two], } self.assertEqual(1, m._get_cached_execution_id(input_dict, [3, 2, 1])) def testSearchArtifacts(self): with metadata.Metadata(connection_config=self._connection_config) as m: exec_properties = {'log_root': 'path'} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info) input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = types.Artifact(type_name='MyOutputArtifact') output_artifact.uri = 'my/uri' input_dict = {'input': [input_artifact]} output_dict = {'output': [output_artifact]} m.publish_execution(eid, input_dict, output_dict) [artifact] = m.search_artifacts( artifact_name='output', pipeline_name=self._pipeline_info.pipeline_name, run_id=self._pipeline_info.run_id, producer_component_id=self._component_info.component_id) self.assertEqual(artifact.uri, output_artifact.uri) def testPublishSkippedExecution(self): with metadata.Metadata(connection_config=self._connection_config) as m: exec_properties = {'log_root': 'path'} eid = m.register_execution( exec_properties=exec_properties, pipeline_info=self._pipeline_info, component_info=self._component_info) input_artifact = standard_artifacts.Examples() m.publish_artifacts([input_artifact]) output_artifact = types.Artifact(type_name='MyOutputArtifact') output_artifact.uri = 'my/uri' [published_artifact] = m.publish_artifacts([output_artifact]) output_artifact.artifact = published_artifact input_dict = {'input': [input_artifact]} output_dict = {'output': [output_artifact]} m.publish_execution( eid, input_dict, output_dict, state=metadata.EXECUTION_STATE_CACHED) def testGetExecutionStates(self): with metadata.Metadata(connection_config=self._connection_config) as m: context_id = m.register_run_context_if_not_exists(self._pipeline_info) context_id2 = m.register_run_context_if_not_exists(self._pipeline_info2) self.assertListEqual( [self._pipeline_info.run_id, self._pipeline_info2.run_id], m.get_all_runs('my_pipeline')) eid = m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info, run_context_id=context_id) m.publish_execution(eid, {}, {}) m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info, component_info=self._component_info2, run_context_id=context_id) m.register_execution( exec_properties={}, pipeline_info=self._pipeline_info2, component_info=self._component_info, run_context_id=context_id2) states = m.get_execution_states(self._pipeline_info) self.assertDictEqual( { self._component_info.component_id: metadata.EXECUTION_STATE_COMPLETE, self._component_info2.component_id: metadata.EXECUTION_STATE_NEW, }, states) def testContext(self): with metadata.Metadata(connection_config=self._connection_config) as m: cid1 = m.register_run_context_if_not_exists(self._pipeline_info) cid2 = m.register_run_context_if_not_exists(self._pipeline_info2) cid3 = m.register_run_context_if_not_exists(self._pipeline_info3) context_type = m.store.get_context_type('run') self.assertProtoEquals( """ id: 1 name: 'run' properties { key: "pipeline_name" value: STRING } properties { key: "run_id" value: STRING } """, context_type) [context] = m.store.get_contexts_by_id([cid1]) self.assertProtoEquals( """ id: 1 type_id: 1 name: 'my_pipeline.my_run_id' properties { key: "pipeline_name" value { string_value: "my_pipeline" } } properties { key: "run_id" value { string_value: "my_run_id" } } """, context) self.assertEqual( cid1, m.register_run_context_if_not_exists(self._pipeline_info)) self.assertEqual(cid1, m._get_run_context_id(self._pipeline_info)) self.assertEqual(cid2, m._get_run_context_id(self._pipeline_info2)) self.assertEqual(cid3, m._get_run_context_id(self._pipeline_info3)) self.assertEqual(None, m._get_run_context_id(self._pipeline_info4)) if __name__ == '__main__': tf.test.main()
true
true
1c4576f26d0bd1dafc5d7d1a3c7a8a3a5b06fec8
2,734
py
Python
unsupNFP/train.py
pfnet-research/hierarchical-molecular-learning
2c88a4737c9268e691e97d92bf2e9e2c7e2c1790
[ "MIT" ]
13
2018-06-20T11:16:27.000Z
2020-06-23T18:56:20.000Z
unsupNFP/train.py
pfnet-research/hierarchical-molecular-learning
2c88a4737c9268e691e97d92bf2e9e2c7e2c1790
[ "MIT" ]
null
null
null
unsupNFP/train.py
pfnet-research/hierarchical-molecular-learning
2c88a4737c9268e691e97d92bf2e9e2c7e2c1790
[ "MIT" ]
4
2019-09-14T23:53:44.000Z
2021-12-09T23:36:27.000Z
import argparse from chainer import optimizers from chainer import serializers import numpy as np import model import load_mutag import load_nci1 import classification n_epoch = 200 n_parts = 5 parser = argparse.ArgumentParser() parser.add_argument('dataset', type=str, choices=('mutag', 'ptc')) args = parser.parse_args() if args.dataset == 'mutag': mutag_file_name = "MUTAG.mat" graphs = load_mutag.load_whole_data('MUTAG.mat') MAX_EDGE_TYPE = load_mutag.MAX_EDGE_TYPE MAX_NUMBER_ATOM = load_mutag.MAX_NUMBER_ATOM elif args.dataset == 'ptc': smile_filename = 'corrected_smiles.txt' result_filename = 'corrected_results.txt' graphs = load_nci1.load_ptc(smile_filename, result_filename) MAX_EDGE_TYPE = load_nci1.MAX_EDGE_TYPE MAX_NUMBER_ATOM = load_nci1.MAX_NUMBER_ATOM else: raise ValueError('Invalid dataset type: {}'.format(args.dataset)) model.MAX_EDGE_TYPE = MAX_EDGE_TYPE model.MAX_NUMBER_ATOM = MAX_NUMBER_ATOM indexs_test = np.random.permutation(len(graphs)) n_graphs = len(graphs) print("num of graphs:", n_graphs) rep_dim = 101 max_degree = 5 num_levels = 6 neg_size = 10 batchsize = 100 hid_dim = 100 out_dim = 2 softmax = model.SoftmaxCrossEntropy(rep_dim, MAX_NUMBER_ATOM) print("[CONFIG: representation dim =", rep_dim, "]") atom2vec = model.Atom2vec(MAX_NUMBER_ATOM, rep_dim, max_degree, softmax) model = model.Mol2Vec(len(graphs), rep_dim, max_degree, num_levels, neg_size, atom2vec) optimizer = optimizers.Adam() optimizer.setup(model) print("start training") for epoch in range(1, n_epoch + 1): print("epoch:", epoch) indexes = np.random.permutation(len(graphs)) sum_loss = 0 for i in range(0, n_graphs, batchsize): maxid = min(i + batchsize, n_graphs) ids = indexes[i:maxid] graphids = [] adjs = [] atom_arrays = [] for id in indexes[i:maxid]: graphids.append(graphs[id][0]) # index 1 and 2 need to be changed for MUTAG or NCI1 datasets atom_arrays.append(graphs[id][1]) adjs.append(graphs[id][2]) graphids = np.asarray(graphids) adjs = np.asarray(adjs, dtype=np.float32) atom_arrays = np.asarray(atom_arrays, dtype=np.int32) optimizer.update(model, graphids, adjs, atom_arrays) sum_loss += float(model.loss.data) * len(graphids) print("-----", float(model.loss.data) * len(graphids)) print("loss: ", sum_loss / n_graphs) serializers.save_npz(str(rep_dim) + "_model_ptc.npz", model) # after each epcoh, check result if epoch % 10 == 0: classification.MLPClassifier(model, graphs, indexs_test, rep_dim, batchsize)
29.717391
73
0.685077
import argparse from chainer import optimizers from chainer import serializers import numpy as np import model import load_mutag import load_nci1 import classification n_epoch = 200 n_parts = 5 parser = argparse.ArgumentParser() parser.add_argument('dataset', type=str, choices=('mutag', 'ptc')) args = parser.parse_args() if args.dataset == 'mutag': mutag_file_name = "MUTAG.mat" graphs = load_mutag.load_whole_data('MUTAG.mat') MAX_EDGE_TYPE = load_mutag.MAX_EDGE_TYPE MAX_NUMBER_ATOM = load_mutag.MAX_NUMBER_ATOM elif args.dataset == 'ptc': smile_filename = 'corrected_smiles.txt' result_filename = 'corrected_results.txt' graphs = load_nci1.load_ptc(smile_filename, result_filename) MAX_EDGE_TYPE = load_nci1.MAX_EDGE_TYPE MAX_NUMBER_ATOM = load_nci1.MAX_NUMBER_ATOM else: raise ValueError('Invalid dataset type: {}'.format(args.dataset)) model.MAX_EDGE_TYPE = MAX_EDGE_TYPE model.MAX_NUMBER_ATOM = MAX_NUMBER_ATOM indexs_test = np.random.permutation(len(graphs)) n_graphs = len(graphs) print("num of graphs:", n_graphs) rep_dim = 101 max_degree = 5 num_levels = 6 neg_size = 10 batchsize = 100 hid_dim = 100 out_dim = 2 softmax = model.SoftmaxCrossEntropy(rep_dim, MAX_NUMBER_ATOM) print("[CONFIG: representation dim =", rep_dim, "]") atom2vec = model.Atom2vec(MAX_NUMBER_ATOM, rep_dim, max_degree, softmax) model = model.Mol2Vec(len(graphs), rep_dim, max_degree, num_levels, neg_size, atom2vec) optimizer = optimizers.Adam() optimizer.setup(model) print("start training") for epoch in range(1, n_epoch + 1): print("epoch:", epoch) indexes = np.random.permutation(len(graphs)) sum_loss = 0 for i in range(0, n_graphs, batchsize): maxid = min(i + batchsize, n_graphs) ids = indexes[i:maxid] graphids = [] adjs = [] atom_arrays = [] for id in indexes[i:maxid]: graphids.append(graphs[id][0]) atom_arrays.append(graphs[id][1]) adjs.append(graphs[id][2]) graphids = np.asarray(graphids) adjs = np.asarray(adjs, dtype=np.float32) atom_arrays = np.asarray(atom_arrays, dtype=np.int32) optimizer.update(model, graphids, adjs, atom_arrays) sum_loss += float(model.loss.data) * len(graphids) print("-----", float(model.loss.data) * len(graphids)) print("loss: ", sum_loss / n_graphs) serializers.save_npz(str(rep_dim) + "_model_ptc.npz", model) if epoch % 10 == 0: classification.MLPClassifier(model, graphs, indexs_test, rep_dim, batchsize)
true
true
1c457730cf5448e958549f79c322f8bde85c2542
13,955
py
Python
stumpy/aamp_ostinato.py
alvii147/stumpy
6dacfcf35ce03255951d70e5dd2f8b3f4e20a27f
[ "BSD-3-Clause" ]
2
2022-01-25T22:38:56.000Z
2022-01-31T10:59:02.000Z
stumpy/aamp_ostinato.py
vishalbelsare/stumpy
5f192a0a41fbb44f144cc4b676d525f19aaeaa98
[ "BSD-3-Clause" ]
null
null
null
stumpy/aamp_ostinato.py
vishalbelsare/stumpy
5f192a0a41fbb44f144cc4b676d525f19aaeaa98
[ "BSD-3-Clause" ]
null
null
null
# STUMPY # Copyright 2019 TD Ameritrade. Released under the terms of the 3-Clause BSD license. # STUMPY is a trademark of TD Ameritrade IP Company, Inc. All rights reserved. import numpy as np from . import core, aamp, aamped def _aamp_across_series_nearest_neighbors( Ts, Ts_idx, subseq_idx, m, Ts_squared, Ts_subseq_isfinite ): """ For multiple time series find, per individual time series, the subsequences closest to a given query. Parameters ---------- Ts : list A list of time series for which to find the nearest neighbor subsequences that are closest to the query subsequence `Ts[Ts_idx][subseq_idx : subseq_idx + m]` Ts_idx : int The index of time series in `Ts` which contains the query subsequence subseq_idx : int The subsequence index in the time series `Ts[Ts_idx]` that contains the query subsequence m : int Window size Ts_squared : list A list of rolling window `T_squared` for each time series in `Ts` Ts_subseq_isfinite : list A list of rolling window `T_subseq_isfinite` for each time series in `Ts` Returns ------- nns_radii : numpy.ndarray Radii to subsequences in each time series of `Ts` that are closest to the query subsequence `Ts[Ts_idx][subseq_idx : subseq_idx + m]` nns_subseq_idx : numpy.ndarray Indices to subsequences in each time series of `Ts` that are closest to the query subsequence `Ts[Ts_idx][subseq_idx : subseq_idx + m]` """ k = len(Ts) Q = Ts[Ts_idx][subseq_idx : subseq_idx + m] Q_squared = np.sum(Q * Q) nns_radii = np.zeros(k, dtype=np.float64) nns_subseq_idx = np.zeros(k, dtype=np.int64) for i in range(k): if np.any(~np.isfinite(Q)): # pragma: no cover distance_profile = np.empty(Ts[i].shape[0] - m + 1, dtype=np.float64) distance_profile[:] = np.inf else: QT = core.sliding_dot_product( Ts[Ts_idx][subseq_idx : subseq_idx + m], Ts[i] ) distance_profile = core._mass_absolute(Q_squared, Ts_squared[i], QT) distance_profile[~Ts_subseq_isfinite[i]] = np.inf nns_subseq_idx[i] = np.argmin(distance_profile) nns_radii[i] = distance_profile[nns_subseq_idx[i]] return nns_radii, nns_subseq_idx def _get_aamp_central_motif( Ts, bsf_radius, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ): """ Compare subsequences with the same radius and return the most central motif (i.e., having the smallest average nearest neighbor radii) Parameters ---------- Ts : list A list of time series for which to find the most central motif bsf_radius : float Best-so-far sradius found by a consensus search algorithm bsf_Ts_idx : int The index of time series in `Ts` where the `bsf_radius` was first observed bsf_subseq_idx : int The subsequence index in `Ts[bsf_Ts_idx]` that has radius `bsf_radius` m : int Window size Ts_squared : list A list of rolling window `T_squared` for each time series in `Ts` Ts_subseq_isfinite : list A list of rolling window `T_subseq_isfinite` for each time series in `Ts` Returns ------- bsf_radius : float The updated best-so-far radius of the most central consensus motif bsf_Ts_idx : int The updated index of time series in `Ts` which contains the most central consensus motif bsf_subseq_idx : int The updated subsequence index in the time series `Ts[bsf_Ts_idx]` that contains the most central consensus motif """ bsf_nns_radii, bsf_nns_subseq_idx = _aamp_across_series_nearest_neighbors( Ts, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) bsf_nns_mean_radii = bsf_nns_radii.mean() candidate_nns_Ts_idx = np.flatnonzero(np.isclose(bsf_nns_radii, bsf_radius)) candidate_nns_subseq_idx = bsf_nns_subseq_idx[candidate_nns_Ts_idx] for Ts_idx, subseq_idx in zip(candidate_nns_Ts_idx, candidate_nns_subseq_idx): candidate_nns_radii, _ = _aamp_across_series_nearest_neighbors( Ts, Ts_idx, subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) if ( np.isclose(candidate_nns_radii.max(), bsf_radius) and candidate_nns_radii.mean() < bsf_nns_mean_radii ): bsf_Ts_idx = Ts_idx bsf_subseq_idx = subseq_idx bsf_nns_mean_radii = candidate_nns_radii.mean() return bsf_radius, bsf_Ts_idx, bsf_subseq_idx def _aamp_ostinato( Ts, m, Ts_squared, Ts_subseq_isfinite, dask_client=None, device_id=None, mp_func=aamp, ): """ Find the consensus motif amongst a list of time series Parameters ---------- Ts : list A list of time series for which to find the consensus motif m : int Window size Ts_squared : list A list of rolling window `T_squared` for each time series in `Ts` Ts_subseq_isfinite : list A list of rolling window `T_subseq_isfinite` for each time series in `Ts` dask_client : client, default None A Dask Distributed client that is connected to a Dask scheduler and Dask workers. Setting up a Dask distributed cluster is beyond the scope of this library. Please refer to the Dask Distributed documentation. device_id : int or list, default None The (GPU) device number to use. The default value is `0`. A list of valid device ids (int) may also be provided for parallel GPU-STUMP computation. A list of all valid device ids can be obtained by executing `[device.id for device in numba.cuda.list_devices()]`. mp_func : object, default stump Specify a custom matrix profile function to use for computing matrix profiles Returns ------- bsf_radius : float The (best-so-far) Radius of the consensus motif bsf_Ts_idx : int The time series index in `Ts` which contains the consensus motif bsf_subseq_idx : int The subsequence index within time series `Ts[bsf_Ts_idx]` the contains the consensus motif Notes ----- `DOI: 10.1109/ICDM.2019.00140 \ <https://www.cs.ucr.edu/~eamonn/consensus_Motif_ICDM_Long_version.pdf>`__ See Table 2 The ostinato algorithm proposed in the paper finds the best radius in `Ts`. Intuitively, the radius is the minimum distance of a subsequence to encompass at least one nearest neighbor subsequence from all other time series. The best radius in `Ts` is the minimum radius amongst all radii. Some data sets might contain multiple subsequences which have the same optimal radius. The greedy Ostinato algorithm only finds one of them, which might not be the most central motif. The most central motif amongst the subsequences with the best radius is the one with the smallest mean distance to nearest neighbors in all other time series. To find this central motif it is necessary to search the subsequences with the best radius via `stumpy.ostinato._get_central_motif` """ bsf_radius = np.inf bsf_Ts_idx = 0 bsf_subseq_idx = 0 partial_mp_func = core._get_partial_mp_func( mp_func, dask_client=dask_client, device_id=device_id ) k = len(Ts) for j in range(k): if j < (k - 1): h = j + 1 else: h = 0 mp = partial_mp_func(Ts[j], m, Ts[h], ignore_trivial=False) si = np.argsort(mp[:, 0]) for q in si: Q = Ts[j][q : q + m] Q_squared = np.sum(Q * Q) radius = mp[q, 0] if radius >= bsf_radius: break for i in range(k): if i != j and i != h: if np.any(~np.isfinite(Q)): # pragma: no cover distance_profile = np.empty(Ts[i].shape[0] - m + 1) distance_profile[:] = np.inf else: QT = core.sliding_dot_product(Ts[j][q : q + m], Ts[i]) distance_profile = core._mass_absolute( Q_squared, Ts_squared[i], QT ) distance_profile[~Ts_subseq_isfinite[i]] = np.inf radius = np.max((radius, np.min(distance_profile))) if radius >= bsf_radius: break if radius < bsf_radius: bsf_radius, bsf_Ts_idx, bsf_subseq_idx = radius, j, q return bsf_radius, bsf_Ts_idx, bsf_subseq_idx def aamp_ostinato(Ts, m): """ Find the non-normalized (i.e., without z-normalization) consensus motif of multiple time series This is a wrapper around the vanilla version of the ostinato algorithm which finds the best radius and a helper function that finds the most central conserved motif. Parameters ---------- Ts : list A list of time series for which to find the most central consensus motif m : int Window size Returns ------- central_radius : float Radius of the most central consensus motif central_Ts_idx : int The time series index in `Ts` which contains the most central consensus motif central_subseq_idx : int The subsequence index within time series `Ts[central_motif_Ts_idx]` the contains most central consensus motif Notes ----- `DOI: 10.1109/ICDM.2019.00140 \ <https://www.cs.ucr.edu/~eamonn/consensus_Motif_ICDM_Long_version.pdf>`__ See Table 2 The ostinato algorithm proposed in the paper finds the best radius in `Ts`. Intuitively, the radius is the minimum distance of a subsequence to encompass at least one nearest neighbor subsequence from all other time series. The best radius in `Ts` is the minimum radius amongst all radii. Some data sets might contain multiple subsequences which have the same optimal radius. The greedy Ostinato algorithm only finds one of them, which might not be the most central motif. The most central motif amongst the subsequences with the best radius is the one with the smallest mean distance to nearest neighbors in all other time series. To find this central motif it is necessary to search the subsequences with the best radius via `stumpy.ostinato._get_central_motif` """ Ts_squared = [None] * len(Ts) Ts_subseq_isfinite = [None] * len(Ts) for i, T in enumerate(Ts): Ts[i], Ts_subseq_isfinite[i] = core.preprocess_non_normalized(T, m) Ts_squared[i] = np.sum(core.rolling_window(Ts[i] * Ts[i], m), axis=1) bsf_radius, bsf_Ts_idx, bsf_subseq_idx = _aamp_ostinato( Ts, m, Ts_squared, Ts_subseq_isfinite ) (central_radius, central_Ts_idx, central_subseq_idx,) = _get_aamp_central_motif( Ts, bsf_radius, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) return central_radius, central_Ts_idx, central_subseq_idx def aamp_ostinatoed(dask_client, Ts, m): """ Find the non-normalized (i.e., without z-normalization) consensus motif of multiple time series with a distributed dask cluster This is a wrapper around the vanilla version of the ostinato algorithm which finds the best radius and a helper function that finds the most central conserved motif. Parameters ---------- dask_client : client A Dask Distributed client that is connected to a Dask scheduler and Dask workers. Setting up a Dask distributed cluster is beyond the scope of this library. Please refer to the Dask Distributed documentation. Ts : list A list of time series for which to find the most central consensus motif m : int Window size Returns ------- central_radius : float Radius of the most central consensus motif central_Ts_idx : int The time series index in `Ts` which contains the most central consensus motif central_subseq_idx : int The subsequence index within time series `Ts[central_motif_Ts_idx]` the contains most central consensus motif Notes ----- `DOI: 10.1109/ICDM.2019.00140 \ <https://www.cs.ucr.edu/~eamonn/consensus_Motif_ICDM_Long_version.pdf>`__ See Table 2 The ostinato algorithm proposed in the paper finds the best radius in `Ts`. Intuitively, the radius is the minimum distance of a subsequence to encompass at least one nearest neighbor subsequence from all other time series. The best radius in `Ts` is the minimum radius amongst all radii. Some data sets might contain multiple subsequences which have the same optimal radius. The greedy Ostinato algorithm only finds one of them, which might not be the most central motif. The most central motif amongst the subsequences with the best radius is the one with the smallest mean distance to nearest neighbors in all other time series. To find this central motif it is necessary to search the subsequences with the best radius via `stumpy.ostinato._get_central_motif` """ Ts_squared = [None] * len(Ts) Ts_subseq_isfinite = [None] * len(Ts) for i, T in enumerate(Ts): Ts[i], Ts_subseq_isfinite[i] = core.preprocess_non_normalized(T, m) Ts_squared[i] = np.sum(core.rolling_window(Ts[i] * Ts[i], m), axis=1) bsf_radius, bsf_Ts_idx, bsf_subseq_idx = _aamp_ostinato( Ts, m, Ts_squared, Ts_subseq_isfinite, dask_client=dask_client, mp_func=aamped ) (central_radius, central_Ts_idx, central_subseq_idx,) = _get_aamp_central_motif( Ts, bsf_radius, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) return central_radius, central_Ts_idx, central_subseq_idx
35.874036
88
0.668649
import numpy as np from . import core, aamp, aamped def _aamp_across_series_nearest_neighbors( Ts, Ts_idx, subseq_idx, m, Ts_squared, Ts_subseq_isfinite ): k = len(Ts) Q = Ts[Ts_idx][subseq_idx : subseq_idx + m] Q_squared = np.sum(Q * Q) nns_radii = np.zeros(k, dtype=np.float64) nns_subseq_idx = np.zeros(k, dtype=np.int64) for i in range(k): if np.any(~np.isfinite(Q)): distance_profile = np.empty(Ts[i].shape[0] - m + 1, dtype=np.float64) distance_profile[:] = np.inf else: QT = core.sliding_dot_product( Ts[Ts_idx][subseq_idx : subseq_idx + m], Ts[i] ) distance_profile = core._mass_absolute(Q_squared, Ts_squared[i], QT) distance_profile[~Ts_subseq_isfinite[i]] = np.inf nns_subseq_idx[i] = np.argmin(distance_profile) nns_radii[i] = distance_profile[nns_subseq_idx[i]] return nns_radii, nns_subseq_idx def _get_aamp_central_motif( Ts, bsf_radius, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ): bsf_nns_radii, bsf_nns_subseq_idx = _aamp_across_series_nearest_neighbors( Ts, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) bsf_nns_mean_radii = bsf_nns_radii.mean() candidate_nns_Ts_idx = np.flatnonzero(np.isclose(bsf_nns_radii, bsf_radius)) candidate_nns_subseq_idx = bsf_nns_subseq_idx[candidate_nns_Ts_idx] for Ts_idx, subseq_idx in zip(candidate_nns_Ts_idx, candidate_nns_subseq_idx): candidate_nns_radii, _ = _aamp_across_series_nearest_neighbors( Ts, Ts_idx, subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) if ( np.isclose(candidate_nns_radii.max(), bsf_radius) and candidate_nns_radii.mean() < bsf_nns_mean_radii ): bsf_Ts_idx = Ts_idx bsf_subseq_idx = subseq_idx bsf_nns_mean_radii = candidate_nns_radii.mean() return bsf_radius, bsf_Ts_idx, bsf_subseq_idx def _aamp_ostinato( Ts, m, Ts_squared, Ts_subseq_isfinite, dask_client=None, device_id=None, mp_func=aamp, ): bsf_radius = np.inf bsf_Ts_idx = 0 bsf_subseq_idx = 0 partial_mp_func = core._get_partial_mp_func( mp_func, dask_client=dask_client, device_id=device_id ) k = len(Ts) for j in range(k): if j < (k - 1): h = j + 1 else: h = 0 mp = partial_mp_func(Ts[j], m, Ts[h], ignore_trivial=False) si = np.argsort(mp[:, 0]) for q in si: Q = Ts[j][q : q + m] Q_squared = np.sum(Q * Q) radius = mp[q, 0] if radius >= bsf_radius: break for i in range(k): if i != j and i != h: if np.any(~np.isfinite(Q)): distance_profile = np.empty(Ts[i].shape[0] - m + 1) distance_profile[:] = np.inf else: QT = core.sliding_dot_product(Ts[j][q : q + m], Ts[i]) distance_profile = core._mass_absolute( Q_squared, Ts_squared[i], QT ) distance_profile[~Ts_subseq_isfinite[i]] = np.inf radius = np.max((radius, np.min(distance_profile))) if radius >= bsf_radius: break if radius < bsf_radius: bsf_radius, bsf_Ts_idx, bsf_subseq_idx = radius, j, q return bsf_radius, bsf_Ts_idx, bsf_subseq_idx def aamp_ostinato(Ts, m): Ts_squared = [None] * len(Ts) Ts_subseq_isfinite = [None] * len(Ts) for i, T in enumerate(Ts): Ts[i], Ts_subseq_isfinite[i] = core.preprocess_non_normalized(T, m) Ts_squared[i] = np.sum(core.rolling_window(Ts[i] * Ts[i], m), axis=1) bsf_radius, bsf_Ts_idx, bsf_subseq_idx = _aamp_ostinato( Ts, m, Ts_squared, Ts_subseq_isfinite ) (central_radius, central_Ts_idx, central_subseq_idx,) = _get_aamp_central_motif( Ts, bsf_radius, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) return central_radius, central_Ts_idx, central_subseq_idx def aamp_ostinatoed(dask_client, Ts, m): Ts_squared = [None] * len(Ts) Ts_subseq_isfinite = [None] * len(Ts) for i, T in enumerate(Ts): Ts[i], Ts_subseq_isfinite[i] = core.preprocess_non_normalized(T, m) Ts_squared[i] = np.sum(core.rolling_window(Ts[i] * Ts[i], m), axis=1) bsf_radius, bsf_Ts_idx, bsf_subseq_idx = _aamp_ostinato( Ts, m, Ts_squared, Ts_subseq_isfinite, dask_client=dask_client, mp_func=aamped ) (central_radius, central_Ts_idx, central_subseq_idx,) = _get_aamp_central_motif( Ts, bsf_radius, bsf_Ts_idx, bsf_subseq_idx, m, Ts_squared, Ts_subseq_isfinite ) return central_radius, central_Ts_idx, central_subseq_idx
true
true
1c4577dd8ddebd2c787183b01c730deb2a42ac5d
1,252
py
Python
tests/unit_tests/data/inline_service_integration_test/requester_service.py
ZacharyATanenbaum/service_framework
b5dde4407998350d1b7ad09284110b986fd4e12a
[ "MIT" ]
1
2020-03-20T21:33:56.000Z
2020-03-20T21:33:56.000Z
tests/unit_tests/data/inline_service_integration_test/requester_service.py
ZacharyATanenbaum/service_framework
b5dde4407998350d1b7ad09284110b986fd4e12a
[ "MIT" ]
1
2020-03-22T03:48:45.000Z
2020-03-22T03:48:45.000Z
tests/unit_tests/data/inline_service_integration_test/requester_service.py
ZacharyATanenbaum/service_framework
b5dde4407998350d1b7ad09284110b986fd4e12a
[ "MIT" ]
null
null
null
""" File to house a requester service """ from service_framework.utils.logging_utils import get_logger LOG = get_logger() def setup_config(config): """ Make config arguments the proper type! """ LOG.info('Setting up config!') config['num_req_to_send'] = int(config.get('num_req_to_send', 2)) config['responses_recieved'] = [] return config def main(to_send, config): """ This function is the main entrance into the Requester Service """ for num in range(config['num_req_to_send']): payload = {'to_echo': 'Hello World - ' + str(num)} LOG.info('Sending payload: %s', payload) returned = to_send('request', payload) LOG.info('Got Response: %s', returned) config['responses_recieved'].append(returned) LOG.info('GOT ALL RESPONSES') config_model = { 'required': { 'num_req_to_send': int, }, 'optional': { 'responses_recieved': str, } } connection_models = { 'out': { 'request': { 'connection_type': 'requester', 'required_arguments': { 'to_echo': str, }, 'required_return_arguments': { 'echoed': str, } } } }
22.357143
69
0.572684
from service_framework.utils.logging_utils import get_logger LOG = get_logger() def setup_config(config): LOG.info('Setting up config!') config['num_req_to_send'] = int(config.get('num_req_to_send', 2)) config['responses_recieved'] = [] return config def main(to_send, config): for num in range(config['num_req_to_send']): payload = {'to_echo': 'Hello World - ' + str(num)} LOG.info('Sending payload: %s', payload) returned = to_send('request', payload) LOG.info('Got Response: %s', returned) config['responses_recieved'].append(returned) LOG.info('GOT ALL RESPONSES') config_model = { 'required': { 'num_req_to_send': int, }, 'optional': { 'responses_recieved': str, } } connection_models = { 'out': { 'request': { 'connection_type': 'requester', 'required_arguments': { 'to_echo': str, }, 'required_return_arguments': { 'echoed': str, } } } }
true
true