entry
stringlengths
6
10
entry_name
stringlengths
5
11
protein_name
stringlengths
3
2.44k
sequence
stringlengths
2
35.2k
function
stringlengths
7
11k
B2ZX90
FAS1_ORYSJ
Chromatin assembly factor 1 subunit FSM (CAF-1 subunit FSM) (CAF-1 p150 homolog) (Protein FASCIATA 1 homolog) (Protein FLATTENED SHOOT MERISTEM)
MEGGKLLGVAHPEPANNIDADLRYDLGQSRMQVDGPVVLNRSAELEPSDSMAIDDVPVEASSQPAPAKQSPALMDTIVEVQKQLKRKRASSGPALAAADKDALVAGCCQELEGLLEYYREVSGHRMQFEVGNLSTNAAIGCLLEESSLGLSKLVDEIYEKLKGMEGVSATSVRSSVLLIGQRMMYGQSSPDADVLEDESETALWCWEVRDLKVIPLRMRGPLSTRRTARKKIHERITAIYSTLSVLEAPGAEAQVNDMRKASLKLSKALNLEGIKSLVERATQKSNIERGAKNTGSTAKEPMQEMVKSNNDTGIIENVDDSQLQKNTSTNEKDTQKAQKQVEKELKQKEKEEARMRKQQKKQQEEALREQKRREKEEAEMKKQQRKQEEEAQKEQKRREKEEAETRKQQKKQQEEAEKEQKRREKEAVQLKKQLAIQKQASMMERFFKNKKDSEKLEKPGGKDSGVQTTDPCTTNKEVVPLVTSIIDSSFSQKENWALEDLRRLQISGWQKLSSYNRSSRWGIRNKPKKEAFKELKLQKTSDNMLEEILSPNEDTCHNLSQENEPDKSANDVDMLPAVELQFHGTNHANPLPTRSIKRKLLQFDKSNRPAYYGTWRKKSAVVGPRCPLKMDPDLDYEVDSDDEWEEEDPGESLSDCEKDNDEVMEEDSKITDEESEDSFFVPDGYLSDNEGIQIESLLDDKDEASSSPPDQCAEVEEFRALLRQQKVLNTLTEQALRKSQPLVISNLTHEKAELLTAGDLKGTSKIEQLCLQVLSMRICPGGATIDLPVIDSSSANAEETNQLNVKSSPAAASAIPDTDLAEIVKVIGSCRDGINKLVESLHQKFPNVSKSQLKNKVREISEFVDNRWQVKKEVLSKLGLSSSPASSKKPKSIATYFSKRCLPPEEAILASPELRLKSKTTQNVNGDTDIPRINLLPSSQ
Component of the chromatin assembly factor complex (CAF-1) involved in chromatin assembly following DNA replication and DNA repair. Required for several aspects of development, including apical meristem maintenance by regulating the durations of the S- and G2-phases of the cell cycle through its chromatin assembly activity.
B2ZZS9
WDR55_ORYLA
WD repeat-containing protein 55 (Protein hokecha)
MAAPPEHAATGSEQTDPPETNSEPDLSQPEPADSDADEPVGPKIRETPEDIRLEAIANTVALHPSRDVLVCGDVDGDVYAYAYSCTEGETRELWSSGHHLKSCRQVRFSADGLKLYSVSRDKAVHQLDVERGQLVSRIRGAHAAAINSLLLVDENILATGDDRGTLKVWDMRKGEAFMDLKHHDDYISDIAVDQAKRILLTTSGDGTMGVFNIKRRRFELLSEFQSGDLTSVALMKRGKKVVCGSSEGTVYIFNWNGFGATSDRFAVKAESVDCIVPITDSIMCTASMDGYIRAINLLPNRVIGCIGQHVGEPIEEINKSWDSRFLVSCAHDQLIKFWEISNLQKTTVSDYRKRKKKDGRMKSLTKKALGDNDFFSGLVEETEKKEEEEEEEEDSDSDSD
Nucleolar protein that acts as a modulator of rRNA synthesis. Plays a central role during organogenesis, including thymus development.
B3A003
LYS3_CRAVI
Lysozyme 3 (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase 3) (Invertebrate-type lysozyme 3) (cv-lysozyme 3)
MNGLFLFCVATTAALAYGSDAPCTNSGGVCQDDHLACHNGHYQSGLCTGGAHRRCCLTSASHTGSFSTGIVSQQCLQCICNVESGCKAIGCHFDVNSDSCGYFQIKEGYWHDCGSPGSSWRSCANDLACASKCVQAYMSRYIGFSGCSHSCESYARIHNGGPAGCKHTNTLGYWSHVHAQGCSHNSK
Has antibacterial activity against the Gram-negative bacterium E.coli. No antibacterial activity detected against the Gram-negative bacterium V.vulnificus.
B3A0M2
SLS4_TRYBB
Phosphatidylcholine:ceramide cholinephosphotransferase 4 (TbSLS4) (EC 2.7.8.-) (EC 2.7.8.27) (Ethanolamine-phosphorylceramide synthase) (EPC synthase) (Sphingomyelin synthase) (SM synthase)
MISYPFFSLSPPGLVPPPMAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILAVALQITHERMPDPKVTKPLPDLGFELLTKVPGMYVLADCCIGFLNILSVFTAFKLYLLHRHCVGSGEPELPCNIPGVSRFFLSVWLCKENCRIELRNIHTIAWIRFITSYALLLLFRSAVIVMTSLPAPDDLCQDPPKIENPVKNVILTVLTAGGGSIHCGDLMYSGHTVILTLHLMFHWIYGAMVHWSFRPVVTVVAIFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQLQLFIRWWPCCGANSREVTEDSQPVMVAFKSEELDEMNGVLEGRQKKHGGVGDGESLMFKCGAYV
Bifunctional sphingomyelin (SM)/ethanolamine phosphorylceramide (EPC) synthase with minimal inositol phosphorylceramide (IPC) synthase activity. Specificity is likely to be defined by residues in the lumenal catalytic domain that interact with the polar head groups of the phospholipid donors. SM is synthesized by both stages of the parasite life cycle, bloodstream forms (BSF) and procyclic forms (PCF), by transferring the phosphoryl headgroup from a 1,2-diacyl-sn-glycero-3-phosphocholine to an N-acylsphing-4-enine (ceramide) or an N-acylsphinganine (dihydroceramide) with release of 1,2-diacyl-sn-glycerol. Also catalyzes the reverse reaction, production of ceramide from sphingomyelin. EPC is synthesized by transferring phosphoethanolamine from a 1,2-diacyl-sn-glycero-3-phosphoethanolamine to ceramide or dihydroceramide by BSF and PCF, while IPC is confined to PCF. The ceramide/dihydroceramide ratios are skewed towards dihydroceramide in PCF parasites and ceramide in BSF parasites, this is likely due to differential expression and/or regulation of dihydroceramide desaturase, the enzyme responsible for converting dihydroceramide to ceramide.
B3A0N3
PA2B3_BOTMA
Basic phospholipase A2 Bmaj-9 (svPLA2) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase)
DLWQWGQMILKETGKLPFSYYTAYGCYCGWGGRGGKPKADTDRCCFVHDC
Snake venom phospholipase A2 (PLA2) that causes irreversible neuromuscular blockade in chick biventer cervicis muscle preparations. The neuromuscular blockade is mediated by inhibitory action at the presynaptic motor nerve endings. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. {ECO:0000269|Ref.1}.
B3A0S5
XYNA_FUSO4
Endo-1,4-beta-xylanase A (Xylanase A) (EC 3.2.1.8) (1,4-beta-D-xylan xylanohydrolase A) (Endo-1,4-beta-xylanase GH10 A) (FoXyn10a) (Xylanase III)
AASGLEAAMKAAGKQYFGTALTVRNDQGEIDIINNKNEIGSITPENAMKWEAIQPNRGQFNWGPADQHAAAATSRGYELRCHTLVWHSQLPSWVANGNWNNQTLQAVMRDHINAVMGRYRGKCTHWDVVNEALNEDGTYRDSVFLRVIGEAYIPIAFRMALAADPTTKLYYNDYNLEYGNAKTEGAKRIARLVKSYGLRIDGIGLQAHMTSESTPTQNTPTPSRAKLASVLQGLADLGVDVAYTELDIRMNTPATQQKLQTNADAYARIVGSCMDVKRCVGITVWGISDKYSWVPGTFPGEGSALLWNDNFQKKPSYTSTLNTINRR
Catalyzes the hydrolysis of the internal glycosidic bonds in heteroxylans, releasing mainly xylobiose and xylotriose. Most active on oat-spelt xylan.
B3BM80
CDIA4_ECO5C
Deoxyribonuclease CdiA-o11 (DNase CdiA) (EC 3.1.-.-) (CdiA-o11-EC869) (Toxin CdiA)
MVNATLSVVQKNSAFVGSATGELAARAIGMLYPGVKQSDLSEEQKQTISTLATVSAGLAGGLTGSSTASAAVGAQSGKNAVENNYLSTNQSLTFDKELSDCRKSGGNCQDIIDKWEKISDEQSAEIDQKLKDNPLEAQVIDKEVAKGGYDMTQRPGWLGNIGVEVMTSDEAKAYVQKWNGRDLTKIDVNSPEWTKFAVFASDPENQAMLVSGGLLVKDITKAAISFMSRNTATATVNASEVGMQWGQGNMKQGMPWEDYVGKSLPADARLPKNFKIFDYYDGATKTATSVKSIDTQTMAKLANPNQVYSSIKGNIDAAAKFKEYALSGRELTSSMISNREIQLAIPADTTKTQWAEINRAIEYGKSQGVKVTVTQVK
Toxic component of a toxin-immunity protein module, which functions as a cellular contact-dependent growth inhibition (CDI) system. CDI modules allow bacteria to communicate with and inhibit the growth of closely related neighboring bacteria in a contact-dependent fashion. The C-terminal 289 residues (the CT fragment) has a strong DNase activity in the presence of Zn(2+), completely degrading supercoiled and linear plasmids, and inhibits growth. In the presence of Mg(2+) it nicks dsDNA. Toxic activity is neutralized by coexpression of the cognate immunity protein CdiI-o11-EC869, but not by non-cognate immunity proteins from other toxin-immunity modules or other strains of E.coli. Gains access to the cytoplasm of target cells by using integral inner membrane protein YciB.
B3DH20
DAA11_DANRE
Dynein axonemal assembly factor 11 (DNAAF11) (Leucine-rich repeat-containing 6-like protein) (Leucine-rich repeat-containing protein 6) (Protein tilB homolog) (Seahorse)
MVRISEDLIRRRAEHNNGEIFSLEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVGNPCAEYQGYRQYVVATVPQLQSLDGKEISRAERIQALQELDAVRTRVLQQETKYLEEREKQKSNANEHPEINQSLSESQNGTQQYPESSSKTHTEAEDEEREFWEKPCPFTPESRLEAHRHLEEKRRANEKEKEKPKTKTPRTLITPDGRVLNVNEPKLDFSLFEDENNCLLLDLHVYRHMDSSLLDVDVQPMYVRVTVKGKVFQLVLPAEVKPDSSSAQRSQTTGHLLLILPLANEDVKPKKRTIRPTSVTSNQNNKKDTRAAPRRELLEVDPGLAGSLANIVPKGQESSHNPQRCGLEERPVSKDFVDDPEVPPLM
Plays a crucial role in regulating cilia motility in pronephric tubules, cloaca and neural tube. Required for establishing left-right asymmetry of the body plan controls cell fate and convergent extension (CE) movements during gastrulation, respectively, via the Wnt and the planar cell polarity (PCP) signaling pathways. Required for the proper development of renal glomeruli and tubules.
B3DIV9
KL40A_DANRE
Kelch-like protein 40a (Kelch repeat and BTB domain-containing protein 5a)
MASMSVDPVTEPRMYQQTLLQDGLCDLLDANKFVDCILKIKDKEFPCHRLVLAATSPYFKAMFLSDLEESKKREIVLKDIEPGVMGMILRYIYTSDINLTEQNVQDIFMAANMYQIPSIFSVCVSYLQQKLVLSNCLAIFRLGLLLDCPRLAMEARDFICDRYLLIIRDQDFHQLGPSELAAIITCDSLNVEREESVFESLMDWVEYDTDERTKELPELLHCVRFRLMPTSYFKEKVEGHRLIRTNQELKKELQLIKDAQKGLLHRVKRSSHRKEGKSAEFESDDDDEDGLLPGILNDNPRFGMFQSDLILMINDAGTVAYDVGANECFVASSSTEIPKNHCSLVTKENQIFVVGGLRYNEENKDQPFSSYFLQFDPMSSEWLGMPSLPNPRCLFGLVEAENSIYVVGGKELKEGERALDSVMIYDRQSFKWGESDPLPYAVYGHGIVSHKGLVYVIGGKTESKKCLRRVCVYDPSKFEWKDLAPMKTARSLFGTAVHKNKIYVVTGVTDNGLTSTVEVYDIASNSWSEFVDFPQERSSLNLVELGGFLYAIGGFAMMPNETTEKLEPTEMNDIWKFDEEENCWNGILREIRYAAGATVLGVRLNTLRLTKI
ubstrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex (By similarity). Required for skeletal muscle development.
B3DJT0
SART3_DANRE
Squamous cell carcinoma antigen recognized by T-cells 3 (SART-3)
MAATGNEEQTLLPDIEEEAEGMEREMESEDDEEEGMGVEHSEEEDEEDTSEDERENEAEIQRLEEQLSINAFDYNCHVDLIKLLRQEGKLHRLRKARQKMSELFPLTEEIWLDWLKDEIRITEDESDREKVYELFERAIKDYVCPEIWLEYVQYSIGGMGAQGGIERVRSIFERALTAVGLHMTKGASIWEAYREFEIVILSTVQPPPGTVPSQEQQELLSAQLERIHTLFRRQLAVPLMDMEGTYAEYSDWADDGVPETVTHQYRRALQQMEKGKPYEEALLVSEPPKLAEYQSYIDFEIKEGDPARVQIIFERALAENCLVPDLWIKYTTYLDRQLKIKDLVLSAHERAVRNCPWTMGLWKSYLLALERHGADHQTVKDVFEKALNAGFIQATDYVEIWQSYLDYLRRRVDFSKEWSRELDELRAAFSRSLEYLKQDVEERFSESGDLSCTLMQIWARIEALHCKNMQKARELWDSIMTKGNAKYANMWLEYYNLERSYGDAAHCRKALHRAVQCTSDYPEHVCDVLLNFERVEGSLEDWDAAVQKTETKLNRVCEQRARVAEKEALHARQEEEKAEQRRKVKADKKAQKKGQKANRTGDKRKAEDDDEEEWGEEAELPSKRLRGEDDFDSTVTEELMETESGLFGRRAPPARKTEPPGFRKNQQGAPEPQRQPHDMPKEQRKDENCVFVSNLTFNMEDPEGKLRTLFQGCGTIQQVRPVFTAKGTFRGYCYVQFEDRLAVPEALKMDRQEVDGRPMYVSPCVDKNKNPDFKVFKYKTSMEKHKIFISGLPYSATKETLEDLCKEHGTIRAIRIVTNRSGKSKGLAYVEFEDEAQASQAVLKMDGTMLENFTLSVAISNPPGRRMKDEAAPSRFLGAAMPRQLQGARGKGRTQISLLPRSLYRQSTPDAKAENGTISAPHATVTDGETSLDTQTKSLSNEDFARMLLKK
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation. May also function as a substrate targeting factor for deubiquitinases and mediate the deubiquitination of components of the spliceosome and histones (By similarity).
B3DK56
PTPRU_DANRE
Receptor-type tyrosine-protein phosphatase U (R-PTP-U) (EC 3.1.3.48) (Receptor-type protein-tyrosine phosphatase psi) (R-PTP-psi)
MNTCAFLLILAVQIHADSVEGPTAGCTFDEDSDPSLCEFSQGEEDDFDWQLFRAHASPHSTSDLLRGSYMMVNSSQHAAGQRAQLLLQTLSENDTHCVQFSYFLYSRDGHSPGALRVYVRVNGGPLGIPVWNVSGSRGRQWHQVELAVSTFWPNEYQILLEATVDRKGYIAVDDILLLNYPCYKAPHFSRLGDVEVNAGQNATFQCVAAGRPSEAEKFLLERHNGEVSSGGSVKHLGRNRFAVSFQLEDVQKPEQDLYRCVTQSSRGSGVSNFAELIVKVPPSPIAPPQLLRAGSTYLIIQLNTNSILGDGPIIRREIEYRASLAPWSEILGVNMVTYKLWHLDPDTEYHISVLLTRPGEGGTGPPGPPLISRTKCAEPMRALRGLRASEIQSRQLTLQWEVPAFNLTRCHTYSVSLCYRYTTAGGGGGHNTTVRECLAVEHNTSRFTLRDLPPFHTIQIRLALANTEGKKEGKEVMFQTEEDIPGGIAPESLTFTPLEDMIFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPGPRRTVSKLKNETYHMFSNLHPGTTYLISVRARTAKGFGQTALTEITTNISAPTFDYGDMPSPLSETENTITVLLRPAQGRGAPVSTYQVVVEEEAGRKVKRELGIQDCFPIPTSHGEAQARGAPHYYTAELPPSSLSEATPFTVGDNHTYNGYWNSPLDPRKNYLVYFQAMSNFRGETRINCIRIARKAACKDHQRALEVTQRSEEMGLILGVCAGGLVVLILLLGAIIIIIKKGRDYYSYSYYPRKPGNMNKTPITYRQEKSNMMGSMERSFTDQSTLQEDERMALSFMDTHTCSTRSDPRSSMNESSSLLGGSPRRQCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFDGWDINKKKDKTKGRHDTLMGYDRHRVKLHPLLGDPNSDYINANYIDGYHRSNHFIATQGPKQETVYDFWRMVWQENCFSIVMITKLVEVGRVKCCKYWPDESEMYGDIKITLLKTETLAEYTVRTFALERRGYSAKHEVCQFHFTSWPEHGVPYHATGLLAFIRRVKTSTPLDAGPVVVHCSVGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYIFIHDAILEACLCGETAIPVNEFALAYKEMLRVDSQSNSSQLREEFQTLNSVTPHLDVEECSIALLPRNREKNRSMDVLPPDRALAFLVTTEGESNNYINAALMDSFHRPAAFIVTPHPLPGTTSDFWRLVFDYGCTSVVMLNQLNQSNSAWPCVQYWPEPGLQQYGPMQVEFLSMSADEDIITRLFRVKNVTRLQEGQLVVCQFQFLRWSAYRDVPDSKKAFLNLLASVQKWQRECGEGRTVVHCLNGGGRSGTYCASNILMEMIQYQNIVDVFYAVKTLRNAKPNMVETLEQYRFCYELVLEYLDCLEVR
Tyrosine-protein phosphatase which dephosphorylates CTNNB1. May function in cell proliferation and migration and play a role in the maintenance of epithelial integrity. Functions in somitogenesis. Functions as a regulator of the biochemical clock responsible for the segmentation of the presomitic mesoderm.
B3DLB3
ANM2_XENTR
Protein arginine N-methyltransferase 2 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT2)
MSTSGCSSEKSDFQDSTEGEEEEDTQSENLCMREYVVIRDYMAADATQLSLCFGDKVLLLSAVTQDWWWVKHNGICGYVPASYLHDALNDQEDTEVDDPWQDEEYYGSYKTLKLHLEMLSDVPRTTAYKEVILRNSSSLCGKHILDLGCGTGIISFFCAKLAQPEAVYAVEASEIAEQTRRLVKQNGISNLVHVIRQRAEELQLPTKVDILVSEWMGTCLLFEFMLESVLQARDRWLKEDGVMWPSTACIHLVPCSASKEYANKVLFWDNPYQLDFSLLKPLAAKEFFARPKPDYVLQPEDCLSEPCILLHLNLKTLQLAELERMNSDFTFFVHTDGLLHGFTAWFSVQFQNLEEQGQLELNTGPFSPLTHWKHTLFMLDEPLQVQKGDKISGSVVFQRNSVWRRHMSVTLSWVINGKLTMQNVSQQWQAILA
Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as histones. Involved in growth regulation. Involved in embryonic dorsal development.
B3DMA2
ACD11_RAT
Acyl-CoA dehydrogenase family member 11 (ACAD-11) (EC 1.3.8.-)
MEMDVTRDTVEVLPQHKFDIRSLEAYLNQHLPGFGSDHRAVLTVTQYRSGQSNPTFFLQKGSQAYVLRKKPPGSLLPKAHKIDREFKVQKALFSVGFPVPKPLLYCSNASIIGTEFYVMEHVQGRIFRDFSIPGVSPAERAAIYVSLVETLAWLHSLDIHSLGLDRYGTGVGYCKRQVSTWTKQYQASAHQSIPAMDQLSTWLMRNLPDSDNEECLVHGDFKLDNIVFHPKECRVIAVLDWELSTFGHPLSDLAHLSLFYFWPRTLPMINRGSHIQENTGIPLMEELISIYCRRRGIDPNLPNWNFFMALSFFKLAGIAQGVYSRYLMGNNSSEDSFLTANTVQPLAETGLQLSRRTLSTVPPQADAKSRLFAQSRRGQEVLTRVKQFMKQHVFPAEKEVAEYYAQNGNSAEKWEHPLVIEKLKEMAKAEGLWNLFLPAVSGLSQVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLHLYGSEQQKQQWLEPLLRGDITSVFCMTEPNVSSSDATNMECSIQRDGGSYIVHGKKWWSSGAGNPKCKIAVVLGRTESPSVSRHKVHSMILVPMDTPGVELIRPLSVFGYMDNVHGGHWEVHFNHVRVPASNLILGEGRGFEISQGRLGPGRIHHCMRSVGLAERILQIMCDRAVQREAFGKKLYEHEVVAHWIAKSRIAIEEIRLLTLKAAHSIDTLGSAAARKEIAMIKVAAPKAVCKIADRAIQVHGGAGVSQDYPLANMYAIIRTLRLADGPDEVHLSAIAKMELQDQARQLKARM
Acyl-CoA dehydrogenase, that exhibits maximal activity towards saturated C22-CoA. Probably participates in beta-oxydation and energy production but could also play a role in the metabolism of specific fatty acids to control fatty acids composition of cellular lipids in brain.
B3DNN5
CDC16_ARATH
Anaphase-promoting complex subunit 6 (Cell division cycle protein 16 homolog) (CDC16 homolog) (Cyclosome subunit 6) (Protein NOMEGA)
MREEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFHLLNASKIVLRDLRFRYLAAKCLEELKEWDQCLLMLGDAKVDDDGIVYDAKDGNVIDFDKDGEDREINISSAICFLRGKAYGALQNRSQARQWYKAAIKADPLCYEALECLIESHMLTSEEESSLLSSLQFSPEDGWLSSFYSCLIKKYDKESTVELKFKKLENETSGSVSGSSMITLANNTDLLACKAEYYHQCCEYQKCFELTAALLEKDPFHLKCTLVHLAAAMELGNSNELYLMACNLVKDYPSKALSWFAVGCYYYCIKKYAEARRYFSKATGIDGSFSPARIGYGNSFAAQEEGDQAMSAYRTAARLFPGCHLPTLYIGMEYMRTHSYKLADQFFMQAKAICPSDPLVYNELGVVAYHMKEYGKAVRWFEKTLAHIPSALTESWEPTVVNLAHAYRKLRKDREAISYYERALTLSTKSLSTYSGLAYTYHLQGNFSAAISYYHKALWLKPDDQFCTEMLNVALMDECQNGVDSKVELC
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication.
B3EWF4
LTX2A_LACTA
Latartoxin-2a (LtTx-2a)
MKVLVIIALCLVAFQSALSKKIENFESYIEDLKSEARECIPLYNDCTAFKYNNNCCKDPEKKYQYKCSCIVCKEGKEQCTCQRKETVESMMKCVRFVKKVGEKVIEKVG
Insect toxin. Causes paralysis in larvae of C.vicina by depolarizing membranes at the neuromuscular junction.
B3EWF5
LTX2B_LACTA
Latartoxin-2b (LtTx-2b)
MKVLVIIALCFFILQTALSEDKYESFESYVEDLKSGNMKGEARECIPLYNDCKEFKYNNNCCKDPEKKYQYKCSCIMCEGGEEQCTCQRKETVENMMKCVRFVKKVVEKVG
Insect toxin.
B3EWF6
LTX2C_LACTA
Latartoxin-2c (LtTx-2c)
MKVLVITALCFILLQNVLGEDTYEDLQNYIENLINENQDEARECVPLENDCTKLKYSNPCCKDEKKKYQYKCSCIVDKTEQCTCQRKETVEKMMKGMKYIKNLGKKIG
Insect toxin.
B3EWF8
3SX1_MICMP
Mipartoxin-1 (Mipartoxin-I) (Three-finger toxin) (3FTx)
MKTLLLTLVVVTIVCLDLGNSLKCYVSREGKTQTCPEGEKLCEKYAVSYFHDGRWRYRYECTSACHRGPYNVCCSTDLCNK
Snake venom neurotoxin that blocks neuromuscular transmission on both avian and mouse nerve-muscle preparations, presenting a postsynaptic action through the nicotinic acetylcholine receptor (nAChR). Reversibly inhibits twitches in mouse phrenic nerve diaphragm and irreversibly in chick biventer cervicis muscle. Has no cytotoxic activity towards C2C12 cells up to 180 ug/ml.
B3EWH0
TXPR2_ALOMR
Purotoxin-2 (PT2)
AKACTPLLHDCSHDRHSCCRGDMFKYVCDCFYPEGEDKTEVCSCQQPKSHKIAEKIIDKAKTTL
Enhances the high-affinity desensitization of human P2RX3 purinoceptors. At 50 nM, the toxin decreases the IC(50) for ambient ATP from 2.67 nM to 0.77 nM in human P2RX3.
B3EWH2
AON_AZEFE
Azemiopsin
DNWWPKPPHQGPRPPRPRPKP
In vitro, reversibly blocks human muscle-type nicotinic acetylcholine receptors (nAChR) alpha-1-beta-1-epsilon-delta/CHRNA1-CHRNB1-CHRNE-CHRND (EC(50)=0.44 uM) and alpha-1-beta-1-gamma-delta/CHRNA1-CHRNB1-CHRNG-CHRND (EC(50)=1.56 uM). Binds to nAChR from T.californica (IC(50)=0.03-0.18 uM), human neuronal nAChR alpha-7/CHRNA7 (IC(50)=22 uM) and acetylcholine-binding proteins (AChBP) from L.stagnalis (IC(50)=63 uM) and A.californica (IC(50)=230 uM).
B3EWP6
PA2_LACMR
Phospholipase A2 (Lmr-PLA2) (EC 3.1.1.4) (Phosphatidylcholine 2-acylhydrolase)
HLLQFGDLINKIARRNGILYYSFYGCYCGLGGRGRPQDATDRCCFVHDCCYGKVTGCDPK
Snake venom phospholipase A2 (PLA2) that displays mild but significant inhibition of mouse platelet aggregation induced by ADP and collagen. Induces edema in the foot pads and gastrocnemius muscles of mice but shows no myonecrotic or myotoxic activity. PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
B3EWR1
LEC1_MYTGA
Alpha-D-galactose-binding lectin (Galactose-binding lectin) (Lectin) (MytiLec) (MytiLec-1) (R-type lectin)
MTFAKQSCFNSIILLSIATSYFKIGHKISELGNRIEKMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYVHPKGGSTNPPNETLTVMHGDKHGAMEFIFVSPKNKDKRVLVYV
Alpha-D-galactose-binding lectin. Binds D-GalNAc, but not glucose or its derivatives. Has hemagglutinating activity towards rabbit erythrocytes. Agglutinates bacteria. Has bacteriostatic activity on both Gram-positive and Gram-negative bacteria including B.subtilis, S.aureus, E.coli and V.parahaemolyticus, respectively. Has a dose-dependent cytotoxic effect on the human globotriaosylceramide (Gb3)-expressing Epstein-Barr virus (EBV)-positive Burkitt's lymphoma (Raji) cell line. Has dose-dependent cytotoxic effect on another Burkitt's lymphoma (Ramos) cell line, which does not possess the EBV genome, but also expresses Gb3. Binds to Gb3 in these cells leading to phosphorylation of MEK1/2, ERK1/2, JNK and p38 kinase, activation of caspase-9/3 and to expression of p21 and tumor necrosis factor (TNF)-alpha. No cytotoxic effect on the human chronic myelogenous leukemia (K-562) cell line, which does not express Gb3. May be involved in innate immunity acting as an antibacterial or antifungal agent. May be a pattern recognition receptor (PRR) involved in recognition of glycans found on parasitic or symbiotic microorganisms.
B3EWR6
AMP_ECHCG
Antimicrobial peptides [Cleaved into: Antimicrobial peptide 1 (EcAMP1); Antimicrobial peptide 3 (EcAMP3); Antimicrobial peptide 2 (EcAMP2); Antimicrobial peptide 2.1 (EcAMP2.1)]
MGKGSSGGGAWWAFLLLAGVLLAVAATAAGAEEDVATEVAAAADRDPKEDLRWCRKGCQWQYGQDTRQRKECERDCRQRHREQEQDADEEDGSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGDDDVAVDACEGADRCRERCERRHRGDWQGKQRCLMECRRREQEEDVDDRCPCPCRRQCERHGDPATRQRCVEACQRRREEERRHGGGDADEEGSRGGRCERKCRRHSDWQTRQRCLQQCEQRERQEEGGRDDAGDGKDTYCADRCQSMCRQRHRGDREMQRRCARKCEREEGCPRRRDATADADEAEEDDGNDRCSQQCQHHRDPDRKQQCMRECRRHQGRSDDDDTRAGEDDS
[Antimicrobial peptide 1]: Has antifungal activity. Inhibits spore germination of F.graminearum (EC(50)=4.5 uM), F.oxysporum (EC(50)=8.5 uM), F.solani (EC(50)=4.0 uM), F.verticillioides (EC(50)=8.1 uM), P.infestans (EC(50)=16.3 uM), P.betae (EC(50)=6.0 uM), P.debaryanum (EC(50)=12.0 uM), P.ultimatum (EC(50)=14.4 uM), B.sorokiniana (EC(50)=18.2 uM), A.alternata (EC(50)=16.0 uM) and A.solani (EC(50)=14.0 uM). Does not destroy spores but rather inhibits hyphal growth during germination. Does not affect spore germination in A.niger, C.graminicola, D.maydis and T.album. Does not inhibit trypsin. [Antimicrobial peptide 2]: Inhibits spore germination of P.infestans with an IC(50) of 24 uM. EcAMP2 has no activity against F.graminearum, F.oxysporum, B.sorokiniana and A.niger at concentration up to 32 uM. Has no antibacterial activity. [Antimicrobial peptide 2.1]: Inhibit spore germination of P.infestans with an IC(50) of 24 uM. EcAMP2 has no activity against F.graminearum, F.oxysporum, B.sorokiniana and A.niger at concentration up to 32 uM. Has no antibacterial activity. [Antimicrobial peptide 3]: Has antifungal activity. Inhibits spore germination of F.graminearum (IC(50)=5.5 uM), F.oxysporum (IC(50)=9.6 uM), B.sorokiniana (IC(50)=15.0 uM) and A.niger (IC(50)=22.4 uM). Has antibacterial activity. Inhibits P.syringae (MIC=4.5 uM), C.michiganensis (MIC=2.1 uM) and E.carotovora (MIC=9.8 uM). Does not inhibit trypsin.
B3EX61
PI4KB_SORAR
Phosphatidylinositol 4-kinase beta (PI4K-beta) (PI4Kbeta) (PtdIns 4-kinase beta) (EC 2.7.1.67)
MGDTAVEPAPLKPASEPAPGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVRLLHGAVAVSKRGTALELVNGDGVDTEIRCLDDPPAQIREEEDEMGATVTSGTAKGARRRRQNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLLNMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLILSDELKPAHRKRELPSLSPALNTGLSPSKRTHQRSKSDATASISLSSSLKRTASNPKVENEDEPIRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLNHKLPARVWLPTAAFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTNVPARIPENRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEMHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFRRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMNMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation (By similarity). Involved in Golgi-to-plasma membrane trafficking (By similarity). May play an important role in the inner ear development.
B3EY95
SCACT_ACEAC
Succinyl-CoA:acetate CoA-transferase (EC 2.8.3.18) (Succinyl-coenzyme A (CoA):acetate CoA-transferase) (SCACT)
MTERIRNVALRSKVCPAETASELIKHGDVVGTSGFTGAGYPKEVPKALAQRMEAAHDRGEKYQISLITGASTGPQLDGELAKANGVYFRSPFNTDATMRNRINAGETEYFDNHLGQVAGRAVQGNYGKFNIALVEATAITEDGGIVPTSSVGNSQTFLNLAEKVIIEVNEWQNPMLEGIHDIWDGNVSGVPTRDIVPIVRADQRVGGPVLRVNPDKIAAIVRTNDRDRNAPFAAPDETAKAIAGYLLDFFGHEVKQNRLPPSLLPLQSGVGNVANAVLEGLKEGPFENLVGYSEVIQDGMLAMLDSGRMRIASASSFSLSPEAAEEINNRMDFFRSKIILRQQDVSNSPGIIRRLGCIAMNGMIEADIYGNVNSTRVMGSKMMNGIGGSGDFARSSYLSIFLSPSTAKGGKISAIVPMAAHVDHIMQDAQIFVTEQGLADLRGLSPVQRAREIISKCAHPDYRPMLQDYFDRALKNSFGKHTPHLLTEALSWHQRFIDTGTMLPS
Utilizes succinyl-CoA to convert toxic acetate to acetyl-CoA and succinate. Required for growth on acetic acid and for resistance to high levels of acetic acid. Has also low activity with acetoacetate as substrate.
B3FK34
PHUZ_BP201
Phage tubulin-like protein (PhuZ) (EC 3.6.5.-) (Phage tubulin/FtsZ) (Tubulin-like protein TubZ)
MPVKVCLIFAGGTGMNVATKLVDLGEAVHCFDTCDKNVVDVHRSVNVTLTKGTRGAGGNRKVILPLVRPQIPALMDTIPEADFYIVCYSLGGGSGSVLGPLITGQLADRKASFVSFVVGAMESTDNLGNDIDTMKTLEAIAVNKHLPIVVNYVPNTQGRSYESINDEIAEKIRKVVLLVNQNHGRLDVHDVANWVRFTDKHNYLIPQVCELHIETTRKDAENVPEAISQLSLYLDPSKEVAFGTPIYRKVGIMKVDDLDVTDDQIHFVINSVGVVEIMKTITDSKLEMTRQQSKFTQRNPIIDADDNVDEDGMVV
A tubulin-like GTPase that forms filaments, which are required for positioning viral DNA and capsids in the middle of the host cell for optimal replication. The motor component of a partition system which pushes phage DNA (encased by protein gp105) to the center of the bacterial host cell. Also required for movement of phage capsids to the vicinity of the viral DNA and rotation of the encased viral DNA at midcell. Forms filaments during the lytic phase, which position phage DNA at the center of the bacterial host cell. Filaments have a three-stranded intertwined achitecture and form a spindle-like cytoskeleton within the infected cell. Has GTPase activity. Filaments grow at the plus end and depolymerize at the minus end, a process called treadmilling, and switch from growing in a polar manner to catastrophic depolymerization, i.e. they display dynamic instability, like tubulin. In infected host cells the filament ends close to the cell pole are relatively stable, while the other end near the phage DNA is highly dynamic. Both capsid movement and DNA rotation probably require treadmilling (Probable).
B3G515
GPER1_DANRE
G-protein coupled estrogen receptor 1 (G protein-coupled estrogen receptor 1) (G-protein coupled receptor 30)
MEEQTTNVIQIYVNGTEQFNASFDFNITDVKESTDTYEFYIIGLFLSCLYTIFLFPIGFIGNILILVVNLNHRERMTIPDLYFVNLAVADLILVADSLIEVFNLNEKYYDYAVLCTFMSLFLQVNMYSSIFFLTWMSFDRYVALTSSMSSSPLRTMQHAKLSCSLIWMASILATLLPFTIVQTQHTGEVHFCFANVFEIQWLEVTIGFLIPFSIIGLCYSLIVRTLMRAQKHKGLWPRRQKALRMIVVVVLVFFICWLPENVFISIQLLQGTADPSKRTDTTLWHDYPLTGHIVNLAAFSNSCLNPIIYSFLGETFRDKLRLFIKRKASWSVVYRFCNHTLDLQIPVRSESEV
Membrane G-protein coupled estrogen receptor that binds to 17-beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Plays a role in the embryonic development of sensory and motor neurons. Specifically induces apoptosis and reduces proliferation of brain cells. Involved in maintenance of meiotic arrest in oocytes.
B3GNI6
SEP11_RAT
Septin-11
MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNPWLCTE
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the cytoarchitecture of neurons, including dendritic arborization and dendritic spines, and in GABAergic synaptic connectivity.
B3GS44
LRE_ARATH
GPI-anchored protein LORELEI
MELILLFFFLMALLVSLSSSSSISDGVFESQTSVSGRNLRHAKKKCEVNFEYMDYKVLTKRCKGPAFPAKECCSAFKEFACPYVSQINDMNSDCAQTMFSYMNIYGNYPTGLFANECRERKDGLVCPLPPLYSHNLNASTADSTPRFISLLISAATAVFALLVLT
Female gametophyte-specific component of the signaling pathway required for fertilization. Required for reception of the pollen tube by the female gametophyte. Acts specifically at the synergid cell surface for pollen tube reception. Plays a role in double fertilization and early seed development. Component of the FER-regulated Rho GTPase signaling complex. Acts as a chaperone and coreceptor for FER. Required for localization of FER to the plasma membrane.
B3GSH5
ASMT_RAT
Acetylserotonin O-methyltransferase (EC 2.1.1.4) (Hydroxyindole O-methyltransferase)
MAPGREGELDRDFRVLMSLAHGFMVSQVLFAALDLGIFDLAAQGPVAAEAVAQTGGWSPRGTQLLMDACTRLGLLRGAGDGSYTNSALSSTFLVSGSPQSQRCMLLYLAGTTYGCWAHLAAGVREGRNQYSRAVGISAEDPFSAIYRSEPERLLFMRGLQETWSLCGGRVLTAFDLSRFRVICDLGGGSGALAQEAARLYPGSSVCVFDLPDVIAAARTHFLSPGARPSVRFVAGDFFRSRLPRADLFILARVLHDWADGACVELLGRLHRACRPGGALLLVEAVLAKGGAGPLRSLLLSLNMMLQAEGWERQASDYRNLATRAGFPRLQLRRPGGPYHAMLARRGPRPGIITGVGSNTTGTGSFVTGIRRDVPGARSDAAGTGSGTGNTGSGIMLQGETLESEVSAPQAGSDVGGAGNEPRSGTLKQGDWK
Catalyzes the transfer of a methyl group onto N-acetylserotonin, producing melatonin (N-acetyl-5-methoxytryptamine).
B3H4Y2
STMP3_ARATH
Secreted transmembrane peptide 3 (Phytocytokine STMP3) (Precursor of secreted transmembrane peptide 3)
MGLKMSSNALLLSLFLLLLCLFSEIGGSETTHWKIVEEPVRGQIATPPSLTCGGQRLGGPQPRLSPCPRPRPRPRPRTGS
Brassicaceae-specific phytocytokine (plant endogenous peptide released into the apoplast) perceived by MIK2 in a BAK1/SERK3 and SERK4 coreceptors-dependent manner, that modulates various physiological and antimicrobial processes including growth prevention and reactive oxygen species (ROS) response regulation.
B3H5A9
PCEP6_ARATH
Precursor of CEP6 (PCEP6) [Cleaved into: C-terminally encoded peptide 6.1 (CEP6.1) (CEP6a); C-terminally encoded peptide 6.2 (CEP6.2) (CEP6b)]
MKLSVYIILSILFISTVFYEIQFTEARQLRKTDDQDHDDHHFTVGYTDDFGPTSPGNSPGIGHKMKENEENAGGYKDDFEPTTPGHSPGVGHAVKNNEPNA
Extracellular signaling peptide that represses primary root growth rate. Modulates leaf morphology. Regulates systemic nitrogen (N)-demand signaling. Mediates up-regulation of genes involved in N uptake and assimilation pathways.
B3H5J1
GLV10_ARATH
Protein GOLVEN 10 (CLAVATA3/ESR (CLE)-related protein CLEL7) (CLE-Like protein 7) (Root meristem growth factor 5) (AtRGF5) [Cleaved into: GLV10p]
MSSIHVASMILLLFLFLHHSDSRHLDNVHITASRFSLVKDQNVVSSSTSKEPVKVSRFVPGPLKHHHRRPPLLFADYPKPSTRPPRHN
[GLV10p]: Signaling peptide (root growth factor) that maintains the postembryonic root stem cell niche. Regulates the pattern of root growth and lateral root development by modulating the length and the number of cortical cells in the root apical meristem (RAM), and the anticlinal asymmetric cell divisions in lateral root initiation cells.
B3H5K9
NEDD1_ARATH
Protein NEDD1 (Neural precursor cell expressed developmentally down-regulated protein 1 homolog) (Protein GCP-WD)
MMSNLVEPSWRLLAASGGDTVKLFDVSADSGDPCVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVPVTGKDGGDSAEECLSAISFSKKGSRYICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQVLRLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCIAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTSEMALLGSTVEDSVVIPDPLPSTTPSASQSAMAPGSRGVSASTVNASSVEQTPNRNHLWPSGPLGRLHALRANDSYNDDMGVFSPIIDVSSVEKWADSEGYNNKDHLVVDNKPSSLLFPSSSKGYSFGDNGSKEHPIFDWKPSSTSKQDDPRAAFSSFGSITPTASSKSEDSALTPPEAWGGDKFSEKFNQLANEKFSDKFSHLHAPSRLAVSSTGASTSGSMFSSSRDFPLSHGQTNFANASLEFPRIRDFSSTFETSSTQTDNNLPSSPLFTKGITAPGNIDSLRLSPNFTRRFSTYAERISTTSSFSDGASLSLGGSPKIKKTGSETREEVLNHLLARPETVVATEAGAMPLMNQGGLKQSQTDQQQVMGSSNFTLQLFQRTLEGTLDSFQNSIHDDVRNLHIEILRQFHMHEMEMSKVLSSILENQAEQMKELKLLRKENQELRQRL
Regulates microtubules organization in a centrosome-independent manner. Required for the spindle to be positioned correctly and for the function of gamma-tubulin in organizing phragmoplast microtubules. Component of active gamma-tubulin ring complexes (gamma-TuRCs) associated with cortical microtubules in interphase cells. Mediates gamma-TuRC recruitment to the nucleation sites and is important for determining the ratio of branched to parallel nucleation. May mediate the localization of GCP2 and GCP3 to the nuclear envelope.
B3H5Q2
GLV8_ARATH
Protein GOLVEN 8 (CLAVATA3/ESR (CLE)-related protein CLEL5) (CLE-Like protein 5) [Cleaved into: GLV8p]
MKKWSYAKLMTSALLLVFLSIILLAFHGGSRGDNHLYDHVAIGTKDILMGRKLKDLKPKTESLKMINPKKKNGFEYSDQVSSDLSRQEVFVDMMARDYQGPKPRSKPLKNN
[GLV8p]: Signaling peptide (root growth factor) that promotes root hairs formation and growth. Regulates the pattern of root growth and lateral root development by modulating the length and the number of cortical cells in the root apical meristem (RAM), and the anticlinal asymmetric cell divisions in lateral root initiation cells (By similarity).
B3H754
APD3_ARATH
E3 ubiquitin-protein ligase APD3 (EC 2.3.2.27) (Protein ABERRANT POLLEN DEVELOPMENT 3)
MGSIRGDLQPLFVMPPPPLDEDCDDIFNSDESSWGLLSLSCFGIIMGLWFFASVCLIFGVYGSETVWLGPNSSILVKPSSIFVKSIKVKELDFSKPGLQLYGFNGQSTPSGYFVNWTESRVLSVSQNSYKGWPYYLNRGTHMNISYNILPKGSAVRLVITEGSQVIGMPFFYRSSLKDIAFRDTAWSWNLIQGSGMIQLDISKSKGYYLTVANLKRKDIEVELDIDVKAVLYDTKQTSYNCSFSNGECSFKMNERYPVENYAVVTSPALGQGVSIDDEWYIELSYQPRLIAYGSFTGVLLSFMLVAIHFCNKLKCCGGEGFLSGDDSVRTCLLADKGDNDCCNDVEASNKSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKMIHVKRIYTA
Involved in pollen mitosis II (PMII) regulation during male gametogenesis.
B3H7A9
PXG7_ARATH
Probable peroxygenase 7 (AtPXG7) (EC 1.11.2.3) (Caleosin-7)
MSHQTVALASKAKSPKPKRGKLDKEKMTALEKHVSFFDRNKDGTVYPWETYQGFRALGTGRLLAAFVAIFINMGLSKKTRPGKGFSPLFPIDVKNSHLCMHGSDTDVYDDDGRFVESKFEEIFNKHARTHKDALTAEEIQKMLKTNRDPFDITGWLSDYGEWKILHTLAQDKNGLLSEKSVRAIYDGSLFHQLEKKRSSSSSRGKKQKLP
Probable calcium-binding peroxygenase. May be involved in pollination.
B3H7I1
SOP12_ARATH
Serine rich endogenous peptide 12 (AtSCOOP12) (Phytocytokine SCOOP12) (Precursor of serine rich endogenous peptide phytocytokine 12)
MRNTISSKMGQVLIVLLLLCTVLCRTESALPSGQHSVLLTGRRLMGSGASGPVRSSQSSQAGGRFNDADPIAIDYGKY
Brassicaceae-specific phytocytokine (plant endogenous peptide released into the apoplast) perceived by MIK2 in a BAK1/SERK3 and SERK4 coreceptors-dependent manner, that modulates various physiological and antimicrobial processes including root growth prevention, phospholipid signaling pathway activation (e.g. accumulation of phosphatidic acid (PA), but transient reduction of phosphatidylinositol 4,5-bisphosphate (PIP(2)) levels) and reactive oxygen species (ROS) response regulation. Moderates primary root growth, and regulates root meristems and cell elongation this root growth regulation is associated with the modulation of ROS metabolism and alteration of cell wall structure, and depends on variations in many genes expression. Promotes ROS (e.g. superoxide anion O(2) and hydrogen peroxide H(2)O(2)) production and MAPK (e.g. MPK3, MPK4 and MPK6) activation in a MIK2-dependent manner, thus leading to the up-regulation of immune-related marker genes (e.g. WRKY30, WRKY33 and CYP81F2). Involved in biotic and oxidative stress responses acts as a negative regulator of defense against necrotrophic pathogens such as the bacteria Erwinia amylovora and the fungus Alternaria brassicicola. Able to prime defense responses against the pathogenic bacteria Pseudomonas syringae pv. tomato DC3000. Contributes to the triggering of defense responses toward generalist herbivores such as Spodoptera littoralis, probably via the activation of jasmonate and indole glucosinolate biosynthesis. Triggers the expression of several PROSCOOP genes (e.g. PROSCOOP3, PROSCOOP7, PROSCOOP12 and PROSCOOP13).
B3KU38
IQIP1_HUMAN
IQCJ-SCHIP1 readthrough transcript protein
MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKRSPSPPSVSSEKLSSSVSMNTFSDSSTPDYREDGMDLGSDAGSSSSSSRASSQSNSTKVTPCSECKSSSSPGGSLDLVSALEDYEEPFPVYQKKVIDEWAPEEDGEEEEEEDERDQRGYRDDRSPAREPGDVSARTRSGGGGGRSATTAMPPPVPNGNLHQHDPQDLRHNGNVVVAGRPSCSRGPRRAIQKPQPAGGRRSGRGPAAGGLCLQPPDGGTCVPEEPPVPPMDWEALEKHLAGLQFREQEVRNQGQARTNSTSAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQICFVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKKLQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMTIGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEKMPAK
May play a role in action potential conduction in myelinated cells through the organization of molecular complexes at nodes of Ranvier and axon initial segments. May also play a role in axon outgrowth and guidance (By similarity).
B3L2V1
PSD_PLAKH
Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase beta chain; Phosphatidylserine decarboxylase alpha chain]
MKKNGRDNNFYHLYKNKYLITGVTILSFILMFQYKYHEVLTLHDNSENAVQSSKLFWARLLFGRTRSRITGQILKMEIPNTYRLFIFNFLIKYMHINKEEIKYPIESYKSIGDFFSRYIREETRPIGDVSDYSIVSPCDSELIDYGELTSEYLENIKGVKFNVNTFLGSKFQKKHNDGSTKFFYAIFYLSPKKYHHFHAPFNFKYKIRRHISGELFPVFQGMFKFINNLFNINERVILSGEWKGGNVYYAAISAYNVGNIKIINDEELVTNNLRHQLSYMGGDINTKIFDSYKSVEVGDEIGEFRMGSSIVVIFENKKDFSWNVNQNQTVSVGQRLGGIGEPVKEENRFIKIRS
Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer). Plays a central role in phospholipid metabolism and in the interorganelle trafficking of phosphatidylserine. {ECO:0000255|HAMAP-Rule:MF_03208, ECO:0000269|PubMed:22057268}.
B3LF48
EHD2_ARATH
EH domain-containing protein 2 (AtEHD2) (EC 3.6.5.2)
METSSTISIGSCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLGLSEFITAMKLVSLAQEGHEITSDLLKGSIDMKSVELPVLEGLENVVSKQKVSKTNVDVEDNVVTKPQVTAKTPWFKSKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFNDFASPVLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDYPGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFECSQMPHPVLDQITLVDTPGVLSGEKQRMQRSYDFTGVISWFASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINEVAVGPIGKELFEKEQNDLLADLMDVPKKACDRKINEFVKRARSAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFPSVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYDN
Involved in endocytosis negative regulation, probably by influencing actin organization. Acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes. Exhibits an inhibitory effect on endocytosis when over-expressed.
B3LGE9
ARO1_YEAS1
Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4); 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10); Shikimate dehydrogenase (EC 1.1.1.25)]
MVQLAKVPILGNDIIHVGYNIHDHLVETIIKHCPSSTYVICNDTNLSKVPYYQQLVLEFKASLPEGSRLLTYVVKPGETSKSRETKAQLEDYLLVEGCTRDTVMVAIGGGVIGDMIGFVASTFMRGVRVVQVPTSLLAMVDSSIGGKTAIDTPLGKNFIGAFWQPKFVLVDIKWLETLAKREFINGMAEVIKTACIWNADEFTRLESNASLFLNVVNGEKNVKVTNQLTNEIDEISNTDIEAMLDHTYKLVLESIKVKAEVVSSDERESSLRNLLNFGHSIGHAYEAILTPQALHGECVSIGMVKEAELSRYFGILSPTQVARLSKILVAYGLPVSPDEKWFKELTLHKKTPLDILLKKMSIDKKNEGSKKKVVILESIGKCYGDSAQFVSDEDLRFILTDETLVYPFKDIPADQQKVVIPPGSKSISNRALILAALGEGQCKIKNLLHSDDTKHMLTAVHELKGATISWEDNGETVVVEGHGGSTLSACADPLYLGNAGTASRFLTSLAALVNSTPSQKYIVLTGNARMQQRPIAPLVDSLRANGTKIEYLNNEGSLPIKVYTDSVFKGGRIELAATVSSQYVSSILMCAPYAEEPVTLALVGGKPISKLYVDMTIKMMEKFGINVETSTTEPYTYYIPKGHYINPSEYVIESDASSATYPLAFAAMTGTTVTVPNIGFESLQGDARFARDVLKPMGCKITQTATSTTVSGPPVGTLKPLKHVDMEPMTDAFLTACVVAAISHDSDPNSANTTTIEGIANQRVKECNRILAMATELAKFGVKTTELPDGIQVHGLNSIKDLKVPSDSSGPVGVCTYDDHRVAMSFSLLAGMVNSQNERDEVANPVRILERHCTGKTWPGWWDVLHSELGAKLDGAEPLECTSKKNSKKSVVIIGMRAAGKTTISKWCASALGYKLVDLDELFEQQHNNQSVKQFVVENGWEKFREEETRIFKEVIQNYGDDGYVFSTGGGIVESAESRKALKDFASSGGYVLHLHRDIEETIVFLQSDPSRPAYVEEIREVWNRREGWYKECSNFSFFAPHCSAEAEFQALRRSFSKYIATITGVREIEIPSGRSAFVCLTFDDLTEQTENLTPICYGCEAVEVRVDHLANYSADFVSKQLSILRKATDSIPIIFTVRTMKQGGNFLDEEFKTLRELYDIALKNGVEFLDLELTLPTDIQYEVINKRGNTKIIGSHHDFQGLYSWDDAEWENRFNQALTLDVDVVKFVGTAVNFEDNLRLEHFRDTHKNKPLIAVNMTSKGSISRVLNNVLTPVTSDLLPNSAAPGQLTVAQINKMYTSMGGIEPKELFVVGKPIGHSRSPILHNTGYEILGLPHKFDKFETGSAQLVKEKLLDGNKNFGGAAVTIPLKLDIMQYMDELTDAAKVIGAVNTVIPLGNKKFKGDNTDWLGIRNALINNGVPEYVGHTAGLVIGAGGTSRAALYALHSLGCKKIFIINRTTSKLKPLIESLPSEFNIIGIESTKSIEEIKEHVGVAVSCVPADKPLDDELLSKLERFLVKGAHAAFVPTLLEAAYKPSVTPVMTISQDKYQWHVVPGSQMLVHQGVAQFEKWTGFKGPFKAIFDAVTKE
The AROM polypeptide catalyzes 5 consecutive enzymatic reactions in prechorismate polyaromatic amino acid biosynthesis. {ECO:0000255|HAMAP-Rule:MF_03143}.
B3LV44
HH_DROAN
Protein hedgehog (EC 3.1.-.-) [Cleaved into: Protein hedgehog N-product]
MDNSDCRVPWASAPSSMTCLSLDPTKCHSSSSSSKCQPDCDTPPAAEKIQRHIAYTQRCPGKITTLLAVLLLVLPLSFTPAHSCGPGRGLGRRRERNLYPLVLKQTIPNLSEYTSGASGPLEGPIRRDSPKFKDLVPNYNRDILFRDDEGTGADRLMSKRCKEKLNVLAYSVMNEWPGVRLLVAESWDEDYQHGKESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSDSSISSHVHGCFTPESTALLEGGVRKPLGELSIGDRVLSMTSNGQPVYSEVILFMDRNLKQMQNFVRLHTAGGAVLTVTPAHLVSVWQPERQELTFTFADRIEERQHVLVRNEETGELRPDQVIKVESVRSMGVVAPLTREGTIVVNSVAASCYAVINSQSLAHWGLAPMRLLSTLEAWLPAKDQLRSSKDHPKDSSAERQNGIHWYAEALYKIKDYVLPKSWRHD
[Protein hedgehog]: The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product) (By similarity). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Once cleaved, the C-product has no signaling activity and diffuses from the cell (By similarity). [Protein hedgehog N-product]: The dually lipidated hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Establishes the anterior-posterior axis of the embryonic segments and patterns the larval imaginal disks. Binds to the patched (ptc) receptor, which functions in association with smoothened (smo), to activate the transcription of target genes wingless (wg), decapentaplegic (dpp) and ptc. In the absence of hh, ptc represses the constitutive signaling activity of smo through fused (fu). Essential component of a signaling pathway which regulates the Duox-dependent gut immune response to bacterial uracil required to activate Cad99C-dependent endosome formation, norpA-dependent Ca2+ mobilization and p38 MAPK, which are essential steps in the Duox-dependent production of reactive oxygen species (ROS) in response to intestinal bacterial infection. During photoreceptor differentiation, it up-regulates transcription of Ubr3, which in turn promotes the hh-signaling pathway by mediating the ubiquitination and degradation of cos.
B3M185
RAS1_DROAN
Ras-like protein 1 (EC 3.6.5.2)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKML
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays a role in eye development by regulating cell growth, survival of postmitotic ommatidial cells and differentiation of photoreceptor cells. During larval development, mediates Ptth/tor signaling leading to the production of ecdysone, a hormone required for the initiation of metamorphosis.
B3M301
SPAST_DROAN
Spastin (EC 5.6.1.1)
MVRTKNQSSSSSASSSTKSPIKSGSAGSGSAAGGNSASGSRQSTHRSSSASNVASAAAAAVASSNRTRTSPGSSPDGDDDTTTTDDLTPTSCSPRSGHHHHGHPYGGSSVHKQNLYVVSFPIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSKDQQQQHQSQPLSYPLELSEGGNPEQQLPSQTQRYRAIQPLEMASNRPGGGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSMARDRLHFLALREEDLRMQRLSLKEKQQKTLPQSDYKALKSREPMLAGMTNDPLKPRVRSSGYGPKASTSAQAAAATAASGRKLTIGTKRPGNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPPAVRRQFSSGRNTPPLRSRTPINNNGPSTSGSGASTPVVSVKGVEPKLVQLILDEIVEGGAKVEWSDIAGQEVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSNEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLSRLLQKQGSPLDTEALRRLAKTTDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITESDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
ATP-dependent microtubule severing protein. Stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability in the neuromuscular junction synapse. Involved in lipid metabolism by regulating the size and distribution of lipid droplets. Involved in axon regeneration by regulating microtubule severing. {ECO:0000255|HAMAP-Rule:MF_03021}.
B3M3M6
UBP36_DROAN
Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.4.19.12) (Deubiquitinating enzyme 36) (Protein scrawny) (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36)
MPVSVAVCETTNVVNAALRESLGVGIGSGGASSDDKSAGEDTNSLQNHIVANAKRILMTKIEYEEVPNYQEAVLENLKSKYIVIKPTNPTNGCNLNGNTANTFGNKNNAGKIVGANGHDNNGRKLSDHPNQNHNHANPNGHHANPNELPKPKRVLYPRENIRIGWKQSERKWQVGSGMINAGNTCYLNSTLQALFHIPALANWLVSEQAHMENCNVSESGSFCIICAMAKTLQATQTTQSAVRPFLIYTKLKQICKHMIVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKSDSLEEAFEGYFSREKLEDFGYKCEGCKKKVSATKQFRLERAPITLCIQLKRFSMMGNKLTKQITFKPRIDLSKFAARSPAASVQPLIYRLVSMVTHLGVSQHCGHYTAIGSTEAGSYYNFDDSYVRPIAIQSVCNTNAYIMFYELDPLQTSSPAAARANGLRLTNGHGPVPVAVPATVSSPLPSPAKFIGPQLPPGGINGYSNGHGPKTTIQFKPQHQPSHQQNGVQQSAKSPLLSTHVKVEAAAGAAALAASAAPTANGNKSSSNHSNHKSVNQQHYLPISSEDEDSEDEVKARPTVQLPSMPKMDDCMDSGKPKSPVKTPVKTPLKSLVPYESASEEEEVVPLPNPNARKRSSDSSDSEHEPTTSSVQLNGHSKTNGSLSNGSSKSTDAIDEIFKSLKGYQAKKKSADSEDDDDDEDEPNNQLTNGWHPQKQSQSQSRSGPPSPKTPPSPAVIKSKTGIWKVTRDDGDDDEDDDDDDDEVVEEARAVRTPVKNHRNPFASSKTATDSPTTPGAKRQKLLNGSAIKTQQQPRAGNGYQSEATANGGTVNELLKQSHRGYSSSVLSWNGKPAELEKEPFVLVCAKRIAGHGSLDGSGSGSNTDIIDTEIPAAAVNFPSGSCSFSLLADARDQRQRDLADDEENEMDRGRQRKVKSGSAKISNSTPGYNPFMEFENQKRWHKNGGGGGFPRFYQNQNFRQGFQQRNKFKFNRFGGPGSAKFQQQRALQRHLAAGGGFTRRQPTHSAQQQQQQQS
Required for maintaining multiple types of adult stem cells, including male and female germline, epithelial follicle cell and intestinal stem cells. May function as a transcriptional repressor by continually deubiquiting histone H2B at the promoters of genes critical for cellular differentiation, thereby preventing histone H3 'Lys-4' trimethylation (H3K4). Controls selective autophagy activation by ubiquitinated proteins.
B3M3X7
WLS_DROAN
Protein wntless
MSGTILENLSGRKLSILVASLLLCQVFCFLLGGLYAPLPAGHVTVLGSLCREDHTRQNDTSFLLYSRGAGACIPVSREEVERDPMKMANELVHVFQMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSTSELREPPKELQLTIDMRLAYRNKGDPDQAWKLYAHGVEQRYLDCVTAHVGPTETLYSCDMIPLFELGALHHSFYLLNLRFPLDTPRQMNLQFGHMHDLTLTAIHQNGGFTQIWLMLKTVLFPFVVGIMIWFWRRVHLLQRSPALLEYMLIYLGGALTFLNLPLEYLSLVVEMPYMLLLSDIRQGIFYAMLLSFWLVFAGEHMLIQDAPNKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMTFIILAGVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAALTVAGFIMGQMAEGQWQWNDNVEIQLTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSDETTQSNENIVASAASEEIEFSHLPSDSNPSEISSLTSFTRKVAFD
A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip (By similarity).
B3MEY6
LIS1_DROAN
Lissencephaly-1 homolog
MKMVLSQRQREELNQAIADYLGSNGYADSLEAFRKEADLSTEAEKKFGGLLEKKWTSVIRLQKKVMELEAKLTEAEKEVIEGAPTKNKRTPGEWIPRPPEKYSMSGHRASITRVIFHPIFGLVVSASEDATIKIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQTYECVKTMHGHDHNVSSVAFVPAGDYVLSASRDRTVKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDHTIRVWLTNSRDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLFTLNGHDNWVRGLAFHPAGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR
Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes. {ECO:0000255|HAMAP-Rule:MF_03141}.
B3MH43
PTK7_DROAN
Tyrosine-protein kinase-like otk (Tyrosine-protein kinase-like 7 homolog)
MAALRISVWILVQALMMALVSSNSSHFLQLPQSQSVVENESVDFECQASTDPSSELHYEWLHNGHRIAYDKRVYQIGSHLHIEAVQRAEDVGDYVCIATSLASGAREASPPAKLSVIYIDSASVQLLGSNRNELLLKCHVEAVSGSDDPLQIEWYRNSAKLSSWQNVQLDQHRLIIRQPSAADDGLYRCTASNAAGRVMSKQGYVYRSSLKCLPRLPRRKNQKLPESWSKEVFLCRGKRGGSGGVEALPSAPEDLRIVQGPASHAIIKEGDPAALTCLYELPAELQNQRIQLRWRKDGKLLRHVELGNSLPLPGISSDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEGYAPINSSPGTLEVIEQLKFVPQPTSKNLELDAPIAKVHCKAQGTPTPQVQWMRDDANTSLPDQVEVDANGTLIFRNVNADHRGNYTCLATNSQGQINATVAINVVVTPKFSVPPVGPIETAEQGNVVIHCQAIGDPKPTIQWDKDLTYLSENNTDRERFRFLENGTLEIRNVQAEDEGSYGCTIGNSAGLKREDVQLVVKTAGDGFPPEESGGDGFLVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNELSTKEAGGDQPDGAANGKGSEQEPCLSKQRNGHGGQSRSKSNGDAQKSDDTACSQQSRASKKSAHIYEQLALPRSGLTELIQIGRGEFGDVFVGKLKASLVATGSPSDKDADTEKQHSNSENGSGGSGSGSTTLSTLNEKRRSKTSMDDIEEIKEEEQEQQQSDLDQLVLVKALNKVKDEQACQEFRRQLDLLRGISHKGVVRLFGLCREKDPHYMVLEYTDWGDLKQFLLATAGKVNTASAAATSSPPPLTTSQVLAVAYQIARGMDAIYRARFTHRDLATRNCVISSEFIVKVSYPALCKDKYSREYHKHRNTLLPIRWLAPECIQEDEYTTKSDIFAYGVVVWELFNQATKLPHEELTNEQVIQKSQAGTLEWTVAESTPDSLREILLSCWVSNPKERPSFSQLGAALSKAMQSLEK
Acts as a calcium-dependent, homophilic cell adhesion molecule that regulates neural recognition during the development of the nervous system. Component of the repulsive Plexin signaling response to regulate motor axon guidance at the embryonic stage. Also component of a receptor complex that is required in the adult visual system to innervate the lamina layer specific targeting of R1-R6 axons (By similarity).
B3MK83
FICD_DROAN
Protein adenylyltransferase Fic (EC 2.7.7.108) (De-AMPylase Fic) (EC 3.1.4.-)
MGATDQALEAESKTTEPPKTPPVPEQHDRPFLGRQANLCHLLVLLFSGGLAAITLHIFTSSNVGWRLRQLHHLPTAHYLQTRDEFAVYSVDELNAFKEFYDRSISDSVGSSYSEAEETNIKEALGALRLAQDMYLAGKDDKAARLFQHSLALAPRHPTVLLRYGEFLEHSQRNIVLADQYYFQALSISPSNSEALANRQRTADVVQSLDERRLESLDSKRDALSAIHESSAALRRAKKEAYFQHIYHTVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKMEITIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLALLMQRFERWLNSEHSSSMHPVNYAALAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPHQIPMLIQSTSEAGEGVPQLQSSQMGGGASIPEFHESGSGSLP
Protein that can both mediate the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins (AMPylation), and the removal of the same modification from target proteins (de-AMPylation), depending on the context (By similarity). The side chain of Glu-252 determines which of the two opposing activities (AMPylase or de-AMPylase) will take place (By similarity). Acts as a key regulator of the unfolded protein response (UPR) by mediating AMPylation or de-AMPylation of Hsc70-3/BiP. In unstressed cells, acts as an adenylyltransferase by mediating AMPylation of Hsc70-3/BiP at 'Thr-518', thereby inactivating it. In response to endoplasmic reticulum stress, acts as a phosphodiesterase by mediating removal of ATP (de-AMPylation) from Hsc70-3/BiP at 'Thr-518', leading to restore HSPA5/BiP activity (By similarity).
B3MPN6
IRS1_DROAN
Insulin receptor substrate 1 (Protein chico)
MASISDDGMVLSGYHKKLKTMKKKFFVLYEETSINQARLEYYDTEKKFLQRAEPKRVIYLKDCFNINRRLDTKHRFVIVLSSREGGFGIVLESENDLRKWLDKLLLLQRNIANVNGQVYSAYEHVWQVIIQKKGMSEKVGITGTYHCCLSAKSLTFVCIGPEKTANGDDRISSIEILLTTIRRCGHASPQCIFYMELGRQSVLGSGELWMETDNAAIATNMHNTILSAMSAKTDSNTNLINVYQARPDISHEPMRKRSSSANEASKPINVIQNRQNSLELRNCSSPHNYGFPRERCDSLPTRNGTLSESSNQSYFGSNLGLRSNTISGIRPHSTSKHSNSPTFNMPLRCSESEDSSISIDESDDNASFGHYRLNTRSSKGAIPEENLDDFASAEYCKGSGPSGDDNYIPMTPIKPASFCEPDKVELPKPDDPNLHINFPEHTSEKLENDFDLDSDNQCGRPIRAYSIGNKVEHLKLNRRLGYLNDTGQNSNRVRAYSVGSKSKIPRCDLQRVVLVEDNRFDTNRSQNNISKEGPISGTSTNREKKSTSAPLLSLKNQINQDRMSDLMEIDFSQSSKIEPWTPAQFKRNVMDVVPKNIESVFPKSYRNDSSNLTLHATSQKDIFNGGKLNTTESSSEGGYLEMKPVGNAFSSSPVTLPSKIEKLKLKDNTELPVHELHKVSSYNIPPEKRKEQTPTQTRIEEKTLNSQLNEKLINTESANVVANITPNVPELKSDKKNNVESLIIENNNWDLGTTDEKKLVHSISSEDYTQIKDKLNDLTKNNEVGYKILQIKSDSSLISSKITLKNRLRDNLERQQRLTESVNTIPDKSPSATTKGTFYSLGNNFQTPPNNVVNNTLDNILQTKDLNFPSRPSSQASQPELHYAKLDLPNCSDQNPAKYLKRGSRESPPVATCAEDGNTYARIDFDQSDSSSSSSKIFNM
Activates phosphatidylinositol 3-kinase when bound to the regulatory p85 subunit. May mediate the control of various cellular processes by insulin-like peptides. When phosphorylated by the insulin receptor binds specifically to various cellular proteins containing SH2 domains. Involved in control of cell proliferation, cell size, and body and organ growth throughout development. Also has a role in a signaling pathway controlling the physiological response required to endure periods of low nutrient conditions. Insulin/insulin-like growth factor (IGF) signaling pathway has a role in regulating aging and is necessary in the ovary for vitellogenic maturation (By similarity).
B3MRI9
SWS_DROAN
Neuropathy target esterase sws (Swiss cheese) (EC 3.1.1.5)
MDVLELLRASATGSYTALFSDAWCQYVSKQITNSMYLYCALGVLSMVFLAWFMYFKRLARIRLRDEASRSMSAVNSSSGGDLRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKRRAVMRFARRILQLRRDNMPLEMRTVEPPAEYLEETIDGSDRVPPDALYMLQSIRIFGHFEKPVFLRLCKHTQLLELMAGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRKGESVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMEAFEEVFQDNPDVMIRVIQVIMIRLQRVLFTALRNYLGLNAELVQNHMRFKSSTIMAPSTHSSQCSRQTGSQPTLGVPAPTCSNTTTTASPTTANTVHSGLAGANGVIGQSRPPISPSRHSREEHTLSDPNPNPDVINTSVGGASGTSMYAEVHGDAPNVDVFHQQQHSVGNLSTRRGSISQMAPDLGPALSQPGLGQGQGLGPGVTGAPPLMTGAPASKIDMRLVHASAVDSLRKELGLPEEDSHIIEPFVEVRELEPNVTLITEGNSDDVCVWFVMTGTLAVYQANQDAARAKQQQEKNDMLIHFVHPGEIVGGLAMLTGEASAYTIRSRNNSRVAFIRRAAIYQIMRQRPRIVLDLGNGVVRRLSPLVRQCDYALDWIFLESGRAVYRQDEISDSTYIVLSGRMRSVITHPGGKKEIIGEYGKGDLVGIVEMITETSRTTTVLAVRDSELAKLPEGLFNAIKLRYPIVVTKLISFLSHRFLGTMQTRSSSAAPGGPVEANPVTHKYSTVALVPITDEVPLTPFTYELYHSLCAIGPVLRLTSDVVRKQLGPNIFEAANEYRLTSWLAQQEDRNIITLYQCDNALSAWTQRCMRQADVILIVGLGNGSHLVGKFEREIDRLAMRTQKELVLLYPETTNSKPANTLSWLNARPWVTKHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGARGAAHIGMLKAIQEAGIPIDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKMTKWFLQLLDLTYPITSMFSGREFNKTIHDTFGDVSIEDLWIPYFTLTTDITASCHRIHTNGSLWRYVRSSMSLSGYMPPLCDPKDGHLLLDGGYVNNLPGQLWRYCRASMSIAGVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTSPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLAFGSFDEIRDVGYVFGKNYFENMAKAGRLGRFNQWFNKEPPKRGNHASLNEYTFIDLAQIVCRLPETNAGNSADIFSEDEDCDGYISEPTTLNTDRRRIQVPRAGNSLSFSENEMDSDVELDLQLDRKTEKSIHSAATSVARGSMRSREFHKLEQDRSVEITRLKDETERIMAPTNLDRKGDGQEQEKEPEQEQELETEEPNQENTEVEEEQRNQGEGNEDNKENKGGAYNETKN
Phospholipase B that deacylates intracellular phosphatidylcholine (PtdCho), generating glycerophosphocholine (GroPtdCho). This deacylation occurs at both sn-2 and sn-1 positions of PtdCho. Its specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy. Plays a role in the signaling mechanism between neurons and glia that regulates glia wrapping during development of the adult brain. Essential for membrane lipid homeostasis and cell survival in both neurons and glia of the adult brain (By similarity).
B3N5J3
FICD_DROER
Protein adenylyltransferase Fic (EC 2.7.7.108) (De-AMPylase Fic) (EC 3.1.4.-)
MGTEAEPPSPPSPPAQQQEQANPPVWNAQNQKPARLYRLVLFFIAGSLTAWMFHAFSSSNLAWKLRQLHHLPTAHYLQTRDEFALYSVEELNAFKEFYDKSVSDSVGASFTEAEQTSINEALVSLRMAQDMYLTGKDDKAARLFEHALALAPRHPEVLLRYGEFLEHNQRNIVLADQYYFQALTISPSNSEALANRQRTADVVQNLDQRRLESLDSKRDALSAIHESNAALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIEITIKDILELHRRVMGHVDPIEGGEFRRNQVYVGGHIPPGPGDLALLMQRFERWLNSEHISTLHPVNYAALAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQRSSILEFYESGSGALP
Protein that can both mediate the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins (AMPylation), and the removal of the same modification from target proteins (de-AMPylation), depending on the context (By similarity). The side chain of Glu-250 determines which of the two opposing activities (AMPylase or de-AMPylase) will take place (By similarity). Acts as a key regulator of the unfolded protein response (UPR) by mediating AMPylation or de-AMPylation of Hsc70-3/BiP. In unstressed cells, acts as an adenylyltransferase by mediating AMPylation of Hsc70-3/BiP at 'Thr-518', thereby inactivating it. In response to endoplasmic reticulum stress, acts as a phosphodiesterase by mediating removal of ATP (de-AMPylation) from Hsc70-3/BiP at 'Thr-518', leading to restore HSPA5/BiP activity (By similarity).
B3N946
IRS1_DROER
Insulin receptor substrate 1 (Protein chico)
MASISDDGMALSGYLKKLKTMKKKFFVLYEETSNSSARLEYYDTEKKFLQRAEPKRVIYLKNCFNINRRLDTKQRFVIVLSSRDGGFGIVLESENDLRKWLDKLLVLQRNIANTNGTAYSPYDQVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPDKTPNGEERVASIEILLTTIRRCGHASPQCIFYVELGRQSVLGSGDLWMETDNAAVATNMHNTILSAMSAKTESNTNLINVYQNRPDLSHEPMRKRSSSANEASKPINVNVIQNSQNSLDLRSCSSPHNYGFGRERCDSLPTRNGTLSESSNQTYFGSNHGLRSNTISGIRPHSSNKHSNSPTFTMPLRCSASEESSISIEESDDNGSFSHYRLNTRSSETAIPEENIDDFASAEFSKVSEQNESDENYIPMTPINPTDAIHEKEKVDMQRLEDGSLHFDFPEHASEKLARDFDLDSDNQCGRPIRAYSIGNKVEHLKFNKRLGHLNDTGQNPNRVRAYSVGSKSKIPRCDLQRVVLVEDNKHEFAANRSQSSITKEGTSYSTSSNRQKKSTSAPLLSLKNHINSDRMSDLMEIDFSQATNLEKQKFIKNNEIPKYIENVFPKTPRTDSSSLTLHATSQKDIFNGTKLNNTVNASEEGYLEMKPVGNAYTPSSNCLPIKVEKLKISDYTAPLTTAAPVHDLNKISAYNISAEKWKEQSLCEEKKSNSPLNETPCSLKPTDVESNSHDEHSTNNMECEVSVQCDKQNNLDDKVAENNNLDIGGHEEKKLVHSISSEDYTQIKDKSNDFTKFNEAGYKILQIKSDSSLISLKLYQKGIHKDNLERSHRLTESVNTIPDNATASSSVTKFNINTKAADSRSTDPSTPQNILQIKDLNFPSRSSSRISQPELHYASLDLPHCSGQNPAKYLKRGSRESPPVSACPGDGNTYAKIDFDQSDSSSSSSNIFNT
Activates phosphatidylinositol 3-kinase when bound to the regulatory p85 subunit. May mediate the control of various cellular processes by insulin-like peptides. When phosphorylated by the insulin receptor binds specifically to various cellular proteins containing SH2 domains. Involved in control of cell proliferation, cell size, and body and organ growth throughout development. Also has a role in a signaling pathway controlling the physiological response required to endure periods of low nutrient conditions. Insulin/insulin-like growth factor (IGF) signaling pathway has a role in regulating aging and is necessary in the ovary for vitellogenic maturation (By similarity).
B3NC86
UBP36_DROER
Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.4.19.12) (Deubiquitinating enzyme 36) (Protein scrawny) (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36)
MPVSMAVCETANVVNAALRESLGGNSSAAGSSADQAKSGEESNGSLQNHIVANAKRILMAKIEYEEVPNYHESVLESLKSKYIVIKPGNPGAINGFGGKNNTGKVVGANGHDNNGARKQAEHPNNQSHHNNHNNHPHPTSNPNELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLENCNVAESGGGCIVCAMAKTLLATQSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADTLEDAFEGHFSRERLEDMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKQISFKPRIDLSKYAARSPAAQAQPLTYRLVSMVTHLGVSQHCGHYTAIGSTDTGSYYNFDDSYVRPIAMQSVCNTNAYIMFYELDLSQTASPAANRPNGMRLTNGHSTTPVPATTVSSPSPTRFIGPQLPPGGVNGYSNGNAQKTAIQFKQHHQQSQQNGFQLGTGKFQDTAKPPLVGAHAKGEANPAPTANGNKSSSTSSNNSSSSNHKSINQQQYLPISSEDEDSEDERTSRPSTVQLPSMPKMTDDHTEKPKSPVKIQAKTPIKTPLKSLVPYESASEEEEAPLPNPRKRRSGEDSSESDQESGQTNGHSKTNGSLTNGSASSSVHVNNSKLKTDAIDEIFKSLKKSADSDDDDDEEESSIQLTNGWHPQKQSQSQSKAPPSPKTPPSPAVIKSKTGIWKVTRNDEVDDIDDDDDEEEEATVKIQTPSKTHRNPFSSSKPSTDSPATPGAKRQKLLNGSPVKSHQQPRVGNGYQSEATSNGSTINELLKQSHRGYGSSVLSWNGKPAELEKETFELVCAKRIAGHGSVDGSDIVESSVAVNASSGSDSNDVVVIAVALLVDAREQRQRDLDDDEENEMDRGRQRKVKSGSAKGNNASNSTPGYNPFQEYEGQKRWNKNGGGGGGFPRFYNQNFRQNFQQRNKFKFNRFGGPGGAKFQQQRALQRHLAAGGGFSRRQPSAQQQQQQS
Required for maintaining multiple types of adult stem cells, including male and female germline, epithelial follicle cell and intestinal stem cells. May function as a transcriptional repressor by continually deubiquiting histone H2B at the promoters of genes critical for cellular differentiation, thereby preventing histone H3 'Lys-4' trimethylation (H3K4). Controls selective autophagy activation by ubiquitinated proteins.
B3NGS7
WLS_DROER
Protein wntless
MSGTILENLSGRKLSILVTTLLLCQVLCFLLGGLYAPLPAGHVTVLGSLCREDHGRQNDTGFLLYSRGAGACIPVTREEVEQDSTKMANELVHVFQMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPDNGWKLYAHGVEHRYLDCVSSHVGPTETLYSCDMIPLFELGALHHSFYLLNLRFPLDTPSQMNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTVLFPFVVGIMIWFWRRVHLLQRSPALLEYMLIYLGAALTFLNLPLEYLSLVFEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDAPNKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWAMPLAAKMAMTFIVLAGVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYESLIYRFKFLMLATIVCAALTVTGFIMGQRAEGQWDWNDNVAIQPTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSDETTQSNENIVASAASEEIEFSHLPSDSNPSEISSLTSFTRKVAFD
A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip (By similarity).
B3NPW0
LIS1_DROER
Lissencephaly-1 homolog
MKMVLSQRQREELNQAIADYLGSNGYADSLETFRKEADLSTEVEKKFGGLLEKKWTSVIRLQKKVMELEAKLTEAEKEVIEGAPTKNKRTPGEWIPRPPEKFSLTGHRASITRVIFHPIFGLMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR
Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes. {ECO:0000255|HAMAP-Rule:MF_03141}.
B3NS99
PTK7_DROER
Tyrosine-protein kinase-like otk (Tyrosine-protein kinase-like 7 homolog)
MTARMISIYGLVLASMMASVWASSSRFQRLPQSQSVVENESVKFECESTDSYSELHYDWLHNGHRIAYDKRVHQIGSNLHIEAARRTEDVGSYVCIATNLASGAREASPPAKLSVIYLESASVQLLGSNRNELLLKCHVEGASGDSEPLEIEWYRNSEKLSTWKNVQLDQHRLIIRQPGSDDDGLYRCTASNAAGRVMSKQGYAYQSSVKCLPRLARRKNQKMMESWDKQTFLCRGKRGGAAGLEALPAAPEDLRIVQGPVGQSIIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPITGHSFDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEGHLPISSTPGVLEVIEQLKFVPQPTSKNLELDAVVAKVHCKAQGTPTPQVQWVRDGENSTLPDQVEVDANGTLIFRNVNSEHRGNYTCLASNTQGQINATVAINVVVTPKFSVPPVGPIETSEQGTVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNDLSTKEAGGDQPDAAGNGKGSEQEPCLSKQHNGHSKSRSKSSGDAQKSDDTACSQQSRASKKSAHIYEQLALPRSGLSELIQIGRGEFGDVFVGKLKATLVTSPTDKDADTEKQHSNSENGSGGSGSGSTTLSTLNEKRRSKTSMDDIEEIKEEEQEQHNQSALEQLVLVKALNKVKDEQACQEFRRQLDLLRAISHKGVVRLFGLCREKDPHYMVLEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLTTSQVLAVAYQIARGMDAIYRARFTHRDLATRNCVISSEFIVKVSYPALCKDKYSREYHKHRNTLLPIRWLAPECIQEDEYTTKSDIFAYGVVVWELFNQATKLPHEELTNEQVVQRSQAGSLEWSVAEATPDSLREILLSCWVSNPKERPSFSQLGAALSKAMQSVEK
Acts as a calcium-dependent, homophilic cell adhesion molecule that regulates neural recognition during the development of the nervous system. Component of the repulsive Plexin signaling response to regulate motor axon guidance at the embryonic stage. Also component of a receptor complex that is required in the adult visual system to innervate the lamina layer specific targeting of R1-R6 axons (By similarity).
B3NY03
SWS_DROER
Neuropathy target esterase sws (Swiss cheese) (EC 3.1.1.5)
MDVLEMLRASASGSYNTIFSEAWCQYVSKQITATMYMYCALGMMGVLFLAWFMYFKRMARLRLRDEIARSISAVTNSSGDLRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKRRAVMRFARRILQLRRDNMPLEMRTVEPPAEYLEETIEGSDRVPPDALYMLQSIRIFGHFEKPVFLRLCKHTQLLELMAGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRKGESVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMQAFEEVFQDNPDVMIRVIQVIMIRLQRVLFTALRNYLGLNAELVQNHMRYKSVSTMSGPINSQTSQSSRQTPNGPPMGISHPLNLMQSTASGTGSGSGSGVSVTVTRPPPSPSRHSREEHTLSDPNPNPDGSVHGTSNLFTEVHGDAPNADLFHQQQQSVGNLSTRRSSITQMTPDGSHSCPPAPGVTTSIDMRLVQSSAVESLRKELGLSEEDAHIIEPFVELRELEPNVTLITEGNADDVCVWFVMTGTLAVYQSNQDATRAKQDKSDMLIHFVHPGEIVGGLAMLTGEASAYTIRSRSNSRIAFIRRAAIYQIMRQRPRIVLDLGNGVVRRLSPLVRQCDYALDWIFLESGRAVYRQDESSDSTYIVLSGRMRSVITHPGGKKEIVGEYGKGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFNAIKLRYPIVVTKLISFLSHRFLGSMQTRSGSGAPGAPVEANPVTHKYSTVALVPITDEVPLTPFTYELYHSLCAIGPVLRLTSDVVRKQLGPNIFEAANEYRLTSWLAQQEDRNIITLYQCDSSLSAWTQRCMRQADVILIVGLGDRSHLVGKFEREIDRLAMRTQKELVLLYPEATNAKPANTLSWLNARPWVTKHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGARGAAHIGMLKAIQEAGIPVDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKMTKWFLQLLDLTYPITSMFSGREFNKTIHDTFGDVSIEDLWIPYFTLTTDITASCHRIHTNGSLWRYVRSSMSLSGYMPPLCDPKDGHLLLDGGYVNNLPGHLWRYCRASMSIAGVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTSPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLAFGSFDEIRDVGYVFGKNYFENMAKAGRLGRFNQWFNKEPPKRVNHASLNEYTFIDLAQIVCRLPETYAVNTADLFSEDEDCDGYISEPTTLNTDRRRIQVPRAGNSLSFSETEMDSDVELDLKLERKTDKSTQSSPPTSSRTSMRGKEEARHMDNWHWGAKHKNETGSGATEGIHTSTEQEQEHQQQQQQDQGVRAEQLVYKDEDKENRSSANNETKN
Phospholipase B that deacylates intracellular phosphatidylcholine (PtdCho), generating glycerophosphocholine (GroPtdCho). This deacylation occurs at both sn-2 and sn-1 positions of PtdCho. Its specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy. Plays a role in the signaling mechanism between neurons and glia that regulates glia wrapping during development of the adult brain. Essential for membrane lipid homeostasis and cell survival in both neurons and glia of the adult brain (By similarity).
B3NZR4
RAS1_DROER
Ras-like protein 1 (EC 3.6.5.2)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKML
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays a role in eye development by regulating cell growth, survival of postmitotic ommatidial cells and differentiation of photoreceptor cells. During larval development, mediates Ptth/tor signaling leading to the production of ecdysone, a hormone required for the initiation of metamorphosis.
B3P7F8
HH_DROER
Protein hedgehog (EC 3.1.-.-) [Cleaved into: Protein hedgehog N-product]
MDNTSSVPWASAASVTCLSLDAKCHSSSAKSAASSISASPETQAMRHIAHTQRCLSRLTSLVALLLIVLPMTFSPAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCREKLNLLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSDSSISSHVHGCFTPESTALLENGVRKPLGELSIGDRVLSMTANGQAVYSEVILFMDRNLEQMQNFVQLHTDGEAVLTVTPAHLVSVWQAESQKLTFVFADRVEEKNQVLVRDVETGELRPQRVVKVGSVRSKGVVAPLTREGTIVVNSVAASCYAVINSQSLAHWGLAPMRLLSTLEAWLPAKEQLHSSPKVVTTAEQQNGIHWYANALYKVKDYVLPQSWRHD
[Protein hedgehog]: The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product) (By similarity). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Once cleaved, the C-product has no signaling activity and diffuses from the cell (By similarity). [Protein hedgehog N-product]: The dually lipidated hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Establishes the anterior-posterior axis of the embryonic segments and patterns the larval imaginal disks. Binds to the patched (ptc) receptor, which functions in association with smoothened (smo), to activate the transcription of target genes wingless (wg), decapentaplegic (dpp) and ptc. In the absence of hh, ptc represses the constitutive signaling activity of smo through fused (fu). Essential component of a signaling pathway which regulates the Duox-dependent gut immune response to bacterial uracil required to activate Cad99C-dependent endosome formation, norpA-dependent Ca2+ mobilization and p38 MAPK, which are essential steps in the Duox-dependent production of reactive oxygen species (ROS) in response to intestinal bacterial infection. During photoreceptor differentiation, it up-regulates transcription of Ubr3, which in turn promotes the hh-signaling pathway by mediating the ubiquitination and degradation of cos.
B3P8A3
SPAST_DROER
Spastin (EC 5.6.1.1)
MVRTKNQSSSSSASSSSTKSPIKSSSGAGSSGGGVGGRQSTHRSSSASNVAAVVAGGSSAAGGGSSSNRRSPGSSPDGDDDTTTTDDLTPTTCSPRSGHHHTYGGYSSSVHKQNLYVVSFPIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPSELSREGDGQEQQLSNQPQRFRPIQPLEMAANRPGGGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSMARDRLHFLALREQDLQMQRLSLKEKPKVQAPSKPQKTREPMLAGMTNEPMKLRVRSSGYGPKATTSAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPPAVRRQFSSGRNTPPQRSRTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
ATP-dependent microtubule severing protein. Stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability in the neuromuscular junction synapse. Involved in lipid metabolism by regulating the size and distribution of lipid droplets. Involved in axon regeneration by regulating microtubule severing. {ECO:0000255|HAMAP-Rule:MF_03021}.
B3PC73
AGUA_CELJU
Extracellular xylan exo-alpha-(1->2)-glucuronosidase (EC 3.2.1.131) (Alpha-glucuronidase)
MSTFARLFLCLVFFASLQPAMAQTEDGYDMWLRYQPIADQTLLKTYQKQIRHLHVAGDSPTINAAAAELQRGLSGLLNKPIVARDEKLKDYSLVIGTPDNSPLIASLNLGERLQALGAEGYLLEQTRINKRHVVIVAANSDVGVLYGSFHLLRLIQTQHALEKLSLSSAPRLQHRVVNHWDNLNRVVERGYAGLSLWDWGSLPNYLAPRYTDYARINASLGINGTVINNVNADPRVLSDQFLQKIAALADAFRPYGIKMYLSINFNSPRAFGDVDTADPLDPRVQQWWKTRAQKIYSYIPDFGGFLVKADSEGQPGPQGYGRDHAEGANMLAAALKPFGGVVFWRAFVYHPDIEDRFRGAYDEFMPLDGKFADNVILQIKNGPIDFQPREPFSALFAGMSRTNMMMEFQITQEYFGFATHLAYQGPLFEESLKTETHARGEGSTIGNILEGKVFKTRHTGMAGVINPGTDRNWTGHPFVQSSWYAFGRMAWDHQISAATAADEWLRMTFSNQPAFIEPVKQMMLVSREAGVNYRSPLGLTHLYSQGDHYGPAPWTDDLPRADWTAVYYHRASKTGIGFNRTKTGSNALAQYPEPIAKAWGDLNSVPEDLILWFHHLSWDHRMQSGRNLWQELVHKYYQGVEQVRAMQRTWDQQEAYVDAARFAQVKALLQVQEREAVRWRNSCVLYFQSVAGRPIPANYEQPEHDLEYYKMLARTTYVPEPWHPASSSRVLK
Alpha-glucuronidase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. It catalyzes the cleavage of the alpha-1,2-glycosidic bond at the non-reducing end of 4-O-methyl-D-glucuronic acid (4-O-MeGlcA) side chain of short xylooligosaccharides and releases 4-O-methylglucuronic acid. It can also hydrolyze small soluble oligosaccharides such as dobiouronic acid, aldotriouronic acid, aldotetraouronic acid, and aldopentaouronic acid.
B3STU4
VCL_CARIL
Vicilin Car i 2.0101 (7S globulin) (7S seed storage protein) (Allergen Car i 2) (Cariv) (allergen Car i 2.0101)
MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQQCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYEQCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRDPREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRDNDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQEERERRRGRDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQRQQEERERQRGRDRQDPQQQYHRCQRRCQTQEQSPERQRQCQQRCERQYKEQQGREWGPDQASPRRESRGREEEQQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAGQNNIINQLEREAKELSFNMPREEIEEIFERQVESYFVPMERQSRRGQGRDHPLASILDFAGFF
Seed storage protein.
B3SV56
NR1D1_SHEEP
Nuclear receptor subfamily 1 group D member 1 (Rev-erbA-alpha) (V-erbA-related protein 1) (EAR-1)
MTTLDSNNNTGGVITYIGSSGSSPNRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLGDDGSPSSSSSSSSSSSSSFYNGSPPGGLQVALEDGNRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETPPTQHPTPGPMGPSPPPAPAPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGTSPGNFNANHASGNRPATTPHRWESQGCPPAPNDNIMAAQRHNEALNSLRQASSSYPPPWPPGATHHSCHQPNSNGHRLCPTHVYPAPEGEAPVNSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ
Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of the circadian clock by directly repressing the expression of core clock components BMAL1, CLOCK and CRY1. Also regulates genes involved in metabolic functions, including lipid and bile acid metabolism, adipogenesis, gluconeogenesis and the macrophage inflammatory response. Acts as a receptor for heme which stimulates its interaction with the NCOR1/HDAC3 corepressor complex, enhancing transcriptional repression. Recognizes two classes of DNA response elements within the promoter of its target genes and can bind to DNA as either monomers or homodimers, depending on the nature of the response element. Binds as a monomer to a response element composed of the consensus half-site motif 5'-[A/G]GGTCA-3' preceded by an A/T-rich 5' sequence (RevRE), or as a homodimer to a direct repeat of the core motif spaced by two nucleotides (RevDR-2). Acts as a potent competitive repressor of ROR alpha (RORA) function and regulates the levels of its ligand heme by repressing the expression of PPARGC1A, a potent inducer of heme synthesis. Regulates lipid metabolism by repressing the expression of APOC3 and by influencing the activity of sterol response element binding proteins (SREBPs) represses INSIG2 which interferes with the proteolytic activation of SREBPs which in turn govern the rhythmic expression of enzymes with key functions in sterol and fatty acid synthesis. Regulates gluconeogenesis via repression of G6PC1 and PEPCK and adipocyte differentiation via repression of PPARG. Regulates glucagon release in pancreatic alpha-cells via the AMPK-NAMPT-SIRT1 pathway and the proliferation, glucose-induced insulin secretion and expression of key lipogenic genes in pancreatic-beta cells. Positively regulates bile acid synthesis by increasing hepatic expression of CYP7A1 via repression of NR0B2 and NFIL3 which are negative regulators of CYP7A1. Modulates skeletal muscle oxidative capacity by regulating mitochondrial biogenesis and autophagy controls mitochondrial biogenesis and respiration by interfering with the STK11-PRKAA1/2-SIRT1-PPARGC1A signaling pathway. Represses the expression of SERPINE1/PAI1, an important modulator of cardiovascular disease and the expression of inflammatory cytokines and chemokines in macrophages. Represses gene expression at a distance in macrophages by inhibiting the transcription of enhancer-derived RNAs (eRNAs). Plays a role in the circadian regulation of body temperature and negatively regulates thermogenic transcriptional programs in brown adipose tissue (BAT) imposes a circadian oscillation in BAT activity, increasing body temperature when awake and depressing thermogenesis during sleep. In concert with NR2E3, regulates transcriptional networks critical for photoreceptor development and function. In addition to its activity as a repressor, can also act as a transcriptional activator. In the ovarian granulosa cells acts as a transcriptional activator of STAR which plays a role in steroid biosynthesis. In collaboration with SP1, activates GJA1 transcription in a heme-independent manner (By similarity). Represses the transcription of CYP2B10, CYP4A10 and CYP4A14 (By similarity). Represses the transcription of CES2 (By similarity). Represses and regulates the circadian expression of TSHB in a NCOR1-dependent manner (By similarity). Negatively regulates the protein stability of NR3C1 and influences the time-dependent subcellular distribution of NR3C1, thereby affecting its transcriptional regulatory activity (By similarity). Plays a critical role in the circadian control of neutrophilic inflammation in the lung under resting, non-stress conditions, acts as a rhythmic repressor to limit inflammatory activity whereas in the presence of inflammatory triggers undergoes ubiquitin-mediated degradation thereby relieving inhibition of the inflammatory response (By similarity). Plays a key role in the circadian regulation of microglial activation and neuroinflammation suppresses microglial activation through the NF-kappaB pathway in the central nervous system (By similarity). Plays a role in the regulation of the diurnal rhythms of lipid and protein metabolism in the skeletal muscle via transcriptional repression of genes controlling lipid and amino acid metabolism in the muscle (By similarity).
B3TLD6
LNBB_BIFB1
Lacto-N-biosidase (LNBase) (EC 3.2.1.140)
MEKSSNRRFGVRTVAAIVAGLMVGGMCTAMTASAADDSAAGYSATAPVNLTRPATVPSMDGWTDGTGAWTLGEGTRVVSSDALAARAQSLASELTKFTDVDIKAATGSATGKDISLTLDASKKAELGDEGFKLNIGSKGLEVIGATDIGVFYGTRSVSQMLRQGQLTLPAGTVATKPKYKERGATLCACQINISTDWIDRFLSDMADLRLNYVLLEMKLKPEEDNTKKAATWSYYTRDDVKKFVKKANNYGIDVIPEINSPGHMNVWLENYPEYQLADNSGRKDPNKLDISNPEAVKFYKTLIDEYDGVFTTKYWHMGADEYMIGTSFDNYSKLKTFAEKQYGAGATPNDAFTGFINDIDKYVKAKGKQLRIWNDGIVNTKNVSLNKDIVIEYWYGAGRKPQELVQDGYTLMNATQALYWSRSAQVYKVNAARLYNNNWNVGTFDGGRQIDKNYDKLTGAKVSIWPDSSYFQTENEVEKEIFDGMRFISQMTWSDSRPWATWNDMKADIDKIGYPLDIREYDYTPVDAGIYDIPQLKSISKGPWELITTPDGYYQMKDTVSGKCLALFTGSKHLDVVTQVGARPELRNCADVSVGQDQRNTANERNTQKWQIRADKDGKYTISPALTQQRLAIATGNEQNIDLETHRPAAGTVAQFPADLVSDNALFTLTGHMGMSATVDSKTVNPASPSKITVKVRAASNANTGDVTVTPVVPEGWEIKPGSVSLKSIPAGKAAIAYFNVVNTTGTGDATVQFKLTNTKTGEELGTTSVALTGSLTKDVEASDYAASSQETTGEHAPVGNAFDKNANTFWHSKYSNPSANLPHWLAFKASPGEGNKIAAITHLYRQDKLNGPAKNVAVYVVAASDANSVADVTNWGEPVATAEFPYTKELQTIALPNTIPSGDVYVKFQINDAWGLTETSAGVTWAAVAELAATAKATPVELTEPEQPKDNPEVTETPEATGVTVSGDGVANGALSLKKGTTAQLTAKVAPDDADQAVTWASSDDKVVTVDKTGKVTAVAKGVAKVTATTANGKSASVTVTVTEDSEVPGPTGPTEPTKPGTEKPTTKPTTKPNDGKLSATGADTAVLATIAALFALAGGAVVAVRRRSVR
Present in the infant gut, this enzyme is involved in the assimilation of type-1 human milk oligosaccharides (HMOs). It hydrolyzes via a retaining mechanism the beta-D-GlcNAc-(1->3)-beta-D-Gal linkage in lacto-N-tetraose (LNT or beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc), an abundant HMO unique to human breast milk, releasing lacto-N-biose (LNB or beta-D-Gal-(1->3)-D-GlcNAc) and lactose. Is a key enzymatic factor for growth and proliferation of B.bifidum in the gut ecosystem of breast-fed infants (Probable). Has substrate preference for unmodified beta-linked LNB since it does not hydrolyze the fucosylated forms of lacto-N-tetraose (lacto-N-fucopentaose I and II) or lacto-N-neotetraose. Is also able to display transglycosylation activity in vitro.
B3TMR8
KIJDR_ACTKI
dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase (EC 1.1.1.384) (3-ketoreductase) (NADPH-dependent C3-ketoreductase)
MENPANANPIRVGVIGCADIAWRRALPALEAEPLTEVTAIASRRWDRAKRFTERFGGEPVEGYPALLERDDVDAVYVPLPAVLHAEWIDRALRAGKHVLAEKPLTTDRPQAERLFAVARERGLLLMENFMFLHHPQHRQVADMLDEGVIGEIRSFAASFTIPPKPQGDIRYQADVGGGALLDIGVYPIRAAGLFLGADLEFVGAVLRHERDRDVVVGGNALLTTRQGVTAQLTFGMEHAYTNNYEFRGSTGRLWMNRVFTPPATYQPVVHIERQDHAEQFVLPAHDQFAKSIRAFAQAVLSGEHPREWSEDSLRQASLVDAVRTGARDIYFP
Involved in the biosynthesis of L-digitoxose, an unusual dideoxysugar attached to various pharmacologically active natural products, including the antitumor antibiotic tetrocarcin A, and the antibiotics kijanimicin and jadomycin B. Catalyzes the reduction of the C-3 keto moiety of dTDP-3,4-diketo-2,6-dideoxy-alpha-D-glucose to yield dTDP-4-keto-2,6-dideoxy-alpha-D-glucose. Also able to reduce dTDP-3-keto-6-deoxy-D-galactose and dTDP-3-keto-6-deoxy-D-glucose to yield dTDP-fucose and dTDP-quinovose, respectively.
B3TP03
CTR2_CHICK
Cationic amino acid transporter 2 (CAT-2) (CAT2) (cCAT-2) (Low affinity cationic amino acid transporter 2) (Solute carrier family 7 member 2)
MLPCGPALTFVRCLVRKKNIKGEGLEDSLCRCLSTLDLIALGVGSTLGAGVYVLAGEVAKSDSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVAVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLGKQISHFFKTYFKMNYPGLAEYPDFFAVFLILLLSGLLSFGVKESAWVNKIFTAINILVLLFVMISGFVKGDVDNWRISEEYLINLSEIAENFSSYKNVTSIYGSGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVVSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFAYVGWGPAKYVVAVGSLCALSTSLLGSMFPLPRIVFAMARDGLLFSFLAKVSKRQAPLLATLTAGVISAIMAFLFDLKALVDIMSIGTLLAYSLVATCVLILRYQPSLTYEQPKYSPEKATLAASKRESAVSESQINMIQESHFSLQTLINPSSLPTEQTATTVNCFVGLLAFLVCGLSALTTYGTHFIANLEPWSICLLATLVVSFIVTILLIQRQPQNQQKVAFMVPLLPFLPSLSILVNIYLMVQLSADTWIRFSIWMALGFIIYFTYGIRHSLEGRHSDGDGDSCSENSGLQEKNPVEEVDEPENANESDKFLARERTSEC
Low-affinity, high capacity permease involved in the transport of the cationic amino acids (L-arginine, L-lysine, L-ornithine and L-homoarginine).
B3VI55
LGK_LIPST
Levoglucosan kinase (LGK) (EC 2.7.1.232)
MPIATSTGDNVLDFTVLGLNSGTSMDGIDCALCHFYQKTPDAPMEFELLEYGEVPLAQPIKQRVMRMILEDTTSPSELSEVNVILGEHFADAVRQFAAERNVDLSTIDAIASHGQTIWLLSMPEEGQVKSALTMAEGAILASRTGITSITDFRISDQAAGRQGAPLIAFFDALLLHHPTKLRACQNIGGIANVCFIPPDVDGRRTDEYYDFDTGPGNVFIDAVVRHFTNGEQEYDKDGAMGKRGKVDQELVDDFLKMPYFQLDPPKTTGREVFRDTLAHDLIRRAEAKGLSPDDIVATTTRITAQAIVDHYRRYAPSQEIDEIFMCGGGAYNPNIVEFIQQSYPNTKIMMLDEAGVPAGAKEAITFAWQGMEALVGRSIPVPTRVETRQHYVLGKVSPGLNYRSVMKKGMAFGGDAQQLPWVSEMIVKKKGKVITNNWA
Levoglucosan kinase that catalyzes the transfer of a phosphate group from ATP to levoglucosan (1,6-anhydro-beta-D-glucopyranose, LG) to yield glucose 6-phosphate in the presence of magnesium ion and ATP (Ref.1, PubMed:21719279, PubMed:26354439). In addition to the canonical kinase phosphotransfer reaction, the conversion requires cleavage of the 1,6-anhydro ring to allow ATP-dependent phosphorylation of the sugar O-6 atom (Ref.1, PubMed:21719279, PubMed:26354439).
B3WFY8
DYF5_CAEEL
Serine/threonine-protein kinase dyf-5 (EC 2.7.11.1)
MSSAVKLADRYLMTKRLGDGTFGEVMLAKKIDTGDRVAIKRMKKKFYSWEEAMSLREVKSLKKLNHPNIIKLREVIRENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIYQVLQGLAFMHKNGFFHRDMKPENIMCNGTELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISILGTPNKDEWPEGYQLASAMNFRFQQVVATPMEQVVNTISKEGMKLMMDMMLWNPEKRPNANQSLRYKYFQVAEKLGAPVVSQPAPGSIRKTSAASVKSDTKAMTAKAAKKDYIGSENVSPQQPAKVIDRHINRNLPLNKETLFEKSDNKPLGPTKSNEAKPTAKEIYLSKSKYVPGQVSKDTHQNQIMTTNGLTGTTKTTTFSAKKEGRTAVQTRFEYAYGYIPSFGARQTGPTVSNQTNNHSANNSHSPNKMSNTGRVDWAAKYVK
Serine/threonine-protein kinase which is required for ciliogenesis. Regulates the length and the morphology of sensory neuron cilia. In addition, plays a role in the anterograde intraflagellar transport (IFT) in the cilia by regulating the undocking of kinesin-II motor complex (composed of klp-11, klp-20 and kap-1) before reaching the distal segment and the docking of kinesin motor osm-3 onto IFT cargos.
B3Y613
TLR2_PANTR
Toll-like receptor 2 (CD antigen CD282)
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFRFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLIVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNVDISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity). May also promote apoptosis in response to lipoproteins. Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2:TLR6:CD14:CD36 in response to diacylated lipopeptides and TLR2:TLR1:CD14 in response to triacylated lipopeptides (By similarity).
B3Y614
TLR2_PANPA
Toll-like receptor 2 (CD antigen CD282)
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYESKSLKSIQNVSHLILHMKQHILLLEIFVDVSSSVECLELRDTDLDTFRFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLIVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNVDISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity). May also promote apoptosis in response to lipoproteins. Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2:TLR6:CD14:CD36 in response to diacylated lipopeptides and TLR2:TLR1:CD14 in response to triacylated lipopeptides (By similarity).
B3Y615
TLR2_GORGO
Toll-like receptor 2 (CD antigen CD282)
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNVDISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity). May also promote apoptosis in response to lipoproteins. Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2:TLR6:CD14:CD36 in response to diacylated lipopeptides and TLR2:TLR1:CD14 in response to triacylated lipopeptides (By similarity).
B3Y618
TLR2_MACMU
Toll-like receptor 2 (CD antigen CD282)
MPHTLWMVWVLGVIISLSKEESSNQASLSCDHNGICKGSSGSLNSIPSVLTEAVKCLDLSNNRITYISNSDLQRYVNLQALVLTSNGINTIEEDSFSSLGRLEHLDLSYNYLSNLSSSWFKPLSSLKFLNLLGNPYKTLGETSLFSHLTKLRILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDLTSSVECLELRDTDLNTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLSQISGLLELEFDDCTLNGVGDFRGSDNDRVIDPGKVETLTIRRLHIPQFYSFNDLSTLYPLTERVKRITVENSKVFLVPCLLSRHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLGKIGETLLTLKNLTNLDISKNTFHYMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDISNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNTITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLVDWPANYLCDSPSHVRGQRVQDVRLSVSECHRAALVSGMCCALFLLILLMGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPNRDICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILVLLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEARQEGFWVNLRAAIKS
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity). May also promote apoptosis in response to lipoproteins. Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2:TLR6:CD14:CD36 in response to diacylated lipopeptides and TLR2:TLR1:CD14 in response to triacylated lipopeptides (By similarity).
B4E9I9
KYNB_BURCJ
Kynurenine formamidase (KFA) (KFase) (EC 3.5.1.9) (Arylformamidase) (N-formylkynurenine formamidase) (FKF)
MDTLWDISPPVSPATPVWPGDTPVAVERVWRMEAGSPVNVARLTLSPHTGAHCDAPLHYDADGAPIGAVPLDTYLGPCRVIHCIGAAPVVRPADVEAALDGVPPRVLLRTYARAAVEQWDSNFCAVAPDTVDLLAAHGVKLIGIDTPSLDPQESKTMDAHRRVRAHRMAILEGIVLDDVPPGDYELIALPLKFATLDASPVRAVLRALPAQAS
Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. {ECO:0000255|HAMAP-Rule:MF_01969, ECO:0000269|PubMed:24942958}.
B4EUF7
ENO_PROMH
Enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (2-phosphoglycerate dehydratase)
MSKIVKVLGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVLKAVEAVNGPIAKALLGQDAKDQANIDKIMIDLDGTENKSNFGANAILAVSLANAKAAAAAKGMPLYEHISDLNGTHGQYSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAPTLKEAVRMGSEIFHHLAKVLKAKGMNTAVGDEGGYAPNLESNAAALAAIKEAVEAAGYVLGKDVTLAMDCAASEFYNNETGNYELKGEGKTFTSQEFTHYLEELTKQYLIVSIEDGLNESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIDKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAIISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGSKAPFNGLKEVKGQA
Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis. {ECO:0000255|HAMAP-Rule:MF_00318, ECO:0000269|PubMed:31328167}.
B4EVF5
NPD_PROMH
NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog)
MMKLKLRHRRLRKFRKIKSLRRQHSRCRYFHLTHKTEHEMNLPKVVVLTGAGISAESGIKTFRSEDGLWEEHRVEDVATPEGYHRNPKLVQQFYNERRRQLQQPSIQPNEAHYALAKLEQYLGKDNFLLVTQNIDNLHEKAGSKHILHMHGELLKVRCPQSGQVFEWKGDLSTTDYCHCCQFPSPLRPHIVWFGEMPIGMDEIYHALAQADLFIAIGTSGNVYPAAGFVHEARLTGAHTVELNLEPSLVESEFEEKHYGPASQVVDAYVHKLFDLINDPKADLTQ
NAD-dependent lysine deacetylase that specifically removes acetyl groups on target proteins. Also acts as a protein-lysine deacylase by mediating protein desuccinylation and de-2-hydroxyisobutyrylation. Modulates the activities of several proteins which are inactive in their acylated form. Catalyzes deacetylation and de-2-hydroxyisobutyrylation of Eno at 'Lys-326' and 'Lys-343', respectively, thereby promoting the enolase activity. {ECO:0000255|HAMAP-Rule:MF_01121, ECO:0000269|PubMed:31328167}.
B4EY22
CAIT_PROMH
L-carnitine/gamma-butyrobetaine antiporter
MSKDNKKAGIEPKVFFPPLIIVGILCWLTVRDLDASNEVINAVFSYVTNVWGWAFEWYMVIMFGGWFWLVFGRYAKKRLGDEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISSPPFGMEGYSAPAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLTPLVGEKHVNGLFGTVVDNFYLVALILAMGTSLGLATPLVTECIQYLFGIPHTLQLDAIIISCWILLNAICVAFGLQKGVKIASDVRTYLSFLMLGWVFIVGGASFIVNYFTDSVGTLLMYMPRMLFYTDPIGKGGFPQAWTVFYWAWWVIYAIQMSIFLARISKGRTVRELCLGMVSGLTAGTWLIWTILGGNTLQLIDQNILNIPQLIDQYGVPRAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCRSMKEGAEPPLLVRIGWSVLVGIIGIILLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDCSPYTQKMTH
Catalyzes the exchange of L-carnitine for gamma-butyrobetaine. {ECO:0000255|HAMAP-Rule:MF_01049, ECO:0000269|PubMed:20829798, ECO:0000269|PubMed:24101465}.
B4F6I5
FICD_XENTR
Protein adenylyltransferase FICD (EC 2.7.7.108) (AMPylator FICD) (De-AMPylase FICD) (EC 3.1.4.-) (FIC domain-containing protein)
MAVTECEWASLGSRIGLRAALVLLSGSLLVVLFPLSGLEHQYRTALNILLQCNLWGGDDRHTFTGQTRGLAVASTAIELLVLKQKPTSDVKFEAKAALNQALEMKRQGKKEKAHKLLHHALKMDPDHVDALNELGILLEEEKDIIQADYLYSKALTISPHNEKALINRDRTLPLVEEIDQRYFSLIDSKVKKLMSIPKGNPALRRVMEESYYHHIYHTVAIEGNTLSLSEIRHIIETRYAVPGKSLEEQNEVIGMHAAMKYVNATLVSRIGSVTIDNILEIHRRILGYVDPVEAGRFRRNQVFVGHHIPPHPRDVEKLMQEFVQWLNSEEAMSLHPVEFAALAHYKLVYIHPFVDGNGRTSRLLMNLILMQAGYPPITVRKEQRSEYYHVLEIANEGDVRPFIRFIAKCTESTLDLLLIATAEHPVGLPEPNHGFSECKQTITIKT
Protein that can both mediate the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins (AMPylation), and the removal of the same modification from target proteins (de-AMPylation), depending on the context (By similarity). The side chain of Glu-222 determines which of the two opposing activities (AMPylase or de-AMPylase) will take place (By similarity). Acts as a key regulator of the ERN1/IRE1-mediated unfolded protein response (UPR) by mediating AMPylation or de-AMPylation of HSPA5/BiP (By similarity). In unstressed cells, acts as an adenylyltransferase by mediating AMPylation of HSPA5/BiP at 'Thr-518', thereby inactivating it (By similarity). In response to endoplasmic reticulum stress, acts as a phosphodiesterase by mediating removal of ATP (de-AMPylation) from HSPA5/BiP at 'Thr-518', leading to restore HSPA5/BiP activity (By similarity).
B4F6N6
LOXL2_XENTR
Lysyl oxidase homolog 2 (EC 1.4.3.13) (Lysyl oxidase-like protein 2)
MLVTHIFLLTLSLSVPTLGQYEHWLYYPEYQASQAPEPLPTPARNVPQIHVRLAGEKRKHNEGRVEVYYEGEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKYGKGEGRIWLDNVNCNGREKSIASCGSNGWGVTDCKHSEDVGVQCSDRRIPGFKVSNELPGQLEGLNIQVEEVRIRAILSAYRKRVPVTEGFVEVKVQGSWRQVCNAEWSSKNSRVVCGMFGFPAEKKFNNKVYKLFSSRRKHTYWQFSANCTGNEAHLSSCKVGGVLTPDPKTNQTCSDGSPAVVSCTPGRAFAPSPGTGFGKAFRQEQPLVRLRGGANTGEGRVEVLKNGEWGTICDDKWNLVTASVVCRELGFGSAKEALAGAQMGQGMGHIHMSEIQCNGFEKSLIDCKFNVHSQGCNHEEDAAVRCNVPAMGFENQVRLSGGRHPTEGRVEVLMERNGTLRWGTVCSDTWGTMEAMIVCRQLGLGFASHAFQETWYWQGDINADDVVMSGVKCSGTEMSLAHCRHDGANINCPRGGGRFAAGVSCVETAPDLVLNAALVEQTTYLEDRPMFMLQCAHEEQCLSSSADRTSPTTGYRRLLRFSSQIHNNGQADFRPKTGRHSWIWHDCHRHYHSMEVFTHYDLLSLNGTKVAEGHKASFCLEDSECETDVQKQYACANFGEQGITVGCWDVYRHDIDCQWVDITDVAPGDYFFQVIINPNQEVAESDYTNNIMKCRCRYDGHRIWMYNCHIGGSYSTETEEKFEHFSGLMNNQLSTR
Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine). Acts as a transcription corepressor and specifically mediates deamination of trimethylated 'Lys-4' of histone H3 (H3K4me3), a specific tag for epigenetic transcriptional activation. Shows no activity against histone H3 when it is trimethylated on 'Lys-9' (H3K9me3) or 'Lys-27' (H3K27me3) or when 'Lys-4' is monomethylated (H3K4me1) or dimethylated (H3K4me2). Also mediates deamination of methylated TAF10, a member of the transcription factor IID (TFIID) complex, which induces release of TAF10 from promoters, leading to inhibition of TFIID-dependent transcription. LOXL2-mediated deamination of TAF10 results in transcriptional repression of genes required for embryonic stem cell pluripotency. Involved in epithelial to mesenchymal transition (EMT) and participates in repression of E-cadherin, probably by mediating deamination of histone H3. When secreted into the extracellular matrix, promotes cross-linking of extracellular matrix proteins by mediating oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Acts as a regulator of sprouting angiogenesis, probably via collagen IV scaffolding. Acts as a regulator of chondrocyte differentiation, probably by regulating expression of factors that control chondrocyte differentiation.
B4F753
ABD12_XENTR
Lysophosphatidylserine lipase ABHD12 (EC 3.1.-.-) (2-arachidonoylglycerol hydrolase ABHD12) (Abhydrolase domain-containing protein 12) (Monoacylglycerol lipase ABHD12) (EC 3.1.1.23) (Oxidized phosphatidylserine lipase ABHD12) (EC 3.1.-.-)
MRKRAEPVPPEHESFGRAPLDRECSIKQKLRIPGTKGHYPHDSDCDSKGMKRFGRRYGLWSRLRMFLIFLLGLYIAIPFLVKICPAIQTQLVFLNLVRFPYFIDLKRPEDQGLNHTCNFYLQPEEDVSIGVWHTVPAVLWKDAQGKDLEWYEEVLSTSYPVILYLHGNAGTRGGDHRVQLYKVLSSMGYHVISFDYRGWGDSVGSPSESGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDSLILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITASGIKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYNIAAPARSLRDYKVQFVPFHKDLGYRHKYIYRSPELRQILRDFLGNTEQQ
Lysophosphatidylserine (LPS) lipase that mediates the hydrolysis of lysophosphatidylserine, a class of signaling lipids that regulates immunological and neurological processes (By similarity). Represents a major lysophosphatidylserine lipase in the brain, thereby playing a key role in the central nervous system (By similarity). Also able to hydrolyze oxidized phosphatidylserine oxidized phosphatidylserine is produced in response to severe inflammatory stress and constitutes a proapoptotic 'eat me' signal. Also has monoacylglycerol (MAG) lipase activity: hydrolyzes 2-arachidonoylglycerol (2-AG), thereby acting as a regulator of endocannabinoid signaling pathways. Has a strong preference for very-long-chain lipid substrates substrate specificity is likely due to improved catalysis and not improved substrate binding (By similarity).
B4F769
SMAL1_RAT
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (EC 3.6.4.-) (HepA-related protein) (Sucrose nonfermenting protein 2-like 1)
MSLPLTEEQRKKIEENRQKALARRAEKLWAEQPQSTASGSSAARPSQCKQNSLLNLPAEPSKPEGHATISKGQNLNNSLPAAQRPHSSPCFQPSTAEEAKGLWKSEGKMSAACPNPSPPEVSNQQLLGSKSSEGHPQATQDTAASCPRPFPRDPKLEAKAGRPSTSGQSISDTFYALGEKTPKTDGRPAKALQTSPQKASCLRGMCLRTGDRFRVKIGYNKELIEVFKSLPSRRYDSFTKTWDFSMSDYRALMKAVERLSTVSLQPLEEVDGTGGQTSLPSAPSLTFVTGRCMLISRARFEVDIGYSEVVIALFKQMESRNYDPKTRKWNFLLEEHNKLIARSRELKQVQLDPLPKTLTLAFASQLEKTSLQSKADVPEADLSGVDAKLVSNLMPFQREGVSFAISKRGRLLLADDMGLGKTIQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPEDINVVVTGKGRLTAGLVNIVSFDLLSKLEKQLKTPFKVVIIDESHFLKNIKTARCRAAVPILKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFPQFHAFGLRYCDAKRLPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRKMVVVNPGRISTRAKAALDAAAKEMTKDKTKQQQKEALLVFFNRTAEAKIPCVIEYILDLLESGREKFLVFAHHKVLLDAIAKELERKNVQHIRIDGSTPSADREDLCQQFQLSKGHTVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVGIHYLVAKGTADDYLWPLIQEKIKVLGEAGLSETNFSEMTEATDYLYKDPKQKTIYSLFQQSFEDDGNDMEFLEAAESFELGSTSGTSGNSSQELGDITDENALADSPPKKRRFEFFDNWDSFTSPF
ATP-dependent annealing helicase that binds selectively to fork DNA relative to ssDNA or dsDNA and catalyzes the rewinding of the stably unwound DNA. Rewinds single-stranded DNA bubbles that are stably bound by replication protein A (RPA). Acts throughout the genome to reanneal stably unwound DNA, performing the opposite reaction of many enzymes, such as helicases and polymerases, that unwind DNA. May play an important role in DNA damage response by acting at stalled replication forks (By similarity).
B4F779
DP13B_RAT
DCC-interacting protein 13-beta (Adapter protein containing PH domain, PTB domain and leucine zipper motif 2)
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSRQLLAYEKQNFALGKGDEEVISTLHYFSKVMDELNGLHSELAKQLADTMVLPVIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKRKENERVKTDVAKEVAAARRKQHLSSLQYYCALNALQYRKRAAMMEPLIGFAHGQINFFKKGAEMFSKSMDGFLSSVTDMVQSIQVELEAEADKMRVSQQELLSVSESVYTPDIDVATPQINRNLIQKTGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQISTPSGKPGIILQAESRKEYEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESFYFSQNIKNSDTGYVKIVPKAAASIPETEELIAPGTPIQFDIVLPATEFLDQNRGSRRINPFGETEDDSFPDAEDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRTTESHLMVTSQTLRLIDPQTQVSRACFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICYAINLGKEIIEVQKDPEALARLMLSVPLTNDGKYVLLNDQADDTGGSPSDHRGAESEA
Multifunctional adapter protein that binds to various membrane receptors, nuclear factors and signaling proteins to regulate many processes, such as cell proliferation, immune response, endosomal trafficking and cell metabolism. Regulates signaling pathway leading to cell proliferation through interaction with RAB5A and subunits of the NuRD/MeCP1 complex (By similarity). Plays a role in immune response by modulating phagocytosis, inflammatory and innate immune responses. In macrophages, enhances Fc-gamma receptor-mediated phagocytosis through interaction with RAB31 leading to activation of PI3K/Akt signaling. In response to LPS, modulates inflammatory responses by playing a key role on the regulation of TLR4 signaling and in the nuclear translocation of RELA/NF-kappa-B p65 and the secretion of pro- and anti-inflammatory cytokines. Also functions as a negative regulator of innate immune response via inhibition of AKT1 signaling pathway by forming a complex with APPL1 and PIK3R1 (By similarity). Plays a role in endosomal trafficking of TGFBR1 from the endosomes to the nucleus (By similarity). Plays a role in cell metabolism by regulating adiponecting ans insulin signaling pathways and adaptative thermogenesis (By similarity). In muscle, negatively regulates adiponectin-simulated glucose uptake and fatty acid oyidation by inhibiting adiponectin signaling pathway through APPL1 sequestration thereby antagonizing APPL1 action (By similarity). In muscles, negativeliy regulates insulin-induced plasma membrane recruitment of GLUT4 and glucose uptake through interaction with TBC1D1 (By similarity). Plays a role in cold and diet-induced adaptive thermogenesis by activating ventromedial hypothalamus (VMH) neurons throught AMPK inhibition which enhances sympathetic outflow to subcutaneous white adipose tissue (sWAT), sWAT beiging and cold tolerance (By similarity). Also plays a role in other signaling pathways namely Wnt/beta-catenin, HGF and glucocorticoid receptor signaling (By similarity). Positive regulator of beta-catenin/TCF-dependent transcription through direct interaction with RUVBL2/reptin resulting in the relief of RUVBL2-mediated repression of beta-catenin/TCF target genes by modulating the interactions within the beta-catenin-reptin-HDAC complex (By similarity). May affect adult neurogenesis in hippocampus and olfactory system via regulating the sensitivity of glucocorticoid receptor. Required for fibroblast migration through HGF cell signaling (By similarity).
B4F7B7
DUS15_RAT
Dual specificity protein phosphatase 15 (EC 3.1.3.16) (EC 3.1.3.48)
MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIVSIHESPQPLLQDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVHCFAGISRSTTVVIAYVMTVTGLGWQEVLEAIKASRPIANPNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEEDLRALLPLCRRCRQGPGTSAPSATTASSAASEGTLQRLVPRSPRESHRPLPLLARVKQTFFCLPRCLSRKGGK
May play a role in the regulation of oligodendrocyte differentiation. May play a role in the regulation of myelin formation. Involved in the regulation of Erk1/2 phosphorylation in Schwann cells the signaling may be linked to the regulation of myelination. May dephosphorylate MAPK13, ATF2, ERBB3, PDGFRB and SNX6 (By similarity).
B4F7C5
LRRT4_RAT
Leucine-rich repeat transmembrane neuronal protein 4
MGFRLITQLKGMSVLLVLFPTLLLVMLTGAQRACPKNCRCDGKIVYCESHAFADIPENISGGSQGLSLRFNSIQKLKSNQFAGLNQLIWLYLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDLSYNKLQTLQSEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKELHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSVSQGLTWTWSSLHTLDLSGNDIQAIEPGTFKCLPNLQKLNLDSNKLTNVSQETVNAWISLISITLSGNMWECSRSICPLFYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSDVQVVNTERSHLAPQTPQKPPFFPKPTIFKSDAIPATLEAVSPSPGFQIPGTDHEYEHVSFHKIIAGSVALFLSVAMILLVIYVSWKRYPASMKQLQQHSLMKRRRKKARESERQMNSPLQEYYVDYKPTNSETMDISVNGSGPCTYTISGSRECEMPHHVKPLPYYSYDQPVIGYCQAHQPLHINKAYEAVSIEQDDSPSLELGRDHSFIATIARSAAPAIYLERITN
May play a role in the development and maintenance of the nervous system (By similarity). Exhibits strong synaptogenic activity, restricted to excitatory presynaptic differentiation. {ECO:0000250, ECO:0000269|PubMed:19285470}.
B4F7E7
PALS1_RAT
Protein PALS1 (MAGUK p55 subfamily member 5) (Protein associated with Lin-7 1)
MTTSYMNGHVTEESDSGIKNLGLASPEEHPKHREMAVDCPGDLGTRLMPVRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVKILEVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVTVHMNKASPPFPLIANVQDLVQEVQTVLKPVHQKEGQELTALLNAPHIQALLLAHDKVAEQEMQLEPITDERVYESIGHYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRAQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR
Plays a role in tight junction biogenesis and in the establishment of cell polarity in epithelial cells (By similarity). Also involved in adherens junction biogenesis by ensuring correct localization of the exocyst complex protein EXOC4/SEC8 which allows trafficking of adherens junction structural component CDH1 to the cell surface (By similarity). Plays a role through its interaction with CDH5 in vascular lumen formation and endothelial membrane polarity (By similarity). Required during embryonic and postnatal retinal development (By similarity). Required for the maintenance of cerebellar progenitor cells in an undifferentiated proliferative state, preventing premature differentiation, and is required for cerebellar histogenesis, fissure formation, cerebellar layer organization and cortical development (By similarity). Plays a role in neuronal progenitor cell survival, potentially via promotion of mTOR signaling (By similarity). Plays a role in the radial and longitudinal extension of the myelin sheath in Schwann cells (By similarity). May modulate SC6A1/GAT1-mediated GABA uptake by stabilizing the transporter (By similarity). May play a role in the T-cell receptor-mediated activation of NF-kappa-B (By similarity). Required for localization of EZR to the apical membrane of parietal cells and may play a role in the dynamic remodeling of the apical cytoskeleton (By similarity). Required for the normal polarized localization of the vesicular marker STX4 (By similarity). Required for the correct trafficking of the myelin proteins PMP22 and MAG. Involved in promoting phosphorylation and cytoplasmic retention of transcriptional coactivators YAP1 and WWTR1/TAZ which leads to suppression of TGFB1-dependent transcription of target genes such as CCN2/CTGF, SERPINE1/PAI1, SNAI1/SNAIL1 and SMAD7 (By similarity).
B4FK49
NDK1_MAIZE
Nucleoside diphosphate kinase 1 (EC 2.7.4.6) (Nucleoside diphosphate kinase I) (NDK I) (NDP kinase I) (NDPK I) (ZmNDPK1)
MESTFIMIKPDGVQRGLIGEIISRFEKKGFYLKALKLVNVERSFAEKHYADLASKPFFQGLVDYIISGPVVAMVWEGKSVVTTGRKIIGATNPLASEPGTIRGDFAVDIGRNVIHGSDSIESANKEIALWFPEGPADWQSSQHPWIYEK
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Involved in transcription regulation (Probable). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds folded G4 with low nanomolar affinity and corresponding unfolded G-rich DNA more weakly. Stabilizes folded G4s regardless of whether they are prefolded or not.
B4FZ81
PTA12_MAIZE
Protein PLASTID TRANSCRIPTIONALLY ACTIVE 12, chloroplastic (ZmpTAC12)
MASCYNPWRLFPGMSTAVPAGPVTAPAHSRTCKSSKVFSALPHRRGLLFLGTRRARIKCVKDDSLHFDPSKIEPPPYSSYFDSTSGQLEPASGARASIPGKEYWPEGTAARVRAARAPAPVGESAGMPSFGTKPGSRRRGYKEQVTSASGTEGAQTDDRKDGDEPDVAIIGSGDDALEEIKDSVDEYVIYETPEEEELSEYDMDKMMGRPHPFIDPAKAMSLGEPKTSEELWWHWRRKSQEEEMWSRWQRRRPDVDTVFAKAMAETGQIKIFGDHPSRTEAALAKTRRHLYKEERLEAEQRRLEEIGPIAYYSEWVEAYKNKDTSREAIQKHFEETGEDENVQLIKMFQHQTAGEYRIMMGTDVRIQRDPLAMRMREDQIKQIWGGDPVYPTINYVQDPDEVIDYRGPEFHEPTPEVVPYLMEHGIMITKEELYARLNEEREDVNQDITYIPEAKDPMATAIDIGEHSYNEDSDDEDEDVDKAAAQPQSLEDEEDDRDDVAEVEEKVNQNWSALKSTGQAEKPKEKSKKDEMTLKEAIDDSENLTDFLMDFEETE
Required for the activity of the plastid-encoded RNA polymerase (PEP) and full expression of genes transcribed by PEP. Required for the proper build-up and formation of the PEP-complex. Binds single-stranded (ss) DNA and RNA, but not double-stranded (ds) DNA.
B4G2I8
HH_DROPE
Protein hedgehog (EC 3.1.-.-) [Cleaved into: Protein hedgehog N-product]
MDNHNEVPMSMSAPWASAARVTCLSLDAKCHRPCPSSISASASASGCASDSAAIATTKLRHIAYTQRCSSRLTMLMTVLLLLLPLSFTPAHSCGPGRGLGRRRERNLYPLVLKQTIPNLSEYQSGASGPLEGEIKRDSPKFKDLVPNYNRDILFRDEEGTGADRLMTKRCKEKLNVLAYSVMNEWPGVRLLVTESWDEDHQHGQESLHYEGRAVTIATSDREPSRYGMLARLAVEAGFDWVSYVSRRHIYCSVKSDSSISSHVHGCFTPESTALLESGITKPLSEIAIGDRVLSMGSNGQPVYSEVILFMDRNLEQMQNFVELHTDGGAVLTVTPAHLISVWHPERQQLDYVFADRVEELNYVLVRDPQTGELRPQRVVRVGSVRSKGVVAPLTREGTIVVNSVAASCYAVIDSQSLAHWGLAPMRILAMLQSWMPAKDQLRSSQTEGVVSRAEQQNGIHWYANALYKVKDYVLPKSWRHD
[Protein hedgehog]: The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product) (By similarity). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Once cleaved, the C-product has no signaling activity and diffuses from the cell (By similarity). [Protein hedgehog N-product]: The dually lipidated hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Establishes the anterior-posterior axis of the embryonic segments and patterns the larval imaginal disks. Binds to the patched (ptc) receptor, which functions in association with smoothened (smo), to activate the transcription of target genes wingless (wg), decapentaplegic (dpp) and ptc. In the absence of hh, ptc represses the constitutive signaling activity of smo through fused (fu). Essential component of a signaling pathway which regulates the Duox-dependent gut immune response to bacterial uracil required to activate Cad99C-dependent endosome formation, norpA-dependent Ca2+ mobilization and p38 MAPK, which are essential steps in the Duox-dependent production of reactive oxygen species (ROS) in response to intestinal bacterial infection. During photoreceptor differentiation, it up-regulates transcription of Ubr3, which in turn promotes the hh-signaling pathway by mediating the ubiquitination and degradation of cos.
B4G437
SPAST_DROPE
Spastin (EC 5.6.1.1)
MVRTKNQSSSSSASSSSHKSPIKSHGGSGSAAAGTAGHPVSRSSSSHRTSIDDRKSATNVSSSSNRRTTPGSSPDGDGDDDTTTTDDLTPTSTSAPRSAGGPSSVHKQNLYVVSFPIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNNSNNKDQKHQQLTSSQSLNYPLEVTSGEAASEQQVQQPLPQQRYRALQPLEMAGANRSGSGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSMARDRLHFLALREEDFQMHRLSLKEKQKANESREQQQKPQKAREAADKPMLTNLTNDPAKLKTRSSGYGPKNGLTTPRIFATATTPTSSSSLASGRKLTIGTKRPGNLAVAANKSQTLPRNLGSKTSVGAVRQPGKTAATPPAVRRQFSSGRNTPPQRSRTPINNNGASGSGSGASTPVVTVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQEVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHLQPSIIFIDEVDSLLSERSSGEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTDALRRLSKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDINAMRHITEKDFHNSLKRIRRSVAPQSLSLYEKWSSDYGDITI
ATP-dependent microtubule severing protein. Stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability in the neuromuscular junction synapse. Involved in lipid metabolism by regulating the size and distribution of lipid droplets. Involved in axon regeneration by regulating microtubule severing. {ECO:0000255|HAMAP-Rule:MF_03021}.
B4GAJ1
LIS1_DROPE
Lissencephaly-1 homolog
MKMVLSQRQREELNQAIADYLGSNGYGDSLETFRKEADVSTESEKKFGGLLEKKWTSVIRLQKKVMELEAKLTEAEKEVIEGAPTKNKRTPGEWIPRPPEKYSLTGHRASITRVIFHPIFGLMVSASEDATIKIWDFETGEYERSLKGHTDSVQDVAFDSQGKLLASCSADLSIKLWDFQQSYECVKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDHTIRVWLMNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLNGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR
Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes. {ECO:0000255|HAMAP-Rule:MF_03141}.
B4GBH0
PTK7_DROPE
Tyrosine-protein kinase-like otk (Tyrosine-protein kinase-like 7 homolog)
MDMDVMMISMCILASTLMAPGWASTSGFLRVPQSQSIVENEAADFGCEATDPASYLHYEWLHNGREISYDKRVYRIGSHLHIEAVQREEDVGDYVCIATSLASGAREASPPAKLSVIYLESASVQLLGSNRNELLLKCHVEGASGDEPLQIEWYRDSARLASWGNVHLEEHRLLVRQPSPSDDGLYRCTASNAAGRVMSKQGYVYQANIKCLPRLLKKNQKLPESWGKQTFLCRGKRGGSGGLDQALSPAPEDLRIVQGPAGQLLIKEGDSAALSCLYELPAELQNQRIQLRWRKDGKLLRHVELGGAIPIPGHAHDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEGHAPLNSSPGLLEVIEQLKFVPQPTSKNLELDAAVAKVHCKAQGTPSPQVQWLREGSLNSSLPDQVEVDINGTLIFRNVRAEHRGNYTCQARSSQGQISATVSINVVVTPKFSVPPVGPIETTEQGTVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRERFSFLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVRSTGDGFAPEETGGDGFLVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNELSIKEAGGDQPDASVTNGKGSEQEPCLSKQRNGASGKPKSKSNGDAQKSDDTACSQQSRSSKKSVYEQLVLPRSGLSELLQIGRGEFGDVFVGKLKASLVAASAQSDKDADTEKQHSNSENGSGGSGSGSGSTTLSTLNEKRRSKTSMDDIEEIKEEEPEQSALEQLVLVKALNKVKDEQACQEFRRQLDLLRGISHKGVVRLFGLCREKDPHYMVLEYTDWGDLKQFLLATAGKVNTATATSSPPALTTSQVLAVAYQIARGMDAIYRSRCTHRDLATRNCVISSEFVVKVSYPALCKDKYSREYHKHRNTLLPVRWLAPECIQEDEYTTKSDIFAYGVLVWELFNQATKLPHEELTSEQVIQRSQAGTLEWTVAEATPDSLKEILLSCWLANPKERPSFSQLGSALSKAMQSVAEK
Acts as a calcium-dependent, homophilic cell adhesion molecule that regulates neural recognition during the development of the nervous system. Component of the repulsive Plexin signaling response to regulate motor axon guidance at the embryonic stage. Also component of a receptor complex that is required in the adult visual system to innervate the lamina layer specific targeting of R1-R6 axons (By similarity).
B4GFJ8
RAS1_DROPE
Ras-like protein 1 (EC 3.6.5.2)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLTTWNVKNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKLNKPNRRFKCKIL
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays a role in eye development by regulating cell growth, survival of postmitotic ommatidial cells and differentiation of photoreceptor cells. During larval development, mediates Ptth/tor signaling leading to the production of ecdysone, a hormone required for the initiation of metamorphosis.
B4GJC1
FICD_DROPE
Protein adenylyltransferase Fic (EC 2.7.7.108) (De-AMPylase Fic) (EC 3.1.4.-)
MAMTILHASEKVNAEAEATTCPPTEKVKEEQQQQEQLQHSKTSKRVQFYRFALFFIAGSFAAFSFHALTSSSSWRLRQLHHLPNAHYLQTREEFAVYSVEELNAFKEFYDKSISDSVGASYSEAEQTNIKEALGALRLAQDMHLSGKDDKASRLFEHALALAPKHPEVLLRYGEFLEHNQRNIVLADQYYFQALTLCPSNSEALANRQRTAEVVQTLDERRLQSLDSKRDALSAIHESSSALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKLEITIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLALLMQRFERWLNSEHSSSLHPVNYAAYAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGEQLAQMRSPHISAQSASIPEFYEFSGSGFQP
Protein that can both mediate the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins (AMPylation), and the removal of the same modification from target proteins (de-AMPylation), depending on the context (By similarity). The side chain of Glu-261 determines which of the two opposing activities (AMPylase or de-AMPylase) will take place (By similarity). Acts as a key regulator of the unfolded protein response (UPR) by mediating AMPylation or de-AMPylation of Hsc70-3/BiP. In unstressed cells, acts as an adenylyltransferase by mediating AMPylation of Hsc70-3/BiP at 'Thr-518', thereby inactivating it. In response to endoplasmic reticulum stress, acts as a phosphodiesterase by mediating removal of ATP (de-AMPylation) from Hsc70-3/BiP at 'Thr-518', leading to restore HSPA5/BiP activity (By similarity).
B4GKZ8
IHOG_DROPE
Interference hedgehog
MSPLTSSLLLFSLLTSSLEAIPVLQPSFPPSSPSPAPSPGVRILRAPESIVAPLGDEVVFECETSLQPEGFEWSYRRWPNAANSNGSVGASRFKYLKSGNGKLNVTQETAISRLRVLVRPDTVGEYRCIGWFGPLVVTSTTARLELANTSVKGRQETHLQWRVAPGNSVLWSCGQQVHSNPSASWSYYRNGVEIKPELAATNGNLFLTNVSTASAGKYTCLATNPASGARIEISSSMVLEVLSGRGSQNKAPHLLSGQPTSQAVTIREGSTLLLLCPGVGSPTPTAVWSSPDVVEAIHNKRTRVLNHGLEISNVQGHDTGTYICYLDNGVRPTLEHFINVTVEVPPRITRPPWADLTNEGERMQLECEATGVPAPELYWLLNGESSINDTEAEQLPNGYLVLHSVQKRHAGYVQCFARNRLGEQSAGTLLQVNPKQIQSEPRETGSGGGFGSHRSMKPVNHGQKPTKMIPPSPPNVTRLSDESVMLRWHVPRNDGLLILFFKVQYRMISEGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQRTYRFRILAVYSNNDNKESNTSAKFYLQPGAALEPMPVPELLEIEEYSETAVVLHWRLDSDADEHLITGYYAYYRPSSSAGEYYKATIEGAHARSFQIATLEAATIYEFKLQSFSAVSASEFSALKQGRTQRPRASTTEEPTIQGIGDRDTTSHNQPSHNETVSMSPMLTGTIGGGALLLILLVSAFLCMCRRRSPRGRGQTQNKPRMAELREDFVPLGSCSPNKQRQRTRHIHITLNPLAQQQQQQLDEKNPPGLETDNDMAYFQRQPTYEYDPGLRRMSSSSLRRSQRTLERAGGANSGGNNGGNNNNLNQSSEAGTADGPCMQSSSKPGRVIMKRPRLSSRSENLSSGSLNSVGV
Mediates response to the active Hedgehog (Hh) protein signal in embryos, functioning upstream or at the level of patched (ptc).
B4GZN1
WLS_DROPE
Protein wntless
MSGTILENLSGRKLSILVGSLLLCQVLCFLLGGLYAPVPAGHTNVLGSLCRENHARQNDTSFFLYSRGEGSCTQVTREEVEQDSMKLANQIVHVFQMPLPRDSRVLDYSRWQQNLIGVLQVEFGYDSSSELREPPKELQLTIDMRLAYRNKGDPDHAWKLYAHGVEHRYLDCVAAHIGSSETLYTCDMIPLFELGALHHSFYLLNLRFPLDTPKQMNLQFGHMHDLTLTAIHQNGGFTHVWLMLKTLLFPFVVGIMVWFWRRVHLLQRSPALLEYMLLYLGGALTFLNLPLEYLSLTIEMPYMLLLSDIRQGIFYAMLLSFWLVFAGEHMLIQDSHNKSTIRSRYWKHLSAVVVGCISLFVFDISERGVQLRNPFYSIWTTPLGAKVAMSFILLAGVSAAVYFLFLCYMISKVFKNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLLCAALTVTGFIMGQMAEGQWKWNDDVEIQLTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHHSDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFE
A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip (By similarity).
B4H3U8
SWS_DROPE
Neuropathy target esterase sws (Swiss cheese) (EC 3.1.1.5)
MDVLELLRVSGSNMYYSTFLADAWCYYISNQITMTMYLYCALGVLSMLFIGWFVYFKRLARLRLRHEIARSLSAVTMASGGDLRGPRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKRRAVIRFARRILQLRRENMPLEVRTVEPPAEYLEETMEGSDRVPPDALYMLQSIRIFGHFEKPIFLRLCKHTQLLELMGGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRKGESVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMAAFQEVFKDSPDVMIRVIQVIMIRLQRVLFTALRNYLGLNAELVQNHMRFKGSSQGAGPSVYCSQTTRQATGSASATATAAAASGTAGSTHTAVPRPASSLSRYSQDEQHTLSDPNPGIPNLELSGDSVNTLFGEVNGGARLNSYPPLYHQRESDGNLSTRRGSITQQEQPEVGPVPSIDMRLVKSSAVDSLRKELGLPEQDAHIIDPFVEVREMEPNVTLITEGNADDVCVWFVMTGTLAVYQGNADATRIKQDKTDLLIHYVHPGEIVGGLAMLTGEASAYTIRSRNHSRVAFIRRAAIYQIMRQRPRIVLDLGNGVVRRLSPLVRQCDYALDWIFLESGRALYRQDESSDSTYIVLSGRMRSVITHPGGKKEIVGEYGKGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFNAIKLRYPIVVTKLISFLSHRFLGSMQTRTTTGAPGAPVEANPVTHKYSTVALVPITDDVPLTPFTYELYHSLCAIGPVLRLTSDLARKQLGMNIFDASNEYRLTSWLAQQEDRNIITLYQCDNALSPWTQRCMRQADVVLIVGLGDHSHLVGKFEREIDRLALRTQKELVLLYPETASSKPANTLSWLNARPWVTKHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGARGAAHIGMLKAIQEAGIPIDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKMTKWFLQLLDLTYPITSMFSGREFNKTIHETFGDVNIEDLWIPYFTLTTDITASCHRIHTNGSLWRYVRSSMSLSGYMPPLCDPKDGHLLLDGGYVNNLPGHLWRYCRASMSIAGVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTAPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPLINKYQTLSCAGCPETYGLNPSDLFSEDEDCDGYISEPTTLNTDVRRYQVPRGGNSLSLSETEMDMDSDVEMDLKMERKMDKATQSTPPLQSKAQILRRKHSKEEARHEWEIKREQKQELAREQELERERELSQKGTTAGATGYTPNAVIATQTSLIFMDEEDEMDKKKTKDNDRDEVRGSAEDTGKEKEEDKENRSNTNNETKNYL
Phospholipase B that deacylates intracellular phosphatidylcholine (PtdCho), generating glycerophosphocholine (GroPtdCho). This deacylation occurs at both sn-2 and sn-1 positions of PtdCho. Its specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy. Plays a role in the signaling mechanism between neurons and glia that regulates glia wrapping during development of the adult brain. Essential for membrane lipid homeostasis and cell survival in both neurons and glia of the adult brain (By similarity).
B4HEB1
WLS_DROSE
Protein wntless
MSGTILENLSGRKLSILVATLLLCQVLCFLLGGLYAPLPAGHVTVLGSLCREDHARQNDTGFLLYSRGAGACIPVTREEVEQDSTKMANELVHVFQMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPDNGWKLYAHGVEHRYLDCVTSHVGPTETLYSCDMIPLFELGALHHSFYLLNLRFPLDTPSQMNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTMLFPFVVGIMIWFWRRVHLLQRSPALLEYMLIYLGAALTFLNLPLEYLSLVYEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDAPNKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWTTPLGAKVAMTFIVLAGVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLATLVCAALTVAGFIMGQMAEGQWDWNDNVAIQPTSAFLTGVYGMWNIYIFALLILYAPSHKQWPAMHHSDETTQSNENIVASAASEEIEFSHLPSDSNPSEISSLTSFTRKVAFD
A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip (By similarity).
B4HFB7
HH_DROSE
Protein hedgehog (EC 3.1.-.-) [Cleaved into: Protein hedgehog N-product]
MDNHSSVPWASAASVTCLSLDAKCHSSSSKSAASSISASPETQTMRHIAHTQRCLSRLTSLVALLLIVLPMMFSPAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSDSSISSHVHGCFTPESTALLESGVRKPLGELSIGDRVLSMTANGQAVYSEVILFMDRNLEQMQNFVQLHTDGGAVLTVTPAHLVSVWQPESQKLTFVFADRIEEKNQVLVRDVETGELRPQRVVKVGSVRSKGVVAPLTREGTIVVNSVAASCYAVINSQSLAHWGLAPMRLLSTLEAWLPAKEQLHSSPKVVSSAQQQNGIHWYANALYKVKDYVLPQSWRHD
[Protein hedgehog]: The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product) (By similarity). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Once cleaved, the C-product has no signaling activity and diffuses from the cell (By similarity). [Protein hedgehog N-product]: The dually lipidated hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Establishes the anterior-posterior axis of the embryonic segments and patterns the larval imaginal disks. Binds to the patched (ptc) receptor, which functions in association with smoothened (smo), to activate the transcription of target genes wingless (wg), decapentaplegic (dpp) and ptc. In the absence of hh, ptc represses the constitutive signaling activity of smo through fused (fu). Essential component of a signaling pathway which regulates the Duox-dependent gut immune response to bacterial uracil required to activate Cad99C-dependent endosome formation, norpA-dependent Ca2+ mobilization and p38 MAPK, which are essential steps in the Duox-dependent production of reactive oxygen species (ROS) in response to intestinal bacterial infection. During photoreceptor differentiation, it up-regulates transcription of Ubr3, which in turn promotes the hh-signaling pathway by mediating the ubiquitination and degradation of cos.
B4HGG6
SPAST_DROSE
Spastin (EC 5.6.1.1)
MVRTKNQSSSSSASSSSTKSPIKSSSGAGSSGGGVGGRQSTHRSSSASNVAAVVAGGSSAAGGGSSSNRRSPGSSPDGDDDTTTTDDLTPTTCSPRSGHHHSYGGYSSSVHKQNLYVVSFPIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPSELNREGDGQEQQLSNQPQRFRPIQPLEMAANRPGGGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSMARDRLHFLALREQDLQMQRLSLKEKQKEEARSKPQKTREPMLAGMTNEPMKLRVRSSGYGPKATTSAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPPAVRRQFSSGRNTPPQRSRTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
ATP-dependent microtubule severing protein. Stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability in the neuromuscular junction synapse. Involved in lipid metabolism by regulating the size and distribution of lipid droplets. Involved in axon regeneration by regulating microtubule severing. {ECO:0000255|HAMAP-Rule:MF_03021}.