entry
stringlengths
6
10
entry_name
stringlengths
5
11
protein_name
stringlengths
3
2.44k
sequence
stringlengths
2
35.2k
function
stringlengths
7
11k
O43827
ANGL7_HUMAN
Angiopoietin-related protein 7 (Angiopoietin-like factor) (Angiopoietin-like protein 7) (Cornea-derived transcript 6 protein)
MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure. Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency.
O43829
ZBT14_HUMAN
Zinc finger and BTB domain-containing protein 14 (Zinc finger protein 161 homolog) (Zfp-161) (Zinc finger protein 478) (Zinc finger protein 5 homolog) (ZF5) (Zfp-5) (hZF5)
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS
Transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. Transcriptional repressor of MYC and thymidine kinase promoters.
O43837
IDH3B_HUMAN
Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial (Isocitric dehydrogenase subunit beta) (NAD(+)-specific ICDH subunit beta)
MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Plays a structural role to facilitate the assembly and ensure the full activity of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.
O43847
NRDC_HUMAN
Nardilysin (EC 3.4.24.61) (N-arginine dibasic convertase) (NRD convertase) (NRD-C) (Nardilysin convertase)
MLRRVTVAAVCATRRKLCEAGRELAALWGIETRGRCEDSAAARPFPILAMPGRNKAKSTCSCPDLQPNGQDLGENSRVARLGADESEEEGRRGSLSNAGDPEIVKSPSDPKQYRYIKLQNGLQALLISDLSNMEGKTGNTTDDEEEEEVEEEEEDDDEDSGAEIEDDDEEGFDDEDEFDDEHDDDLDTEDNELEELEERAEARKKTTEKQSAAALCVGVGSFADPDDLPGLAHFLEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDRWAQFFIHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETLKHEPRKNNIDTHARLREFWMRYYSSHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPRPNFGHLTDPFDTPAFNKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGSILSFLRKKCWALALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAYTVFQYLKMLQKLGPEKRIFEEIRKIEDNEFHYQEQTDPVEYVENMCENMQLYPLQDILTGDQLLFEYKPEVIGEALNQLVPQKANLVLLSGANEGKCDLKEKWFGTQYSIEDIENSWAELWNSNFELNPDLHLPAENKYIATDFTLKAFDCPETEYPVKIVNTPQGCLWYKKDNKFKIPKAYIRFHLISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHKLPLLFQLIIDYLAEFNSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQFQVVELPSGHHLCKVKALNKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFSKSDLVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFTTTLNLLPYHKIVK
Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs. Is a critical activator of BACE1- and ADAM17-mediated pro-neuregulin ectodomain shedding, involved in the positive regulation of axonal maturation and myelination. Required for proper functioning of 2-oxoglutarate dehydrogenase (OGDH) (By similarity).
O43852
CALU_HUMAN
Calumenin (Crocalbin) (IEF SSP 9302)
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF
Involved in regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. Seems to inhibit gamma-carboxylase GGCX. Binds 7 calcium ions with a low affinity (By similarity).
O43854
EDIL3_HUMAN
EGF-like repeat and discoidin I-like domain-containing protein 3 (Developmentally-regulated endothelial cell locus 1 protein) (Integrin-binding protein DEL1)
MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
O43865
SAHH2_HUMAN
S-adenosylhomocysteine hydrolase-like protein 1 (DC-expressed AHCY-like molecule) (IP(3)Rs binding protein released with IP(3)) (IRBIT) (Putative adenosylhomocysteinase 2) (S-adenosyl-L-homocysteine hydrolase 2) (AdoHcyase 2)
MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY
Multifaceted cellular regulator which coordinates several essential cellular functions including regulation of epithelial HCO3(-) and fluid secretion, mRNA processing and DNA replication. Regulates ITPR1 sensitivity to inositol 1,4,5-trisphosphate, competing for the common binding site and acting as endogenous 'pseudoligand' whose inhibitory activity can be modulated by its phosphorylation status. Promotes the formation of contact points between the endoplasmic reticulum (ER) and mitochondria, facilitating transfer of Ca(2+) from the ER to mitochondria. Under normal cellular conditions, functions cooperatively with BCL2L10 to limit ITPR1-mediated Ca(2+) release but, under apoptotic stress conditions, dephosphorylated which promotes dissociation of both AHCYL1 and BCL2L10 from mitochondria-associated endoplasmic reticulum membranes, inhibits BCL2L10 interaction with ITPR1 and leads to increased Ca(2+) transfer to mitochondria which promotes apoptosis. In the pancreatic and salivary ducts, at resting state, attenuates inositol 1,4,5-trisphosphate-induced calcium release by interacting with ITPR1. When extracellular stimuli induce ITPR1 phosphorylation or inositol 1,4,5-trisphosphate production, dissociates from ITPR1 to interact with CFTR and SLC26A6, mediating their synergistic activation by calcium and cAMP that stimulates the epithelial secretion of electrolytes and fluid (By similarity). Also activates basolateral SLC4A4 isoform 1 to coordinate fluid and HCO3(-) secretion. Inhibits the effect of STK39 on SLC4A4 and CFTR by recruiting PP1 phosphatase which activates SLC4A4, SLC26A6 and CFTR through dephosphorylation (By similarity). Mediates the induction of SLC9A3 surface expression produced by Angiotensin-2. Depending on the cell type, activates SLC9A3 in response to calcium or reverses SLC9A3R2-dependent calcium inhibition. May modulate the polyadenylation state of specific mRNAs, both by controlling the subcellular location of FIP1L1 and by inhibiting PAPOLA activity, in response to a stimulus that alters its phosphorylation state. Acts as a (dATP)-dependent inhibitor of ribonucleotide reductase large subunit RRM1, controlling the endogenous dNTP pool and ensuring normal cell cycle progression. In vitro does not exhibit any S-adenosyl-L-homocysteine hydrolase activity (By similarity).
O43866
CD5L_HUMAN
CD5 antigen-like (Apoptosis inhibitor expressed by macrophages) (hAIM) (CT-2) (IgM-associated peptide) (SP-alpha)
MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKSLSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG
Secreted protein that acts as a key regulator of lipid synthesis: mainly expressed by macrophages in lymphoid and inflamed tissues and regulates mechanisms in inflammatory responses, such as infection or atherosclerosis. Able to inhibit lipid droplet size in adipocytes. Following incorporation into mature adipocytes via CD36-mediated endocytosis, associates with cytosolic FASN, inhibiting fatty acid synthase activity and leading to lipolysis, the degradation of triacylglycerols into glycerol and free fatty acids (FFA). CD5L-induced lipolysis occurs with progression of obesity: participates in obesity-associated inflammation following recruitment of inflammatory macrophages into adipose tissues, a cause of insulin resistance and obesity-related metabolic disease. Regulation of intracellular lipids mediated by CD5L has a direct effect on transcription regulation mediated by nuclear receptors ROR-gamma (RORC). Acts as a key regulator of metabolic switch in T-helper Th17 cells. Regulates the expression of pro-inflammatory genes in Th17 cells by altering the lipid content and limiting synthesis of cholesterol ligand of RORC, the master transcription factor of Th17-cell differentiation. CD5L is mainly present in non-pathogenic Th17 cells, where it decreases the content of polyunsaturated fatty acyls (PUFA), affecting two metabolic proteins MSMO1 and CYP51A1, which synthesize ligands of RORC, limiting RORC activity and expression of pro-inflammatory genes. Participates in obesity-associated autoimmunity via its association with IgM, interfering with the binding of IgM to Fcalpha/mu receptor and enhancing the development of long-lived plasma cells that produce high-affinity IgG autoantibodies (By similarity). Also acts as an inhibitor of apoptosis in macrophages: promotes macrophage survival from the apoptotic effects of oxidized lipids in case of atherosclerosis. Involved in early response to microbial infection against various pathogens by acting as a pattern recognition receptor and by promoting autophagy.
O43868
S28A2_HUMAN
Sodium/nucleoside cotransporter 2 (Concentrative nucleoside transporter 2) (CNT 2) (hCNT2) (Na(+)/nucleoside cotransporter 2) (Sodium-coupled nucleoside transporter 2) (Sodium/purine nucleoside co-transporter) (SPNT) (Solute carrier family 28 member 2)
MEKASGRQSIALSTVETGTVNPGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHASLFKKILLGLLCLAYAAYLLAACILNFQRALALFVITCLVIFVLVHSFLKKLLGKKLTRCLKPFENSRLRLWTKWVFAGVSLVGLILWLALDTAQRPEQLIPFAGICMFILILFACSKHHSAVSWRTVFSGLGLQFVFGILVIRTDLGYTVFQWLGEQVQIFLNYTVAGSSFVFGDTLVKDVFAFQALPIIIFFGCVVSILYYLGLVQWVVQKVAWFLQITMGTTATETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLGAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDIQGLTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIKFFINEFVAYQQLSQYKNKRLSGMEEWIEGEKQWISVRAEIITTFSLCGFANLSSIGITLGGLTSIVPHRKSDLSKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
Sodium-dependent and purine-selective transporter. Exhibits the transport characteristics of the nucleoside transport system cif or N1 subtype (N1/cif) (selective for purine nucleosides and uridine). Plays a critical role in specific uptake and salvage of purine nucleosides in kidney and other tissues. May contribute to regulate the transport of organic compounds in testes across the blood-testis-barrier (Probable).
O43889
CREB3_HUMAN
Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Luman) (Transcriptionally active form)]
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription. Plays a role in the unfolded protein response (UPR), promoting cell survival versus ER stress-induced apoptotic cell death. Also involved in cell proliferation, migration and differentiation, tumor suppression and inflammatory gene expression. Acts as a positive regulator of LKN-1/CCL15-induced chemotaxis signaling of leukocyte cell migration. Associates with chromatin to the HERPUD1 promoter. Also induces transcriptional activation of chemokine receptors. [Isoform 1]: (Microbial infection) Plays a role in herpes simplex virus-1 (HSV-1) latent infection and reactivation from latency. Represses the VP16-mediated transactivation of immediate early genes of the HSV-1 virus by sequestering host cell factor-1 HCFC1 in the ER membrane of sensory neurons, thereby preventing the initiation of the replicative cascade leading to latent infection. [Isoform 2]: Functions as a negative transcriptional regulator in ligand-induced transcriptional activation of the glucocorticoid receptor NR3C1 by recruiting and activating histone deacetylases (HDAC1, HDAC2 and HDAC6). Also decreases the acetylation level of histone H4. Does not promote the chemotactic activity of leukocyte cells. [Processed cyclic AMP-responsive element-binding protein 3]: (Microbial infection) Activates transcription of genes required for reactivation of the latent HSV-1 virus. It's transcriptional activity is inhibited by CREBZF in a HCFC1-dependent manner, by the viral transactivator protein VP16. Binds DNA to the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3') and C/EBP sequences present in many viral promoters. [Processed cyclic AMP-responsive element-binding protein 3]: (Microbial infection) It's transcriptional activity is inhibited by CREBZF in a HCFC1-dependent manner, by the viral transactivator HCV core protein.
O43895
XPP2_HUMAN
Xaa-Pro aminopeptidase 2 (EC 3.4.11.9) (Aminoacylproline aminopeptidase) (Membrane-bound aminopeptidase P) (Membrane-bound APP) (Membrane-bound AmP) (mAmP) (X-Pro aminopeptidase 2)
MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWASVLVVSTLAILGWSV
Membrane-bound metalloprotease which catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. May play a role in the metabolism of the vasodilator bradykinin.
O43896
KIF1C_HUMAN
Kinesin-like protein KIF1C
MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTSTEDPQFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVPQLCEDLFSRVSENQSAQLSYSVEVSYMEIYCERVRDLLNPKSRGSLRVREHPILGPYVQDLSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRCHDQLTGLDSEKVSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADMQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAIINEDPNARLIRELQEEVARLRELLMAQGLSASALEGLKTEEGSVRGALPAVSSPPAPVSPSSPTTHNGELEPSFSPNTESQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMGVAVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQVDMDIKLTGQFIREQHCLFRSIPQPDGEVVVTLEPCEGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHPEQARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGIDIKLEMEKRLQDLENQYRKEKEEADLLLEQQRLYADSDSGDDSDKRSCEESWRLISSLREQLPPTTVQTIVKRCGLPSSGKRRAPRRVYQIPQRRRLQGKDPRWATMADLKMQAVKEICYEVALADFRHGRAEIEALAALKMRELCRTYGKPDGPGDAWRAVARDVWDTVGEEEGGGAGSGGGSEEGARGAEVEDLRAHIDKLTGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEEAAPSDRMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGGGLRRPPARFVPPHDCKLRFPFKSNPQHRESWPGMGSGEAPTPLQPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDLKESGAAV
Motor required for the retrograde transport of Golgi vesicles to the endoplasmic reticulum. Has a microtubule plus end-directed motility.
O43897
TLL1_HUMAN
Tolloid-like protein 1 (EC 3.4.24.-)
MGLGTLSPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK
Protease which processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.
O43900
PRIC3_HUMAN
Prickle planar cell polarity protein 3 (LIM domain only protein 6) (LMO-6) (Prickle-like protein 3) (Pk3) (Triple LIM domain protein 6)
MFARGSRRRRSGRAPPEAEDPDRGQPCNSCREQCPGFLLHGWRKICQHCKCPREEHAVHAVPVDLERIMCRLISDFQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSEAQYCTALEEEEKKELRAFSQQRKRENLGRGIVRIFPVTITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCTTCQELLVDLIYFYHVGKVYCGRHHAECLRPRCQACDEIIFSPECTEAEGRHWHMDHFCCFECEASLGGQRYVMRQSRPHCCACYEARHAEYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPRRGLIFCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPATGPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPLVSEGGPRRTLSAPPAQRRRPRSPPPRAPSRRRHHHHNHHHHHNRHPSRRRHYQCDAGSGSDSESCSSSPSSSSSESSEDDGFFLGERIPLPPHLCRPMPAQDTAMETFNSPSLSLPRDSRAGMPRQARDKNCIVA
Involved in the planar cell polarity (PCP) pathway that is essential for the polarization of epithelial cells during morphogenetic processes, including gastrulation and neurulation (By similarity). PCP is maintained by two molecular modules, the global and the core modules, PRICKLE3 being part of the core module (By similarity). Distinct complexes of the core module segregate to opposite sides of the cell, where they interact with the opposite complex in the neighboring cell at or near the adherents junctions (By similarity). Involved in the organization of the basal body (By similarity). Involved in cilia growth and positioning (By similarity). Required for proper assembly, stability, and function of mitochondrial membrane ATP synthase (mitochondrial complex V).
O43903
GAS2_HUMAN
Growth arrest-specific protein 2 (GAS-2)
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK
May play a role in apoptosis by acting as a cell death substrate for caspases. Is cleaved during apoptosis and the cleaved form induces dramatic rearrangements of the actin cytoskeleton and potent changes in the shape of the affected cells. May be involved in the membrane ruffling process (By similarity).
O43909
EXTL3_HUMAN
Exostosin-like 3 (EC 2.4.1.223) (EXT-related protein 1) (Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Hereditary multiple exostoses gene isolog) (Multiple exostosis-like protein 3) (Putative tumor suppressor protein EXTL3)
MTGYTMLRNGGAGNGGQTCMLRWSNRIRLTWLSFTLFVILVFFPLIAHYYLTTLDEADEAGKRIFGPRVGNELCEVKHVLDLCRIRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKATRGCRLHNCFDYSRCPLTSGFPVYVYDSDQFVFGSYLDPLVKQAFQATARANVYVTENADIACLYVILVGEMQEPVVLRPAELEKQLYSLPHWRTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVAQSTFYTVQYRPGFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEARSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQVLVEFTCKNQPKPSLPTEWALCGEREDRLELLKLSTFALIITPGDPRLVISSGCATRLFEALEVGAVPVVLGEQVQLPYQDMLQWNEAALVVPKPRVTEVHFLLRSLSDSDLLAMRRQGRFLWETYFSTADSIFNTVLAMIRTRIQIPAAPIREEAAAEIPHRSGKAAGTDPNMADNGDLDLGPVETEPPYASPRYLRNFTLTVTDFYRSWNCAPGPFHLFPHTPFDPVLPSEAKFLGSGTGFRPIGGGAGGSGKEFQAALGGNVPREQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSPKLPSEDLLWPDIGVPIMVVRTEKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFRVWREARDRIVGFPGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHKYYAYLYSYVMPQAIRDMVDEYINCEDIAMNFLVSHITRKPPIKVTSRWTFRCPGCPQALSHDDSHFHERHKCINFFVKVYGYMPLLYTQFRVDSVLFKTRLPHDKTKCFKFI
Glycosyltransferase which regulates the biosynthesis of heparan sulfate (HS). Initiates HS synthesis by transferring the first N-acetyl-alpha-D-glucosamine (alpha-GlcNAc) residue (GlcNAcT-I activity) to the tetrasaccharide linker (GlcA-Gal-Gal-Xyl-)Ser core linker. May also transfer alpha-GlcNAc residues during HS elongation (GlcNAcT-II activity). Lacks glucuronyl transferase II (GlcAT-II) activity. Important for both skeletal development and hematopoiesis, through the formation of HS proteoglycans (HSPGs). Through the synthesis of HS, regulates postnatal pancreatic islet maturation and insulin secretion (By similarity). Receptor for REG3A, REG3B and REG3G, induces the activation of downstream signaling pathways such as PI3K-AKT or RAS-RAF-MEK-ERK signaling pathway. Required for the function of REG3A in regulating keratinocyte proliferation and differentiation. Required for the inhibition of skin inflammation mediated by REGA through the activation of PI3K-AKT-STAT3 pathway. Required for the function of REGA and REG3G in glucose tolerance in pancreas. Expressed in microglia, is activated by nociceptor-derived REG3G in response to endotoxins, leading to the inhibition of kynurenine pathway to prevent endotoxic death (By similarity).
O43913
ORC5_HUMAN
Origin recognition complex subunit 5
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYLYDFL
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
O43914
TYOBP_HUMAN
TYRO protein tyrosine kinase-binding protein (DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)
MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Adapter protein which non-covalently associates with activating receptors found on the surface of a variety of immune cells to mediate signaling and cell activation following ligand binding by the receptors. TYROBP is tyrosine-phosphorylated in the ITAM domain following ligand binding by the associated receptors which leads to activation of additional tyrosine kinases and subsequent cell activation. Also has an inhibitory role in some cells. Non-covalently associates with activating receptors of the CD300 family to mediate cell activation. Also mediates cell activation through association with activating receptors of the CD200R family (By similarity). Required for neutrophil activation mediated by integrin (By similarity). Required for the activation of myeloid cells mediated by the CLEC5A/MDL1 receptor. Associates with natural killer (NK) cell receptors such as KIR2DS2 and the KLRD1/KLRC2 heterodimer to mediate NK cell activation. Also enhances trafficking and cell surface expression of NK cell receptors KIR2DS1, KIR2DS2 and KIR2DS4 and ensures their stability at the cell surface. Associates with SIRPB1 to mediate activation of myeloid cells such as monocytes and dendritic cells. Associates with TREM1 to mediate activation of neutrophils and monocytes. Associates with TREM2 on monocyte-derived dendritic cells to mediate up-regulation of chemokine receptor CCR7 and dendritic cell maturation and survival. Association with TREM2 mediates cytokine-induced formation of multinucleated giant cells which are formed by the fusion of macrophages. Stabilizes the TREM2 C-terminal fragment (TREM2-CTF) produced by TREM2 ectodomain shedding which suppresses the release of pro-inflammatory cytokines. In microglia, required with TREM2 for phagocytosis of apoptotic neurons (By similarity). Required with ITGAM/CD11B in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development (By similarity). Promotes pro-inflammatory responses in microglia following nerve injury which accelerates degeneration of injured neurons (By similarity). Positively regulates the expression of the IRAK3/IRAK-M kinase and IL10 production by liver dendritic cells and inhibits their T cell allostimulatory ability (By similarity). Negatively regulates B cell proliferation. Required for CSF1-mediated osteoclast cytoskeletal organization (By similarity). Positively regulates multinucleation during osteoclast development (By similarity).
O43915
VEGFD_HUMAN
Vascular endothelial growth factor D (VEGF-D) (c-Fos-induced growth factor) (FIGF)
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
O43916
CHST1_HUMAN
Carbohydrate sulfotransferase 1 (Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1) (GST-1) (Keratan sulfate Gal-6 sulfotransferase) (KS6ST) (KSGal6ST) (KSST) (EC 2.8.2.21)
MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLAEAGLAERLCEESPTFAYNLSRKTHILILATTRSGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIKPPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLVRYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTVRNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of internal galactose (Gal) residues of keratan. Cooperates with B4GALT4 and B3GNT7 glycosyltransferases and CHST6 sulfotransferase to construct and elongate disulfated disaccharide unit [->3(6-sulfoGalbeta)1->4(6-sulfoGlcNAcbeta)1->] within keratan sulfate polymer. Has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. Involved in biosynthesis of phosphacan, a major keratan sulfate proteoglycan in the developing brain (By similarity). Involved in biosynthesis of 6-sulfoGalbeta-containing O-linked glycans in high endothelial venules of lymph nodes. May act in a synergistic manner with CHST4 to generate sialyl 6',6-disulfo Lewis X motif, a recognition determinant for immune cell receptors implicated in leukocyte trafficking. Catalyzes sulfation of N-acetyllactosamine (LacNAc) oligosaccharides with highest efficiency for sialylated LacNAc structures.
O43918
AIRE_HUMAN
Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (APECED protein)
MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARAAAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVPAPLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS
Transcription factor playing an essential role to promote self-tolerance in the thymus by regulating the expression of a wide array of self-antigens that have the commonality of being tissue-restricted in their expression pattern in the periphery, called tissue restricted antigens (TRA). Binds to G-doublets in an A/T-rich environment the preferred motif is a tandem repeat of 5'-ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Mainly expressed by medullary thymic epithelial cells (mTECs), induces the expression of thousands of tissue-restricted proteins, which are presented on major histocompatibility complex class I (MHC-I) and MHC-II molecules to developing T-cells percolating through the thymic medulla. Also induces self-tolerance through other mechanisms such as the regulation of the mTEC differentiation program. Controls the medullary accumulation of thymic dendritic cells and the development of regulatory T-cell through the regulation of XCL1 expression. Regulates the production of CCR4 and CCR7 ligands in medullary thymic epithelial cells and alters the coordinated maturation and migration of thymocytes. In thimic B-cells, allows the presentation of licensing-dependent endogenous self-anitgen for negative selection. In secondary lymphoid organs, induces functional inactivation of CD4(+) T-cells. Expressed by a distinct bone marrow-derived population, induces self-tolerance through a mechanism that does not require regulatory T-cells and is resitant to innate inflammatory stimuli (By similarity).
O43920
NDUS5_HUMAN
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (Complex I-15 kDa) (CI-15 kDa) (NADH-ubiquinone oxidoreductase 15 kDa subunit)
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
O43921
EFNA2_HUMAN
Ephrin-A2 (EPH-related receptor tyrosine kinase ligand 6) (LERK-6) (HEK7 ligand) (HEK7-L)
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. With the EPHA2 receptor may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis (By similarity).
O43924
PDE6D_HUMAN
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (GMP-PDE delta) (Protein p17)
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
Promotes the release of prenylated target proteins from cellular membranes. Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location. Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E. Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI) (By similarity). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate (By similarity).
O43927
CXL13_HUMAN
C-X-C motif chemokine 13 (Angie) (B cell-attracting chemokine 1) (BCA-1) (B lymphocyte chemoattractant) (CXC chemokine BLC) (Small-inducible cytokine B13)
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
O43929
ORC4_HUMAN
Origin recognition complex subunit 4
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3.
O43933
PEX1_HUMAN
Peroxisomal ATPase PEX1 (EC 3.6.4.-) (Peroxin-1) (Peroxisome biogenesis disorder protein 1) (Peroxisome biogenesis factor 1)
MWGSDRLAGAGGGGAAVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVVWSHQPAFLSWVEGRHFSDQGENVAEINRQVGQKLGLSNGGQVFLKPCSHVVSCQQVEVEPLSADDWEILELHAVSLEQHLLDQIRIVFPKAIFPVWVDQQTYIFIQIVALIPAASYGRLETDTKLLIQPKTRRAKENTFSKADAEYKKLHSYGRDQKGMMKELQTKQLQSNTVGITESNENESEIPVDSSSVASLWTMIGSIFSFQSEKKQETSWGLTEINAFKNMQSKVVPLDNIFRVCKSQPPSIYNASATSVFHKHCAIHVFPWDQEYFDVEPSFTVTYGKLVKLLSPKQQQSKTKQNVLSPEKEKQMSEPLDQKKIRSDHNEEDEKACVLQVVWNGLEELNNAIKYTKNVEVLHLGKVWIPDDLRKRLNIEMHAVVRITPVEVTPKIPRSLKLQPRENLPKDISEEDIKTVFYSWLQQSTTTMLPLVISEEEFIKLETKDGLKEFSLSIVHSWEKEKDKNIFLLSPNLLQKTTIQVLLDPMVKEENSEEIDFILPFLKLSSLGGVNSLGVSSLEHITHSLLGRPLSRQLMSLVAGLRNGALLLTGGKGSGKSTLAKAICKEAFDKLDAHVERVDCKALRGKRLENIQKTLEVAFSEAVWMQPSVVLLDDLDLIAGLPAVPEHEHSPDAVQSQRLAHALNDMIKEFISMGSLVALIATSQSQQSLHPLLVSAQGVHIFQCVQHIQPPNQEQRCEILCNVIKNKLDCDINKFTDLDLQHVAKETGGFVARDFTVLVDRAIHSRLSRQSISTREKLVLTTLDFQKALRGFLPASLRSVNLHKPRDLGWDKIGGLHEVRQILMDTIQLPAKYPELFANLPIRQRTGILLYGPPGTGKTLLAGVIARESRMNFISVKGPELLSKYIGASEQAVRDIFIRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNVLSDSLPLADDVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESKFNMYRLYFGSSYESELGNGTSSDLSSQCLSAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESFQNPKRRKNQSGTMFRPGQKVTLA
Component of the PEX1-PEX6 AAA ATPase complex, a protein dislocase complex that mediates the ATP-dependent extraction of the PEX5 receptor from peroxisomal membranes, an essential step for PEX5 recycling. Specifically recognizes PEX5 monoubiquitinated at 'Cys-11', and pulls it out of the peroxisome lumen through the PEX2-PEX10-PEX12 retrotranslocation channel. Extraction by the PEX1-PEX6 AAA ATPase complex is accompanied by unfolding of the TPR repeats and release of bound cargo from PEX5.
O43948
PK4_PLAFA
Eukaryotic translation initiation factor 2-alpha kinase PK4 (eIF2alpha kinase PK4) (EC 2.7.11.1) (Protein kinase PK4) (PfPK4)
MKKRIRSSYKVGSSNKYHKKNYTDNEKDKKKYRSYKEKHINEKMFDKKEFLNFLTNFNKKFMKKNSLVDHLMKMNDKAEDNYDGYNSSGSRYNNINDDGVELCGTKRYTNNKNNSDYDNYNNNNNMKNKRYSNKKHNNDNIIINNNNNKYTDERKYRNKSIKEDVDYTNDYYNIQLNNNKINNNQTKNKIDTIRNISHEKLGNNKSSSARNLSLIQTSHIPYDAPLADFLENGRFLRTFENISLIGQGGFGSVYKVSHRLEPGSPTYAVKFIYLKVSSLDNVSSRRYFREIAANRDIYSKHVVRYYTWWCEEPQFLPMHLMPKEIQNLVKKNKDTFKKRLTKNKKYSNNCISDSSNNNNSSCYSASSYNSSINSNYRNMKLWIKKKEQSPDMKRYKEVLRKNNAPNLVFYSDNDGLTSKNKENPEKNHNPFLSDKNFSDSIYKKKKSHDYNSSSHKLKKRKNKKKKSKKKRKSKSKIKTNAQGIYEESENDEGRDHFQYKKGKEQFSKFIGKLILWVLHKVSKNMILLIMVILSEEDRDLIVFADNEESNGNDQQMIRHDNMNNENVIIKHRNEDDKNGLDGDKNGLDGDKNGLDGDKNGLDGDKNELDDNKNELDDLLMKQKINSLTRNDIVNIENENPAPHATNNIKNKKVDLNGELTYYDYVGKNEVIPNSRTETNVESINTNGMFNNKFSVMKDEGGEYKKKENMTWGDTKRDGLYENGKHEKDGLGVNKCITNKYIENDDDDDDDDDDNNNNNNIDERKKDLKKKQKNAITKGNEDLLATNGTNNKEKRKKDDDINKNMEKIKSYKKKTPVPEFSIVLLLQMELCKGYTLRKWLDRSTRSDKPLHFTYSDKKMNHPLEFDLFKQLIKGLKDIHATCFIHRDLKPENIFVDNDTYTLKIGDLGLVRFIEEKKREKDFNNIDCYKDNIYTDINQNRITSQISIKGQIIGTPGYTAPEGGALCDEKADIYSAALILLELLCPRFTTIMERYKRLNDFRNYYTVPDYVKIHLNPWYILMLQMSKPNPADRPSAADVYSKIKVLLDPHLTDFAFSFNDIHNEHMNKPPQGTNNFERITDNKDKFVIQSVVDMKNKVENEEIPIEKGLNSNVENIKNENNGADK
During the asexual blood stage, phosphorylates translation factor eIF2alpha in late schizonts resulting in protein translation inhibition. Plays a role in trophozoite differentiation into schizonts (By similarity).
O44074
SDHB_ASCSU
Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (Ip) (EC 1.3.5.1) (Fumarate reductase iron-sulfur subunit, mitochondrial)
MLRGSTSVCRSLELVTQAARYASAATAAAPTGKRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Iron-sulfur protein (Ip) subunit of the mitochondrial electron transport chain complex II which, together with the flavoprotein (Fp) subunit forms the catalytic core of the complex. During the free-living egg-larvae stages, which occur in an aerobic environment, complex II acts as a succinate dehydrogenase by transferring electrons from succinate to ubiquinone. During the parasitic larvae and adult stages, which occur in an anaerobic environment, complex II acts as a fumarate reductase by transferring electrons from rhodoquinol to fumarate.
O44081
DKC1_DROME
H/ACA ribonucleoprotein complex subunit 4 (EC 5.4.99.-) (Nucleolar protein AT band 60B) (Protein minifly)
MADVEVRKEKKKKKIKEEPLDGDDIGTLQKQGNFQIKPSSKIAELDTSQWPLLLKNFDKLNIRSNHYTPLAHGSSPLNRDIKEYMKTGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLHGAVESVAKVRQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKLLDYDETRNMGVFWVSCEAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQSERDGMVTMHDVLDAMWLYENHKDESMLRRVIKPLEGLLVNHKRIIMKDSSVNAVCYGAKITLPGVLRYEDGIEIDQEIVICTTKGEAICLAIALMTTATMASCDHGVVAKIKRVIMERDTYPRKWGLGPKASAKKALIAAGKLDKFGRPNENTPKEWLTGYVDYNAKKPAAQEVSPTNGSSEPSKRKLSTSSVEETAAAAVSEETPSKDKKKKKKKHKGDEEAPEAAEEEAEPVEKEKKKKKKKDKDRDRDEAQE
Plays a central role in ribosomal RNA processing. Probable catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ('psi') residues may serve to stabilize the conformation of rRNAs. Required for maintenance of the germline stem cell lineage during spermatogenesis.
O44126
LEG1_HAECO
32 kDa beta-galactoside-binding lectin (Galectin-1)
MVSQFLHWYEYNKPVPYRSLLQEKIEPGQTLIVKGSTIDESQRFTINLHSKSADFSGNDVPLHISVRFDEGKVVMNTFANGEWGKEERKSLPIKKGDSFDIRIRAHDDRFQIVIDQKEFKDYEHRLPLTSITHLSIDGDLYLNHVHWGGKYYPVPYESGIASGFPIDKTLLIFGTVEKKAKRFNINLLRRNGDIALHFNPRFDEKAVIRNALAANEWGNEEREGKMPFEKGVGFDLAIKNEAYAFQIFVNGERFTSFAHRQDPNDISGLQIQGDIELTGIQIQ
Binds galactose. Exerts immunomodulatory effects on host peripheral blood mononuclear cells to down-regulate host immune response. Hemagglutinates human, dog, rabbit, chicken and mouse erythrocytes but does not hemagglutinate the erythrocytes of goat, its natural host.
O44185
FLP13_CAEEL
FMRFamide-like neuropeptides 13 [Cleaved into: SDRPTRAMDSPLIRF-amide; AMDSPLIRF-amide; AADGAPLIRF-amide 1; APEASPFIRF-amide 1; AADGAPLIRF-amide 2; APEASPFIRF-amide 2; ASPSAPLIRF-amide; SPSAVPLIRF-amide; SAAAPLIRF-amide; ASSAPLIRF-amide]
MMTSLLTISMFVVAIQAFDSSEIRMLDEQYDTKNPFFQFLENSKRSDRPTRAMDSPLIRFGKRAADGAPLIRFGRAPEASPFIRFGKRAADGAPLIRFGRAPEASPFIRFGKRASPSAPLIRFGRSPSAVPLIRFGRSAAAPLIRFGRASSAPLIRFGRK
Probable FMRFamide-like neuropeptides. Binds to neuronal receptors such as dmsr-1 to promote sleep in response to cellular stress also known as stress-induced sleep (SIS). Plays a role in behaviors associated with SIS, acting in concert with the FMRFamide related peptide, flp-24 and neuropeptide-like protein nlp-8.
O44249
PRP1_MANSE
Phenoloxidase subunit 1 (EC 1.14.18.1) (proPO-P1)
MTDAKNNLLYFFDRPNEPCFMQKGEDKVVFEIPDHYYPDKYKSLSNTLSNRFGNEATKRIPIRNITLPNLEVPMQLPYNDQFSLFVPKHRTMAAKLIDIFMGMRDVEDLQSVCSYCQLRINPYMFNYCLSVAILHRPDTKGLSIPTFAETFPDKFMDSKVFLRAREVSNVVISGSRMPVNVPINYTANTTEPEQRVAYFREDIGINLHHWHWHLVYPFDSADRSIVNKDRRGELFYYMHQQIIGRYNVERMCNGLPQVKPFSDFSAPIEEGYFPKLDSQVASRTWPPRFAGSVFRNLDRTVDQVKIDVRKLFTWRDQFLEAIQKMAIKMPNGRELPLDEVTGIDMLGNLMESSIISPNRGYYGDLHNMGHVFAAYTHDPDHRHLEQFGVMGDSATAMRDPFFYRWHRFVDDVFNIYKEKLTPYTNERLDFPGVRVSSVGIEGARPNTLRTLWQQSTVELGRGLDFTPRGSVLARFTHLQHDEFQYVIEVNNTTGGNLMGTVRIFMAPKVDDNGQPMSFNKQRRLMIELDKFSQALRPGTNTIRRRSVDSSVTIPYERTFRNQSERPGDPGTAGAAEFDFCGCGWPHHMLIPKGTAQGYPVVLFVMISNWNNDRIEQDLVGSCNDAASYCGIRDRKYPDKQAMGYPFDRKMANDAATLSDFLRPNMAVRDCSIQFSDTTVERGQQG
This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6 dihydroxyindole to indole-5'6 quinone. Binds to the surface of hemocytes and is involved in hemocyte melanization.
O44326
HMP2_CAEEL
Beta-catenin-like protein hmp-2 (Protein humpback-2)
MLLHSTNSYSIFTDHEVETRTSRIRSAMFPDWIPPTSAAEATNSTTSIVEMMQMPTQQLKQSVMDLLTYEGSNDMSGLSLPDLVKLMCDHDESVVARAVHRAYMLSREDPNFFNAPGFDHRSFVEALMAASKSSNVNVRRNAIGALSHMSEQRGGPLLIFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQARALNAVEALTPHLHKTNPKLLAQVADGLYFLLIDDAPSKITFLSLLGPQILVSILREYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPALYVELCTAKDERSQTAILVAMRNLSDSATNEENLTQLIIKLLEIIRVANDGMTACACGTLSNLTCNNTRNKQTVCSHGGIDALVTAIRRLPEVEEVTEPALCALRHCTARHSLAEEAQSELRFCQAFPVILDQLETLRTPVIKAALGVIRNSALLQTNLIELTQEQTANGHTAVSLTMDILRRAITAIEENPDIAVDGVPMWGVIEGAVSALHQLANHPAVAAACCDDIGQVGNPECPPFLDLLHRLLAHPRLGSMDDEVLEREILGLLYQLSKRPDGARAVESTGVSALLMESRGSQYKSVVTYANGVLSNLKRGDSAAIMNMSNSYDYEMSGSAADWQRDGLERELFAEMYPTNDGGHSESINMALNNSQMRPNHNWYDTDL
Required for cell migration during body enclosure and cell shape changes during body elongation. Plays a role in recruitment of the cadherin protein hmr-1 to adherens junctions.
O44342
WBL_DROME
Protein windbeutel (Erp29 homolog)
MMHILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL
Probable chaperone protein involved in dorsoventral axis patterning in early embryos. Probably acts by folding and targeting pipe (pip) into the Golgi.
O44386
ITA3_DROME
Integrin alpha-PS3 (Position-specific antigen subunit alpha-3) (Protein scab) (Protein volado) [Cleaved into: Integrin alpha-PS3 heavy chain; Integrin alpha-PS3 light chain]
MNAESTMFPHIFLALLALISHIEAFNFMPRPSRVINSPKHLKFHINQTRSSYFGYTLVIRQTSIIVGAPRAQSTLESQRTINETGAIYRCSLTNGVCSPYVLDSRGNVDAPYSEYTFDSERKDFQWLGGSMDGGTKDTDKLLVCAPRFYAPSSRDNHLHGVCYWVNNTVASTPQHVTRISPLRLKSEQVKEEDNGNKASFFYIMGELGLSAHVADDNTKFLIGAPGINTWRGSVILYRQVDPVDNPTASRRDTSKALRRTYRDVDSNDYTPEHYAPEIPTPGLWGQEEDSYFGYAVSSGFFDSSNPTKLLYVATAPQANKQSGEAYIFDVRGKSIHKYHVFRGEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINKGFFNFERQILRSPVETMARFGTALSRLGDINHDGYNDVAVGAPFAGNGTVFIYLGSENGLRDQPSQRLDAPSQQPSKYGSHMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESREIKPEQEKVKITACYRLSTTSTDKLVQEQELAIRIAMDKQLKRVKFTQTQTNEISFKVNANFGEQCRDFETQVRYSEKDIFTPIDLEMHYELTKKVPDSEEFCETCAIVDPTEPKVSTQNIIFSTGCATDVCTADLQLRSKDVSPTYILGSADTLRLNYEITNIGETAYLPQFNVTSTSRLAFAQVPGNCKVVDAVMVCDLNRGRPLAKGDTDSVTISFDVSQLSGQSLIIHAEVFSTGYEQNPTDNRQTNVIGLKEFTEIDASGGQTNSQIDLEHYSNSAEIVNNYEIKSNGPSVIEQLTVSFYIPIAYKVAGSTAIIPIINVTSLKMQASYDSQLLSIDLYDQNNTMLVVDPVEVTTTLSGGLERTVITQNRQSYDIHTSGHVHQTMEVLDTSMVATASMSRKRRDLKALTANREQYARISNVKAHDLLSDDFKGKLPVNRTIVFNCRDPEMTICVRAEMRVHFRPEKSINLNMRYSVDLNEVNAILVDPWEYFVILTDLKLQKKGDPTSTSFSINRRIEPNIISKHQETGLPIWIIIVSVIGGLLLLSAISYLLYKFGFFNRTKKDELDRLVQQNPVEPEAENLNSGGNN
Integrin alpha-PS3/beta-PS is a receptor for laminin. Also binds to wb. Important during embryogenesis for the development of the trachea, dorsal vessel and salivary gland, as well as for dorsal closure. Required for short-term memory processes. Minor involvement in the establishment of the oocyte anterior-posterior length. Plays a role in timely border cell migration during oogenesis, probably mediated by JNK signaling. Integrin alpha-PS3/Itgbn is required for effective phagocytosis of apoptotic cells during embryonic development and for the phagocytic elimination of S.aureus by mediating the binding of S.aureus peptidoglycan to larval hemocytes, which probably activates a signaling pathway involving Rac1 and Rac2. Integrin alpha-PS3/Itgbn also regulates Fak activity during neuromuscular junction (NMJ) growth and is required for its activation in presynapsis of NMJs. Seems to be dispensable for major morphogenetic processes.
O44406
ERI1_CAEEL
3'-5' exonuclease eri-1 (EC 3.1.-.-) (Enhanced RNAi protein)
MSADEPSPEDEKYLESLRDLLKISQEFDASNAKQNDEPEKTAVEVESAETRTDESEKSIDIPREQQLLPSERVEPLKSMVEPEYVKKVIRQMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEIIYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQKCSYKENQRSAARKDEERELEDAANVDLTSVDISRRDFQLWMRRLPLKLSSVTRREFINEEYLDCDSCDDLTDDKNDEAAFQEKMAIREYLENKQTEDFAKIAAERGIFKIGEIKSYQTARPIIEDDDVDVESEEEDYGTEFEMLEVVERMPPVSSTLHTEVDLDAVWERDGGSDSERENLSNAPSLHEFPSSSTSSPHATSEHVTSSSPLHIDDDVDRVLNAPPKNSLASSSNRSSF
RNA exonuclease that acts as a negative regulator of RNA interference (RNAi). Probably acts by degrading the 3'-overhangs of short interfering RNAs (siRNAs). Component of the ERI/DICER complex which is involved in processing amplified double-stranded RNA (dsRNA) intermediates during small-RNA-mediated gene-silencing or RNA interference (RNAi) (Probable).
O44408
KGB1_CAEEL
GLH-binding kinase 1 (EC 2.7.11.24)
MEVDLPVHNEYDASRFHQVTIRDPIAGADSTFTIPTRYVNLSFLNAGAQGTVVMADDLVTTQRVAIKKMQQPFVMTMSAKRAYREFILLTTIKHPNIIRLLNAFTPDTSLSTFREVYLVMELMTHNLHEVIHRLRLDHKTLSFFVYQSLCAIKHLHNSGVIHRDLKPSNIVVNDRCVLKVLDFGLARKKNVDTSMRMSDYVVTRYYRAPEVILGLPYSEKVDIWSVGCIFAEMINHTVLFPGKDRIDQWTKIYSVLGTPDDHFISQLGQSAAMYVRSLPRHQARAFSEIVPDTNFLPETENPRVHLTPHVARDLLFNMLKINPEERYSVEDALNHPYVKLWFKDDEVNAPASENRYDQEIDFADKTLIEWKELIFNEVQRYQADHDIFTG
Mitogen-activated protein kinase which is an essential component of the JNK pathway composed of mlk-1, mek-1 and kgb-1. Phosphorylates the transcription factor fos-1 which prevents fos-1 dimerization and promoter binding and results in activation of target genes including F53A9.2/kreg-1 and lys-3/kreg-2. Phosphorylates jun-1 and activates the AP-1 transcription factor which is a heterodimer of jun-1 and fos-1. Phosphorylates glh-1 in vitro which may play a role in controlling glh-1 protein levels in the germline by targeting it for degradation by the proteasome. Required for oogenesis and probably also for spermatogenesis. Involved in the response to environmental stress such as heavy metals, infection and protein folding stress in an age-dependent manner. In larvae, has a protective role which becomes detrimental in adults. May control susceptibility to infection, heavy metal stress and premature lethality by regulating daf-16 cellular localization. Involved in the transcriptional response to bacterial pore-forming toxins and to fasting. Required for fasting-induced longevity. Involved in axon regeneration after injury downstream of tyrosine receptor svh-2.
O44411
NOG1_CAEEL
Nucleolar GTP-binding protein 1
MTSMYNFKRITCVPNAQELKDVVLSKTQRKTPTVVHRQYSIGRIRAFYARKIKFLQQTLHDKLTQIITEFPKMEEIHPFYSDLMNILYDRDHYKIALGQMNTARHLIDGIAREYVRLMKYADSLYRCKMLKRAALGRMVKLLKRQKSSFEYLEQVRQHLSRLPSIDPATRTLILCGFPNVGKSSFINNVTRADVEVQPYAFTTKALYVGHLDYRFLRWQVIDTPGILDQPLEDRNTIEMQAVTALAHLKASVLFMMDVSEQCDRSIEEQLHLFESIRPLFANKPVLIGLNKVDIRHRSDLPPEKAALLDQLEKEGIPIIETSTLTQEGVMGLRDRACDELLAQRVEAKIQAKKITNVEDCVLNRVFVAYPAPRDEKVRAPFVPPGLAAKRAQKKLQEAQELMETDGDEFAAKIPQKPGKIGKEKIAKGGSQSTDLGDLRDENTRRLEREIELEMQDDYILDLKKHYMLKNPDEKYDIVPEIWEGHNLADFVDPEIQSKLENLLREEELLEQAGEYESDLDSDDEETKEKLKLALQIREKEKLLTLDHAVNKRIAGRIGSRIHGSRKRDRSMSRLENELGELGVDVDTKKMKNLQGQCAKPQLGKKMKVGRSRSLSAVRPAPRDELAFPDEEKRAHVDKLRTKAMRGLRREAKKGEADRHVYDLKPKHLFCGKRGNGKTDWR
Involved in the biogenesis of the 60S ribosomal subunit (By similarity). Has a role in regulating longevity, growth and brood size. May regulate fat storage via the insulin/IGF pathway.
O44437
SMD3_DROME
Small nuclear ribonucleoprotein Sm D3 (Sm-D3) (snRNP core protein D3)
MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGSKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKAAILRAQARGRGRGGPPGGGRGTGGPPGAPGGSGGRGAWQGGPTGGRGRGGL
Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (By similarity).
O44476
RNZ2_CAEEL
Zinc phosphodiesterase ELAC protein 2 homolog (EC 3.1.26.11) (Homolog of ELAC2 protein) (tRNA 3 endonuclease 2) (tRNase Z 2)
MLGAIARKTVENRILVSRHLISSTSCLFKDNNEELLESIKERIARNRRILQKHSSSHLKAREVNASISNLRQSMAAVQKKQKAAHEPPANSIVNIPSQVSIEVLGNGTGLLRACFILRTPLKTYMFNCPENACRFLWQLRIRSSSVVDLFITSANWDNIAGISSILLSKESNALSTRLHGAMNIKHFLECIRPFQDSDYGSCKYPSQVEERPYTMENYEDAGLKVTYIPLSPPLNIGSNNEKSKNVKVNNVDIAFLIEMKEAARRIDTMKLMELKVPKGPLIGKLKSGEAVTLPDGRTIQPDQVFSSDKVEGDKPLLLVTECTTEDHVKALIDSSSLQPFLNGEKQLDYMVHISDDAVINTPTYRHLMEKLNNPSITHLLINGGNPVIPAVESVYKHTRLLRSIAPSLFPALHPIDWSGIITQNEELSQRQDQFIRVAPMQRYWMRRGASFNEEPIVNNLLAAEPELSDKAKELIKEYQKLEKENKMDCEFPKLTFFGTSSAVPSKYRNVTGYLVEASENSAILIDVGEGTYGQMRAVFGEDGCKQLLVNLNCVLITHAHQDHMNGLYTIIARRKEAFESLGAPYRPLVLVCNRNVLKPMKTYSICFENIEHLLEIVDISRYPLTPPGSPGGPPGKRPRLPSPHLPPSRDVLQDMSSSFDKKAWKLDELKAVQVHHTRMANGFVMRVAGKRIVFSGDTKPCDLLVEEGKDADVLVHESTFEDGHEADAMRKRHSTMGQAVDVGKRMNAKHIILTHFSARYPKVPVLPEYLDKENIGVAMDMLRVRFDHLPLVSKLLPIFREVFVAELFELTIKKEQRVLKDKELSEKRGQLKA
Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA (By similarity). Involved in germline proliferation. May be required for both mitosis and meiosis in germ cells. [Isoform b]: Plays a role in mitochondrial unfolded protein response. Upon mitochondrial stress is exported from the nucleus where its tRNA endonuclease activity is negatively regulated. In response to mitochondrial stress, might be involved in activating a transcriptional response in an ATFS-1- and DVE-1-dependent manner. May play a role in negatively regulating the mitochondrial membrane potential.
O44514
PMK3_CAEEL
Mitogen-activated protein kinase pmk-3 (EC 2.7.11.24) (Stress-activated protein kinase pmk-3) (p38 MAP kinase 3)
MASVPSSSSLPVSHVRRHEDVSTPSAPPTKRSNNQSQPPESYEPNTWLQQQREQEQQKKLAAENIKKQSIEATGNNEMVGEEEEDILSKPCGPHKRRFQFVMIRNITFAIPEGYDVEPNSIEYLGGGSFGNVIKTSAVCRDGLRRYVAIKKMREPFFDPHHARRIFRETKLLQLMRHDNIICALDIYTPDEENDFRDVYVVTEFAGRSLYQILKQQRDYGRRVLTDEHIKFIIYQIIRALKYIHSANIIHRDLKPGNLALTDDSDLMILDFGLARSLEKKDTSLTQYVQTRWYRSPEVIYWKIDSYTNLADMWSLGCIAAELLTGEPLFPGDEPNAQYQRITQLCGSPDEELLTKIENDNSSAIKAVIQSYTTHKRRNFRDVFSAHNPSEDFIDLLEKLLVLDPEKRITVEEAIQHPYLAEFSLPEDEPRADHIFDLDDSQARTRFEWRDAVWKEIMNYKRLSSSPLIPGEADR
Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Involved in axon regeneration after injury, probably downstream of dlk-1 and mkk-4 and upstream of mak-2. May phosphorylate mak-2. Plays a role in cilium length regulation, possibly by reducing rab-5 mediated endocytosis. Plays a role in the formation of muscle connections, also called muscle arm extensions, between the body wall and the motor axons in the dorsal and ventral cord.
O44516
EFN4_CAEEL
Ephrin-4 (Protein male abnormal 26)
MKQFFEFLITTFLLLGLAAADEHIVYWNSTNSLFRNRQPTIEVRMGDVVRFVCPDNEEGRNDGEYLIVYEVTEFAMDDCALESHSREVIRCAPEGTAEKVLRTQQLSGGRREDWKKQKVPPKNVAQLIRQLNPIPNGKEYQPGQTYYYMTTSTGKANGTNHRMYGLCESQNMRLSMKVSASQPHPTRRAPTRRQEDFVTTASAELMGGQEDEDSDNDNAHLLPRDLEGSTNPKFRRPSQLETAGVENQQFMKVVQMAQAGKTGTFENEKEAIAQKSSEKDGWHPVNVQYVADLMNNAYQNADERISYQRDFEIHEENDLAVKSLEYSSSSTSLSTNFAILLAVIYVLY
Regulates the formation or stabilization of cell-cell contacts at several stages of epithelial morphogenesis. In early embryonic development, involved in ventral closure of the epidermis. During male tail morphogenesis, regulates precursor cell sorting together with mab-20 and allows the formation of distinct sensory rays. Probably acts as a ligand for lad-2 to regulate axon guidance of several neurons including SDQL, SDQR, SMD and PLN neurons during neurogenesis.
O44518
CYFIP_CAEEL
Cytoplasmic FMR1-interacting protein homolog (Gut on exterior protein 2)
MNANVTVDDAISNVNLLDTLAIPDDLPDIEARALPLLYRSNFDTNFEDRSAFVTGIAKYSEEATRHAQFNDMLSEGLQHAANMYTWRCCSRAVPMAKSNDQPNRTEINEMVVEVLKPEVSKLGSFMRFTLTAIQRFCEEVRRLCHSEKRRDFVSEAYLLTLGRFINMFAVLDELKNMKASIKNDFSTFRRASQFLTAMSDTQAVHDMQNLSMFLATQNKIKDDLKLQMKTIEGYEELLCDVVNICAHMYEHQLYLSPNEKHMFVKVIAFSLFLMDGDAANVAKLDQKKRLSISRLDKIFKTLEVVPLYGDMQIQPFAFVRRSSHYEPSKWPLSDKESDRCHVNIVEKVQSIRSDHESYVTQFAKINNEVAICDRPGNDSENREITSLALSGIQLLCQWSCAVVETISWKLLNPTNPKDNRECPENAEEYERATRYNYSPAEKTALIQIIAMIKGLQSMLGKTESDMSNSTRKCVYVELQAFIHHTINEPLQKAVKHKKDLLASILQSVKDSISDAGNELNRMTDVKGKKKSSAPKGDSANSSSSDIRIPRRTAAPGSTQLYMARTQLESLISDKLCGGKKILRKELDSKTIEKISVFLRKSAHWPALFRLSDSMTEAGELSQLWFREFYLEMTMGQRIQFPIEMSMPWILTDYILSCNEPSLIESALYQLDLYNDAAQYSLFNFNKQFLYDEVEAEVNLCFDQFVYKLSEMVFTHYKQLASCMLLDKRFKAEILRSGTMIRSPSAARFESLLQQRHVQLLGRSVDLNRVVSQRVNMALLKALDAAIWKFESEPLSSIVELDMLIDTNRLCHTLLSDVLHSIAPFDDLFQEANHAVNSPHGRITLHVFWELNYDFVPNFVYNGSTHRFVRARHVFRKTPAREKPPQVGQVYYWGSKSLMAAFMNICNAYSQCIGTQHLKAITRLLHYQGIAVILDELLKMTNRLLNDKIRRHVRNVFNMMPKVCKLPRSDYGSNALLQYYVHHLEAVGKYPELKSEFCQDLRELGNMIVFCQQLEVALGQEEAHDLFLAAAYTGTVPQPPARNAQEQMKQLAKLEDKYSRIHLTEIIDKISPDDGQAAIAKDAELMTKERLCCGLNAFENFLVRIKQMLAADDIWTGGYPTNGVFWIDECVEWYRVYSALQFFLCQPTRDDNEVYAEELFGDSLQWGGLTLITLLGQHRRFEVLDFCYHLHRVNKADGKDEVISGIRLAKMVERIRRFQLLNNQIFIILENQLNENNDDPNERVREFAPPVHPNYANHAARRQ
Required for initial steps of body morphogenesis. May play a role in egg laying and yolk protein clatherin-mediated endocytosis by oocytes during oogenesis. Plays a role in the formation of muscle connections, also called muscle arm extensions, between the body wall and the motor axons in the dorsal and ventral cord.
O44548
KNL2_CAEEL
Kinetochore null protein 2
MGDTEIVPLRVQNVLDSEIIRLNLWSMKFNATSFKLEGFVRNEEGTMMQKVCSEFICRRFTSTLLFDVSGRFFDLVGQIDREYQQKMGMPSRIIDEFSNGIPENWADLIYSCMSANQRSALRPIQQAPKEPIRTRTEPIVTLADETELTGGCQKNSENEKERNRREREEQQTKERERRLEEEKQRRDAEAEAERRRKEEEELEEANYTLRAPKSQNGEPITPIRFTRGHDNGGAKKVFIFEQTPVRKQGPIASSTPQQKQRLADGANNQIPPTQKSQDSVQAVQPPPPRPAARNAQFASDADLFAVPKAPPSKSVRNLAASNVDIFADVDSVLDTFHFESTPGRVRKPGRRNVSSPSPEPRHRSSSRDGYEQSRYSQRYEHDNSRWSRHNATYRRHEDESRMSRKRSIVRDDFEYSRRHDDGARRRDYYDADIQGDSKRYRGRDASSSSGRSVRFEEEHRRHGDEYRDPRGPRDYNDYGRRRNHANSRSGEDEEKLNAIVRREKELRNRLQKSQKASSSSYRHRSNSSDAEESLNEWDIENQELLDNSMMFGDGIPKRSNARKDKFVKKQATRSKPANSTKSPAQARKKKRASLEDNRDLNDSIACNRPRRSCVTPVAKKITWRKQDLDRLKRVIALKKPSASDADWTEVLRLLAKEGVVEPEVVRQIAITRLKWVEPEQNEEVLKQVEEVEQKRRRGAVARVKENVKMHEELREGGNHRAEDLQSGVESMEDYQPEDVAADQSLLALRTPIVTKKRGGTRASIMPKPVEDSPMSRGNNSTFNSPRLEQTKAKDIETNFKYVQHLSMMQARPSSRLKKSSSMNNSTYRGNKNTSISLEKGTQKALKIINRGTTIHEDDENEDNDDDDDMREEDTSIY
Required for the recruitment of hcp-3, hcp-4, knl-1, bub-1 and lin-53 to kinetochores, kinetochore assembly, chromosome condensation and chromosome segregation in meiosis and mitosis.
O44712
AHR_CAEEL
Aryl hydrocarbon receptor protein 1
MYASKRRQRNFKRVRDPPKQLTNTNPSKRHRERLNGELETVAMLLPYDSSTISRLDKLSVLRLAVSFLQCKAHFQACLHNSQFLSAGFPMSTHSYSYQPHPPIPFSNKVPTIFDLRIGTPMLDPEESNFEEISLKSLGGFILVLNDNGEIYYASENVENYLGFHQSDVLHQPVYDLIHSEDRDDIRQQLDSNFHIPTSSASNQFDVFAPQNSKYLERNVNARFRCLLDNTCGFLRIDMRGKLMSLHGLPSSYVMGRTASGPVLGMICVCTPFVPPSTSDLASEDMILKTKHQLDGALVSMDQKVYEMLEIDETDLPMPLYNLVHVEDAVCMAEAHKEAIKNGSSGLLVYRLVSTKTRRTYFVQSSCRMFYKNSKPESIGLTHRLLNEVEGTMLLEKRSTLKAKLLSFDDSFLQSPRNLQSTAALPLPSVLKDDQDCLEPSTSNSLFPSVPVPTPTTTKANRRRKENSHEIVPTIPSIPIPTHFDMQMFDPSWNHGVHPPAWPHDVYHLTQYPPTYPHPPGTVGYPDVQIAPVDYPGWHPNDIHMTQLPHGFTPDAQKLVPPHPQMSHFTEYPTPSTHHDLHHHPLKQDNFHLISEVTNLLGT
Probable ligand-activated transcriptional activator. Acts as a transcriptional regulator in GABAergic motor neuron cell fate specification and development. Promotes cell-type-specific expression of guanylate cyclase genes that have key roles in aggregation behavior and hyperoxia avoidance. Has no role in carbon dioxide avoidance.
O44740
MEI2_CAEEL
Meiotic spindle formation protein 2
MSGLDDRKKLTHAKNRKPLNDIPKSAENRPNTRSTSSRRGAEKDVPITFIGSSRTVKADLPEFTNTRSRRPLHSESKKELSRNPVSRGEEHSSSLPKSSPESSVSVMSSNASLWSACTEEVNKIGVCAKRESRNLRVYKMKSFTSNMEQILSNDNQLAPTVIRILNSRNSWCLNSCHACLTFIMENITSDNYGKRSACLKALASITNSLLDTIIGFASTKTRRIGVDVVAEERAAKATECIHNFRKIVKNRDKIYKQIDQETIYKLDAILERLKKVSSHK
Forms a heterodimeric complex in conjunction with mei-1 which severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays. May act to target mei-1 within the cell. Required specifically for meiotic spindle formation in the female germline.
O44743
LE607_CAEEL
CREB-H transcription factor homolog let-607 (Lethal 607 protein)
MDQDFDLDEGAGQFNLKTTLMMFTSNDSQNDDGIWSPGSPYQALEDPSFLDKHFVSDPDRYTADELYSALEKMDGKSDLIGMDDMDNDNCYSLSPPDSGSLPISPASTSPSSYHSSGGEDLMDCYPSIDILQQASEELLYSKDDDYEICSSGPLLAYTNANSVATSAVHQNQQQQQRRLNQAGFPHQNSNGLVRFKSSQPRVLNPASISLNAPSSSFNPQSTSSTPATSSSSSSSTNGGFVKSSTGERRKYPPLRLDEEEIKLCKKEGICLPDFFPLTKAEERDLKRIRRKIRNKRSAQTSRKRKQDYIEQLEDRVSESTKENQALKQQIERLSSENQSVISQLKKLQAQLGQNAKRTTQAGRCLAVFMLSACLLVSPQLSPLGNQDNQKVLECIEEACQPSATSMNSANSAQRAIAGVTAPSVVIPSGGPVMVSTNANRQMNRNAVLNHHNNSKYPASGNQNHHPIALEDLNHPPPTLQPKQSYQQQHQPSMYRRSDETIAMAMAKIGARKGSSTSSSSASSVASSTSTSSATSPIYRTSRTLGAFEDQCDASSDDSNCANMPSLVPMKMSAQPPKRKIVTMNGQPRVTYRAVPASSVNVEQAQYYKVPQQKVQYVTMDRPIKYEVLQLNDYIKMEEESTIRLPNSWSTAGPRLHPQVNASSRTVRPLTVATPVHYNGPSAKKIKTQMF
Probable transcription factor, required during migration of the gonadal distal tip cells (DTC). Probably regulates cell adhesion of DTCs via modulation of expression of genes involved in integrin-mediated adhesion, including tln-1, src-1, and integrin pat-2. Modulates expression of genes involved in protein trafficking during embryogenesis, including emo-1, sec-61, calu-1, sec-24.1, enpl-1, sar-1 and tfg-1.
O44750
XPP_CAEEL
Xaa-Pro aminopeptidase app-1 (EC 3.4.11.9) (Aminopeptidase P)
MTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRSVPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. Has activity towards the flp-9 neuropeptide KPSFVRF-amide.
O44757
LIN59_CAEEL
Probable histone-lysine N-methyltransferase lin-59 (EC 2.1.1.-) (Abnormal cell lineage protein 59)
MHGAGEQQQRYRYNARSDEQHHHPSTSSHQYQQQGARQMHQMHPIQATLMCTPTTTSAAASTSSSGGSNSSGGSGGHRQQGNILRIGNSIKIGDNILEPAGTLVFSQADGTPWTGQRIVVNGSTHAVVKANLFPIGTTPPVLNMQSNQNWYMNQPSGTVPMSSNAPATTSSATPDSGIQSVPTSPPSPSYAMMNDVDIGDHDDEEDDDGPADFTDMPLLKPVDEDDDCYDVPCTSEGPPPNNSNPAITTIPSSCSTPAPPKESLPTGMNVEEWGSFLIASNMDREEIVRRLMAHDPEMAKAIAMRIRELSAEESKKKKDMEAEVSSTTPTTPRARGTRTRNKCATRSTNSPDVTTSNLPEEPSTSTMGLVKENEDVEKVEGKRRGRKPKKRRGFHKESFEDLESDAKKSKAEQHEDHLPEASCSSRPESVIPPPVDPIQFRLKVREMMERKLEQLTQKMSEDMTELRLSHLTSSKMVNGERGKRRESFLRQLNEQSKKLRKGGMLGRKRLRMFMTESDILEENKDNIKKEVKEESTPPPTKLRGRLPSRRTREPSEIVNPEPVEKKFNGEYFEITKSVPSSDDIIPLWMAPSLTCGCTKGACTSDMDCLNRALRVQCSSDCSVPYCSNRRFWKEDCGNKLCVSNGPRSKRVLKTKIARRAGEFLCEYAGEVITREQAQEKFAQDRDPRIIAIAAHLFVDATKRSNIARFIKHSCKPNSRLEVWSVNGFYRAGVFALSDLNPNAEITVDKSDLLPFDMACNCGATECKRVIRGVRWRCADPNEKIVTRRFVIRNRRKTIERSSHSGLPAILQTPMDENSSIRLKMKQVLAAFAFRVRKIDGSMSRTMLPHYTLIIKFLKTKGNNPNPVEFVSLFRKWLEAIDDDDLERAFVAIESHYMSSSILSSSLQSKKAKDNAPRARALSTSCPSPVPSKRGDADLSYLESLYPIGSYDPDDAWESYSTNKKGNAVRCICGALDEEGTMVQCDTCHFWLHVDCCQYVVRSNEKAQKSKNPPSDDGEYICDFCTNKQNGLRPSADVKLTEQPDVRFENCDYYRSLINRRGIQVVLNETVYVNRVLPEDHKAMLRNLREEKKGSKQKDTNKYRFPKAATSPLPIEKVDRKNARIFRVERLFVCPGNNRFVFGSFYAWPHETYADAGRVFSKKEVFATPYYETLPLDEVIGRCLVLDTATWCKGRPKVPKFKEDDVFLCEMQIGKTQRVFEKVPPKNRYPINTNSYVFTEFTHPKKVVRDFRPYDPSNPSPKPPKTSSIPSTSSIDPPQSSSDGLPEVDTKKLSKRHIQRVLKRLVKNGSRRS
Probable histone methyltransferase (By similarity). Essential protein required to maintain expression of homeotic genes egl-5 and mab-5. May play an analogous role to the trithorax Group (trxG) proteins. TrxG proteins form multiprotein complexes that are required to maintain the transcriptionally active state of homeotic genes throughout development. May act via a modification of chromatin. {ECO:0000250, ECO:0000269|PubMed:10648230}.
O44783
SPY_DROME
Protein sprouty (Spry)
MDRRNGGDPLAPPRPPKLLPRVHRPRAPEPTLSGVDHNAGATASALASGASSAAPVAIHNNNSQQQLSISAAASNNNTISIIPASPDFDDYQIHHLTFLPQRPSSLSRNSSTASSTTATGISVSGSGSVSGSSSSFTRRRPPAPVPLNNSISNNNNNSINNNFLSHFQSAEPASNALGQPPASPVTLAQPRPESERLTNEYVDTPLQHATRSQHPAGQQDNGQTTTHHLLLLPQRNQHLHLQQHQQHLQQQQQQQQQQQQQQHLQHQQNQQHARLATTTQATSVGSDHTDGLLHSHLQNSTTKPPASKQPAPPRLGMGLGLGLGLGLNQPIITKQPTPATQKERMHALEELLQPGGAGGNGGPLVMAGDPSLLNPIVCPRCGRCRCEQCQSPRPLPQTWVCNKTCLCSAESVIDYASCLCCAKALFYHCARDNDLDCDDGNGTPCVDNPCSCGPYKRTQRWGWLGALSIFLPCLWFYWPMRGCMKLCEKCYGRFAGRGCRCQGIGGGGAGSGGGVGSIGSTSSMLPIVPLGVNGSGLGGGVSLSGGVTDGGLNQANGKAMDHGCSAARSILRKGDLTPEKRLLDSSPDY
Inhibitor of tracheal branching that restricts branch budding by antagonizing the BNL-FGF pathway (BNL: branchless, an fgf inducer of branching). Acts as an antagonist of EGFR-mediated signaling in the eye (where it is important for cell determination) midline glia, chordotonal organs, wing and ovarian follicle cells.
O44836
MMPB_CAEEL
Matrix metalloproteinase-B (MMP-B) (MMP-H19) (EC 3.4.24.-) (Zinc metalloprotease 2)
MTKWSPNGNPLSTIYLILSLFTLAHTAPTTQHSRTTTQLRLEDEDGGGGVDEDSIHFVKGQMEKYGYLKGIDHSSPQEFRQALMFFQEVLEVEQTGNVDEMTVEAASKPRCTQTDVRQEQTKRTKRFTLSKRAKWAHASGQSVTLKWYISDYTSDIDRLETRKVVEKAFKLWSSQSYIKNEKKVTLTFQEASSKDEADINILWAEGNHGDEHDFDGANGKIEGNKKENVLAHTFFPGYARPLNGDIHFDDAEDWEIDVDQVGHGSNKRFFPYVLAHEIGHALGLDHSQKADALMHPYYKNVPINEIQLDIDDKCGVIWNYGGASDFCLYVWLMSQIVEAHNSSAQNNHGVGSITSSRTNKKSFKSEGFFLFQLKFPHSTLTHTDDVVMREKDKRSYRGDSKIPKCSSNNSSQRTLAEKKLTLGLHLSEADAKRYTEMVCNFLAGLHMWRTNPNHHASESLEKEYKGVSQEMGTFSGKSIAVRRLIRHAEHQKERSEKGPLDPDYFDDDFFENFFMEYSK
Metalloprotease involved in molting, a process during larval stages in which a new cuticle is formed and the old cuticle is shed. Plays a role in thermotolerance probably by preventing the accumulation of oxidized lipoproteins and cholesterol.
O44857
NEPL2_CAEEL
Neprilysin-2 (EC 3.4.24.-)
MRPDEEDGTTKSPGSRWTRIWAIIALILLILFLLVLGAAIYFYINYKDSSDVCLSPGCIKTASVILSSMNSSVDPCDDFYEFACGQWIKGHPIPDDAPSVSNFENLGQDLEFALKELLDENDEPYDYETSAVGKAKYFYNLCLNESEILDNWRTTFDEVVKSFGGWPSLGHQMKPDASIEMLYADMVAKFKADSLFKATVQPDDKNSQRHVLLIDQPQLNLFARDFYVAAENEERMAYLQLIRDVLILLDADRTRATLDAKEIIDFETALANITMADEHRHDIAELYTKITLGEMRRSLPHFNWPLFFNRMFKDLHEKNGKRITFDDNTEVVVYGYEFLRRLDVLIPQYDNRLIVNYLEWCWFFKTMLRDLPDPFALTIFKFYKTLNIMNVQKVRWHGCVTRINSLMPMATSAIYVKNHFDHEAKQQVEEMISLIMESFVDLLLSEDWLTKETKQTAKQKVNEMKRKIGYPDYLNDPAAVNNEYKTFKVYPGHYYQTKFSFYEQYQRDVLERITEAVDRERWVAGAALVNAFYSPNTNEIIFPAGILQPVFYSKDFPSSMNFGGIGVVIGHEITHGFDDRGRLYDNLGNIRQWWDNATISKFEHKAQCIEKQYSSYVLDQINMQINGKSTKGENIADNGGLKQAYRAYKKYEKRHSRPPRLPGVNLTHDQLFFLNYAQIWCGTMNDKEAIRKLRTSEHSPGPIRVKGPLSNSYDFAKAYNCEPGSQMNPREKCRVW
Required for olfactory plasticity, which is the change from positive chemotaxis to dispersal after prolonged exposure to an odorant. Thought to antagonise snet-1 by degrading excess snet-1 peptides and thus enabling olfactory plasticity.
O44952
LONM_CAEEL
Lon protease homolog, mitochondrial (EC 3.4.21.53)
MYRAGAVLLRGATRTRLLAAASAHQSFATFSQRNQSILMMKSMELAGNSGERRFYSTHDDPIAVDDSLELYKDLGGMSPIQVPADMPNVPMLAINRYPLFPGFIKKVDIVKDDNLKALIRRQLSLKQPYAGVFVKRDDENKEETITSLSEVYPTGSFVQIIEVRDQGSVLELVLSAHRRIRALEPIDEITPKNETPLNGRRARGKRAASATSPLTPPPSPPPLAPSVASVAPEISATEEKEEKTTPPSATGEKQKKGIIMVRTENVVAEPVPKNNETKATMMAIVQTIRDVVQFNQLFGQQINLLLHPSQNVIDNPVYLCDLVATLVQSAETKDLQEMMDEIDVSKRLKIALLLIQKEKAVAKLKYDINKDVEKKVQDHHRKYLLNEQLKVIKKELGIEKDEKTTIIEKIDERIKTLAVPEYALKVINEEKTKLQFLDPHSSEFSVTRNYLEWLTSVPWGLTSPENRRLSVAKKALDEGHYGMKDVKERIMEFIAVNLLRKSIGGKILCFHGPPGVGKTSIAKSIATALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKMIQCMKKVKTENPLVLIDEVDKIGGAGFHGDPASALLELLDPEQNANFNDHFLDVPVDLSRVLFICTANEISKIPGPLRDRMEMIDVSGYLAEEKVEIAHQHLIPQLRKDTSLATEQLKIEDSALEELIKHYCRESGVRNLQQHIERIFRKAALQIAEQQNEDEEPAEKATTAITENSEAEPITSTSSADCLKSSAEQIVVCTENLQKFVGRPKFTSDRMYEVTPPGVIMGLAWTAMGGSALYIETVLKRPVDLTNDKDGSIETTGNLGDVMKESVRTALTVAKGILAREQPDNKFFDKAHIHIHVPEGATPKDGPSAGVTLVSSLLSLALDRPVVQDMAMTGEISLTGKVLPVGGIREKVIAARRVGAKRVFLPNENRRDFDDLPEFMKSELDIRFVSHYDELYEHLFQ
ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner. Involved in the degradation of transcription factor atfs-1 in the mitochondrion. {ECO:0000255|HAMAP-Rule:MF_03120, ECO:0000269|PubMed:22700657}.
O44959
RIOK1_CAEEL
Serine/threonine-protein kinase RIO1 (EC 2.7.11.1)
MEKVEHLNLNIQNILEDVDIDTASSSSDDEPEQAVVKQEKLEAGEQIEEQYDTDSDYDDDIVEFAEATGDFTKKLNAARLNTIGPNAARNRLTVDVERHADTSEDRKRKRVKDRADRATVEQVLDPRTRLVLFRLLQRGTLLNIDGCISTGKEANVYHATGTDNDLAIKIYKTSILTFKDRERYVTGEFRYRHGYCKSNPRKMVAVWAEKEMRNLARMHEVGLPVPKPHLLKGHVLVMDFLGKDGWPAPLLKNANLSQEDAEPMYVGLVRDMRRLYRECKLVHADLSEFNMLVHDGKLWIIDVSQSVEQDHPHALEFLRMDCNNVNKFFRELGVPVLSVRRLFEVIVDPLMSSKEMETIIEEERVLVNSEDDSLFMNAFIPHKLEHVLHFERDGKLAKEGVEANNPFQNIVSKIDLKGDGFGEEHDDSDDNDDEENGKKSRKKRAEPTEEEIQEKERKIAMHTRNREETAEERKERKAAVKEEKREQRKEKIPKHLKKRAHRQHMK
Involved in the final steps of cytoplasmic maturation of the 40S ribosomal subunit (By similarity). Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity). The catalytic activity regulates its dynamic association with the 40S subunit (By similarity). Plays a role in oogenesis by regulating germ cell proliferation, progression through diplotene and diakinesis stages and oocyte maturation. Regulates germline development probably by regulating the phosphorylation of mpk-1. Involved in larval development.
O44997
DAPK_CAEEL
Death-associated protein kinase dapk-1 (EC 2.7.11.1)
MSDDVNSSATSTSSSTVHFDDTPFEDVYEIETELGSGQFAVVRRVRDRKTGEKYAAKFIKKRRYATSRRGVTRQNIEREVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGGELFDHVCAKECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQRGDSQIKIIDFGLSREIEPGAVVKDMVGTPEFVAPEVVNYEALSPATDMWAVGVVTYILLSGGSPFLGDNRDETFSNITRVRYHFSDRYFKNTSKHAKDFIYRLFVRDVDQRATVEECLQHPWIRGPEGNAIDIRKASCITISHIQSFKTRQRWKRCVELVMVLLKASKSSRRIGDGRFDEEDMVASCTLICAEEGNLRALHKLSALHKLLPNATRKSLKSSFSEPNGATAMHCAAKYGHAEVFNYFHMKGGNICARDDNGDTPLHVACRFAQHTVAGYVANEKIDVDSINKTGETALHCAVESADTRVVRLLLQLRPRLDLPNASGDTVLHLAADSINPRIVPLLVCLAPPLHLRNIREETPLHVAAARGHVDCVQALLDANSPIDAVEQDGKTALIIALENGNVDIASILITNGCDINHADHHGDTALHIASKHGLLQAVQTLCHCAVTVDSVNANKKTALHLAAHYGHVDIIRVLLLARADVTLRGDDGLTAELVAVAAERLEAHSLLKMVKSQEIREEYISQLYPLDTSLRRIKLKLLGHSQSGKTRLVQTLHSSRGISSFLESVTRRISDHYSPSSSMKDDGIHSTNGSFVSESNNNSSFDLAAAAGSKYAPPHSQYTRGIDVQTVNINGCGEFSVWEFGGYEPMHTCYDHFVGNADCIHLILYRTSDPTEVQYKQILYWMNFLKGRVTPFEPIGHCGFSSRRSKVIIVGTHATSSLFPQMNQEGEYVSSDIEAMLNTVRLRFETHFDMDHRLILLDATNPSCIGMKTLKMELAKCRTNILAKLLKPLAILDTVVNHLNLVRKKHANFPVITWPDFIQLVRNEINPLTGDAHCRQIVQQLQLIGELVYLRNDLCDADYVVLNAEWFGTHILGQLLSAEFLSKASPNGSYHTSSLAKIFPEIPEQSDLMTILEVLQLCAPDARTGAHEFPVFIQTEAPDSIWRPYSLKEKERDTVYGGVRILPMRGMERSLHSTFPRIQVALRRSINDYQPAKDTQLHQWSECSKLVSQDREAVIRMVGDAVEIRARGPSESATSMFYFMEDLINLVEHAAAEVGPGISLERHFISPKHLKEHREHPALFPPESMMEMQQRESLSVKGTQDEEELFTDVVCFGSRDVARHLTLGIDVGVADLQMASRCELACLLDPPHAMGRDWSILAVKLQLTDQVPDVDSTGQSLSRTDQLLNEWAIHHPEQASVGNLCRILVELGRCDARDALYRTVPLYVFAPLEDQFLLETNDSGVVSSCHSSSEHNPINI
Negative regulator of epidermal barrier repair and innate immune responses to wounding. The role in epidermal tissue integrity and wound healing is established through the inhibition of epidermal microtubule stability, possibly via the negative regulation of the microtubule minus-end binding protein ptrn-1. In epidermis, prevents expression of specific unc-44 isoforms probably by promoting nuclear localization of pinn-1, which in turn may affect sydn-1-ssup-72-mediated regulation of alternative polyadenylation of unc-44 mRNA. Appears to act downstream of or in parallel to muscarinic signaling in the regulation of autophagy.
O45100
ATAT1_CAEEL
Alpha-tubulin N-acetyltransferase 1 (Alpha-TAT 1) (TAT 1) (EC 2.3.1.108) (Mechanosensory abnormality protein 17)
MQVDADLRPILGPQLVRLDPMRVKQLQDPIVYEAIDNLAKLSAHCLQLRTPLTTCEKLINSDSTLYLSWKYDEEEKVSRLMGFAKVGRKKLFLYDSQMQTYEGEILCLLDFYVHFSCQRQGVGQQILDYMFSQEHTEPYQLALDNPSVTLLGFMSQKYGLIKPVWQNTNFVVFEELFLALSAENGIEKPPPDGWRRPMTPRRLGTGMTDTRWLQHAVSGHQSKGNAMAAPVDADMTPQGALSNRAHQAKARKAHILSSKPLW
Specifically acetylates 'Lys-40' in alpha-tubulin/mec-12 on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics this activity may be independent of acetylation activity. Acetylates alpha-tubulin with a slow enzymatic rate, due to a catalytic site that is not optimized for acetyl transfer. Enters the microtubule through each end and diffuses quickly throughout the lumen of microtubules. Acetylates only long/old microtubules because of its slow acetylation rate since it does not have time to act on dynamically unstable microtubules before the enzyme is released. Required for the maintenance of touch receptor neurons and possibly other type of neurons involved in locomotion. {ECO:0000255|HAMAP-Rule:MF_03130, ECO:0000269|PubMed:12124626, ECO:0000269|PubMed:20829795, ECO:0000269|PubMed:2646709}.
O45244
DHX16_CAEEL
Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 (EC 3.6.4.13) (Masculinization of germline protein 4) (Sex determination protein mog-4)
MSVEQFINDQLHSIVGISDRSICQYVHALAKKAKSAPDLVEKLRDAGDFPISPAIQSFADQLMSRMPRQATSARQRGPTTAELAEQELNRLNRAVGVLEDYSASSTKTKNVRKRKESSSEDDEAPIKASKPGKSVKPSKSDDSESDIEAMEAKLDADIAERDALAARINKKEKDKTRNVMEKKRDDNKDKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKADMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEEEQLMASMLHLGAKDAKRKEQEFELLLDEKVDFIQALQMPGTNEEVVETEAEKKKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKSSTDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPRWVVYFELVFTSKEFMREMSEIESGWLLEVAPHYYKGRELEDATNKKMPKNKGKSGKDLER
ATP-binding RNA helicase involved in pre-mRNA splicing (Probable). Operates during embryogenesis.
O45293
GALT8_CAEEL
Probable N-acetylgalactosaminyltransferase 8 (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase 8) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 8) (pp-GaNTase 8)
MRRHVVLSIFVFAGIVFAAEEAEKLPKCEHVDPYENLEGWLDLKPLTERKCNHTLKENLTEAESKKSEWGIKSFAFDALSSEKLGPNRNVGKQAHKLCEEEKYDASYSTSVVVIHHNEALSTILRMINGIIEFTPKSLLKEIVLYEDASEEDHVLTKHLEKFAKIKGLEDKLIIKRSEYRQGLIRAKVHASRLATGEVIVFMDSHCEVAERWLEPLLQPIKEDPKSIVLPVVDLINPVSFDYSPSMVAKSGFDWGFTFKWIYLPWEYFETPENNVKPFNSPAMPGGLLAMRKEYFVELGEYDMGMEIWGSENIELSLKAWLCGGRVVVAPCSRVGHVFRMRRPYTSKPGMDTALYNAVRVAKTWLGEYESKFFAVKPRGAKMVFGDLTEPMQVKDRLKCKDMKWFIENVYPELEPKVHDEL
Potential glycopeptide transferase involved in O-linked oligosaccharide biosynthesis (By similarity). In contrast to other members of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on peptides that have been tested. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.
O45307
OXDD1_CAEEL
D-aspartate oxidase 1 (DASOX 1) (DDO-1) (EC 1.4.3.1)
MTPKIAIIGEGVIGCSTALQVAQAVPDARVTVLSDRPFEQTCSFGPAGLFRIDDIANREFGKSTFDWFAHLHRTEKGDKTGVKLLSGHIQSDSKERLEQQQKAYGDIVYNFRFLEKREILDLFPNPSEHCIHYTAFASEGNKYVPYLKFQCQARGVEFLHRKVRDLEELANEGYDVIVNCAGLSGGTLAGDDDSVYPIRGVVLDVEAHWHKHFNYKDFITFTIPKENSVVIGSVKQENRWDLEITDVDRKDILERYVALHPAMREPKILGEWSGLRPARKTIRIEKVEKKSEKSGKKYTVVHHYGHGGNGFTLGWGTAVEATKLVKSALNSSKL
Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate. Highest catalytic efficiency for D-Glu followed by D-Asp and NMDA. May play a role in the egg-laying events and early development of the worm, in addition to quality control of the germ cells.
O45346
OSM11_CAEEL
Notch ligand osm-11 (Osmotic avoidance abnormal protein 11)
MNFITVAALAIVMVLAQANPARVRRNEEMSERYCIKHLDHYNKYCGDNAGPIDRALFGKVAKFCPAYEKHCAVGKAGLVELPDLGSPLVMPPVLPRGSDFASLDLPIADERKPAHIHSSRTAPQTTRLTAAIVATCTPECTAAHCTDECKCAHTHPKVHQMCNPPSSAAMAETCQRWYSKCTMFTPVQY
Probable secreted lin-12/Notch ligand or co-ligand involved in the mediation of Notch signaling. Involved in the lin-12/Notch pathway signaling of cell fate in vulval precursor cells (VPCs), acting redundantly with dsl-1 and lag-2. Required for normal octanol avoidance response, acting via both lin-12/Notch and glp-1/Notch signaling pathways in neurons, in concert with lag-2. Involved in regulation of sleep-like quiescence during the larval to adult transition, acting via Notch receptor activation and in parallel with EGF signaling.
O45405
EXL1_CAEEL
Chloride intracellular channel exl-1 (Exc-4-like protein)
MPTFSLWLPAGSNNVHPCGDPYAHHLFMRCLYHAKHDPTMKFDVKTTNVNKTSQEFKNTGLRRMPGISAEESGETQTFETEDDILDFLEYLKPERGDDEEAENATCDLFRQFARFVKDVEHRDTAFNTELLRLDKYLSEQETKFLISDDVTHIDCLVLTRLHSIRVAAKMLKNYEIPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLHWTELKDTPRLSAKDRAKLVREEPVFSFSV
Probable chloride channel.
O45495
UB2V1_CAEEL
Ubiquitin-conjugating enzyme E2 variant 1
MVDVPRNFRLLEELEEGQKGKGDGNISWGLEDDSDMTLTRWTASIIGPPRTPYESRIYNLQIQCGGNYPREPPTVRFTTKVHMVGVNQSNGVIDKRNLTTLRNWSNSYMIKTVLEDIRKNMMMAKENLKLQQPAEGAMF
Involved in protein ubiquitination, but has no ubiquitin ligase activity on its own. The uev-1-ubc-13 heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. Involved in sorting Lys-63-linked polyubiquitinated maternal membrane proteins for degradation by targeting to multivesicular bodies. Required for glr-1-containing glutamate receptor trafficking in neurons. May have a role in synaptic transmission at motorneurons. May be involved in the ubiquitination and growth of intracellular polyglutamine protein aggregates.
O45539
SRC2_CAEEL
Tyrosine protein-kinase src-2 (EC 2.7.10.2) (SRC oncogene related protein 2)
MGSCIGKEDPPPGATSPVHTSSTLGRESLPSHPRIPSIGPIAASSSGNTIDKNQNISQSANFVALFQYDARTDDDLSFKKDDILEILNDTQGDWWFARHKATGRTGYIPSNYVAREKSIESQPWYFGKMRRIDAEKCLLHTLNEHGAFLVRDSESRQHDLSLSVRENDSVKHYRIRQLDHGGYFIARRRPFATLHDLIAHYQREADGLCVNLGAPCAKSEAPQTTTFTYDDQWEVDRRSVRLIRQIGAGQFGEVWEGRWNVNVPVAVKKLKAGTADPTDFLAEAQIMKKLRHPKLLSLYAVCTRDEPILIVTELMQENLLTFLQRRGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARILMKENEYEARTGARFPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRPTFETLQWKLEDLFNLDSSEYKEASINF
Non-receptor tyrosine-protein kinase which may play a role in larval and pharynx development. Unlike src-1, does not play a role in embryonic development.
O45551
IF4E1_CAEEL
Eukaryotic translation initiation factor 4E-1 (eIF-4E-1) (eIF4E-1) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein)
MTETEQTTAPIYPLKRNWTWWYLNDERNKSWEDRLKKVYTFNTVSEFWALYDAIRPPSGLNALCDYNVFRDDIQPMWEVPENSNGGRWLIVIDKGKTPEMVDAIWLEILMALVGEQFGKDMESICGLVCNVRGKGSKISVWTKDCNDDETNMRIGVVLKEKLMAASKDHSKPLFDVIRYEDHESCQKKTSSVVKAKLSLHSSDAPVAEKSAV
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. All 5 eIF4E proteins bind monomethyl cap structures. Only ife-1, ife-2 and ife-5 bind trimethyl cap structures which result from trans-splicing. Translation of trimethyl cap structure mRNAs may be regulated by intracellular redox state disulfide bonds change the width and depth of the cap-binding cavity determining selectivity to mRNA caps. Required for progression through meiotic divisions during spermatogenesis and for the production of viable sperm. It is not required during oogenesis.
O45657
PLX2_CAEEL
Plexin-2
MLPESVFLLLISHFLRAVTQPPFETEGVKQKLFHFSGHIDDFIVSRDQQTIYVASLNRLTSLSISNFSIQHEVSLGPVQDSPWCSADGKSCLKDNRPFPTDVRTKILQILPTNQILQCGSVKLGSCSTFNSKLSLITESTIAVAANSPDASTVSKIIDNRLIVAASATKESPYRDPFPAVAIRNLPGLNVENAGDLEGEAAVFLRAAYKNAFKFLYTFTHQHFVFVVAMVTPRESRLPMTTRLIRFCRNDTKFESYSEIELQCRGEDNTNYPFLNAIIQSYDKLIASFSTSSTSPKSSICVFSMQKVKLTFWYNVDRCRSGTDSIRLPHIGRDTKCVNKAHIPLDEDSCELGVGGSIELVEMSTKDIMGKVTSLMAVDQKAIFAGTTTSQIVMFKWDEHHSNQLEEYGRKEVGDGRTGSEVSKMVKFGDFVIVQMPYGIILEELSTCSHHSSCTECLVSVDPLCQWCHPTQSCTTSARCTSPVTSQCPIVDGDPIPSIVSVNSSTPISFNIHHLPPPVGFTYRCQFGTSTSSIKANWTTTGVSCPSEIFTSPNTFEILLLTSISNNPISRHNFTVYDCSGYGTCSSCMSSEYNCAWCSGLHKCSNSCGALEKSKACVKIQPMRLPIAIGSQQEIVLEASNLDTLDRRHEHFCKVNEQVSLAKIASDSIRCGKIQLTLSNTTSANMVVPLSLITRDSVIDIANVSLYSCTNLASDCSSCLALSPSLSCGWCNRQCSHECHESKATAVCDPPRIDKFEPTSGPIEGGTIIKIYGNDLGMSVEDVRGKIYVAGSRCNIVEYHVSNMIACQVDKGVSSGPIRISVGRATVAVAESSELYSFVRTSIFSAYPLYGPISGGTRITLYGQNLSSGSQTSVTVGGMPCPIERVNSSTVLTCLTPSGTRIGKSARVVVHVDHSQTQLDQPFEYRSDPSISSIFPMTSFKAGGRIVYVQGNSLNTVQTAKLFLISSPTPPFYIISDLAPCHIINSTLMTCMTPKILETITRRVEYTRQPVGFHMDNVTAVANLGRRIQMGIYPNPTLSPFKGVRYHQGEQSLILEGHNLNLAAEPNDFKIFIGNERCYVTLVDVRQLVCSGPVRQPKATDERGIPINGDNPLVTVIVGSLRMELGLIEYSDHALPSRLSLLILGLLLFIVVTLTVMCLVFKRRRQEREKEYRKIQLQMENLENNVRKECKQAFAELQTNLVLSPKSANSVNLGPELINFPHFVENLLWSDNNLTSAPSLARTLPVTLAQFHALLSFKGFIFTIVEAAESDVSISTSEKSMLASLLISVLLRNFSYCTEVVVDLLRAHIARSVQNKRAELLFRNSDSVVEKMFSKWMSICLYSHLTPQMNSYFYLYKALQYQTDKGPVDAVTGDARYTINEAKLLRESVDTKTLKIRVIPFEKCDESIDLEVHACDAICQVKQKVASAVYRETPYSQRPRITQFELKYKCPKRGDVKLTDVLPIETLSQKKLPVKLFTLADYGISDGCTLEMSPAVYTAESYRNSLADSGQSSWSSLDRCSPIYSSSKYYHLTNPSSGTMTFKKKSSNDSNLLPKSIPEVYLTRLLTSKGTVETYVEDFLESVLYMHDSSYPPILKFFFDILDREASVNGVSENICQQWKANGYVLRVWANFVRNPQLVFDVPHSISMDANLSTVAQTMMDCFSFSEPVLGAHSPSSRLLFAKDVARLRPLSVDLFKRVKNSPPLGMDELRTELVNMANDVSTCKGSSLALSELLSWVRGNGIRISQLLSSNEQFSQQRLPQKLSQVLHVCLETDNHIYSTISDYE
Involved as a receptor for mab-20/sema-2a in the formation or stabilization of cell-cell contacts at several stages of epithelial morphogenesis. In early embryonic development, required for proper ventral closure of the epidermis. During male tail morphogenesis, involved in precursor cell sorting and in the formation of distinct sensory rays. Involved in axon guidance of SDQL neurons during neurogenesis. Probably in response to stimulation by mab-20, regulates fln-1-mediated remodeling of the actin cytoskeleton and thus axon guidance and/or fasciculation of DD/VD neurons.
O45666
NHR49_CAEEL
Nuclear hormone receptor family member nhr-49
MDYFLDASKHIQLNQIDEESSDDFMDLVDPLAEPCAVCGDKSTGTHYGVISCNGCKGFFRRTVLRDQKFTCRFNKRCVIDKNFRCACRYCRFQKCVQVGMKREAIQFERDPVGSPTSGASLNGTPFKKDRSPGYENGNSNGVGSNGMGQENMRTVPQSSSVIDALMEMEARVNQEMCNRYRRSQIFANGSGGSNGNDTDIQQGSDSGASAFAPPNRPCTTEVDLNEISRTTLLLMVEWAKTINPFMDLSMEDKIILLKNYAPQHLILMPAFRSPDTTRVCLFNNTYMTRDNNTDLNGFAAFKTSNITPRVLDEIVWPMRQLQMREQEFVCLKALAFLHPEAKGLSNSSQIMIRDARNRVLKALYAFILDQMPDDAPTRYGNILLLAPALKALTQLLIENMTLTKFFGLAEVDSLLSEFILDDINDHSTAPVSLQQHLSSPTTLPTNGVSPLNPAGSVGSVSSVSGITPTGMLSATLAAPLAIHPLQSQDSILNSEQNNHML
Orphan nuclear receptor. Regulates expression of genes involved in fat metabolism and in maintaining homeostasis of fatty acid saturation, such as lipid desaturase fat-7, and acyl-CoA synthetase acs-2. May form part of a negative feedback loop with fat-7 to limit mitochondrial beta-oxidation, in which it stimulates expression of fat-7 and acs-2, and in turn fat-7 indirectly inhibits acs-2 and other genes also involved in beta-oxidation. As part of a lysosome-to-nucleus retrograde lipid signaling pathway, acting in concert with nuclear hormone receptor nhr-80, activates the transcription of genes promoting longevity and mitochondrial beta-oxidation. In concert with nuclear hormone receptor nhr-66, involved in regulating target genes with roles in sphingolipid breakdown and lipid remodeling. Also involved in regulating fatty acid desaturase genes, acting in concert with nuclear hormone receptors nhr-13 and nhr-80. Plays a role in modulating mitochondrial morphology and function. Plays a role in transgenerational lipid accumulation in response to a high-fat diet.
O45679
CYSK2_CAEEL
Bifunctional L-3-cyanoalanine synthase/cysteine synthase (CAS) (EC 2.5.1.47) (EC 4.4.1.9) (O-acetylserine (thiol)-lyase 2) (OAS-TL)
MSRELMVETGGELIGNTPLLKLNKIGKDLGASIAVKVEYMNPACSVKDRIAFNMIDTAEKAGLITPGKTVLIEPTSGNMGIALAYCGKLRGYKVILTMPASMSIERRCLLKAYGAEVILTDPATAVKGAVQRAEELRDVIPNAYILNQFGNPANPEAHYKTTGPEIWRQTQGKVDIVCFGVGSGGTCTGVGRFLKEKNPSVQVFPVEPFESSVINGLPHSPHKIQGMGTGMIPDILDLTLFSEALRVHSDDAIAMAKKLADEESILGGISSGANVCAAVQLAKRPENKGKLIVTTVNSFGERYLSTALYAELRDNAANMKQLNLDDSIKIAKEYLGI
Primarily catalyzes the formation of cyanoalanine and hydrogen sulfide from cysteine and hydrogen cyanide. Can also catalyze, although less efficiently, the formation of cyanoalanine and hydrogen sulfide from either S-sulfocysteine or O-acetylserine and hydrogen cyanide and the formation of cysteine from either S-sulfocysteine or O-acetylserine and hydrogen sulfide. By catalyzing the assimilation of cyanide produced by P.aeruginosa, mediates resistance to infection. Involved in fertility, growth and aging. Does not mediate survival in high levels of hydrogen sulfide.
O45717
NUD2_CAEEL
Protein nud-2
MDLSEDQIRGLPHHELLGHFLQMREEFNEFQTSSAEIEKMMDSELDDLKTQLKKAETRVQQMTTEQIRNKDRQDDSRVQFAQVEEQLRRENSHLHEQCESQRERIRKLEQRNDVLETSERNKEYLASDLGSKLDHAIEKIAMLESELYERQVAAEEMHRLREEQLRTTERPRLIVEPLRNDPEILPDEPSPGPSKEEFKMSSEDVFMEDVQHHEDVRMEETIAKIDEVRIDDNKNIQEKSQRVSTGTGAGACINRIVKDLMTKVERLDSILSTIRVSNNSSNNNSSHLTTTRA
Part of a complex with lis-1, which is recruited to the nuclear envelope by unc-83, where, in turn, it recruits dynein to the nuclear surface and regulates nuclear migration in hypodermal precursor cells. Plays a role in GABAergic synaptic vesicle localization in the ventral nerve cord.
O45734
CPL1_CAEEL
Cathepsin L-like (EC 3.4.22.15)
MNRFILLALVAAVVAVNSAKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMIHIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQVPDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV
Cysteine protease which plays an essential role in the degradation of proteins in lysosomes. During early embryogenesis, maternally required for the proteolytic processing of yolk proteins in platelets, a lysosome-like structure where a slow and controlled degradation of yolk proteins occurs. In the gonad, required for the clearance of apoptotic germ cells in the engulfing cell phagolysosomes. In embryos, required for the degradation of endocytic and autophagic cargos. In embryos, may play a role in the degradation of lipid-containing droplets. Required for larval development.
O45784
TAF9_CAEEL
Transcription initiation factor TFIID subunit 9 (TBP-associated transcription factor family member taf-9)
MADTGEKDTETTASGTDGHSKEALAVISMLHECGIQEFDPRVVSMLMDVQYAVTSKILQMSSGLSRHAEKAQIEAEDVQTAADMLGVLTTNAPDREKILQLANDKNQQPLPQIRHNYGLKLPNDRFCQLQQNFVYKADDSYQPMEMQQVTHQPHIIEPPTQVLRPEHVQNMLKRRAPDDDFDS
The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (By similarity). TFIID recognizes and binds promoters via its subunit tbp-1, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (By similarity). The TFIID complex consists of tbp-1 and TBP-associated factors (TAFs), including taf-9 (By similarity). Essential for early embryonic development, but not required for transcription of some genes probably acts via activating transcription initiation by RNA Pol II, as part of the TFIID complex.
O45797
WARTS_CAEEL
Serine/threonine-protein kinase WARTS homolog (EC 2.7.11.1) (LATS kinase homolog)
MRPAAPGTTPNGASSDIRHQRGVAPIPFGSTNSAIDAHHNSEIRVGRHRAKLDEIRESLKAYEHEAGLLSSHVALGSLATPSSSSVSHSDITNDNAEVMNFSSSSSNAAATTTTVSSAAVSNSNSFRTEGGGHKMRITPMPQRHLMMDTGANETVFRSGKEMIRNGNPSTTISSTPSTTTEESIRIHPAGYRYDMPTPAYHMNNNAPQYSPGYSRPPPPAYDSSPVNTRMTPVATDNYRTHLHMKVHPVVKAPPPNPTMLNHNKNMAPPPPPPAKSTISIETMSEERKADNIQRLYHTSMDKKTASSVVSINVASPHTTKVNVGDSPLPSKSFIIGPRYTADVDRKNFVNYKDELRPDPRLIPSTSDANHEDFRPILFKPRNLEITMKSRAQPPPPQYNQPSEPPPKRVSSPIDRTLLEPYIKNTRRVQPCKPNMLRFYMEQHVERLLQQYKEREKRMKQLEKEMVSAQLPDIMRNKMLGLLQQKESKYTRLRRQKMSKSHFTVISHIGVGAFGKVSLVRKNDTRKVYAMKSLEKADVIMKQQAAHVKAERDILAEADSPWIVRLFFSFQDDACLYFIMEYVPGGDMMTLLIQKGIFEEDLARFYIAELACAIEYVHNVGFIHRDLKPDNILIDQHGHIKLTDFGLCTGLRWTHDRRYYGPENDHHRVDSFSLPPEVAAIDKSVKVLNVRQQTRRITAHSLVGTGNYMAPEVIAKTGHNQSCDWWSTGVILYEMVFGRVPFHDDTPGGTQHRIKNWRNFLDFTYCGNLSKECLMMIQQLICDASSRLGSHGKDVAERTAQVKNHPWFRGIDWVNLRKLRADYIYIPRVTHDEDTSNFETFQDNDRADKPNVRGLHNPAFYEFTYRHFFDTDSVGCPSLRPSRRRSLRPLLENGTFNESVSEEDSSSHI
Phosphorylates yap-1 which may negatively regulate yap-1 nuclear localization. Plays an essential role in larval development. Regulates growth, the formation of gut granules, lifespan and cell and body sizes probably in synergy with the TGF-beta sma/mab pathway. Does not appear to regulate apoptosis and proliferation. In addition, may synergize with the TGF-beta daf-7 dauer pathway to regulate entry into the dauer stage. Maintains the cellular integrity of intestinal cells by regulating the localization of apical actin and junctional proteins.
O45813
SNF12_CAEEL
Sodium-dependent transporter snf-12 (Sodium: neurotransmitter symporter family protein snf-12)
MNGEWKSALRLQIEALAKRNELHRKSSVDEIKKRTVDMDKRIVKLRELVGSSANDAALFYLECVCHADETERLLNRGSSVGKEKKWKKVKRKTSSSVAPPLSRTISSLPGVSSPDVIQTIDVSALEDQTPQRPHWWDQFQLYRRTDLLRFSKQNDRRELWRTQKDFFLSCLGFMVGVGHTMRFPAKVYQHGGGVFFIPYLFSLIFFGLPLVFLHLSLGQYTGQAANTAFQRLMPIGSGVGWALVVIAIPVAVYYNIIVAWAIHYFFQSAKGLLLGDELPWETCRDEWQLDNRCCNLHNLHSCFNSTNSITAPEAFFHSEVLSLSTFGDFALGPLQSHLVLSLAAAWLLVFFGVFKGLGSIAQTMNVTATVPYLLLSILLLRGISLPGANKGLTFLFTVDSTKLWKWQIWKSAAEQVFYELGIDAGPLISMAAFSRYRNNIYRDSVLLVIMDALTSCLSGMVIFSFVGFIASESNSNVNDVLKHDPLYLSFTVYPGVTSFMYWGGLWATLFFGMLVLAAIDAEFAWLEMIASAFMNHFSMKNKAVENRLLAFLCLAGFFLGLPLCAQGGIFVFHAIENLNANWNSFSLALLSVAIVCYVYGIDNYLTDISAMLRVPRIQISKATRLKEKLIYFFGPGGIYIKFSLCFICPVILTVLLVASVLGYQRISFAGRPIPIDYEIVAWIVMIGPLLVVPLVAFMQIRQIRNEGKLLKSLFDTSEWRESQDDSLEPKDLYMRQSGKFESPPNRRRTPTIFTHRENTYMYIDSRGPTVRSRVFPLGASLDPYGWKAGRLRDRQQQIEETASNYSEEDSATTNSFMASTVKHNDDMELTLFGSPPAILGDDEKIMTTRFSESMPVNYKCRNVEVPRIPNKLPQNMERMARKTRKKRSSPSASDPPVPTSPLPPPPKLQHCRSEPPMMNSKESHSPEIITPGDDSPSISNSSDDSSDDCFRRATVIRRKTSDDDAFTHFSTATAESISITPLDFPRQRSLSSVAIYDQEQKNGRSKVLSQLKRPKPIDMPPK
Probably mediates sodium-dependent uptake of unknown small molecule(s). By positively modulating expression, in the epidermis, of antimicrobial peptides such as nlp-29, plays a role in resistance to fungal infection and in the response to physical wounding and phorbol ester PMA treatment. Role in response to wounding of the epidermis may be facilitated by recruitment of snf-12 to the wound site by microtubule-dependent vesicle trafficking. Functions cell autonomously in the epidermis, in concert with STAT transcription factor sta-2, probably acting at vesicular membranes, downstream of a p38 MAPK/pmk-1 pathway.
O45818
DKF2_CAEEL
Serine/threonine-protein kinase dkf-2 (EC 2.7.11.13) (D kinase family-2)
MDANDYPRLYYTSMPSSSTSMVTTTRFSTSFSPSIPCHRQENFRRHSTSALAKRNGSESEKSAEIRENPDEIEVSRVSGRDSSLAFYTTAHETSSMLSRDSRDETLTPNEHIHQASSRRVSANDSVFEDGYVDFVDEPREHGSRRKSFEKFTDRNGEEKEGRVFELSTPQPTREAAPGAHQFQLPTLLVTSTPTTVFDHSDDEVWTPYRPPPNREYSSSSEPMMGDLTFRLQSGIHKKSIAVEGTEIALRDLRNEALQFIKEIYPEKGCSSLEDYILLYKHDLRSINILQLITTSSDVTDGTLVEVVIGSCPQNERIVVHPHTLFVHSYKVPTFCDFCGELLFGLVKQGLKCFGCGLNYHKRCASKIPNNCNGSKQRRPSAIPLSPSNSNILNLNERRHSRRESCLEALDAARPSSTLGGAATPNIFITSDDCGDAVGGNYLQMPRKDRSCSWSGRPLWMEIAEATRVKLQVPHTFQVHSYKLPTVCQHCKKLLKGLIRQGMQCRDCKYNCHKKCSEHVAKDCSGNTKASQFFLGSQADDGASEDRDDDLSLRSGSGAHKKAQNTPSAPLQGSEGSGSPGPVVSFAANALSNMPDDDVISSESANIPLMRVVMSKKQTKRKNNKLLKEGWIVHYTDQQNMRKKHYWRLDTKGITMYQDENTTRYYKEIPLNEILNVSMSPPDKTADYLFEIRTGVCVYFISGSPSDEKGSSLDAQSWTTAIQSALMPVTPQSSVVGGKRIDKLKVPTEGETGHLGAKIQTEHEFSQLYQIFAEEVLGSGQFGTVYGGIHRRNGQHVAVKLIDKLKFPPNKEDLLRAEVQILEKVDHPGVVHFMQMLETTDRIFVVMEKLKGDMLEMILSSEKGRLSERTTQFLVAQILEALRYLHHLNIVHCDLKPENILLNSNSDFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGFNRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAEFMYPPTPWKEISENAIEFINGLLQVKMSKRYTVTKAQSQIWMQNYTLWSDLRVLEKAVGQRFVTHESDDVRWQAYEKEHNVTPVYV
Converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. Acts in the intestine to regulate both innate immunity by promoting activation of PMK-1 and also stress response and life span by acting as an upstream, negative regulator of the daf-16 transcription factor.
O45824
CL38_CAEEL
C-type lectin domain-containing protein 38
MAIFYDDPLERLNQPIKTKSYRKKQVVQRVHVFIFDNWKLILLGILNLIFLIIAIVFAILFFVGSADCAQLPDYTTSPASQLTTSAISSRTSEVQTNAITTTQGTPSNKTSTTTPSTSKVICASGFTLVGTKCGKLVSSNQPRTEADSICKGYGGSTLFSVRNEQETRDMLDFVKDSNIDFLWTGLVCNQTARTSCIWDVKSGTTADYNNFADGFPNVVYGYCIYFIVTGNSAGQWGSEQCSQLMNFVCELPTTIRDPDCKYNYNKNCYIRFDITLTIPQAQRFCNEKGADLVSIHSANENRFILTIYDIHGQILLGGLAPAVDFIVWLDGSPTTYSNLLYFYDTRSCVLMTVARGGPYDGDWYTMNCNVQEFFLCKRAIDF
Involved in negative modulation of unc-40-mediated axon outgrowth. Required for proper presynaptic development in axons that have reached their targets. May function in concert with E3 ubiquitin-protein ligase rpm-1 in regulating axon outgrowth.
O45876
APH1_CAEEL
Gamma-secretase subunit aph-1 (Anterior-pharynx-defective protein 1) (Presenilin enhancer protein 1)
MGYLLTIACYIASFSPSIALFCSFIAHDPVRIILFFLGSFFWLVSLLFSSLAWLGLSTVLPDTFLLSLTVCIIAQELSRVAYFMLLKKAQRGLNKITRQGQISVAPGVSDLHNARHMLALVCGLGMGVISALFYTMNAFAIFSGPGTIGLPNALKTGEIDTNRAGKYLPLCYTLSAILLTLFHVTWTIMVWDSCHKIGRIPSAFVPGAAAVVSHLLVTFLSSLNSRGFHVLVFAVQFLILLICIAYCNVIMGGTISSFVNGIGQSITDAVTLKQVRTLIEERKLRTQRQSVPDEPMTERAGTSNTVNA
Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors (lin-12 or glp-1). It may represent a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. Required for the localization of aph-2.
O45923
TTM1_CAEEL
Zinc transporter ttm-1 (Toxin-regulated target of MAPK 1) (Toxin-regulated target of p38MAPK)
MTISMISPSSIRLSSDKRDSSSSNLPANIEEDTQSVSSSDSGVSADSIDHHHHGHGHGHSHGGHGHSHTHNNDDSSSDCSGAGGGAHKHSHDEKYQKGRRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVLHFGTGGHGHTHGGHSSHGHAHDGKNVNVRAALIHVIGDLVQSIGVLIAALIIRFTGWTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENVAEARSLIRRRFGVAVATVQVEPFDEKIDSCDTCQQQETA
Promotes excretion of zinc from intestinal cells into the intestinal lumen in response to increased dietary zinc. Involved in cadmium resistance, possibly by promoting its transport from cells. Involved in resistance to B.thuringiensis pore-forming toxin Cry5B downstream of the sek-1 and pmk-1 MAPK kinase pathway.
O45935
KLP19_CAEEL
Kinesin-like protein klp-19
MSSDASLRVVVRARPMNGRETKEGASRCVQFYENTKQIVINESATFTFDAVFADTSDQESVYETTALPLLDRIFAGFNATVLAYGQTGSGKTYTMGTEDNVGTDEMRRGIIPRLVSALFQRIMNTEAPESFAVTVSMFEVYGDNVYDLLRPDKVKLNVHGDEKNCTVVNLTAVPVIDLKGALKQLAVGCHYRTKAETAMNAMSSRSHAVFTVFVEKTATAECDSAFSAKLQLVDLAGSERLKKTEAEGNRMKEGININGGLLILSQVIAALATKQKHIPYRNSVITRVLQDSLGGNSFTVFLACISPADSNSQETLNTLRYADRAKQIKNKPIVNKNPKAEEIAILQAQLKRLQKENADLKQGIAPAEVRFNDANNSAEILSLKEEVVRKTEQLKERAMKQSECIIRMSALTQKNSRLEEDKAKLQSMLTDVRNTVLNEEMLDAAEVVRSIQQVVGDTEESTTLADDDNDETALGGQDDTIYDTERLPELQAELDDLEKQIAMKDENRQKALDEQRAFIEAMQQRESEKTQLVVRISELETEMNKLRQEGKKVTTAAKLAEERRQKLKDLERQHAEDKKVLNDMKKLQETRRRMEETLKKTEDELKNLKTQRLRLLREQRAEASKFQAFKQKHEREMAQMKSKLQKRENDVAIQKRMTDQKLTVLQMRLTEANRANKTLRELNLKRANRKSSPTNASALQNMIEEELEHEMCAQRSHWLCEDLRRQRHDLMQNINTVESMKFEGGKRRRISASADPNVSVVIEGEEEFEVKRQKELTFLRASLETLNEEIKDSLRNETIAGNEERANSRWEKVPAEMRPAFEAVYAQAVAHIRKEIELEFKLARTKSEFTAKIASKASHEEKRKKEDEEMRAKYRELAQCLEDAKSGLHEKIAFLLCLIKENRVDENAIQQFESLKNQFCDVEQKVKKASRRKTTNFMGGLTPKPELQRNERARRAVKYYGNVVNSEDVTMDDSRHQKRKDHSLLAVEMNRTTDDNVKRRVAMSPIKCDDDTRLTEEDEDIENEAMNNATFVKDSFNSATIVLDDSQPSPSNSTFVIGAAPTSEADGVPPIKRKSRRTDLGPL
Required for chromosome movement and orientation on spindle poles in mitosis and meiosis. May play a role in early anterior-posterior chromosome movement in mitotic embryos.
O45947
GLT10_CAEEL
Putative polypeptide N-acetylgalactosaminyltransferase 10 (pp-GaNTase 10) (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase 10) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10)
MVAICIKIGERERKRVHIMLLAYTWKTRVSSHQCNKSPIFGLFAIQFSNICSNLLLLQQKLSMGLSRYLSRRHHWVIQYCGLLLFLYLIYSYVATSNDGPNLHEDIPVFQGQGKDRANPNPPAALGDEALDPFEKYRGHEKIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLYKHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIRNVGTNFCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKKCDSSSDLQKWAWQTVDNELLETRQANEAKEQE
May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
O45952
CSC1_CAEEL
Chromosome segregation and cytokinesis defective protein 1
MPPRKIKKDPAVVAMADTLETRVKDLLEEYKKKLREVALQTAKAESDRIIATIKPKYRDMPIMEFLASPPDDFYIESGEEEEEGEAAVAVKQELPSEPDMEIDDAAAAQKTSIPIGQNSGRNTVQVKQEPEIDDDAAHETSIPIAPSGQNSGRNTAADEHRRNEIITPAGQVLPLPTLQPEKPFRAPHVDEEIAFSVNGSPLVLAGRTTATAAGKENRKKSKKSGAASKKAAAAAGPLQPETENAGTSV
Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of chromosome segregation and cytokinesis during mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation. In the complex, it may be required to direct the Aurora B/air-2 to centromeric DNA.
O45962
RLE1_CAEEL
Regulation of longevity by E3 ubiquitin-protein ligase (EC 2.3.2.27) (RING-type E3 ubiquitin transferase rle-1)
MAPTGQGGQWQEVLCCSICNRHFNETFLPVSLICGHVICRKCAEKPENQTKPCPHDDWKTTHSPSEYPNNVALLSVIFPRKQCMTLSGAVSEAEKRVDQLSIQIAKFFREADSERGGTVSSREISRTLQRKVLALLCYQWREVDGRLKTLKMCRGISERVMIEIILSIQSNTHVSSQLWSAVRARGCQFLGPAMQDDVLRLILMTLETGECIARKNLVMYVVQTLASDYPQVSKTCVGHVVQLLYRASCFNVLKRDGESSLMQLKEEFRTYESLRREHDSQIVQIAFESGLRIGPDQWSALLYADQSHRSHMQSIIDKLQSKNSYQQGVEELRALAGSQTSMLVPAYRYFLTQVIPCLEFFAGIEHEDTSMRMIGDALHQIRILLKLHCSQDDLRKMPKEERRGVILQAEVPGGMGGGPGGSGGAEAGRIGGLHPLYSQIDETGRSISRTNPKDNSHNSPQTPPKQPRQKRYQMGIPPNRMGYSSDAPPFIPSHQQQPPPQFFNSQHLPQRFRGGRQRGAPPPPPPQPMPMLIGYDMPGAPMMQATEVLTADGQMVNGTPQRVVIMQSPTHLPGGPVVMIPQQQMVPPPQSMTPVGGPMGPMGPMTPSIPVQVPPNTMWTATSPTGSVIYPAASPPGQPPHTIWIQSTDGNMFPMFDRGSGGMVWGPGTMLRESGADAEQLLAKRYEILKRLQPSEDDDDPEDGGIGHVSYTVASSVLDDRMDHHPLTMIPVPTIDLPAIPISFANMPTEETMTMIGEMVQNRPRAPSLTAPSSNQPMNVNASASATVQAECGTMSVMDSICQPISTSAIHNSATIPQPVIPMVQVPVQVPIVPAENFNPNVPPPPPPPQGQPMLVDSAIGLLTPIRPILVAHPQNVVSNSLDKIVDVKERISEAQGNASEAENAHLRMELRMAESQMAHLDPYTKNNCLLRALQQVDMELQQLHLNPTVEG
E3 ubiquitin-protein ligase. Regulates the activity of daf-16 and is thereby involved in regulating aging and stress resistance. Regulates nsy-1 activity and thereby attenuates the activation of sek-1 and pmk-1, two components of the p38 pathway, which results in susceptibility to pathogenic bacterial infection.
O46036
CTBP_DROME
C-terminal-binding protein (CtBP protein) (dCtBP)
MDKNLMMPKRSRIDVKGNFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNKEYFMRTPPAAAAGGVAAAVYPEGALHHRAHSTTPHDGPHSTTNLGSTVGGGPTTVAQAAAAAVAAAAAAALLPSPVPSHLSPQVGGLPLGIVSSQSPLSAPDPNNHLSSSIKTEVKAESTEAP
Corepressor targeting diverse transcription regulators. Hairy-interacting protein required for embryonic segmentation and hairy-mediated transcriptional repression.
O46043
PARG_DROME
Poly(ADP-ribose) glycohydrolase (EC 3.2.1.143)
MSKSPDGGISEIETEEEPENLANSLDDSWRGVSMEAIHRNRQPFELENLPPVTAGNLHRVMYQLPIRETPPRPYKSPGKWDSEHVRLPCAPESKYPRENPDGSTTIDFRWEMIERALLQPIKTCEELQAAIISYNTTYRDQWHFRALHQLLDEELDESETRVFFEDLLPRIIRLALRLPDLIQSPVPLLKHHKNASLSLSQQQISCLLANAFLCTFPRRNTLKRKSEYSTFPDINFNRLYQSTGPAVLEKLKCIMHYFRRVCPTERDASNVPTGVVTFVRRSGLPEHLIDWSQSAAPLGDVPLHVDAEGTIEDEGIGLLQVDFANKYLGGGVLGHGCVQEEIRFVICPELLVGKLFTECLRPFEALVMLGAERYSNYTGYAGSFEWSGNFEDSTPRDSSGRRQTAIVAIDALHFAQSHHQYREDLMERELNKAYIGFVHWMVTPPPGVATGNWGCGAFGGDSYLKALLQLMVCAQLGRPLAYYTFGNVEFRDDFHEMWLLFRNDGTTVQQLWSILRSYSRLIKEKSSKEPRENKASKKKLYDFIKEELKKVRDVPGEGASAEAGSSRVAGLGEGKSETSAKSSPELNKQPARPQITITQQSTDLLPAQLSQDNSNSSEDQALLMLSDDEEANAMMEAASLEAKSSVEISNSSTTSKTSSTATKSMGSGGRQLSLLEMLDTHYEKGSASKRPRKSPNCSKAEGSAKSRKEIDVTDKDEKDDIVD
Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism is required for maintenance of the normal function of neuronal cells.
O46084
PGAM5_DROME
Serine/threonine-protein phosphatase Pgam5, mitochondrial (DPGAM5) (EC 3.1.3.16) (Phosphoglycerate mutase family member 5 homolog)
MRKLTSFVCGTGAGLAAYYLQRLRDPQTVVQNSWTHSDKPVDPWALWDTNWDCREPRALVRPLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAGFRRYFHRAYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITWLTISPSGNVSIKYLGDSGFMPAELLTNRIPRDVKNVV
Displays phosphatase activity for serine/threonine residues, and dephosphorylates and activates Pk92B kinase. Has apparently no phosphoglycerate mutase activity.
O46102
PAPD1_DROME
Poly(A) RNA polymerase, mitochondrial (DmMTPAP) (EC 2.7.7.19)
MNSLVRRSAQQLSLWRTYCIKHNASEAASPGRNAGRPNYEEFIGRHQRQAQCSIVVQVSSEKSYEELYNYCSSFGSIMGAHHYCVRQDETLHYILLEYATSDEAAAAIGAGVTNGELSGVPVRSPFLWFRAAGGGRRSPKLVANTAPALLSLDGTRQVDQRHLLGLLRGAADIEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQFFEFYSQFDFHNRAISLNEGKPLSKPDHSAMYIVNPLEQLLNVSKNVSLEECERLRIEVRNAAWVLESEVENASVPEGDGQELSCGLLNLFKHPEKAVIRPNMFFKPRMVEVSDLFEQKEAGATSSSTPPTPAITYKSASVRQQVQSIKAATRSELKQLRGSGSSVPTSSPNNRRRSR
Polymerase that creates the 3' poly(A) tail of mitochondrial transcripts. This is not required for transcript stability or translation but may maintain mRNA integrity by protecting 3' termini from degradation.
O46106
NOI_DROME
Splicing factor 3A subunit 3 (Protein noisette)
METLLEQQRRLHEERERLVKLMVDEHATKKPGEKERIHSEHRLKYLMELHHNSTSQLRDLYEDKDNERKAEIAALSGPNEFNEFYARLKQIKQFYKSHPAEVSVPLSVEFDEMIRVYNNPDDMSALVEFTDEEGGGRYLDLNECYELYLNLRSVEKLDYITYLMSFDHVFDIPRERKNREYRIYIETLNDYLHHFILRIQPLLDLEGELLKVELDFQRQWLMGTFPGFSIKETESALANTGAHLDLSAFSSWEELASLGLDRLKSALVALGLKCGGTLEERAQRLFSTKGKSTLDPALMAKKPSAKTASAQSREHERHKEIAQLEALLYKYADLLSEQRAATKENVQRKQARTGGERDDSDVEASESDNEDDPDADDVPYNPKNLPLGWDGKPIPYWLYKLHGLNISYNCEICGNFTYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAITLWEKLKSQKQSERWVADQEEEFEDSLGNVVNRKTFEDLKRQGLL
Probable subunit of a splicing factor complex required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA (By similarity). Involved in male fertility.
O46166
TXI1_ERAAG
U1-agatoxin-Ta1a (U1-AGTX-Ta1a) (Insecticidal toxin 1) (TaITX-1)
MKLQLMICLVLLPCFFCEPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQKG
Toxin that paralyzes insects. May have a direct effect on the insect central nervous system.
O46339
HTH_DROME
Homeobox protein homothorax (Homeobox protein dorsotonals)
MAQPRYDDGLHGYGMDSGAAAAAMYDPHAGHRPPGLQGLPSHHSPHMTHAAAAAATVGMHGYHSGAGGHGTPSHVSPVGNHLMGAIPEVHKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYMMDSQAHMMHRPPGDPGFHQGYPHYPPAEYYGQHL
All isoforms are required for patterning of the embryonic cuticle. Acts with exd to delimit the eye field and prevent inappropriate eye development. Isoforms that carry the homeodomain are required for proper localization of chordotonal organs within the peripheral nervous system and antennal identity required to activate antennal-specific genes, such as sal and to repress the leg-like expression of dac. Necessary for the nuclear localization of the essential HOX cofactor, extradenticle (exd). Both necessary and sufficient for inner photoreceptors to adopt the polarization-sensitive 'dorsal rim area' (DRA) of the eye fate instead of the color-sensitive default state. This occurs by increasing rhabdomere size and uncoupling R7-R8 communication to allow both cells to express the same opsin rather than different ones as required for color vision.
O46373
ADT1_RABIT
ADP/ATP translocase 1 (30 kDa calsequestrin-binding protein) (30 kDa CSQ-binding protein) (ADP,ATP carrier protein 1) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4)
MSDQALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity). Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane (By similarity). In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis. Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A4/ANT1 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity). Proton transporter activity requires free fatty acids as cofactor, but does not transport it. Probably mediates mitochondrial uncoupling in tissues that do not express UCP1. Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death. It is however unclear if SLC25A4/ANT1 constitutes a pore-forming component of mPTP or regulates it (By similarity). Acts as a regulator of mitophagy independently of ADP:ATP antiporter activity: promotes mitophagy via interaction with TIMM44, leading to inhibit the presequence translocase TIMM23, thereby promoting stabilization of PINK1 (By similarity).
O46374
TOP2A_PIG
DNA topoisomerase 2-alpha (EC 5.6.2.2) (DNA topoisomerase II, alpha isozyme)
MEVSPLQPVNENMQVNKTKKNEEAKKRLSIERIYQKKTQLEHILLRPDTYIGSVESVTQQMWVYDEDIGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDEEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFHPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDLYLKDKVDETGNPLKIIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVAKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQVKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRLLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKEADKSDSVADSGPTFNYLLDMPLWYLTKEKKDELCKLRNEKEQELETLKRKSPSDLWKEDLAAFIEELEAVEAKEKQDEQIGLPGKGGKAKGKKTQMAEVLPSPCGKRVIPRVTVEMKAEAEKKIKKKIKSENTEGSPQEDGMEVEGLKQRLEKKQKREPGTKTKKQTTLPFKPIKKAKKRNPWSDSESDISSDESNFNVPPREKEPRRAAAKTKFTVDLDSDEDFSDADEKTRDEDFVPSDTSPQKAETSPKHTNKEPKPQKSTPSVSDFDADDAKDNVPPSPSSPVADFPAVTETIKPVSKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGAKKDPDLDSDVSKKPNPPKPKGRRKRKPSTSDDSDSNFEKMISKAVTSKKPKGESDDFHLDLDLAVASRAKSGRTKKPIKYLEESDEDDLF
Key decatenating enzyme that alters DNA topology by binding to two double-stranded DNA molecules, generating a double-stranded break in one of the strands, passing the intact strand through the broken strand, and religating the broken strand (By similarity). May play a role in regulating the period length of BMAL1 transcriptional oscillation (By similarity).
O46382
BIG1_BOVIN
Brefeldin A-inhibited guanine nucleotide-exchange protein 1 (Brefeldin A-inhibited GEP 1) (ADP-ribosylation factor guanine nucleotide-exchange factor 1) (p200 ARF guanine nucleotide exchange factor) (p200 ARF-GEP1)
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQSPPHGEAKAGSSTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHIPQEHEGDLDPQTNDVDKSLQDDTEPENGSDISSAENEQTEADQATAAETLSKNDILYDGENHDCEEKPQDIVQSIVEEMVNIVVGDTGERTTINVSADGNNGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPIFGTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQETSEMKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFTKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPAKSSKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSLTGAKDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTLVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGYTYEKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPISGETAPPTPSPVSENQLDTISQKSVDIHDSIQPRSADNRQQAPLASVSTVNEEISKIKPTAKFPEQKLFAALLIKCVVQLELIQTIDNIVFFPATSRKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYTDESRASAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHASFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPPEQELGINKQ
Promotes guanine-nucleotide exchange on ARF1 and ARF3. Promotes the activation of ARF1/ARF3 through replacement of GDP with GTP. Involved in vesicular trafficking. Required for the maintenance of Golgi structure the function may be independent of its GEF activity. Required for the maturaion of integrin beta-1 in the Golgi. Involved in the establishment and persistence of cell polarity during directed cell movement in wound healing. Proposed to act as A kinase-anchoring protein (AKAP) and may mediate crosstalk between Arf and PKA pathways. Inhibits GAP activity of MYO9B probably through competitive RhoA binding. The function in the nucleus remains to be determined (By similarity).
O46385
SVIL_BOVIN
Supervillin (Archvillin) (p205/p250)
MKRKERIARRLEGIETDTQPILLQSCTGLVTHRLLEEDTPRYMRATDPASPHIGRSNEEEETSDSSLEKQTRSKQCTETSGIHADSPYSSGIMDTQSLESKAERIARYKAERRRQLAEKYGLTLDPEADSETPSRYSRSRKDPEAAEKRGVRSERSAESSRDAGSSYSRTELSGLRTCVAESKDYGLHRSDGVSDTEVLLNAENQRRGQEPSATGLARDLPLAGEVSSSFSFSGRDSALGEVPRSPKAVHSLPSPSPGQPASPSHSTSDLPLPAEARASIGKPKHEWFLQKDSEGDTPSLINWPSRVKVREKLVREESARSSPELTSESLTQRRHQTAPGHYLAFQSENSAFDRVSGKVASSARQPIRGYVQPAEPVHTITLVTSDTPESISEGSWVGPAPQTVTKPPPSKVLEGERRDTPVLHICESKAEDVLFSDALEKTRKTLAVLEDRGSGRSQEAPSGTEDLSQPAVGIVTAEPQKESESLAHPPMAQQQPTERMGRSEMVMYVQSEAVSQGHRKEVPTRKHRVLTRSLSDYTGPPQLQALKAKAPAPKRDAESQTSKAELELGLLDTKVSVAQLRNAFLESARASRKPELHSRVEGSSEGPGVERERGSRKPRRYFSPGENRKTSERFRTQPITSAERKESDRSTSNSEMPAAEDEEKVDERARLSVAAKRLLFREMEKSFDEKSVPKRRSRNAAVEQRLRRLQDRSHTQPVTTEEVVIAAEPTPASCSVATHPVMTRHPSPTVAKSPVQPARTLQASAHQKALARDQTNESKDSAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRLDMRQRRMNARYQTQPVTLGEVEQVQSGKLMAFSPTINTSVSTVASTVPPMYAGNLRTKPLPDDSFGATEQKFASSLENSDSPVRSILKSQGWQPSVEGAGSKAMLREFEETERKGGLTGGDGGVTKYGSFEEAELSYPVLSRVREGDNHKEAIYALPRKGSLELAHPPIAQLGDDLKEFSTPKSTMQASPDWKERQLFEEKVDLENVTKRKFSLKAAEFGEPTSEQTGAAAGKPAAPTATPVSWKPQDPSEQPQEKRYQSPCAMFAAGEIKAPAVEGSLDSPSKTMSIKERLALLKKSGEEDWRNRLNRKQEYGKASITSSLHIQETEQSLKKKRVTESRESQMTIEERKHLITVREDAWKTRGKGAANDSTQFTVAGRMVKRGLASPTAITPVASPVSSKARGTTPVSRPLEDIEARPDMQLESDLKLDRLETFLRRLNNKVGGMQETVLTVTGKSVKEVMKPDDDETFAKFYRSVDSSLPRSPVELDEDFDVIFDPYAPRLTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTEQRLNVAFVESKRMKVEKLSANSSFSEVTLAGLASKENFSNVSLRSVNLTEQNSNNSAVPYKKLMLLQVKGRRHVQTRLVEPRAPSLNSGDCFLLLSPHHCFLWVGEFANVIEKAKASELASLIQTKRELGCRATYIQTVEEGINTHTHAAKDFWKLLGGQASYQSAGDPKEDELYETAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRPNEKNASELAQHKDDARAEVKPYDVTRMVPVPQTTAGTVLDGVNVGRGYGLVEGDDRRQFEIASISVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFIVSTAVGSRQKGEHSVRVAGKEKCVYFFWQGRQSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENTQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVHKALIYLWHGCKAQAHTKEVGRTAANKIKDQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALGRRDRKAYDCMLQDPGNFNFTPRLFILSSSSGDFSATEFMYPARDPSVVNSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCRGKNLKKPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF
[Isoform 1]: Forms a high-affinity link between the actin cytoskeleton and the membrane. Is among the first costameric proteins to assemble during myogenesis and it contributes to myogenic membrane structure and differentiation. Appears to be involved in myosin II assembly. May modulate myosin II regulation through MLCK during cell spreading, an initial step in cell migration. May play a role in invadopodial function (By similarity).
O46392
CO1A2_CANLF
Collagen alpha-2(I) chain (Alpha-2 type I collagen)
MLSFVDTRTLLLLAVTSCLATCQSLQEATARKGPTGDRGPRGERGPPGPPGRDGDDGIPGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGASGAPGPQGFQGPAGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGQPGTVGPAGIRGSQGSQGPAGPPGPPGPPGPPGPSGGGYDFGYEGDFYRADQPRSPPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCFK
Type I collagen is a member of group I collagen (fibrillar forming collagen).
O46411
5NTC_BOVIN
Cytosolic purine 5'-nucleotidase (EC 3.1.3.5) (EC 3.1.3.99) (Cytosolic IMP/GMP-specific 5'-nucleotidase) (Cytosolic nucleoside phosphotransferase 5'N) (EC 2.7.1.77)
MTTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTVCDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE
Broad specificity cytosolic 5'-nucleotidase that catalyzes the dephosphorylation of 6-hydroxypurine nucleoside 5'-monophosphates. In addition, possesses a phosphotransferase activity by which it can transfer a phosphate from a donor nucleoside monophosphate to an acceptor nucleoside, preferably inosine, deoxyinosine and guanosine. Has the highest activities for IMP and GMP followed by dIMP, dGMP and XMP. Could also catalyze the transfer of phosphates from pyrimidine monophosphates but with lower efficiency. Through these activities regulates the purine nucleoside/nucleotide pools within the cell.
O46420
CP51A_PIG
Lanosterol 14-alpha demethylase (LDM) (EC 1.14.14.154) (CYPLI) (Cytochrome P450 51A1) (CYP51) (Cytochrome P450-14DM) (Cytochrome P45014DM) (Cytochrome P450LI) (Sterol 14-alpha demethylase)
MVLLGLLQAGGSVLGQAMEQVTGVNLLSSLLLACAFTLILVYLFRQAIGHLAPLPAGAKSPPYIFSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFRQHVSIIEKETKEYFQSWGESGERNLFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKNIFYKAIQKRRQSEEKIDDILQTLLDSTYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCYLEQKTVCGEDLPPLTYDQLKDLNLLDRCIKETLRLRPPIMTMMRMAKTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
Sterol 14alpha-demethylase that plays a critical role in the cholesterol biosynthesis pathway, being cholesterol the major sterol component in mammalian membranes as well as a precursor for bile acid and steroid hormone synthesis. Cytochrome P450 monooxygenase that catalyzes the three-step oxidative removal of the 14alpha-methyl group (C-32) of sterols such as lanosterol (lanosta-8,24-dien-3beta-ol) and 24,25-dihydrolanosterol (DHL) in the form of formate, and converts the sterols to 4,4-dimethyl-5alpha-cholesta-8,14,24-trien-3beta-ol and 4,4-dimethyl-8,14-cholestadien-3beta-ol, respectively, which are intermediates of cholesterol biosynthesis. Can also demethylate susbtrates not intrinsic to mammals, such as eburicol (24-methylene-24,25-dihydrolanosterol), but at a lower rate than DHL.
O46421
EST1_MACFA
Liver carboxylesterase 1 (EC 3.1.1.1) (Cholesteryl ester hydrolase) (CEH) (EC 3.1.1.13)
MWLRALVLATLAAFTAWGHPSSPPVVDTVHGKVLGKFVSLEGFTQPVAVFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCSQDAVAGQVLSELFTNRKENTPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLVVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQLAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTAVLVKKGDVKPLAEQIAIAAGCQTTTSAVMVHCLRQKTEEELLETTLKMKFFSLDLHGDPRESHPFLGTVIDGLLLPKTPEELQAERKFNTVPYMVGFNKQEFGWIIPMLMGYPLSEGKLDQKTAMSLLWKSYPLVYIAKELIPEATEKYLGGTDDPVKKKDRFLDLLADVMFSVPSVIVARHHRDAGVPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPRWPEYNQEEGYLQIGANTQAAQKLKDKEVAFWTTLFAKKAVEKPPQTEHIEL
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Hydrolyzes aromatic and aliphatic esters, but has no catalytic activity toward amides or a fatty acyl-CoA ester. Displays fatty acid ethyl ester synthase activity, catalyzing the ethyl esterification of oleic acid to ethyloleate. Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes of 2-arachidonoylglycerol and prostaglandins. Hydrolyzes cellular cholesteryl esters to free cholesterols and promotes reverse cholesterol transport (RCT) by facilitating both the initial and final steps in the process. First of all, allows free cholesterol efflux from macrophages to extracellular cholesterol acceptors and secondly, releases free cholesterol from lipoprotein-delivered cholesteryl esters in the liver for bile acid synthesis or direct secretion into the bile.
O46427
CATH_PIG
Pro-cathepsin H [Cleaved into: Cathepsin H mini chain; Cathepsin H (EC 3.4.22.16); Cathepsin H heavy chain; Cathepsin H light chain]
MWAVLSLLCAGAWLLGPPACGASNLAVSSFEKLHFKSWMVQHQKKYSLEEYHHRLQVFVSNWRKINAHNAGNHTFKLGLNQFSDMSFDEIRHKYLWSEPQNCSATKGNYLRGTGPYPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Important for the overall degradation of proteins in lysosomes.
O46491
CP7A1_PIG
Cytochrome P450 7A1 (24-hydroxycholesterol 7-alpha-hydroxylase) (EC 1.14.14.26) (CYPVII) (Cholesterol 7-alpha-hydroxylase) (Cholesterol 7-alpha-monooxygenase) (EC 1.14.14.23)
MMSISLLGGIVTAVCCCLWLLLGMRRRQTGEPPLENGIIPYLGCALQFGANPLEFLRANQRKHGHIFTCQLMGNYVHFITNPLSYHKVLCHGKYLDWKKFHFTASAKAFGHRSIDPSDGNTTDNINKTIIKTLQGDALNLLAAAMMENLQLVLRPQVAPQPEKPAWVTEGMYSFCYRVMFEAGYVTLFGKDPIGHDAQKALILNNLDNFKQFDKIFPALVAGFPIHVFKTGHYAREKLAEGLRLQKLRKRDHISELVRFLNDTLSTLDDAEKAKSLLAVLWASQANTIPATFWCLFQTIRSPEAMKAASEEVNKTLEKAGQKISLDDKPIYLNQIELDSMPVLDSIIKESLRLSSASLNIRTAKEDFTLHLQDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYSHGLKLKYYYMPFGSGATICPGRLFAVQEIKQFLILMLSYFDLELVESHVKCPPLDQSRAGLGILPPSNDIEFRYKLKHL
A cytochrome P450 monooxygenase involved in the metabolism of endogenous cholesterol and its oxygenated derivatives (oxysterols). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR NADPH-ferrihemoprotein reductase). Functions as a critical regulatory enzyme of bile acid biosynthesis and cholesterol homeostasis. Catalyzes the hydroxylation of carbon hydrogen bond at 7-alpha position of cholesterol, a rate-limiting step in cholesterol catabolism and bile acid biosynthesis. 7-alpha hydroxylates several oxysterols, including 4beta-hydroxycholesterol and 24-hydroxycholesterol. Catalyzes the oxidation of the 7,8 double bond of 7-dehydrocholesterol and lathosterol with direct and predominant formation of the 7-keto derivatives.
O46512
CP19A_HORSE
Aromatase (EC 1.14.14.14) (CYPXIX) (Cytochrome P-450AROM) (Cytochrome P450 17-alpha) (Cytochrome P450 19A1) (Estrogen synthase)
MILEMLNPMHYNLTSMVPEVMPVATLPILLLTGFLFFVWNHEETSSIPGPGYCMGIGPLISHLRFLWMGLGSACNYYNKMYGEFVRVWISGEETLVISKSSSTFHIMKHDHYSSRFGSTFGLQYMGMHENGVIFNNNPAVWKALRPFFVKALSGPSLARMVTVCVESVNNHLDRLDEVTNALGHVNVLTLMRRTMLDASNTLFLRIPLDEKNIVLKIQGYFDAWQALLIKPNIFFKISWLSRKHQKSIKELRDAVGILAEEKRHRIFTAEKLEDHVDFATDLILAEKRGELTKENVNQCILEMMIAAPDTLSVTVFFMLCLIAQHPKVEEALMKEIQTVLGERDLKNDDMQKLKVMENFINESMRYQPVVDIVMRKALEDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFTLENFEKNVPYRYFQPFGFGPRSCAGKFIAMVMMKVMLVSLLRRFHVKTLQGNCLENMQKTNDLALHPDESRSLPAMIFTPRNSEKCLEH
A cytochrome P450 monooxygenase that catalyzes the conversion of C19 androgens, androst-4-ene-3,17-dione (androstenedione) and testosterone to the C18 estrogens, estrone and estradiol, respectively. Catalyzes three successive oxidations of C19 androgens: two conventional oxidations at C19 yielding 19-hydroxy and 19-oxo/19-aldehyde derivatives, followed by a third oxidative aromatization step that involves C1-beta hydrogen abstraction combined with cleavage of the C10-C19 bond to yield a phenolic A ring and formic acid. Alternatively, the third oxidative reaction yields a 19-norsteroid and formic acid. Converts dihydrotestosterone to delta1,10-dehydro 19-nordihydrotestosterone and may play a role in homeostasis of this potent androgen. Also displays 2-hydroxylase activity toward estrone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR NADPH-ferrihemoprotein reductase).
O46521
CY24A_BOVIN
Cytochrome b-245 light chain (Cytochrome b(558) alpha chain) (Cytochrome b558 subunit alpha) (Neutrophil cytochrome b 22 kDa polypeptide) (Superoxide-generating NADPH oxidase light chain subunit) (p22 phagocyte B-cytochrome) (p22-phox) (p22phox)
MGQIEWAMWANEQALASGLILITGGIVATAGQFTQWYLGAYSIAAGVLVCLLEYPRGKRSKGSTMERCGQKYLTRVVKLFGPLTRNYYIRAFLHLGLAVPAGFLLATILGTACLAIASGIYLLAAIRGEQWSPIEPKPKERPQIGGTIKQPPSNPPPRPPAEARKKPSEEAAGVPTGGPQENPMPVNDEVV
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide.