text stringlengths 23 13.3k | all_labels listlengths 1 91 | true_labels listlengths 0 45 |
|---|---|---|
Northern California . Spanning the state 's northernmost 48 counties , in contrast to the 10 counties of Southern California , its main population centers include the San Francisco Bay Area ( anchored by the cities of San Francisco , San Jose , and Oakland ) , the Greater Sacramento area ( anchored by the state capital Sacramento ) , and the Metropolitan Fresno area ( anchored by the city of Fresno ) . San Francisco ( initials SF ) ( [ sæn_frənˈsɪskoʊ ] , Spanish for Saint Francis ; Spanish : [ san franˈsisko ] ) , officially the City and County of San Francisco , is the cultural , commercial , and financial center of Northern California . <<EXAMPLE>> Peyton Manning . During his tenure as starting quarterback , Manning led the team to eight division championships , two AFC championships , and one Super Bowl title , the franchise 's first in over three decades , as well as their first since relocating to Indianapolis . A two-time Super Bowl winner and the most valuable player of Super Bowl XLI , Manning is also the only quarterback to start the Super Bowl for two different franchises more than once each and the only starting quarterback to win a Super Bowl with two different franchises . At 39 years of age , Manning is the oldest quarterback to start in and win a Super Bowl . <<TRUE_LABEL>> Peyton Manning was a quarterback. <</EXAMPLE>> <<EXAMPLE>> California ( [ kælᵻˈfɔːrnjə , _ - ni.ə ] , ) is the most populous state in the United States and the third most extensive by area . San Francisco ( initials SF ) ( [ sæn_frənˈsɪskoʊ ] , Spanish for Saint Francis ; Spanish : [ san franˈsisko ] ) , officially the City and County of San Francisco , is the cultural , commercial , and financial center of Northern California . <<FALSE_LABEL>> San Francisco is in Northern Colorado. <</EXAMPLE>> <<EXAMPLE>> Classify research papers based on their methodology: qualitative, quantitative, or mixed methods. Utilizing both qualitative and quantitative methods, this study aims to provide a holistic understanding of social phenomena. Through a combination of in-depth interviews, observations, and statistical analysis, we seek to uncover both the nuances of personal experiences and the broader patterns that emerge from the data. <<FALSE_LABEL>> The text utilizes numerical data such as surveys, experiments, and statistical analysis to understand social phenomena. <<FALSE_LABEL>> The text utilizes non-numerical data such as interviews, observations, and case studies to understand social phenomena. <<FALSE_LABEL>> The text combines both qualitative and quantitative methods to understand social phenomena. <</EXAMPLE>> | [
"San Francisco is in Northern California next to Sacramento."
] | [] |
The Grand Slam tournaments , also called majors , are the four most-important annual tennis events . Serena Williams . She has won an all-time record of 13 Grand Slam singles titles on hardcourt . <<EXAMPLE>> The Grand Slam tournaments , also called majors , are the four most-important annual tennis events . Serena Williams . Her total of 23 Grand Slam singles titles marks the record for the most Grand Slam wins by a tennis player in the Open Era , and is second on the all-time list behind Margaret Court ( 24 ) . <<FALSE_LABEL>> Serena Williams is a golf player. <</EXAMPLE>> <<EXAMPLE>> The Grand Slam tournaments , also called majors , are the four most-important annual tennis events . Serena Williams . Williams holds the most Grand Slam titles in singles , doubles , and mixed doubles combined amongst active players . <<FALSE_LABEL>> Serena Williams is a golf player. <</EXAMPLE>> <<EXAMPLE>> The Grand Slam tournaments , also called majors , are the four most-important annual tennis events . Serena Williams . She has won 14 Grand Slam doubles titles with her sister Venus , and the pair are unbeaten in Grand Slam doubles finals . <<FALSE_LABEL>> Serena Williams is a golf player. <</EXAMPLE>> | [
"Serena Williams is a golf player."
] | [] |
BENGALURU: Karnataka chief minister BS Yediyurappa on Monday expressed his willingness to talk to farmer leaders, as ryots staged demonstrations in several parts of the state during the Karnataka Bandh on Monday against two bills. The chief minister's reaction came as pro-farmer organisations backed by a number of other social and political outfits including the Congress on Monday called for a state-wide Bandh against the amendments to the Agricultural Produce Marketing Committee Act (APMC) Act and Karnataka Land Reforms (KLR) Act passed by the state assembly. The farmers alleged that the amendment to the APMC Act will deprive them of the minimum support price and enable multinational companies and big corporate houses to directly procure produce at their rates. "I want to tell the farmer leaders that conduct the agitation today but later come, sit with us and have a discussion.I am always ready to make changes for the benefit of farmers," the chief minister told a a press conference. Describing the two amendments as anti-farmer, the protesters alleged that these laws will ruin the agriculture sector as people with moneybags will purchase agricultural land to convert their black money into white and turn agriculture land into real estate business. Dismissing the allegation, the chief minister said the amendment to the APMC Act will enable farmers to sell their produce wherever they wish. They can sell either in the APMC or sell it directly to anyone in any part of the state and the country, he explained. "There was a time when cases were registered against farmers for selling their produce from one district to another district.We are removing these restrictions on farmers to sell their produce anywhere," the Chief Minister said. He, however, clarified that the government was not shutting down APMCs. "... We are only giving you complete independence so that you can sell at the APMC or sell it where they get the good price. This is a historic decision. I appeal to our farmers' associations that whoever is misleading you,just wait for six months or a year.All the hassles in selling your produce will go," he added. Regarding the amendment to the KLR Act, the chief minister said there were about 18 lakh-20 lakh acres of barren land and after this amendment, anyone can do farming. To a question about AICC in charge of Karnataka Randeep Singh Surjewala allegedly terming Prime Minister Narendra Modi and Yediyurappa harmful to the country and Karnataka, the chief minister said, "Let Surjewala build his own party.Then let him speak about the BJP and other political parties." He said the Congress was on decline and as a result, the BJP will rule for the next ten years. He claimed the BJP will get absolute majority in the next election as well. The protests were staged at important locations in Bengaluru, Ramanagara, Mandya, Mysuru, Chamarajanagara, Kolar, Chikkaballapura, Tumakuru, Ballari, Raichur, Chitradurga, Kalaburagi, Yadgir, Vijayapura, Bagalkote, Bidar, Belagavi, Uttara Kannada, Udupi, Dharwad and Davangere among others. Amid the coronavirus scare and ignoring social | [
"video gaming",
"news and politics",
"technology and computing",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"real estate"
] |
Celebrity show, 'Njanum Entalum' never misses a chance to grab the attention of the viewers and the recent episode is no exception. After the fun-filled segments of love and celebration, the show featured some emotional moments between the contestants in the recent episode. Couple Anoop and Darshana had a heart-touching moment on the stage which left the audience emotional as well.Read AlsoNjanum Entalum: Joby and Susan shoot their 'Save The Date' video after 28 years of marriage, judge Johny Antony calls them 'super couple'During their turn in the marriage special segment, Joby and Susan followed the current trend and filmed a 'Save The Date' video for themselves. From the bride-seeing ceremony to some romantic time, the couple has nailed it with their charm.Ammayariyathe: Ambadi to call off his wedding with Alina?In the recent episode of the show, Jithendran is spotted threatening Chandran. He says that Chandran will be soon murdered. Meanwhile, he also mocks the bedridden person saying that his bad luck is because of his evil deeds in the past. However, Chandran strongly reacts to Jithendran's statement andIn the episode in which the contestants were asked to confess something to their wives, Anoop shared how Darshana made him realize the value of his father."My parents got divorced when I was 1.5 years old. I never missed my father in my entire life. When I was in school, I started hearing stories about how bad he was and I started hating him. I was ashamed to say to anyone that I was his son. I hated everything, parents, god, religion everything. I used to curse my father and my home," he said.Further, he narrates how Darshana pushed him to see his father after 28 years on the latter's deathbed."When he was sick, I never felt emotional. But, you pushed me to go visit him. You took me and my mom to see him at the hospital. Well, it was the only memory I have of seeing my father alive. After a few days, he passed away and I didn't feel anything. I gave him the last kiss and at that moment, I felt something inside me. Now, when I see our son, I realize how much I missed my father and how much he would have missed me. You made me like this. It is because of you that my father owns a piece of my heart," he said with tears in his eyes.Here's the video:Actor Darshana and Anoop tied the knot after an elopement. The happy couple has a baby boy, Arjun.On a similar note, in one of the episodes of the show, the makers arranged a traditional wedding for the couple, who missed a ceremony in the past. | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"television"
] |
Amid the government talks with global tech giants to let Indians have email IDs in their local language, markets regulator Sebi has directed all intermediaries in the securities market to start communicating with the investors in vernacular languages, in addition to Hindi and English. To start with, Sebi has asked intermediaries that documents stating the rights and obligations of brokers, disclosure about risks, as well as the dos and don’ts of stock trading should be available in 15 Indian languages. All documents are to be made available on the websites of the the intermediaries in Assamese, Bengali, Gujarati, Hindi, Kannada, Kashmiri, Konkani, Malayalam, Marathi, Oriya, Punjabi, Sindhi, Tamil, Telugu and Urdu for both existing and prospective investors. | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"personal finance"
] |
Energy Efficiency
Lighting upgrade projects involve modifying, replacing or supplementing lighting equipment with the purpose of reducing electricity usage.
A determination can be made on the energy efficiency of commercial building is made through the National Australian Built Environment Rating System (NABERS).
NABERS rates the energy performance of four types of commercial buildings: offices, shopping centres, data centres and business hotels. By calculating the emission reductions associated with energy efficiency you can add another stream of revenue to your business in the form of carbon credits.
The reduction delivered by a lighting upgrade is calculated by comparing the electricity consumption of an upgraded lighting system to the electricity consumption of the system that existed prior to the upgrade.
To find out more about how efficient lighting can benefit your business please call AI Carbon on 0410 541 662 or email us at info@aicarbon.com.
Australian Integrated Carbon Financial Services
ACN: 159 166 846
Australian Financial Services Licence: 425 610 <<EXAMPLE>> Employee Skin Cancer Screenings – One Forward-Thinking Employer.
Skin Cancer Free is committed to early detection of skin cancer by expanding access to skin cancer screenings for everyone using its Skin Screenings for All™ worldwide initiative.
Catching skin cancer early is an important way to reduce the time and cost required to treat the cancer and improve outcomes. It can be accomplished through effective early skin cancer screening**. This is done by a trained professional photographing a “total body” set of digital images for review by an expert dermatologist using a web based e-consult. Initial base line total body imaging is done at any location that is friendly to the employer’s place of employment and can also be scheduled at a local Regional Care Physician’s office.
**The estimated 5-year survival rate for patients where a melanoma is detected early is about 98 % in the U.S. The survival rate falls to 62 percent when the disease reaches the lymph nodes, and 18 percent when the disease metastasizes to distant organs.
Regular skin examinations can compare changes that occur over time, many of which are the only indicator of a more serious skin cancer condition.
More Information:.”
Noble statement, but what are the other driving factors?
.”
Will you be then screening only the outdoor workers?
“No, all the administrative and support staff, anyone on our health care plan.”
Is this a requirement for employees to participate?
“No, anyone can opt out if they choose. However, we have had no one refuse to be screened.” <<TRUE_LABEL>> healthcare initiatives <<TRUE_LABEL>> early detection of diseases <<TRUE_LABEL>> employee wellness programs <</EXAMPLE>> <<EXAMPLE>> Our goal is to teach home owners how their homes use energy and in turn help them make wise choices when it come to making energy improvements.
We achieve this by recommending ALL possible improvements available to the client and providing information on the cost effectiveness of implementing these based on potential return of investment.
We feel Energy measures should truly save our clients money, improve comfort, and improve quality of life. These should be based on measured results - not pie in the sky claims.
We are a Home Performance Contractor winning awards for the quality of our work with the NYSERDA Residential Energy Conservation Programs.
Our Business
Energy Saving Solutions has been offering energy testing and reduction measures in the Western NY area since 2007. Our experience staff has over 75 combined years of home building and repair experience. We are BPI Certified, EPA LEAD Certified, Members of the BBB, and fully equipped to assist you meet your energy needs!
The New York State Energy Research and Development Authority’s (NYSERDA) Home Performance with ENERGY STAR program created a network of independent home improvement energy auditors that are accredited by the Building Performance Institute (BPI).
Your energy auditor, through their participation in this Program, has been trained in taking a ‘whole-house’ approach when testing your home and identifying energy efficiency improvements.
Check out the Virtual Home - See where you might save energy in your home!
Visit the New York Home Performance with Energy Star web site
Get Your Free Home Energy Audit Today! <<TRUE_LABEL>> This text is about a home performance contractor who offers energy testing and reduction measures, and has extensive experience in home building and repair. <</EXAMPLE>> | [
"This text highlights the advantages of lighting upgrades for increasing electricity consumption in residential buildings, as well as the procedure for assessing energy efficiency through the National Residential Built Environment Rating System."
] | [] |
margaret river & beyond | a look around this beautiful region in the south west of western australia – margaret river & beyond a look around this beautiful region in the south west of western australia - margaret river & beyond lumle holidays | tailormade holidays | group tours | making your dreams possible a holiday specialist travel company specializing in tailor-made holidays and small group tours throughout the world. visit slo cal | things to do, hotels, restaurants, maps & guides located in the heart of california, slo cal is known for its relaxed pace. explore san luis obispo county's wineries, things to do, and relaxing resorts. | [
"video gaming",
"technology and computing",
"news and politics",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"travel"
] |
For Gurugrammers, ‘tis the season to be jolly and eco-friendly. As Christmas approaches, in markets across the Millennium City, Christmas trees are flying off the shelves. But residents of Gurgaon are choosing real trees over the artificial ones this year. This change has been because of a combination of pollution concerns and a penchant for buying organic and real things on the festival. Most nurseries in Gurgaon already having surpassed last year’s sales and are expecting a bumper Christmas as sales will only go up.Sale of Christmas trees up by 30% The rising pollution level seems to be the chief reason that people are opting for real Christmas trees in Gurgaon this year. In fact, the first thing buyers ask nurseries is which Christmas trees are good for purifying air. A seller from Sapna Nursery says, “People keep asking if Christmas trees like Araucaria and juniper also help in purifying the air inside the home. Their main focus is to get a tree not just for Christmas, but one they can keep in their house after the festival too. Our sales for these trees are up by 30% this year.” Ritika Nayak, Delhi Times Fresh Face 2018 second runner-up, checks out Araucaria plants at a nursery Ritika Nayak, Delhi Times Fresh Face 2018 second runner-up, checks out Araucaria plants at a nursery Dinesh Jain, who bought a 4-foot Araucaria for his house this Christmas, explains his choice, “We have all seen the smog and pollution and it is not going away. Even Metros and schools are opting for vertical gardens because plants are the best weapons against air pollution. These Christmas trees are low maintenance. They just need to be watered twice or thrice a week and to me, they look better than the artificial ones.” Many say their decision was influenced by their kids putting their foot down against the plastic trees. Alka Sahney, a Golf Course Road resident, tells us, “We always get the artificial trees, but this year, my kids were adamant that we will not get a ‘plastic’ tree as it is not good for the environment. So, I opted for a large Araucaria tree. It is good to have it in the house anyway as plants purify the air.”Cypress and Araucaria are the bestsellersThe trees and plants that sell during Christmas include Cypress and Araucaria. A medium-sized plant of either of these varieties (2-3 feet high) sells for around Rs 500-700, while a taller tree (4-5 feet high) can sell for anything between Rs 900 and Rs 1,200, with some costing more than Rs 1,500 too. In comparison, artificial trees are much cheaper, with a 5-foot tree selling for Rs 600-900. However, the price difference doesn’t deter Gurugrammers. “The price is not that high, and it is a good investment. I am okay with spending Rs 500 extra if that means my family can have a better Christmas experience,” says Rajit Kumar, a Sector 43 resident, who bought an Araucaria tree.Santosh, a salesperson at Osho | [
"video gaming",
"technology and computing",
"news and politics",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"home and garden"
] |
Youthclub BuildingArchitecture photography for Huettner Architekten
Bathe Vision & HistoricDocumentation of single restoration works and murals by Bathe Vision & Historic
Private HousePrivate house in Lichtenberg / Oberfranken. Interieur design by Huettner Architekten
H1 Service BuildingDocumenting the construction phase of the new H1 Service Building in Naila / Germany. Huettner Architekten
Private HousePrivat domicile in Selb / Germany. Architecture by Huettner Architekten.
<<EXAMPLE>> This Inspirational Contemporary Double Storey House with Plan is situated on a manageable corner block of and has a total built up area of including garage, portico and alfresco.
Plan Craftsman, Ranch, Shingle Style, Cottage, Northwest House Plans & Home Designs 1199 sq. Very nice for downsizing - love the layout.
Merging traditional and contemporary design, Visbeen Architects completed Cicero, an eye-catching transitional-style home in Grand Rapids, Mich. The project was built in collaboration with Falcon Cust
40 Facades of wonderful modern and sculptural houses.
De ventanas hacia afuera, también se nota que es Interceramic. - Tap the link to shop on our official online store! You can also join our affiliate and/or rewards programs for FREE <<TRUE_LABEL>> This text mentions a specific architectural style: transitional. <<TRUE_LABEL>> This text includes a Spanish phrase and an online shopping link. <<TRUE_LABEL>> This text describes a house design with square footage. <<FALSE_LABEL>> This text prompts the reader to join a loyalty program. <<FALSE_LABEL>> This text focuses on the exterior design of the house. <<FALSE_LABEL>> This text is about a historical architectural style. <</EXAMPLE>> <<EXAMPLE>> Residential Complex “EVRYKA” BUILDING #18 ,GOLOSIIVSKIY DISTRICT
JSC Bank “ARCADA” and ltd “ARCADA-BUDIVNYTSTVO” (Constructions) offer a new 24-storied bearing-wall residential house #18 (made of materials by «DBK-3») at the residential complex “EVRIKA”, which is located at the av.Academic Glushkov, 6 in the District Golosiivskiy in Kyiv.
The project of the building #18 single bedroom apartments, 2- and 3-bedroom apartments with interior finishing works:
- Single bedroom apartments with usable flat space from 32.79 sq/m to 38.62sq/m;
- 2-bedroom apartments with usable flat space from 56,62 sq/m to 65,85 sq/m;
- 3-bedroom apartments with usable flat space from 81,67sq/m to 81,85<< <<TRUE_LABEL>> This text introduces a new 24-storied residential building #18 in the residential complex 'EVRIKA' in Kyiv, offering single bedroom, 2-bedroom and 3-bedroom apartments. <</EXAMPLE>> | [
"This text mentions Huettner Architekten's interior design",
"This text describes a public building",
"This text includes photography and documentation works",
"This text showcases architecture projects",
"This text features drawings instead of photography",
"This text focuses on bathroom design"
] | [
"This text includes photography and documentation works",
"This text mentions Huettner Architekten's interior design",
"This text showcases architecture projects"
] |
Once Upon a Time seventh season unboxing [video] August 28, 2018 by Daniel J. Lewis in ONCE podcast • 1 Comment Podcast: Play in new window | Download | Embed See what’s inside the complete seventh and final season Once Upon a Time Blu-Ray and DVD! Click here to order your own copy of season 7. TweetPinShare11 Shares | [
"TV show merchandise",
"TV show seasons",
"Movie DVDs",
"DVD unboxing",
"Book unboxing",
"Once Upon a Time (TV show)",
"Video content"
] | [
"Once Upon a Time (TV show)",
"DVD unboxing",
"Video content",
"TV show seasons"
] |
Classify legal documents based on their relevance to specific areas of law to help streamline the process of identifying the most pertinent legal precedents or regulations for a case. Section 1. Definitions. (a) 'Parties' refers to the individuals entering into an agreement as defined by this statute. (b) 'Agreement' denotes a written or oral understanding between parties regarding the exchange of goods, services, or considerations. (c) 'Consideration' signifies anything of value, tangible or intangible, that is exchanged between parties in accordance with an agreement. Section 2. Binding Agreements. (a) An agreement becomes binding upon both parties upon mutual assent, signified by acceptance of the terms proposed by one party and communicated to the other. (b) An agreement is unenforceable if either party was coerced, induced by fraud, or lacked capacity to enter into the agreement. Section 3. Breach of Agreement. (a) A breach of agreement occurs when one party fails to perform a material obligation as outlined in the agreement. (b) Upon breach, the non-breaching party may seek remedies as prescribed by this statute. Section 4. Remedies. (a) Remedies for breach of agreement may include, but are not limited to, damages, specific performance, or cancellation of the agreement. (b) The choice of remedy shall be determined by the court based on the circumstances of the case and the relative hardships borne by each party. Section 5. Limitations. (a) No action based on breach of agreement may be brought more than four years after the cause of action accrues. (b) This statute of limitations may be tolled under certain circumstances as provided by law. <<EXAMPLE>> Classify legal documents based on their relevance to specific areas of law to help streamline the process of identifying the most pertinent legal precedents or regulations for a case. Section 1. Definitions. (a) 'Party' refers to any individual, corporation, or entity entering into an agreement as specified in this statute. (b) 'Agreement' denotes a legally binding contract between two or more parties. (c) 'Obligation' signifies a legal duty imposed upon a party by an agreement or by law. Section 2. Formation. An agreement shall be considered valid upon the mutual assent of the parties, expressed through clear and definite terms. Section 3. Performance. A party's obligation under an agreement shall be performed in good faith, with reasonable skill and care. Section 4. Breach. A breach of obligation occurs when a party fails to perform or improperly performs any obligation under an agreement. Section 5. Remedies. Upon a breach, the non-breaching party may seek remedies as prescribed by law, including damages or specific performance. Section 6. Governing Law. The validity, construction, and performance of this agreement shall be governed by and construed in accordance with the laws of this jurisdiction. <<FALSE_LABEL>> The text pertains to offenses against the state or society. <<FALSE_LABEL>> The text deals with civil wrongs and damages not arising from contracts. <<FALSE_LABEL>> The text relates to matters of marriage, divorce, and child custody. <<FALSE_LABEL>> The text involves agreements between parties and their legal obligations. <</EXAMPLE>> <<EXAMPLE>> Classify legal documents based on their relevance to specific areas of law to help streamline the process of identifying the most pertinent legal precedents or regulations for a case. Section 1. Definitions. (a) 'Parties' refer to two or more individuals or entities entering into a legally binding agreement. (b) 'Agreement' means a mutual understanding between parties, which may be written or oral, and is enforceable by law. (c) 'Legal obligations' are duties imposed by law or contract that must be fulfilled by the parties involved. (d) 'Breach' refers to the failure to perform any of the legal obligations under an agreement. (e) 'Damages' are the monetary compensation recoverable for breach of an agreement. Section 2. Formation. An agreement becomes a legally binding contract if it contains an offer, acceptance, consideration, and mutual assent, also known as a 'meeting of the minds'. Section 3. Performance. Parties must perform their obligations in accordance with the terms of the agreement. Section 4. Breach. A breach occurs when a party fails to perform its obligations under the agreement. Section 5. Damages. Damages for breach of contract may include compensatory damages, consequential damages, and punitive damages. Section 6. Remedies. Remedies for breach of contract may include specific performance, injunction, and rescission. Section 7. Statute of Limitations. Actions for breach of contract must be brought within the time period specified by law. Section 8. Governing Law. The law of the jurisdiction where the agreement is entered into governs the interpretation and enforcement of the agreement. <<FALSE_LABEL>> The text pertains to offenses against the state or society. <<FALSE_LABEL>> The text deals with civil wrongs and damages not arising from contracts. <<FALSE_LABEL>> The text relates to matters of marriage, divorce, and child custody. <<FALSE_LABEL>> The text involves agreements between parties and their legal obligations. <</EXAMPLE>> | [
"The text relates to matters of marriage, divorce, and child custody.",
"The text involves agreements between parties and their legal obligations.",
"The text deals with civil wrongs and damages not arising from contracts.",
"The text pertains to offenses against the state or society."
] | [] |
Jul 07, · Although I am 56 year old woman I can hypnotize any man with my big boobs! And what's most important is that I am an experienced cock sucker. In this homemade sex video I will prove it to you%(). Watch Old Woman Big Tits porn videos for free, here on tsinjoarivo.info Discover the growing collection of high quality Most Relevant XXX movies and clips. No other sex tube is more popular and features more Old Woman Big Tits scenes than Pornhub! welcome to tsinjoarivo.info! free big mature tits, high quality milf, mature & wife porn! <<EXAMPLE>> Got him patched up an' into town; then he keeled over when he tried to git down off his hoss an' was in bed a week." <<TRUE_LABEL>> He was in bed a week after he keeled over trying to get off his horse. <<FALSE_LABEL>> He's got a heavy fever combined with cold sweats - not a good combination. <</EXAMPLE>> <<EXAMPLE>> Deepthroat gay porn videos - FAP Male
The deepthroat blowjob is amazing and prepares the cock for entrance into a tight asshole. Hot black busty Middle East Girl Ada in Hijab Porn Fantastic puffy nipples teen showering. Free Gay Deepthroat Cum Swallow Porn Videos - Pornhub Most. Fanzines and Amateur By using this site, you agree to the Terms of Use and Privacy Policy. See the Most Relevant 70 year old nude women Porn GIFs on Page 20 here on Pornhub.
DrTuber 8 Free naked gay emo porn Alexander likes to deepthroat a large dick,. More videos like this one at Gay Vidz - Watch and download GAY videos at vidz. Deep Throating A Thick Dick STR8 Marine and Cumming in Mouth.
Watch all 4 videos with Amanda Rae and 0 new videos with Amanda Rae added today. I acknowledge having read this warning and am an adult under the laws of my country. Blog contents are NSFW as they contain images of nude males and sexual acts.
Teacher Brittany Larson, 27, of West Street in New Milford, turned herself in on Oct. This Porntube Porn in Reunion Island Sex reunion with my form secretary Tracey. Indian hairy gay porn sex movies He gets Phillip to deepthroat his knob 2,812 views. <<FALSE_LABEL>> This text is about a romantic relationship between two men, including intimate moments of affection. <</EXAMPLE>> <<EXAMPLE>> Watch Max porn videos for free, here on Pornhub.com. Discover the growing collection of high quality Most Relevant XXX movies and clips. No other sex tube is more popular and features more Max scenes than Pornhub! Browse through our impressive selection of porn videos in .
Awesome mature brunette jumps on big black dick with her back door. In this porn video you can see frisky bitch. In this sex video you can see awesome fuck. Pretty booty tranny is jumping on her lover`s erct boner. This pretty and sexy doll is here to suck their dicks.
May 04, 2019 · Duration:0:09:54 Resolution:720×480 Format:mp4 Size:122Mb. 04241_Black_boy_white_girl_oral_and_fuck.mp4.
Most wanted porn archive, beaty girls, fantastic pornstars, watch online absolutely for FREE.
Free mature porn videos on Pornhub.com. Watch mature women get naked and fuck in hardcore sex videos. Older, experienced pornstars school younger lovers in hot mom porno. Sexy milfs, mommies, housewives, cougars, and older women never disappoint! <<TRUE_LABEL>> This text uses descriptive language to entice viewers. <<TRUE_LABEL>> This text highlights the diversity of video categories. <<TRUE_LABEL>> This text advertises free porn videos on Pornhub. <</EXAMPLE>> | [
"video sharing platform",
"self-proclaimed seduction",
"subtle innuendos",
"romantic relationships",
"artistic nudity",
"explicit language"
] | [
"video sharing platform",
"explicit language",
"self-proclaimed seduction"
] |
.armsunflowerlillies
Related Products
The product consist of 1 Heart shape balloon. Color and design may vary..Add to Cart
24 pieces Ferrero chocolates in acrylic box...Add to Cart
This product is composed of 1 I Love You balloon with Sparkling wine...Add to Cart
INSTAGRAM #Flowerdeliveryphilippines
Tel: (+632) 8736 0134
Sun: (+63) 932-8764288
Globe: (+63) 916-6704288
Viber: 0916-6704288 | [
"emotional expression",
"gift ideas",
"personal experience",
"flower delivery service"
] | [
"gift ideas"
] |
Define whether subjective or objective the statement is:
most folks with a real stake in the american sexual landscape will find it either moderately amusing or just plain irrelevant . | [
"objective",
"subjective"
] | [
"subjective"
] |
Vijayawada: Bhavanipuram police registered a case against a fraudster who forged land documents of a vacant plot and sold it to a man claiming it as own property. The victim who learned about the matter lodged a complaint.G Ramesh Babu (50), a resident of Patamata in Vijayawada, lodged a plaint stating he had purchased a vacant plot from L Ramesh Gollapudi and registered documents in his name in March 2008. Later, when the complainant visited the site two weeks ago, he was shocked to see a compound wall on the site. Upon enquiry, the complainant learned that the land belongs to one Vimaladevi and she had purchased it from one Thota Srinivasa Rao in December 2002. The accused Ramesh committed fraud by creating fake documents and selling it to the complainant. When he questioned Ramesh, the latter abused the complainant with filthy language. | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"food and drinks",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"health"
] |
2008, up about 1.3 million from 2003, according to the Pew Hispanic Center. Births to Immigrant Mothers on the Rise How many children are being born to illegal immigrants in the U.S. each year? Federal and state governments do not specifically track the annual number of U.S. births by illegal immigrants. But according to the conservative Center for Immigration Studies, one out of every 10 births in the U.S. is to an illegal immigrant. The number of U.S. births by non-resident mothers -- women who are in the U.S. temporarily -- has also been on the rise: up 53 percent between 2000 and 2006, according to the National Center for Health Statistics. Total births rose 5 percent in the same period. It's unclear how many of the 7,600 births to non-resident mothers in 2006, the most recent data, were by women who traveled to the U.S. with the sole purpose of obtaining citizenship for their child. The count includes international travelers passing through and foreign students studying at U.S. universities. The State Department and Department of Homeland Security have no specific regulations banning pregnant foreigners from entering the United States. But officials say they can and do turn away pregnant women with obvious designs on coming to the United States to take advantage of free medical care. "When determining if an individual will be allowed to enter the U.S., Customs and Border Protection officers take into consideration the date the child is due for delivery and the length of time the individual intends to stay in the U.S.," a Department of Homeland Security spokesman said. The 14th Amendment to the Constitution, which was enacted after the Civil War to grant citizenship to descendants of slaves, reads, "All persons born or naturalized in the United States, and subject to the jurisdiction thereof, are citizens of the United States and of the state wherein they reside." "I find it so interesting that strict constitutionalists, whether it's Kyl, McCain, Brewer, the Tea Party, find that the Constitution can be malleable if it fits their ads," charged Democratic Rep. Raul Grijalva of Arizona. "You're either for the Constitution that you swore to uphold or you`re not. It's politics. It's useful, destructive politics that they're using. And they have to continue to use it until the midterms." "I don't think the founders understood when they did the 14th amendment that they would create a circumstance where people could fly into America, all over the world and have a child and that child would have dual citizenship, fly back to their home countries," said Republican Sen. Jeff Sessions. "It has been clearly abused." The Supreme Court has only addressed the issue once, clarifying in 1898 that citizenship does apply to U.S.-born children of legal immigrants who have yet to become citizens. The United States is one of the few remaining countries to grant citizenship to all children born on its soil. The United Kingdom, Ireland, India and Australia, among others, have since revised their birthright laws, | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"food and drinks",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"travel"
] |
Posts Tagged ‘SideQuest Studios’
PS4
Rainbow Skies (PS4) review
Sometimes you beat the game, and sometimes the game beats you. GamesFiends get worn down by Rainbow Skies' quantity over quality.
PS4
Rainbow Moon (PS4) Review
If you like grinding, you'll love Rainbow Moon....,,, | [
"video game reviews",
"Xbox games",
"board games",
"player experience",
"art design",
"Rainbow Skies and Moon",
"PS4 games"
] | [
"video game reviews",
"Rainbow Skies and Moon",
"PS4 games",
"player experience"
] |
StoveTeam
and Honduran partner E’Copan were recognized with the National Energy
Globe Award for helping combat deforestation and overconsumption of
firewood in Honduras. More than half the population of Honduras uses
wood for cooking, a factor that, over the last quarter century, has led
to the disappearance of greater than a third of Honduras’ forests. The
E’Copan factory began in 2010 with a grant from Copan Ruinas and Eugene
Southtowne Rotary Clubs, and with support from StoveTeam International.
Since 2010, E’Copan has sold approximately 6,000 cookstoves.
The Energy Globe Award is supported by the United Nations Educational, Scientific, and Cultural Organization (UNESCO) and done in cooperation with the United Nations Environment Program (UNEP). “As one of only 177 winners out of 1,500 applicants, we are thrilled to receive this prestigious award,” said program director, Katie Laughlin, “and are honored to be recognized among the many worthwhile entities working to advance sustainable solutions to global environmental challenges.” StoveTeam and E’Copan will be evaluated automatically for the Energy Globe World Award.
Learn more about the Energy Globe Award.
- Why stoves?
- Fundraise
- What We Do
- Factories
- Get Involved
- News+Media <<EXAMPLE>> />
In this Tuesday, Jan. 24, 2017 photo, piles of freshly-made charcoal sit in a parcel intercropped with banana trees and other plants, in the mountains above of Les Cayes, Haiti. For decades, authorities and development workers have denounced rural charcoal makers of stripping the nation’s forests, sending topsoil to sea and helping make Haiti the poorest country in the Americas. The stigma is so great that few openly admit their involvement. (AP Photo/David McFadden) <<TRUE_LABEL>> poverty in Haiti <<TRUE_LABEL>> stigma of charcoal making <<TRUE_LABEL>> deforestation <<TRUE_LABEL>> charcoal production in Haiti <</EXAMPLE>> <<EXAMPLE>> Another successful year for the International Gourmet Festival which took place last month in Puerto Vallarta, Riviera Nayarit and Tepic. The festival welcomed renowned international chefs and featured a number of Puerto Vallarta’s most celebrated restaurants including La Palapa, Cafe des Artistes, La Leche, El Trio, Hiroshi and Garza Blanca’s very own modern steakhouse, BocaDos STK.
Garza Blanca Resort was joined by Chef Alfredo Bazán from sister resort in Cancun, Villa del Palmar Cancun Luxury Beach Resort & Spa, to lead the kitchen at BocaDos STK during the International Gourmet Festival, while Carlos Leyva joined Hiroshi, the Japanese fusion restaurant at the recently opened Hotel Mousai, Garza Blanca’s adults only hotel.
Both chefs shared their culinary talents with hotel guests at Garza Blanca and Hotel Mousai as well as diners taking part in the International Gourmet Festival.
Here is an insight into Garza Blanca’s contribution to the International Gourmet Festival in Puerto Vallarta 2015. <<TRUE_LABEL>> Hotel industry <<TRUE_LABEL>> Restaurants and chefs <<TRUE_LABEL>> Successful events <<FALSE_LABEL>> Food ingredients <<FALSE_LABEL>> Festival planning <<FALSE_LABEL>> Culinary education <</EXAMPLE>> <<EXAMPLE>> Susan Kershaw Mars, RDH
Susan Kershaw Mars is one of the amazing Registered Dental Hygienists at Dallas Laser Dentistry who helps Dr. Swift and Dr. Myers provide the best care to their patients. As a Registered Dental Hygienist, Susan performs routine preventative and periodontal maintenance procedures, along with deep cleanings, to optimize every patient’s oral health. In addition to performing general dentistry care, Susan takes the time to educate every patient on the proper techniques for brushing and flossing during their visit so their next check up is even better. <<TRUE_LABEL>> Dental Procedures <<TRUE_LABEL>> Oral Health Education <<TRUE_LABEL>> Patient Care <</EXAMPLE>> | [
"This text highlights environmental impact of wood usage",
"This text describes an international recognition for deforestation",
"This text focuses on positive impact of firewood usage",
"This text mentions a national award for combating deforestation",
"The text features StoveTeam's role in promoting susta... | [
"The text features StoveTeam's role in promoting sustainable cookstoves",
"This text highlights environmental impact of wood usage",
"This text mentions a national award for combating deforestation"
] |
Classify budget documents based on their function: revenue, expenditure, or capital. The government's long-term investments and assets portfolio performed exceptionally well in 2022. The total value of the portfolio increased by 12% to $6.5 trillion, driven by strong equity markets and robust real estate prices. The equity portfolio, which accounts for 55% of the total portfolio, returned an impressive 14% in 2022. The real estate portfolio, which represents 20% of the total portfolio, also performed well, with a return of 10%. The government's investment in infrastructure projects, which accounts for 15% of the total portfolio, returned 8%. However, the government's investment in fixed-income securities, which represents 10% of the total portfolio, underperformed, returning only 2%. Despite this, the overall performance of the portfolio highlights the government's ability to generate stable and consistent returns on its long-term investments. <<EXAMPLE>> Classify budget documents based on their function: revenue, expenditure, or capital. The government's long-term investments and assets portfolio had a total value of $893.1 billion as of June 30, 2022, representing a 6.5% increase from the previous year. The largest asset category was real estate, which accounted for $345.2 billion, or 38.7% of the total. Other significant asset categories included infrastructure ($221.5 billion, or 24.8%), and financial investments ($182.8 billion, or 20.5%). The government's long-term investments and assets are managed with a focus on maximizing returns while maintaining prudent risk management practices. These investments and assets will provide long-term benefits to the government and its citizens, including supporting economic growth and providing essential services and infrastructure. <<FALSE_LABEL>> The text relates to income or funds received by the government. <<FALSE_LABEL>> The text relates to spending or expenses by the government. <<FALSE_LABEL>> The text relates to long-term investments or assets of the government. <</EXAMPLE>> <<EXAMPLE>> Beastie Boys . Originally formed as a four-piece hardcore punk band , the Young Aborigines , in 1978 by Diamond ( vocals ) , John Berry ( guitar ) , Yauch ( bass ) and Kate Schellenbach ( drums ) , the band appeared on the compilation cassette New York Thrash , before recording their first EP , Polly Wog Stew , in 1982 . <<TRUE_LABEL>> Beastie Boys's first EP was released in November 1982. <<TRUE_LABEL>> Beastie Boys is formerly known as the Young Aborigines. <<TRUE_LABEL>> Beastie Boys released their first EP in 1982. <<TRUE_LABEL>> Beastie Boys's first EP was released in 1982. <<TRUE_LABEL>> Beastie Boys did not appear on a compilation album. <</EXAMPLE>> | [
"The text relates to long-term investments or assets of the government.",
"The text relates to income or funds received by the government.",
"The text relates to spending or expenses by the government."
] | [] |
Vicki Pon won the title of Miss New York Chinese 2008 on Saturday, July 19 and will represent the city at the Miss Chinese International 2009 pageant next year in Foshan, China. The runners-up are Jessica Yang and Shelly Yang.
Shelly Yang (2nd Runner-up), Vicki Pon and Jessica Yang (1st Runner up)
Miss New York Chinese 2008 contestants during the bikini competition
Finalists of Miss NY Chinese 2008 in Press Conference on Friday, 27 June 2008 <<EXAMPLE>> French Revolution . Through the Revolutionary Wars , it unleashed a wave of global conflicts that extended from the Caribbean to the Middle East . The causes of the French Revolution are complex and are still debated among historians . Following the Seven Years ' War and the American Revolutionary War , the French government was deeply in debt and attempted to restore its financial status through unpopular taxation schemes . <<TRUE_LABEL>> The French Revolution happened after the Seven Years' War. <</EXAMPLE>> <<EXAMPLE>> Heather Watson . She holds the Mixed Doubles title at the 2016 Wimbledon Championships with Henri Kontinen . On 14 October 2012 , Watson won her first WTA singles title with a win over Chang Kai-chen of Taiwan in the final of the Japan Open , becoming the first British female to win a WTA singles title since Sara Gomer in 1988 . <<TRUE_LABEL>> Heather Watson is an award-winning tennis player. <</EXAMPLE>> | [
"This text is about a beauty pageant winner and the runners-up."
] | [
"This text is about a beauty pageant winner and the runners-up."
] |
BENGALURU: Karnataka has reported 3,222 new Covid-19 cases and 93 related deaths taking the total number of infections to 28,40,428 and toll to 34,929 respectively, the Health department said on Tuesday.The day also saw 14,724 discharges, continuing to outnumber the fresh cases, taking the total number of recoveries in the state so far to 27,19,479. Out of 3,222 new cases reported on Tuesday, 753 were from Bengaluru Urban, as the city saw 10,722 discharges and 16 deaths. The total number of active cases in the state is at 85,997. While the positivity rate for the day stood at 2.54 per cent, case fatality rate (CFR) was at 2.88 per cent. Of the 93 deaths reported on Tuesday, 16 were from Bengaluru Urban, followed by Dakshina Kannada (15), Mysuru (10), Ballari and Haveri (8 each) among others. Among the districts where the new cases were reported, Bengaluru Urban accounted for 753, Mysuru (415), Dakshina Kannada (385), Hassan (242), Shivamogga (225), followed by others. Bengaluru Urban district tops the list of positive cases, with a total of 12,12,746, followed by Mysuru 1,66,207 and Tumakuru 1,14,818. Among discharges too, Bengaluru Urban tops the list with 11,44,685, followed by Mysuru 1,59,759 and Tumakuru 1,12,188. Cumulatively a total of 3,40,98,615 samples have been tested in the state so far, out of which 1,26,670 were tested on Tuesday alone. KSU SS | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"health"
] |
Warning - June 10, 2006
Please stop. If you continue to vandalize pages, you will be blocked from editing Wikipedia. | [
"obscene",
"toxic",
"severe toxic",
"threat",
"non toxic",
"identity hate",
"insult"
] | [
"non toxic"
] |
G.I. Jane is a 1997 American action film directed by Ridley Scott , produced by Largo Entertainment , Scott Free Productions and Caravan Pictures , distributed by Hollywood Pictures and starring Demi Moore , Viggo Mortensen and Anne Bancroft . Hollywood Pictures was an American film production label of The Walt Disney Studios , a division of The Walt Disney Company . <<EXAMPLE>> G.I. Jane is a 1997 American action film directed by Ridley Scott , produced by Largo Entertainment , Scott Free Productions and Caravan Pictures , distributed by Hollywood Pictures and starring Demi Moore , Viggo Mortensen and Anne Bancroft . Largo Entertainment was a production company founded in 1989 . <<TRUE_LABEL>> G.I. Jane was produced by a production company. <<TRUE_LABEL>> A production company founded in 1989 produced G.I. Jane. <</EXAMPLE>> <<EXAMPLE>> We have developed a definition of case studies that leads to appropriate uses and says something about how a good case study is conducted. <<TRUE_LABEL>> Our case studies definition is able to accurately evaluate how good another case study is conducted. <<FALSE_LABEL>> Our definition does not help or say anything about appropriate uses. <<FALSE_LABEL>> Definitions are needed to develop accuracy. <</EXAMPLE>> <<EXAMPLE>> G.I. Jane is a 1997 American action film directed by Ridley Scott , produced by Largo Entertainment , Scott Free Productions and Caravan Pictures , distributed by Hollywood Pictures and starring Demi Moore , Viggo Mortensen and Anne Bancroft . <<TRUE_LABEL>> G.I. Jane stars Anne Bancroft. <<TRUE_LABEL>> G.I. Jane features Demi Moore in a starring role. <<TRUE_LABEL>> G.I. Jane's director was Ridley Scott. <<TRUE_LABEL>> G.I. Jane had Anne Bancroft in it's cast. <<TRUE_LABEL>> G.I. Jane was directed by Ridley Scott. <<TRUE_LABEL>> G.I. Jane features Viggo Mortensen in a starring role. <<TRUE_LABEL>> G.I. Jane is an American action film. <<TRUE_LABEL>> G.I. Jane is action movie of American production. <<TRUE_LABEL>> G.I. Jane stars Demi Moore. <<TRUE_LABEL>> G.I. Jane includes Anne Bancroft in a starring role. <<TRUE_LABEL>> G.I. Jane is an action film. <<TRUE_LABEL>> G.I. Jane was distributed by Hollywood Pictures. <<TRUE_LABEL>> G.I. Jane's distributor was Hollywood Pictures. <<TRUE_LABEL>> G.I. Jane stars Viggo Mortensen. <<TRUE_LABEL>> Ridley Scott worked on G.I. Jane. <<TRUE_LABEL>> G.I. Jane was distributed. <<TRUE_LABEL>> G.I. Jane was distributed by Hollywood Pictures in 1997. <<TRUE_LABEL>> G.I. Jane was produced by Largo Entertainment, Scott Free Productions, and Caraven Pictures. <<TRUE_LABEL>> G.I. Jane includes Viggo Mortensen in it's cast. <</EXAMPLE>> | [
"G.I. Jane was distributed by an American film production label in 1997.",
"An American film production label distributed G.I. Jane.",
"G.I. Jane was distributed by a French film production label."
] | [
"G.I. Jane was distributed by an American film production label in 1997.",
"An American film production label distributed G.I. Jane."
] |
Kolkata: Want a short and exclusive vacation with your family during the Pujas? You can opt for the 'Jyamon Khushi Beran' scheme from the Indian Railway Catering and Tourism Corporation (IRCTC), Eastern Zone. The Indian railways subsidiary that has been arranging tours to major destinations across the country for large groups for several years now, has decided to foray into the business of tailor-made short trips for fewer people. IRCTC (east) group general manager Debashis Chandra said, "Our normal tours are arranged for groups of 25-30 people and last for at least 6-7 days. Nowadays, there are many couples who want 2-3 day outings with their children to destinations that are not run of the mill. We want to target such people. For instance, families may want to visit Manas in Assam or Gopalpur-Bhittarkanika in Odisha. We will arrange everything, from their travel by air or rail to accommodation and sightseeing. Our plan is to go in for the 'wish marketing' concept instead of selling tours planned by us." All one needs to do to schedule their dream trip is to call up IRCTC or send a mail. Executives will call back to find out what the requirements are. IRCTC will then take 7-10 days to work out details and give various options to the travellers . "Our aim is to exploit the immense potential that the eastern sector has. People now want to travel to the northeastern states. We also want to tap the adventure tourism market. We are in plans to arrange for trekkers' huts and forest bungalows. The monsoons are a very good time to travel for those who want small trips, particularly to forests that remain open. At this time, accommodation is normally cheaper than the normal tourist seasons," added Chandra. Discussing the future plans of IRTC, Chandra said, "We shall be participating in a tourism fair in Kolkata in the first week of July where the 'Jyamon Khushi Beran' scheme will be announced. " According to Chandra, IRCTC's foreign tours - particularly to destinations like Sri Lanka, Singapore, Thailand and Malaysia - are extremely popular. "There are also plans to foray into the field of medical tourism. We will tie-up with several city hospitals and arrange for the travel, stay and treatment for outstation patients, particularly from the northeastern states," he said. Kolkata: Want an exclusive vacation with your family away from the madding crowds during the Pujas? You can opt for the 'Jyamon Khushi Beran' scheme from Indian Railway Catering and Tourism Corporation (IRCTC), Eastern Zone. The Indian Railways subsidiary that has been arranging tours to major destinations across the country for large groups for several years now, is now foraying into the business of tailor-made trips for fewer people. "Our normal tours are for groups of 25-30 people and last for at least 6-7 days. Nowadays, there are many couples who want 2-3 day outings with their children to destinations that are not run of the mill. We want to target such people. | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"travel"
] |
Are these hate crimes?
Posted on November 29, 2007 by Sarah Corbitt
Filed Under Uncategorized | same one written at St. Paul’s two days earlier. <<EXAMPLE>> Database Stopped Because the OracleService<SID> Service Terminated Unexpectedly
Last updated on DECEMBER 06, 2016
Applies to:Oracle Database - Enterprise Edition - Version 9.2.0.8 to 11.2.0.2.0 [Release 9.2 to 11.2]
Generic Windows
***Checked for relevance on 20-Sep-2016***
Database Sudden Stopped cause of OracleService
Symptoms
The database stops suddenly on Windows server.
Found the OracleService<SID> service has stopped / crashed.
Cause
My Oracle Support provides customers with access to over a
Million Knowledge Articles and hundreds of Community platforms <<TRUE_LABEL>> This text is a technical support article for a database problem on Windows Server. <</EXAMPLE>> <<EXAMPLE>> Categorizing legal cases based on their area of law. This helps lawyers specialize in specific legal domains and quickly identify relevant case law for a particular legal issue. In the matter of Smith v. Jones, the plaintiff brought an action against the defendant for breach of contract. The plaintiff alleged that the defendant had failed to deliver goods as agreed upon in a written contract. The defendant argued that the plaintiff had failed to make timely payments as required by the contract. The court found that the defendant had indeed breached the contract and ordered the defendant to pay damages to the plaintiff. The case highlights the importance of adhering to the terms of a contract and the potential consequences of breaching it. <<FALSE_LABEL>> The text describes a case related to business and corporate issues. <<FALSE_LABEL>> The text describes a case related to patents, trademarks, and copyrights. <<FALSE_LABEL>> The text describes a case related to disputes between individuals or organizations. <<FALSE_LABEL>> The text describes a case related to crimes and punishments. <<FALSE_LABEL>> The text describes a case related to family matters such as divorce and child custody. <</EXAMPLE>> <<EXAMPLE>> Whether the text is hate speech or not:
Maybe hate crime will now apply to whites ( in an odd fashion ) <<TRUE_LABEL>> noHate <<FALSE_LABEL>> idk/skip <<FALSE_LABEL>> hate <<FALSE_LABEL>> relation <</EXAMPLE>> | [
"This text raises the question of whether certain acts constitute hate crimes."
] | [
"This text raises the question of whether certain acts constitute hate crimes."
] |
She is one of those actresses who enjoy working across mediums including films, television, web-shows and even plays. Suchitra Pillai who’s been a part of interesting plays and enjoys performing live in front of the audience is excited that she is finally getting back to one. The actress is gearing up to perform on a stage by end of this month at a theatre in Mumbai.That apart, she is also excited about the line-up of projects she’s awaiting to be released in 2021.Read AlsoExclusive! Suchitra Pillai: Sandeep Nahar was shaken by Sushant Singh Rajput’s deathThe Kehne Ko Humsafar Hai co-actor is shocked that the actor himself took this drastic stepShe says, “I have some six projects waiting to get released this year. That apart I am also busy with a lot of projects that are on floor. I am happy that after a break of several months last year, this year is keeping me on my toes.”Suchita who’s been a part of Hindi films like Dil Chahta Hai (2001), Waisa Bhi Hota Hai Part II (2003), Page 3 (2005), Pyaar Ke Side Effects (2006), Fashion (2008) among others is excited about her next Malayalam project. Her first being, Priyadarshan’s Oppam, which released in 2016 and starred Mohanlal.About her second outing, she says, “I am doing Tanu Balak’s Cold Case with Prithviraj (Sukumaran). I have shot for the film already. It’s a pivotal role. Unfortunately, I didn’t have any scenes with Prithviraj.” | [
"video gaming",
"news and politics",
"technology and computing",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"movies"
] |
."
The design would be impossible to create using traditional manufacturing methods, and was 3D printed layer by layer from bronze-infused stainless steel powder, and fused in a kiln.
Their Porous cuff bracelet is designed to fit snugly on the wrist, and measures 70x47x23mm. Please compare these dimensions with one's wrist before ordering. The stainless steel is composed of roughly 60% steel and 40% bronze, so color and polish may vary from piece to piece. | [
"kiln operation",
"jewelry sizing instructions",
"bronze casting",
"jewelry design",
"3D printing",
"material composition"
] | [
"jewelry design",
"3D printing",
"material composition"
] |
Organ-specific autoantibodies in children with Helicobacter pylori infection. BACKGROUND: We compared the prevalence of organ-specific autoantibodies in a group of Helicobacter pylori infected children and a group of uninfected children and investigated the relationship between the presence of relevant autoantibodies and the status of the target organs.PATIENTS AND METHODS: One hundred and twenty-four children with dyspepsia (54 boys, 70 girls; mean age 10.5 years; range 4-19) underwent gastroscopy: 56 had H. pylori infection (31 girls, 25 boys), while 68 (37 girls and 31 boys), were H. pylori-negative. All sera were tested for the presence of: parietal cell autoantibodies (PCA), intrinsic factor autoantibodies (IFA), microsomial autoantibodies, thyroglobulin autoantibodies, islet cell autoantibodies, glutamic acid decarboxylase autoantibodies, adrenal cortex autoantibodies, steroid-producing cell autoantibodies; gastrin, pepsinogen A, pepsinogen C and anti-H. pylori antibodies. The histological features and the ureA and cagA genes were also considered.RESULTS: The frequency of organ-specific autoantibodies was higher in patients with H. pylori infection than in uninfected patients (chi2-test p < .0001). Specifically gastric autoantibodies were significantly higher: seven of the 56 H. pylori-positive children were PCA-positive and one was IFA-positive (chi2-test p = .0004). The presence of autoantibodies was not associated with any clinical or biohumoral signs of disease.CONCLUSIONS: Our study detected a relationship between H. pylori infection in childhood and the presence of organ-specific autoantibodies unassociated with any clinical or biohumoral signs of disease. Helicobacter pylori infection in childhood could trigger the onset of clinical autoimmune gastritis, and/or other clinical autoimmune diseases. | [
"video gaming",
"technology and computing",
"news and politics",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"pharmaceuticals, conditions, and symptoms"
] |
NEW DELHI: Global realty consultant Cento International Investments on Tuesday said it expects to sell 500 Indian real estate properties in the overseas markets within next three months attracting a net worth of over Rs 250 crore by projecting the country as an investment destination. The UK-based consultant is in advanced stages of discussions with many developers, like Parsvnath for its 'Nano City', K Raheja Group, DS Kulkarni, Lodha Group and Alpha G Corp, for showcasing their projects in the European markets. "We are in final stages of talks with them (developers) and will be showcasing their products in London for selling. We expect to sell 500 properties of these developers of at least Rs 50 lakh each in the next three months," Cento International Investments Director (Sales) Nitesh Alagh said. The company would mainly project both residential and commercial properties in Tier II and Tier III cities, he added. "After a formal tie up, we will also be selling properties of Parsvnath's recently launched Nano City in Haryana, where Shabeer Bhatia is one of the promoters," Alagh said. The company would tie up with 40 developers across the country to help in selling their properties and to attract overseas investments into India in the form of joint ventures with the domestic firms, he said. "Investors in the Europe are eagerly waiting to invest in Indian properties, but they can not directly do so because of restrictions. The government should relax the norms so that there will be no obstacles in money inflow into the country's real estate sector," Alagh said. | [
"video gaming",
"news and politics",
"technology and computing",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"personal finance"
] |
Mum "Mum's.
The product was briefly withdrawn from the market in the United States, but is again widely available. It is popular in Australia, Germany, Mexico, Peru, Singapore, South Africa, the United Kingdom and Venezuela. In the Philippines, it was sold in the 1970s and 1980s but has since been withdrawn..
WorldNews.com | 15 Jan 2021 <<EXAMPLE>> Conn's Fiscal Q1 Sales Increase
Conn's, the 47-store CE and majaps chain based here, reported that total sales for its first fiscal quarter, ended April 30, rose 11.2 percent to $118.6 million, while same-store sales grew 3.5 percent.
"We expected same store sales for this quarter and the balance of the year to return to more realistic levels," chairman/CEO Tom Frank said in a statement. Comparable store sales for the preceding quarter had soared 11.7 percent.
He attributed the net gains in part to Conn's power aisle programs. <<TRUE_LABEL>> This text discusses Conn's sales increase <<TRUE_LABEL>> This text reports Q1 fiscal sales figures <<TRUE_LABEL>> This text mentions CEO's expectation for sales in the year <<FALSE_LABEL>> This text reports on a different quarter's sales <<FALSE_LABEL>> This text describes a decrease in sales <<FALSE_LABEL>> This text attributes sales growth to a different factor <</EXAMPLE>> <<EXAMPLE>> Mother’s day is just around the corner and it is officially the time to go gift hunting for the most important woman in your life. Buying gifts for our mamas is not an easy task as they never really admit that they need anything at all. So, if you want to pamper your mother and make her feel incredibly special, we have a list of gift ideas for you. Thank us later. Also See: Happy Mother's Day 2023: Wishes, messages, quotes, images, Facebook & WhatsApp statusWhen is Mother’s Day 2023?Do keep in mind that the window for buying presents is closing soon as Mother’s Day 2023 is falling on this Sunday i.e. May 8. It is especially important to act now if your mother lives far away and you are planning to send her something online. We present you an extensive list of the best gifts for your mother which will make her feel incredibly special. Your gifts will make it a day to remember for your mama and ensure that she gets giddy with all the love and affection showered at her.10 best gifts for Mother’s Day: 1. Take her out for dinner There is no better gift than giving her a break from the hectic routine and spending some quality time with her. Make sure that you make a reservation at her favourite eatery which has good food and good ambience. She will surely cherish this beautiful memory for a long, long time. 2. A handmade card There is something incredibly nostalgic about a handmade card which makes it extremely special for mamas. It shows that you are willing to put in that extra effort to tell your mother how much she means to you and the whole family. Also See: Happy Mother's Day 2023: Images, Cards, Greetings, Quotes, Pictures, GIFs and Wallpapers3. A sapling/plantDon’t wrinkle your nose just yet. If your mother is a lover of nature, be rest assured that she is going to love your thoughtful gift. You can also get her new gardening tools if she really enjoys looking after the plants in the house. 4. Sleepwear set What better way to ensure that your mom sleeps peacefully than to gift her super comfy sleepwear? You know that she is never really going to buy one for herself so this little luxury for your sleep-deprived mama is going to make her feel really special. 5. Jewellery If you are not the one to experiment with your gifts and are looking for a foolproof option, be rest assured that you cannot really go wrong with jewellery. Be it a pair of beautiful earrings that go with a lot of outfits or an incredibly delicate pendant, your mother will surely thank you for this wonderful present! 6. A nice-smelling perfume A beautiful fragrance makes for an excellent Mother’s Day gift. So you can easily vouch on nice-smelling perfumes or deodorants to make your mom happy. Always ensure that you choose a fragrance which is really soothing <<TRUE_LABEL>> home and garden <</EXAMPLE>> <<EXAMPLE>> !
The links in this post may be affiliate links. Read our disclosure policy here. If you purchase something through a post on our site, MomFave may get a small share of the sale. <<TRUE_LABEL>> affiliate marketing <<TRUE_LABEL>> online sales <<TRUE_LABEL>> website monetization <</EXAMPLE>> | [
"Product advertising",
"Product ingredients",
"Online news article",
"Product availability in various countries",
"Product usage instructions",
"Product history in the Philippines",
"Product popularity"
] | [
"Product history in the Philippines",
"Online news article",
"Product availability in various countries",
"Product popularity"
] |
A fireraiser has been convicted of an arson spree which left four pensioners trapped in their blazing homes.
Firemen had to rescue the elderly residents, the oldest a woman of 101, after Neil Oates set alight wheelie bins by their bungalows in The Terraces, Columbia, Washington. Flames spread to the front doors and porches blocking escape. The other victims, women of 81 and 86, and a disabled man, 88, were led to safety after one woke and raised the alarm.
Oates, 22, of Lanercost, Glebe, Washington, denied seven charges of arson but a jury at Newcastle Crown Court found him guilty.
Sentence was adjourned for reports and Oates was remanded in custody. | [
"fire department",
"wildfires",
"court procedure",
"victims of crime",
"arson investigation techniques",
"court conviction",
"fire safety regulations"
] | [
"victims of crime",
"fire department",
"court conviction"
] |
KOCHI: In the wake of the increasing number of stray dog bites, Better Kochi Response Group (BKRG), an NGO, has submitted a proposal to rehabilitate dogs in any of the islands off Kochi. The proposal is being discussed at various levels so that it can be implemented once it is found feasible. The animal birth control (ABC) programme of Kochi corporation is progressing at a snail’s pace. At the same time, there isn’t ABC at all in other local bodies in the district. “Since the dogs are left back to the streets after ABC surgery, the problem of getting rabies does not diminish. This also does not prevent dogs from attacking human beings and animals,” said BKRG president S Gopakumar. “There are many uninhabited islands off Kochi. One of them is Deepu Sagar Island as marked on Google Map between Bolgatty and Willington Island. Shelters should be constructed there, and the island should be fenced properly. Arrangements for water and electricity in the island should be ensured. There should be food dispensing areas as well,” Gopakumar said.Cleaning arrangements should be made using high pressure water jets. A small space for a veterinary doctor to examine dogs should be there. “First, the focus should be on catching female dogs. Then, they should be subjected to various tests to diagnose any diseases. After that they should be brought to the fenced area. Then, male dogs should also be caught. After sterilization, they also should be brought to the island,” he said. “Efficiency of the ABC programme should be increased by making use of organizations like DAYA. Food for the dogs can be arranged from nearby hotels. Crematorium for dogs to be made in the island itself. It could even be a tourist attraction,” he said. “After the ‘dog island’ is developed, strict rules for keeping pet dogs have to be framed,” Gopakumar said. Mayor M Anilkumar said he has already held discussion with BKRG office-bearers. “Availing land for the purpose is not under corporation’s control. We will convene a meeting with various stakeholders to discuss the issue,” he said. | [
"video gaming",
"technology and computing",
"news and politics",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"pets"
] |
Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova Mouse Cxcl1 (P12850) Recombinant Protein
Used for Func, SDS-PAGE
Manufacturer: Abnova P4603
DescriptionSpecificationsDocuments
DescriptionSequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Specifications
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title <<EXAMPLE>> BoJack Horseman is an American adult animated sitcom created by Raphael Bob-Waksberg . The series ' first season premiered on August 22 , 2014 , on Netflix , with a Christmas special premiering on December 19 . <<TRUE_LABEL>> BoJack Horseman had a special. <</EXAMPLE>> | [
"This text does not mention account numbers.",
"This text states all pricing is the same.",
"This text advertises a promotional price online.",
"This text promotes a dedicated account number.",
"This text offers a promotional price in-store.",
"This text mentions a contract pricing difference."
] | [
"This text mentions a contract pricing difference.",
"This text advertises a promotional price online.",
"This text promotes a dedicated account number."
] |
During travel
Your vacation is all booked and you’re ready to travel but you feel you may have forgotten to ask something. Some of these questions may be below.
What should I bring with me?
We always recommend that you travel light if possible. Check the long term weather forecast before leaving and bring appropriate clothing. Don’t forget an umbrella (in case of showers) an electrical adapter to fit UK plug sockets for your electrical appliances. And of course a camera to get snaps of everything you see. For further information on what to pack, click here.
Can I use my US cell phone in the UK?
Nowadays most cell-phones will work when travelling abroad especially if your phone is a “tri-band” phone (ask your mobile/cell-phone provider). Most cell-phone networks however will charge overseas or international tariffs so it is best to check all charges before you depart so you know what you’ll be paying. If you want a low-cost way of making calls whilst you’re here in Britain you may choose to purchase a “pay-as-you-go” sim-card (chip) to put in your cell-phone, this will give you a UK number and allow you to call locally. For more information please ask your adeo Travel Britain expert.
I’m travelling and have a question, what do I do?
Call us! In your travel documents you will receive the business card of your Britain expert with a local telephone number within the UK. Pop this card in to your purse or wallet so that you have it with you during travel – it will contain our office number for calls during working hours and an emergency number if you need to call us of an evening or weekend.
I have bought an expensive item; can I claim back the tax?
Yes! You can claim back VAT tax on items that you purchase in the UK but are taking out of the country back to your home nation. For more information on what items you can claim tax back on and how to do so, please click here. <<EXAMPLE>> Studying abroad is quite an adventure. The applicants who usually go to alien nations to fulfil their quest for education are mostly on the right side of thirty and are in a position to experience new emotions and situations with a fresh outlook. Therefore, it is very important to blend in and follow a path to cultural integration. Regardless of the country the applicant is coming from, the culture of the student's host country has standards of appearance and social behaviour that subtly set it apart. More often than not, the visitor's dress, appearance, choice of words and habits may naturally let others know that he is not a local. There are safety issues too. Those who stick out as obvious visitors are targeted more often by pickpockets and other thieves. This may also draw unhealthy interest in the form of stares. It would be wise to observe and implement a dress sense to fit in. This can begin as a conscious exercise the moment the student lands. The student should also keep in mind what makes him or her comfortable. For example, normal casual attire for an American student going to class may include a hooded sweatshirt or team logo t-shirt , shorts, tennis shoes, white athletic socks, and a baseball cap. Such dress habits may be considered rude or upstart in a social environment that of India's . A student may also notice that in some countries dressing for the class room may border on the formal. This could be unnerving too for anybody travelling from cities such as New Delhi, Mumbai, Bangalore or Chennai. Rules of interaction may vary too. For instance, in some cultures, making eye contact with or greeting strangers in the Indian culture may illicit a strange look or even draw unwanted attention. On the other hand, some other cultures may be less ashamed about making inquisitive eye contact, which may seem like rude staring to an American visitor. The student's experience may begin with fascination towards the host culture. The food tastes delicious , everything is novel and exciting ; full of enthusiasm, he or she senses that a wonderful experience lies ahead and cannot wait for everything that is to come. Before long, the student begins to encounter difficulties in the language (wherever applicable), colloquialisms , studies, and awkward interactions with the locals inadvertently creep in. Independent consultants say something similar. According to Naveen Chopra of The Chopras Consultant, education undertaken in foreign contries is important because studying abroad is not merely about surfing the net, filling in application forms and sending them to universities you have heard of. It is a well planned investment that one makes in order to reap great results. The internet, increased travel and a fast globalizing world has created huge higher education opportunities for students in countries across the globe. There are many reasons as to why education imbibed in foreign lands is important. Internationally sourced education offers global views and perspectives that enhance the education <<TRUE_LABEL>> arts and culture <<FALSE_LABEL>> pharmaceuticals, conditions, and symptoms <<FALSE_LABEL>> personal finance <<FALSE_LABEL>> academic interests <<FALSE_LABEL>> hobbies and interests <<FALSE_LABEL>> video gaming <<FALSE_LABEL>> news and politics <<FALSE_LABEL>> family and relationships <<FALSE_LABEL>> technology and computing <<FALSE_LABEL>> pets <<FALSE_LABEL>> automotives <<FALSE_LABEL>> healthy living <<FALSE_LABEL>> television <<FALSE_LABEL>> style and fashion <<FALSE_LABEL>> shopping <<FALSE_LABEL>> music and audio <<FALSE_LABEL>> home and garden <<FALSE_LABEL>> food and drinks <<FALSE_LABEL>> movies <<FALSE_LABEL>> real estate <<FALSE_LABEL>> travel <<FALSE_LABEL>> books and literature <<FALSE_LABEL>> health <<FALSE_LABEL>> careers <<FALSE_LABEL>> sports <<FALSE_LABEL>> business and finance <</EXAMPLE>> <<EXAMPLE>> Whether you are scheduling a quick pollu-cation or heading for that long-awaited annual holiday, you know that packing right needs top priority. Along with packing your bags, pay heed to your travel beauty kit too, else you can say bon voyage to looking your best. Here’s a little primer on what you should stow before you go... If it’s a beach holiday Keep a hydrating mist (for face and hair) handy because too much of sun and the moisture-heavy climate of the area can make your skin sore and tresses frizzy; keep spritzing on your face and hair every two hours. If it’s a hilly vacay Make sure you carry a face and body cream rich in ‘ceramides’ because cold winds make the skin very dry and even patchy. You also require a sunscreen with more SPF than usual because of the harsh hillside sun rays. And a creamy hair conditioner to keep your strands soft.If it’s a desert region Pack a ‘silicone-based sunscreen’ to help you deal with sweat that can make your skin look greasy. For hair, a gentle shampoo will do, and the hair conditioner should be light so that it doesn’t weigh down the hair in humid weather conditions. What else? A skin serum application at night is great for all climatic zones because it heals and repairs any damage (via sun, humidity, cold wind) that your skin may have suffered during sight-seeing. Keep a dry shampoo in your travel kit to use it as a quick-fix on days you are too busy or pressed for time to wash your hairIdeal Travel KITFace cleanser & toner Skin serum Sunscreen Shampoo and conditioner BB cream Razor Tinted lip balm & lipsticks Dual pencil with kajal and eyeliner Travel-size fragrance bottle Cleansing wipes- Expert: Dr Soma Sarkar, dermatologistBy Pallavi.Shankar@timesgroup.com <<TRUE_LABEL>> travel <</EXAMPLE>> | [
"This text provides advice and information to travelers visiting the UK."
] | [
"This text provides advice and information to travelers visiting the UK."
] |
wanted to shoot Khosla in those houses which came up in the late 60s, like mine. Of all the clothes worn by Anushka during weddings planned by the group, the first (shown in the picture) is the most jhintak and is something that can be found in all West Delhi suit shops and wardrobes. Talking about getting the real Janak Puri on the big screen, director Maneesh Sharma said, “The environment was very real, so it had to be a proper Janak Puri house. For the first wedding taken up by the duo, the site was the mohalla park and gali, a regular venue for all birthday parties, jagraans and weddings in the Janak Puri region till date. Lucky Oye! was another movie that captured the essence of West Delhi in its depiction of Lucky’s childhood and milieu. Manjot’s first date with the neighbourhood card shop girl (whom he impressed by giving her a card from her own shop), starts with a bike ride from Tilak Nagar to Rajouri Garden and ends in a dingy Rajouri restaurant with their Butter Chicken order. Identifiable situations and characters, like the chartered bus friendship of KK Khosla and Sahni saab, the jobless elder brother (Ranvir Shorey), the jugaadu Asif Iqbal (Vinay Pathak), who owned an auto and got visa formalities done, were all people you met and interacted with on a daily basis in West Delhi. Khosla Ka Ghosla was about the aspiration of a typical inner city family to move out to suburban bliss. Director Maneesh Sharma told us, “Janak Puri ki behenji is a phrase I have grown up with. Talking to us about OLLO, Dibakar had said in a previous interview, “Lucky’s story starts from his small West Delhi colony and his working class morally corrupt father – he has a mistress, doesn’t care about his wife and son, and that has an influence on his aspirations. Now, it’s the gali itself. For the interiors, we shot in a much bigger colonial bungalow in Civil Lines which we converted to make it look like that Karol Bagh house. 'West ke Khosla ji ka sapna, South Delhi ka south facing plot' Dibakar Banerjee scored many, many points with Dilliwalas with his debut directorial outing, Khosla Ka Ghosla, a hilarious yet sharp look at middle-class aspirations, and went on to win the National Award too. There was a time when the gali ka ladka making it to Bollywood was gossip for West Delhiites. | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"home and garden"
] |
coronavirus pandemic affected bulk population across globe daily tolls increasing prescribed cases fatalities india caseload significantly high compared body politic since set out pandemic enormous efforts carried scientific researchers develop novel vaccine end pandemic vaccine still long path situations support wellness great deal government along ministry ayush stressed importance building strengthening immune system traditional indian system health like ayurveda stress ways strengthen body ability regulate healthy immune response ayurveda classics advise consumption various herbs rasayana properties specific group immunomodulatory herbs helps soundbox lifelike ability overcome infections also gut health prime importance since catgut micro biome principal regulators immunity hosting body immune cells Ayurveda infinite wisdom recognized gut right ratio called good bad bacteria key strong immune latest enquiry findings highly upholds importance healthy gut micro biome source balanced immunity good health plant free-base prebiotics tremendously pet contain group polyose including arabinose arabinogalactans theme giloy guduchi plant acts good bacteria gut thereby raise healthy microbiome gut repopulate restore goodish bowel ecosystem giloy hailed medicinal properties host health benefits scientific name miraculous herb tinospora cordifolia likewise known amrita sanskrit literally render nectar life good documented benefits wonderful plant enumerate immunomodulatortinospora cordifolia giloy boost phagocytic activity macrophages first agate line defense body play crucial office innate nonspecific adaptive specific immunity also remarkably augment production cytokines enhances antigen particular recall antioxidantthe presence flavonoid polyphenols tinospora cordifolia attribute free radical scavenging activity giloy serves source nutraceuticals alleviate oxidative stress helps prevention reduction chronic degenerative disease sequent health cordifolia giloy helps reduce joint pain inflammation colligate arthritis decreasing synthesis proinflammatory cytokines like tumor necrosis cordifolia giloy stimulates growth osteoblasts increases differentiation cells osteoblastic lineage also improves mineralization swot hepatoprotectivetinospora cordifolia giloy efficient hepatoprotective agent ability scavenge free ros promotes hepatic regeneration giloy also increases glutathione gsh level affirm liver detoxify toxic waste cardioprotectivetinospora cordifolia giloy modulates lipid metabolism via inhibiting glucuronide cholesterol also protect hearts infarct antioxidant neuroprotectivetinospora cordifolia giloy have significant neuroprotective activity modulates antioxidant enzyme organisation brain tissue preserve dopaminergic neurons giloy also enhance cognition learning memory increasing synthesis acetylcholine cordifolia giloy works like hypoglycemic agent stimulates production insulin secernment pancreas helps lower blood refined sugar levels giloy besides improves long term cellular insulin sensitivity helps manage diabetes forestall respiratory illnesstinospora cordifolia giloy preferred traditionally treat ailments bronchitis chronic cough due powerful antioxidant properties lenify mucous membrane respiratory system thereby making effective respiratory proceeds like asthma cough cold cordifolia giloy efficient herbaceous plant rich flavonoids fight cell price initiate new cell growth besides nourishes skin enhances collagen production reduce visible signs humanity never adopt fact learn live virus incumbrance aspect keep immune strong protect self fight infection giloy ayurvedic plant ray hope us help us keep immune strong eubstance disease free incredible chintan gandhi ceo director millennium herbal care | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"healthy living"
] |
Identify the primary audience of written content to ensure tailored messaging for enhanced engagement and effectiveness. As the use of artificial intelligence and machine learning continues to grow, it is increasingly important for data scientists and other professionals to have a strong understanding of the ethical considerations and potential impacts of these technologies. In this paper, we will explore the ethical implications of AI and machine learning, including issues related to privacy, fairness, and transparency. We will also provide practical guidance for data scientists and other professionals on how to navigate these challenges and ensure that their work is responsible and ethical. Through clear, concise writing and real-world examples, we aim to provide valuable insights and advice for practitioners in this field. <<EXAMPLE>> Identify the primary audience of written content to ensure tailored messaging for enhanced engagement and effectiveness. The field of artificial intelligence has seen rapid advancements in recent years, with machine learning algorithms and natural language processing techniques becoming increasingly sophisticated. This has led to a proliferation of AI-powered tools and applications, from virtual assistants to autonomous vehicles. In this paper, we will provide an overview of the current state of the art in AI and discuss the potential implications of these technologies for society. We will also examine some of the ethical considerations that arise from the use of AI and offer recommendations for responsible development and deployment of these technologies. <<FALSE_LABEL>> The text targets readers with interests or knowledge in a specific field. <<FALSE_LABEL>> The text is intended for an academic or scholarly audience. <<FALSE_LABEL>> The text is aimed at individuals in a specific profession. <<FALSE_LABEL>> The text is written for a broad audience with no specific expertise required. <</EXAMPLE>> <<EXAMPLE>> Identify the primary audience of written content to ensure tailored messaging for enhanced engagement and effectiveness. The field of artificial intelligence (AI) and machine learning (ML) is rapidly advancing, with new applications and technologies emerging every day. From natural language processing to computer vision, these technologies are transforming the way we live and work. However, with great power comes great responsibility. As AI and ML become increasingly integrated into our daily lives, it is crucial for professionals to stay informed about the latest developments and ethical considerations. In this issue, we explore the potential of AI and ML in healthcare, including the use of predictive analytics to improve patient outcomes and the challenges of data privacy. We also examine the role of AI in cybersecurity and the importance of responsible AI practices in ensuring the safety and security of our society. <<FALSE_LABEL>> The text targets readers with interests or knowledge in a specific field. <<FALSE_LABEL>> The text is intended for an academic or scholarly audience. <<FALSE_LABEL>> The text is aimed at individuals in a specific profession. <<FALSE_LABEL>> The text is written for a broad audience with no specific expertise required. <</EXAMPLE>> | [
"The text is intended for an academic or scholarly audience.",
"The text targets readers with interests or knowledge in a specific field.",
"The text is written for a broad audience with no specific expertise required.",
"The text is aimed at individuals in a specific profession."
] | [] |
Classify academic articles based on their theoretical framework: structural functionalism, conflict theory, or symbolic interactionism. This paper explores the relationship between economic power and political influence in contemporary society. Drawing on data from a variety of sources, including government reports, corporate records, and news articles, the analysis reveals a strong correlation between economic wealth and political power. The paper argues that this correlation is not merely a coincidence, but is the result of systematic efforts by powerful economic interests to shape political outcomes in their favor. The paper concludes by suggesting possible policy interventions aimed at reducing economic inequality and promoting greater political democracy. <<EXAMPLE>> Classify academic articles based on their theoretical framework: structural functionalism, conflict theory, or symbolic interactionism. This paper examines the relationship between economic power and political influence in American society. Drawing on data from a variety of sources, the analysis reveals a strong correlation between wealth and political power. The findings suggest that economic elites have disproportionate influence over the political process, shaping policies that serve their own interests at the expense of the broader population. The research highlights the ways in which power dynamics and conflict between social groups can undermine democratic institutions and perpetuate social inequality. <<FALSE_LABEL>> The text analyzes social phenomena through the lens of social structures and their functions. <<FALSE_LABEL>> The text analyzes social phenomena through the lens of power dynamics and conflict between social groups. <<FALSE_LABEL>> The text analyzes social phenomena through the lens of symbolic meanings and interactions between individuals. <</EXAMPLE>> | [
"The text analyzes social phenomena through the lens of social structures and their functions.",
"The text analyzes social phenomena through the lens of power dynamics and conflict between social groups.",
"The text analyzes social phenomena through the lens of symbolic meanings and interactions between individ... | [] |
HYDERABAD: Pochampally and Ramappa are the two destinations that are being widely promoted by the Telangana tourism department at the India International Travel Mart (IITM) tourism fair, which was inaugurated by state tourism minister V Srinivas Goud on Friday.The officials at the stall set up by Telangana, which is the host state for the event, were seen promoting several packages, destinations in the state as well as the National Institute of Tourism and Hospitality Management University located in Gachibowli.“Under the leadership of chief minister K Chandrasekhar Rao, Telangana is glowing like a diamond and blooming with back-to-back awards for state tourism like UNESCO Site Ramappa Temple and Best Tourism Village Pochampally-Land of Ikkath,” said Uppala Srinivas Gupta, chairman of Telangana State Tourism Development Corporation (TSTDC).He said that Telangana has the potential to become a hub for ecology/health tourism among others and TSTDC was working on a proposal to make this possible. The TSTDC chairman said that they have also been working on developing 450 acres near Yadagirigutta temple into a garden and an international convention centre to attract the crowd visiting the temple. Kaleshwaram was also being developed into a tourism circuit, he added. | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"music and audio",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"travel"
] |
Absence of human papillomavirus infection in minimal deviation adenocarcinoma and lobular endocervical glandular hyperplasia. The human papillomavirus (HPV) is basically always detected in squamous cell carcinoma of the cervix and its precursors; a high incidence of HPV also has been reported in adenocarcinoma and adenocarcinoma in situ of the uterine cervix. Lobular endocervical glandular hyperplasia (LEGH) was first described by Nucci in 1999. It is difficult to differentiate minimal deviation adenocarcinoma (MDA) from LEGH preoperatively or postoperatively by clinical and pathologic features. The relationships between HPV and MDA or LEGH have not been studied well because of the rare incidence of the two diseases. To our knowledge, the HPV status in LEGH has not been reported. This study was designed to investigate HPV infection in MDA and LEGH, using the polymerase chain reaction (PCR) technique. Tumor tissue lesions were microdissected and the detection of HPV and its typing were analyzed by PCR-based assay. As the control, HPV DNA was detected in all cases of squamous cell carcinoma and three of five cases of adenocarcinoma. However, no HPV DNA was detected in any of the 10 cases of LEGH or in the 3 cases of MDA. These results suggest that MDA and LEGH are probably not related to HPV infection. | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"pharmaceuticals, conditions, and symptoms"
] |
The headline over the NYT 's online version doesn't mention the homosexual angle, while the WP 's headline--FRANCE LEGALIZES GAY UNIONS--doesn't mention the heterosexual angle. The WP headline mentions the homosexual angle. | [
"neutral",
"contradiction",
"entailment"
] | [
"entailment"
] |
bangalore: ten students of the international school, bangalore have obtained exceptional results in the international general certificate of secondary education (igcse) exams in extended mathematics. while three secured b grades, four obtained a grades and three were rewarded a* grades that is awarded to only two per cent of all students, who take up the exam, in the world. the exam is administered to over one million students each year from 157 countries around the world. "but, what emphasises their achievement is that the students took the exam only after one year of preparation rather than the stipulated two years and one calendar year early", hector s. macdonald, principal, tisb told this paper. the achievers are james christian jayesuria (b), meghna jayanth (b), vedant arun (b), aditya patel (a); kartikeya shah (a); rachna shanbogue (a); raj pulin shah (a); aditi shrikumar (a*); akshay bareja (a*) and nikhil mallavarapu (a*). the school, situated on a 36-acre green campus, was set up about one-and-a-half years ago and offers both the primary years programme (pyp) and the international baccalaureate diploma programme and also the igcse curricula. about 80 per cent of the students are indians while 20 per cent of them are westerners from uk and europe and also usa. "we have about 360 students from lower kinder garten to grade xii. the students are mostly those who would normally enrol in a foreign university for higher education", he said. the programmes are designed to develop in the students not just text book knowledge but on overall personality development through a focussed approach to learning, research and development, comparable to the best institution in the world, macdonald said. the school has a 25,000 volume library, a bank of permanently on-line computers, well equipped science labs, a large art studio with ceramic, photographic and textile facilities, a drama and music room and an audio-visual room. to encourage students in sports, the school has a 400 meter athletic track, hockey, cricket and football fields, a 25-m swimming pool, basket ball, volley ball, tennis, squash and badminton courts, a billiard room, a gymnasium, a bicycle track, a roller blade ring and a horse riding track. "our students will play against the sevenoaks -- one of the best boarding schools in uk -- in cricket. there will also be a triangular tournament including our team, a sri lankan team and the sevenoaks team", macdonald explained. with bangalore being the hub for technological growth and also a vibrant city, it was chosen as the ideal location for an international school. ``southern india is strong in family values and our school is meant to reflect those values'', he added. | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"food and drinks",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"music and audio"
] |
Data Processing Information
Information regarding Opportunities
As your child progresses on their chosen instrument we would like to provide you with information about other opportunities that are available to your child in order to enhance their learning experience. We will only use your data to do this where you have given consent for us to do so.
Photographs and Video Recording
As part of LMEH's activities, we may take photographs and record images of central ensemble groups, centre groups, centre activities and individual performers. Such material will be used solely by LMEH, for example, for publicity purposes, such as prospectuses and other similar information about the Hub; on banners at concerts, on our website and for social media purposes; for assessment and educational purposes; and for fundraising or other purposes to help achieve the Hub's aims.
For music groups entering national performances,.
Although we will carefully use images on the basis of our 'legitimate interests' (see above),.
Social Media
Leicester-Shire Music Education. | [
"photography and video recording",
"social media usage",
"personal hobbies",
"music education opportunities",
"local news",
"food processing",
"data usage"
] | [
"photography and video recording",
"music education opportunities",
"data usage",
"social media usage"
] |
Pune: Arun Seth (78) has been waiting for nearly four years for revenue officials to execute the recovery warrant order issued by MahaRERA against the builder for the delay in ensuring possession of an apartment the former had bought in Mumbai.“We had booked a one bhk flat in Malad measuring 550 sqft way back in 2011. The agreement for the project was done in 2014 with the developer and we were supposed to get its possession in June 2015. But due to the delay in possession, we approached MahaRera for a refund. The order for a Rs78 lakh refund was issued in April 2019. But the wait continues,” he said.Seth, who is shuttling between the Mumbai Suburban collectorate and Maharashtra Real Estate Regulatory Authority (MahaRERA) authorities since 2019 to get his work done, said, “The revenue officials had earlier said they could not execute the order due to the Covid pandemic. There’s no movement from either the revenue officials or the MahaRERA authorities. The tehsildar was directed to carry out the order by the end of 2019. But nothing happened.” A Pune resident said the developer from whom he had bought a property had agreed on a settlement of the amount to be paid to him after he received the recovery warrant. “But the builder is yet to meet us. The revenue authorities said they have stopped the auction process. Many recovery warrants reach the cold storage in the absence of follow-ups from either MahaRERA or revenue authorities. The aggrieved homebuyers are made to do the rounds for an order passed in their favour,” the consumer said.Statistics available on MahaRERA website revealed that 773 recovery warrant orders from 13 districts in the state have been issued against 302 projects in the state till August 2022. The total recovery warrant amount for these projects is Rs729.7 crore, while the maximum recoveries and listed projects are from Pune, Mumbai, Thane and the Raigad collectorates (See graphic).In Pune city, an official said, 10 recovery warrant orders have been taken up. Of these, five orders have entered the settlement stage. Due to this, the official said, the process did not reach the auction stage. Five orders had to be sent back to the MahaRERA authorities “as the properties could not be traced for auction”, the official said. Maharashtra Society Welfare Association chairperson Ramesh Prabhu said revenue officials have to initiate the recovery process under the Maharashtra Land Revenue Code, 1966. He said the collectors have to initiate the process and forward it to the tehsildars.“This takes years and homebuyers are again forced to approach the HC to file a writ petition and get the order executed in a time-bound manner. This is not possible for every person who has invested his or her life’s savings and borrowed funds to purchase a property,” he said.Last week, the Bombay HC issued contempt notices against the Mumbai suburban district administration officials for not abiding by its earlier orders of executing recovery warrants against promoters for a project | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"real estate"
] |
Olympus D-600L
The D-600L or C-1400L is a early fixed lens DSLR from Japanese manufacturer Olympus released in 1997.
It's body design is similar to the 35mm film ZLR designs from the Olympus iS series. It offers a maximum resolution of 1280 x 1024 on a 2/3" CCD based sensor. Images can be stored in JPEG at standard, high and super high modes. The lens is a 35mm equivalent 36 – 110 mm, 3.1x zoom. The lens aperture is at f/2.8 to f/5.6 but only has three fixed settings of 2.8, 5.6, or 11. It has shutter speeds of 1/4 to 1/10,000 of a sec. There is a optical viewfinder as well as a 1.8" colour LCD. Images are stored on SmartMedia with a 4MB card usually included. It can take cards at up to 8MB, but some models have been updated to take 16MB or 32MB. It powered 4x AA batteries. <<EXAMPLE>> Olympus announced a bright, wide-angle, single-focal-length lens for micro four thirds system cameras. It is ideal for snapshot street shooting, landscape photography or capturing subjects in challenging low-light environments. The new M.ZUIKO DIGITAL 17mm f1.8 lens (34mm in 35mm equivalent).
Pricing and Availability
The Olympus M.ZUIKO DIGITAL ED 17mm f1.8 Lens will be available in December 2012 for $499.99
Google+
YouTube
Tumblr
RSS <<TRUE_LABEL>> camera equipment pricing <<TRUE_LABEL>> camera lens announcement <<TRUE_LABEL>> photography techniques <<TRUE_LABEL>> product specifications <</EXAMPLE>> | [
"This text describes a digital camera with interchangeable lenses."
] | [] |
If \( \sin y=x \sin (a+y), \) then show that
\( \frac{\boldsymbol{d} \boldsymbol{y}}{\boldsymbol{d} \boldsymbol{x}}=\frac{\sin ^{2}(\boldsymbol{a}+\boldsymbol{y})}{\sin \boldsymbol{a}} \) | [
"Maths",
"Physics",
"Chemistry",
"Biology"
] | [
"Maths"
] |
News From the Field
Four-dimensional physics in 2-D
January 3, 2018
For the first time, physicists have built a 2-D experimental system that allows them to study the physical properties of materials theorized to exist only in 4-D space. An international team of researchers demonstrated that the behavior of particles of light can be made to match predictions about the 4-D version of the "quantum Hall effect" -- a phenomenon at the root of three Nobel Prizes in physics -- in a 2-D array of "waveguides.": <<EXAMPLE>> MELBOURNE: Australian researchers have used photons — single particles of light — to simulate quantum particles travelling through time. University of Queensland researchers used photons to simulate quantum particles travelling through time and study their behaviour, possibly revealing bizarre aspects of modern physics. "The question of time travel features at the interface between two of our most successful yet incompatible physical theories — Einstein's general relativity and quantum mechanics," said lead author and PhD student Martin Ringbauer, from UQ's School of Mathematics and Physics. "Einstein's theory describes the world at the very large scale of stars and galaxies, while quantum mechanics is an excellent description of the world at the very small scale of atoms and molecules," he said. Einstein's theory suggests the possibility of travelling backwards in time by following a space-time path that returns to the starting point in space, but at an earlier time — a closed timelike curve. This possibility has puzzled physicists and philosophers alike since it was discovered by Kurt Godel in 1949, as it seems to cause paradoxes in the classical world, such as the grandparents paradox, where a time traveller could prevent their grandparents from meeting, thus preventing the time traveller's birth. This would make it impossible for the time traveller to have set out in the first place. UQ physics professor Tim Ralph said it was predicted in 1991 that time travel in the quantum world could avoid such paradoxes. "The properties of quantum particles are 'fuzzy' or uncertain to start with, so this gives them enough wiggle room to avoid inconsistent time travel situations," he said. In the study, the research team simulated the behaviour of a single photon that travels through a wormhole and interacts with its older self. This was achieved by making use of a mathematical equivalence between two cases, Ringbauer told "Speaker". In the first case, photon 1 "travels trough a wormhole into the past, then interacts with its older version." In the second case, photon 2 "travels through normal space-time, but interacts with another photon that is trapped inside a CTC forever." "We used single photons to do this but the time-travel was simulated by using a second photon to play the part of the past incarnation of the time travelling photon," Ralph said. The study is published in the journal Nature Communications. <<TRUE_LABEL>> travel <<FALSE_LABEL>> pharmaceuticals, conditions, and symptoms <<FALSE_LABEL>> personal finance <<FALSE_LABEL>> academic interests <<FALSE_LABEL>> hobbies and interests <<FALSE_LABEL>> video gaming <<FALSE_LABEL>> news and politics <<FALSE_LABEL>> family and relationships <<FALSE_LABEL>> technology and computing <<FALSE_LABEL>> pets <<FALSE_LABEL>> automotives <<FALSE_LABEL>> healthy living <<FALSE_LABEL>> television <<FALSE_LABEL>> style and fashion <<FALSE_LABEL>> shopping <<FALSE_LABEL>> music and audio <<FALSE_LABEL>> home and garden <<FALSE_LABEL>> food and drinks <<FALSE_LABEL>> movies <<FALSE_LABEL>> arts and culture <<FALSE_LABEL>> real estate <<FALSE_LABEL>> books and literature <<FALSE_LABEL>> health <<FALSE_LABEL>> careers <<FALSE_LABEL>> sports <<FALSE_LABEL>> business and finance <</EXAMPLE>> <<EXAMPLE>> The poverty, for instance, does not create the sense of shame as it does for people who live in Western countries. <<TRUE_LABEL>> People in Western countries feel a sense of shame about their poverty. <</EXAMPLE>> | [
"This text mentions an experiment with light particles",
"This text discusses 4-D physics in 2-D",
"The text refers to the quantum Hall effect",
"This text is about 2-D physics in 4-D",
"The text involves a study of sound waves in 2-D",
"This text describes a real-life application of the quantum Hall effe... | [
"This text mentions an experiment with light particles",
"This text discusses 4-D physics in 2-D",
"The text refers to the quantum Hall effect"
] |
Greg Jennings has put his house in snowy and cold Wisconsin up for sale, and now he’s aware of that fact that his relocation will probably a permanent one.
Jennings who is a free agent and most likely will not return to Green Bay will have his list of suitors, but Jennings seems to want a warm weather relocation, and according to Pro Football Talk, “he wouldn’t mind playing in Miami.”
“I wouldn’t mind that at all,” Jennings said. “The weather’s definitely nice. They have an up and coming quarterback and they definitely have a defense that’s pretty solid and some pieces on offense that are pretty solid as well.”
The Dolphins do need a playmaker on the outside, having only Brian Hartline and Davone Bess as decent targets for Ryan Tannehill.
Jennings has wanted for sometime to be the main guy and get all the attention, so I think Miami should be his choice. <<EXAMPLE>> Jennings' free-agent talk doesn't bother Skiles
Brandon Jennings' declaration that he may leave the Bucks after his rookie contract expires hardly came as a surprise to anyone on the Bucks organization.
Jennings, the Bucks' 22-year-old point guard, is in the third year of his contract and is eligible for an extension this summer.
If Jennings rejects the extension, he would likely play two more years with the Bucks and become an unrestricted free agent in 2014.
Jennings, the Bucks' leading scorer, didn't rule out signing an extension, saying he was going to "keep my options open."
Jennings, who had 24 points in the Bucks' 113-112 victory over the Cavaliers in overtime on Friday night, said he didn't have issues living in Milwaukee or with Bucks officials.
Considering most players in Jennings' position would do the same thing, his statements didn't rattle Bucks officials.
"I don't have a problem with that at all," Bucks Coach Scott Skiles said of Jennings' remarks. "Look, there's a system in place and players operate within the system. If people had a problem with it, they should have changed the system."
Jennings insisted his uncertain status with the team won't adversely affect him in going forward.
"I'm going to keep playing hard every night for the Bucks as long as I'm there," said Jennings, whose next game is Saturday night against the Magic in Milwaukee. <<TRUE_LABEL>> Player's free agency in the NBA <<TRUE_LABEL>> Bucks' organization's perspective on free agency <<TRUE_LABEL>> Jennings' commitment to the Bucks <<TRUE_LABEL>> Brandon Jennings' future with the Milwaukee Bucks <</EXAMPLE>> | [
"The text suggests that Greg Jennings might relocate to Miami."
] | [
"The text suggests that Greg Jennings might relocate to Miami."
] |
Red Hot Chili Peppers , also sometimes shortened to The Chili Peppers or abbreviated as RHCP , are an American alternative rock/funk rock band formed in Los Angeles in 1983 . Because of commitments to other bands , Slovak and Irons did not play on the band 's self-titled debut album ( 1984 ) . Slovak performed on the second and third albums , Freaky Styley ( 1985 ) and The Uplift Mofo Party Plan ( 1987 ) , but he died from a heroin overdose in 1988 . After short-lived replacements at guitar and drums , John Frusciante and Chad Smith joined in 1988 . <<EXAMPLE>> Classifying legal documents based on their type. This helps lawyers quickly identify the purpose and content of a document and determine its relevance to a case or legal issue. The Congress hereby enacts the following law. This law shall be known as the Consumer Protection Act. It is hereby declared the policy of the State to protect consumers against deceptive, unfair, and unconscionable sales acts and practices. The Act establishes a Consumer Protection Agency responsible for the implementation and enforcement of its provisions. The Agency shall have the power to investigate, conduct hearings, and impose penalties on violators. <<FALSE_LABEL>> The text outlines an agreement between two or more parties. <<FALSE_LABEL>> The text is a law passed by a legislative body. <<FALSE_LABEL>> The text is a decision made by a court or tribunal. <<FALSE_LABEL>> The text is a rule issued by a government agency. <<FALSE_LABEL>> The text provides an interpretation or advice on a legal matter. <</EXAMPLE>> <<EXAMPLE>> Red Hot Chili Peppers , also sometimes shortened to The Chili Peppers or abbreviated as RHCP , are an American alternative rock/funk rock band formed in Los Angeles in 1983 . Because of commitments to other bands , Slovak and Irons did not play on the band 's self-titled debut album ( 1984 ) . After short-lived replacements at guitar and drums , John Frusciante and Chad Smith joined in 1988 . Records and recorded the album Blood Sugar Sex Magik ( 1991 ) under producer Rick Rubin . <<FALSE_LABEL>> The Red Hot Chili Peppers were founded in 1992. <</EXAMPLE>> <<EXAMPLE>> Red Hot Chili Peppers , also sometimes shortened to The Chili Peppers or abbreviated as RHCP , are an American alternative rock/funk rock band formed in Los Angeles in 1983 . The group 's musical style primarily consists of rock with an emphasis on funk , as well as elements from other genres such as punk rock and psychedelic rock . <<FALSE_LABEL>> The Red Hot Chili Peppers are an American jazz band. <</EXAMPLE>> | [
"Red Hot Chili Peppers were formed in 1990."
] | [] |
So, I want to take our house from dark to light. I want it to have pops of color but be calm and relaxing. I knew exactly of the house that I would LOVE to have. You might have heard of a little blog called The House of Smith's? Of course! Shelley and her husband do AMAZING things, all DIY, and on a budget. Now, that's my kind of decorating! So, feast your eyes on these inspirations for our house.
I know you've seen this pantry. It is too die for!
The colors and organization of their gallery wall is just perfect!
The colors that she uses is just the look I'm going for.
The pop of color in the kitchen is just adorable.
And what I think I will use as my first project inspiration.
Ahhhh.....Isn't it all just lovely? I bet you can see why we're inspired! Go check out Shelley's blog, I'm sure you'll get some inspiration too. I can't wait to get started. <<EXAMPLE>> MOHALI: Fortis Hospital, Mohali observed the National Nutrition Week to spread awareness about the importance of nutritious meal. The importance of a healthy diet for overall good health, prevention of diseases or ailments, and curbing malnutrition was emphasised. The target audience included children, adults and the elderly.As a part of the week-long celebrations, a slogan-writing contest on ‘A Healthy Food for a Health Body’ was organised for 140 students from Chandigarh schools.Sonia Gandhi, head, Department of Clinical Nutrition, welcomed the audience. She explained that good nutrition helps prevent problems like eating disorders, obesity, dental cavities and iron-deficiency anemia. Since the way children eat influences, their growth and health during childhood, during adolescence and for the rest of their lives, it’s best to adhere to healthy eating habits right from the beginning; and parents have a major role to play in accomplishing this.During the week, a ‘Health Food Exhibition’ was organised in the premises of the hospital. Patients and their attendants and members of the hospital staff availed the opportunity of learning more about healthy food products and neutraceuticals. <<TRUE_LABEL>> healthy living <</EXAMPLE>> <<EXAMPLE>> Marie Antoinette . After a two-day trial begun on 14 October 1793 , Marie Antoinette was convicted by the Revolutionary Tribunal of high treason and executed by guillotine on the Place de la Révolution on 16 October 1793 . <<TRUE_LABEL>> Marie Antoinette died in 1793. <</EXAMPLE>> | [
"The text is unenthusiastic about a house transformation, expressing doubts about the blog's DIY abilities."
] | [] |
and i went the next morning to Arlington and they gave it to me for that price and what's so funny is they took the car they i knew they were gonna pull it from Town North because that's where the white one was and they had already told me we located one at Town North so it was that same car <<EXAMPLE>> went and took the car because i told him there's a place in Arlington that's gonna give it to me for that price he said no they're not and the next day they <<TRUE_LABEL>> He told me the place in Arlington would not offer me that price. <</EXAMPLE>> <<EXAMPLE>> that they required you to do and i took it to Town North and sure enough i saw that guy and he recognized me he said he said oh hi Dana and he kind of looked down and saw that car and i'm and i'm sure he probably knew what was going on the very next day of course when when the place in Arlington <<TRUE_LABEL>> I went to Town North and when I saw that guy he remembered me and greeted me by name. <</EXAMPLE>> <<EXAMPLE>> but i i guess i got a pretty good deal because i went back to the Town North Mazda right off central and offered them the same price as what i knew i was gonna be able to get it for in Arlington <<TRUE_LABEL>> I know I got a good deal, I went back to the Town North Mazda and offered the same price I knew I was certain to get from Arlington <</EXAMPLE>> | [
"I went the following morning to Arlington, but they had increased the price.",
"I went there the following day to Arlington, and got it for that price."
] | [
"I went there the following day to Arlington, and got it for that price."
] |
574 ft
Distance
7 ft
Climb
-6 ft
Descent
00:00:25
Avg time
Sun Belt Sun Belt mountain bike trail
- Altitude change0 ft
- Altitude min337 ft
- Altitude max344 ft
- Altitude start341 ft
- Altitude end341 ft
- Grade0.034%
- Grade max-4.238%
- Grade min4.963%
- Distance climb153 ft
- Distance down247 ft
- Distance flat175 ft
- Avg time00:00:25
- view trail stats
Trail Conditions
- Unknown
- Snow Packed
- Snow Covered
- Freeze/thaw Cycle
- Icy
- Prevalent Mud
- Wet
- Variable
- Dry
- Very Dry
Directions to sun-belt trailhead (47.486480, -122.557881)
update trails status or condition
Sun Belt Trail Reports
view all reports »
Photos
no photos have been added for Sun Belt yet, add a photo.
Reviews / Comments
No reviews yet, be the first to write a review or ask a question.
Use trail reports to comment on trail conditions.
Videos
no videos have been added for Sun Belt yet, add a video.
Nearby Trails
- embed Sun Belt trail on your website
Open trail in mobile app <<EXAMPLE>> 1 miles
Distance
169 ft
Climb
-181 ft
Descent
00:10:41
Avg time
Ridge Details
- Riding areaPeninsula Ridge mountain bike trail
- Altitude change-12 ft
- Altitude min1,863 ft
- Altitude max1,973 ft
- Altitude start1,916 ft
- Altitude end1,904 ft
- Grade max-38.198%
- Grade min23.583%
- Distance climb2,827 ft
- Distance down3,493 ft
- Distance flat345 ft
- Avg time00:10:41
- view trail stats
Trail Conditions
- Unknown
- Snow Packed
- Snow Covered
- Freeze/thaw Cycle
- Icy
- Prevalent Mud
- Wet
- Variable
- Dry
- Very Dry
Directions to ridge-17035 trailhead (44.307170, -73.989620)
- purple trail 3 miles
- embed Ridge trail on your website
- By kramerica77 BETA & contributors
- #17035 - 298 views
Open trail in mobile app <<FALSE_LABEL>> The text describes an uphill mountain bike trail. <</EXAMPLE>> | [
"wildlife encounter accounts",
"hiking gear recommendations",
"trail elevation statistics",
"trail difficulty ratings",
"hiking/biking trail details",
"user-generated content promotion"
] | [
"hiking/biking trail details",
"trail elevation statistics",
"user-generated content promotion"
] |
Separate names with a comma.
[IMG]
[MEDIA]
so @Shane we are you going to release this info so we can make one
anyone got about 5 mill i can brow :)
Buying the Britain Galleon scroll paying 50k
that one i have to look at
welcome back :)
hahahaha yes i ran in to them some time back there not to bad when you talking to them
I like to Know who is all out Sea and what Guilds . there is so much to do and so much Fun. I have been seen a Decrease on Gild out at sea. I know...
Nice
I pick this up the outer day and Blessed it i like to know what it worth
[IMG]
very nice
and Deco my house is ageless
TY :) will give it a good home
850
600k
i did not do it the outer god did | [
"virtual goods trading",
"online gaming",
"gaming equipment",
"social interactions",
"in-game narrative"
] | [
"social interactions",
"online gaming",
"virtual goods trading"
] |
Fred Vargas. *** An Uncertain Place (Commissaire Adamsberg #8) by Fred Vargas Commissaire Adamsberg leaves Paris for a three-day conference in London. Accompanying him are Estalere, a young Sargeant, baroque' riveting new novel, Commissaire Adamsberg finds himself in the line of fire as never before. Genre: Mystery Download EPUB, MOBI Trích: Vui lòng đăng nhập hoặc đăng ký để xem link Nguồn: Russie (TVE) <<EXAMPLE>> A New York book editor hopes to find a lost manuscript that will rock the publishing world. But the real challenge is the cowboy who's guiding her to it. Un jour de septembre 1759, Robinson, seul survivant du naufrage de La Virginie, échoue sur l'île de Speranza et s'en déclare gouverneur. Aussi, quand il rencontre l'Indien Vendredi, le tient-il naturellement pour son esclave. Mais, finalement, les rôles s'inversent : Robinson a beaucoup à apprendre de Vendredi... "Ce n'est plus Robinson qui apprend la civilisation à Vendredi, c'est Vendredi qui apprend la vie sauvage à Robinson", explique Michel Tournier, signant là l'une de ses plus belles histoires. <<TRUE_LABEL>> books and literature <</EXAMPLE>> <<EXAMPLE>> Luis Hernandez is a Mexican artist who participated in a recent border art festival in San Diego and Tijuana called inSite. Last week when flying home from Colorado he was stopped in the airport, searched, and ended up being deported to Mexico and barred from returning for 5 years. A message from him with many details, including a dialog with an FBI agent, is on the blog of fellow artist Ricardo Domiguez.
Absolutely crazy. Make a video game about border tunnels, get deported? This cannot be allowed.Posted by steev at Diciembre 6, 2005 09:23 PM <<TRUE_LABEL>> This text reports the story of a Mexican artist who was deported after being stopped in the airport. <</EXAMPLE>> <<EXAMPLE>> AUTHOR: ROGER-MILES, Leon
TITLE: Comment Discerner les Styles du VIIe au XIXe Siecle Etudes Pratiques sur les Formes et les Decors Propres a en Determiner les Caracteres.
PUBLISHER: Paris: Edouard Rouveyer, n.d. (c.1890's).
DESCRIPTION: RUDOLPH VALENTINO'S COPY. 1 vol., 11-1/4" x 8", limited to 50 numbered copies on Japan this being copy #23, with 900 illustrations engraved by J. Mauge. Bound in full olive green morocco, ribbed gilt decorated spine, covers ruled and paneled with an arabesque design, gilt dentelles, top edge gilt, others uncut, by Tallibart, with the personal bookplate of Rudolph Valentino designed by William Cameron Menzies on the front pastedown.
CONDITION: Hinges fine, head and foot of spine fine, spine uniformly sunned, overall VERY GOOD.
ADDITIONAL INFORMATION: There were 349 lots of books, mostly single volumes, sold at the sale of Valentino's estate. <<TRUE_LABEL>> 19th century art history <<TRUE_LABEL>> Book condition and binding <<TRUE_LABEL>> Rudolph Valentino's book collection <<TRUE_LABEL>> Limited edition book <</EXAMPLE>> | [
"This text promotes a mystery novel by Fred Vargas.",
"This text is about a non-fiction book on travel to London.",
"The text includes a reference to a young sergeant named Estalere.",
"This text mentions Commissaire Adamsberg's trip to London.",
"The text focuses on the young sergeant Estalere's experience... | [
"The text includes a reference to a young sergeant named Estalere.",
"This text promotes a mystery novel by Fred Vargas.",
"This text mentions Commissaire Adamsberg's trip to London."
] |
add a dose of aggressiveness to the overall design. Hiding behind the fairing of the CBR500RR is a 471cc parallel twin DOHC 4-valve motor that is expected to have the refinement that Honda is renowned for. Power output stands at 47.6PS at 8,500rpm and 43Nm of peak torque at 7,000rpm. 6) Hero Leap electric scooter Hero MotoCorp will not restrict its scooter offerings to internal combustion engines as it plans to launch the Leap hybrid scooter that was showcased as a concept at the 2012 Auto Expo. The Leap is a serial hybrid scooter with an 8KW electric motor and 124cc petrol mill. It has a small 3-litre fuel tank and a range of 340km hinting that it will be highly efficient. It weighs in at 140kg, heavy for a scooter of its size. This is mainly due to the large lithium-ion battery powering it, though in its latest guise the scooter could be lighter. It will get a 240mm disc up front and a drum brake for the rear wheel. ET Bureau Published On Jan 14, 2016 at 08:49 AM IST Telegram Facebook Copy Link Be the first one to comment. Comment Now COMMENTS Comment Now Read Comment (1) All Comments Post Post Find this Comment Offensive? Choose your reason below and click on the submit button. This will alert our moderators to take actions REASONS FOR REPORTING Foul Language Defamatory Inciting hatred against a certain community Out of Context / Spam Others Report Join the community of 2M+ industry professionals Subscribe to our newsletter to get latest insights & analysis. Download ETAuto App Get Realtime updates Save your favourite articles Scan to download App BMW Honda leap Apache Hero MotoCorp Ltd Hero MotoCorp Maruti Suzuki India Limited 200 Hero Leap Auto Expo 2016 TVS Apache 200 BMW India Private limited TVS Motor Company Limited HomeNews2016 Auto Expo: Top six most anticipated two-wheelers | [
"video gaming",
"news and politics",
"technology and computing",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"automotives"
] |
It's here. The day Sonam Kapoor walks the red carpet of Cannes has arrived. The younger L'Oreal ambassador, who is all set to take over the red carpet alongside senior ambassador Aishwarya Rai, has arrived in the city of Cannes. Sonam Kapoor shared with us the first glimpse of her getting ready for Cannes, which involves mani-pedis, make-ups, Anamika Khanna and Rimzim Dadu outfits and Namrata Soni.Here are the first photos of Sonam Kapoor getting ready for Cannes Film festival. She will be walking the red carpet for the screening of the film 'Mal de Pierres (From the Land of the Moon)'Cannes is here, but first let me do the manisSonam Kapoor is all set for CannesNamrata Soni working her magic on SonamSonam Kapoor's B-teamSonam Kapoor in Anamika KhannaSonam Kapoor flaunts her finished lookSonam Kapoor arrives at the airport (Image source: L'Oreal, Namrata Soni, Instagram) | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"food and drinks",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"style and fashion"
] |
Married men always had mistresses - now women are keeping 'misters', and it's helping at least one of them save her marriage...Jilly has a great relationship with her two grown-up daughters - their friends consider her a fun, sexy mum. The girls often borrow their mother's enviable collection of rainbow-coloured three-ply cashmere. Jilly was always a fantastic dancer and at 54 she continues to be. "My youngest daughter got a bit cross with me at her 21st because I was dancing a little too much with one of her male friends. She came over and said, 'Enough! That's my mum!'" Their father has worked hard for the lifestyle the family continues to enjoy, but he is, says Jilly, typically English and remote. Their home has that new carpet and beeswax smell of wall-to wall-comfort, and then there's the second home in the Alps that holds many shared memories for the family. And a few other memories aside for Jilly, who has, on discreet occasions, taken her lovers to the family's holiday home. "That was a mistake. The lovers' ghosts are everywhere when you go back with the family." We discuss the rules of keeping a male mistress, more precisely, a "mister", in her SUV during shopping expedition in a smart provincial town. It starts snowing, the engine runs, the heated seats warm the rear of her expensive jeans. She's tall, dark and good-looking, as much through gym sweat and impeccable grooming as genetic good fortune. She's friendly, sweet almost, and buzzing with positive energy. When she talks about a series of intensely physical and largely unemotional relationships with men, she makes it sound demure and ladylike. Even when she is saying something like, "My lovers have to be good-looking and fit. You know, intelligent and fun to be with, and very good at oral sex." Jilly has echoes of Vera Farmiga's character, Alex, in the new George Clooney film Up In The Air. The sexually assured executive aces the similarly no-stringsplease Clooney character with the line: "Just think of me as you, but with a vagina." When he falls in love with her, it is only to discover she is married with kids. Farmiga says she loved the Alex character because, "when a female character is so demanding and sexually unapologetic, she usually lacks some dignity. It was cool to see someone who was completely self-possessed, had class, had depth and yet was operating in a very masculine way". Jilly does not see herself as acting in a very masculine way - rather, as creating the best possible situation to preserve her happiness as an individual, and as part of a well-enough-functioning family unit. "I have a comfortable life, I have a kind husband and lovely children. Why would I hurt them? My husband's a difficult man, but I am happy. We share our long-standing in jokes and rows, we are great friends. Every other word bar love describes our marriage." Sex with her husband is both rare and unexciting, | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"food and drinks",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"hobbies and interests"
] |
Actual rating will vary with options, driving conditions, habits and vehicle condition.
The standard features of the Dodge Avenger SXT include 2.4L I-4 173HP engine, 4-speed automatic transmission with overdrive, 4-wheel anti-lock brakes (ABS), side seat mounted airbags, curtain 1st and 2nd row overhead airbags, air conditioning, 16" steel wheels, cruise control, power mirrors, power windows, and power locks.
*! | [
"Dodge Avenger SXT model",
"engine performance ratings",
"vehicle features",
"fuel efficiency",
"used car market",
"driving habits",
"car specifications"
] | [
"Dodge Avenger SXT model",
"car specifications",
"vehicle features"
] |
The “vast majority” of the Law Commission’s 43 recommendations on charity law reform have been accepted by government.
This includes a recommendation for a periodical review all financial thresholds in the Charities Act 2011 with a view to increasing them in line with inflation.
However, government will not accept six recommendations, including around charities’ rights of appeal; and allowing charities to ask the court for authorisation to pursue charity proceedings under the Charities Act 2011 if asking the Charity Commission for authorisation involves a conflict issue.
The recommendations were set out in the Commission’s report from 2017 on technical issues in charity law.
The Law Society of England and Wales welcomed the news that government is to accept most of the recommendations.
Law Society president I. Stephanie Boyce said: “We are pleased the government will implement the vast majority of the 43 recommendations… which will maximise the efficient use of charitable funds and ensure the public has appropriate safeguards.”
She noted how tough it has been for charities during the covid-19 pandemic, “especially for small and unincorporated ones, which have had to continue operating despite a very challenging economic environment”.
“We welcome the government’s plans to move ahead with these reforms to charity law, which will save time, costs and provide clarity around the more complex areas of the law”, added Boyce.
“The changes will provide a more user-friendly environment for all charities, whatever their legal structure. However, what is still needed is greater clarity on issues relating to non-charities.”
It is not known when the recommendations will be implemented. <<EXAMPLE>> Published: Saturday February 27, 2016
‘Trustees have a legal duty and responsibility under charity law to protect the funds and other property of their charity so that it can be applied for its intended beneficiaries.
They must also comply with the general law (and overseas law where applicable) including in relation to the prevention of fraud, money laundering and terrorist financing. Fraud will flourish in an environment of weak governance and poor financial management. So this means that the protection of charity funds begins with having robust financial control systems within a framework of strong and effective governance.’
So says the Charities Commission and we at CFIL totally concur. The consequence of failing to acknowledge the risks charities face can (and has) have dire consequences. Those involved in the systematic attacks on businesses know that the 3rd sector is fertile ground for two main reasons. Firstly, in general, charity work attracts good people- trusting and committed individuals who may be unintentionally blind to the dangers individuals with far less scruples may present. Secondly charities exist to give not profit and so costs are kept to a minimum meaning that expenditure on counter fraud systems generally are not as robust as those in the financial and corporate sectors.
The Fraud Advisory Panel have just published an informative report for the 3rd sector. Tackling-fraud-in-the-charity-sector-conference-summary-February-2016
CFIL have experience in the issues that face 3rd sector organisation and are able to provide briefings and educational opportunities which translate directly to the workplace. Contact us for more information. <<TRUE_LABEL>> This text warns of fraud in charities due to weak governance <<TRUE_LABEL>> This text promotes CFIL services for charity fraud prevention <<TRUE_LABEL>> This text discusses charity fund protection law <</EXAMPLE>> <<EXAMPLE>> Foo Fighters . Over the course of the band 's career , four of its albums have won Grammy Awards for Best Rock Album . In Your Honor is the fifth studio album by American rock band Foo Fighters , released on June 14 , 2005 by RCA Records . One by One is the fourth studio album by American rock band Foo Fighters , released on October 22 , 2002 by RCA . <<TRUE_LABEL>> Foo Fighters is a band. <</EXAMPLE>> <<EXAMPLE>> To avoid that, for this recommendation we would have to say something like, Problematic alcohol-use screening instruments under consideration for use in the ED should be evaluated as a component of protocols that provide alcohol-use interventions for patients to decrease problems or use. <<TRUE_LABEL>> We need to word our recommendation carefully in order to avoid that. <</EXAMPLE>> | [
"The Law Commission's 2017 report on charity law reform, which includes a proposal for regular review of financial thresholds, has received support from the government, with the exception of six recommendations.",
"The Law Commission's 2017 report on charity law reform, which includes a proposal for regular revie... | [
"The Law Commission's 2017 report on charity law reform, which includes a proposal for regular review of financial thresholds, has received support from the government, with the exception of six recommendations."
] |
The Lynchburg Region is a great place to live and work: all of the amenities of a city coupled with rural beauty at an affordable cost. Rich in history and culture, our region is one you’ll be proud to call home.
The Lynchburg Region offers an attractive quality of place with numerous cultural and recreational advantages. LEARN MORE
The Lynchburg Region boasts an appealing quality school system and numerous institutions of higher learning. LEARN MORE
The Lynchburg region boasts a cost of living below the national average with housing options to suit every taste and budget. LEARN MORE
Learn more about the excellent healthcare system in the Lynchburg Region. LEARN MORE
Read more about mesmerizing recreational amenities available to residents of the Lynchburg Region. LEARN MORE
Rich in history, the Lynchburg Region offers many cultural amenities, including Appomattox Courthouse National Historical Park. LEARN MORE
The Lynchburg Region boasts inviting shopping and dining opportunities for every style and palate. LEARN MORE <<EXAMPLE>> New here? You can subscribe to our blog via RSS feed and email. Thanks for visiting!
By Web Team | Categories: Multimedia, Partners
New here? You can subscribe to our blog via RSS feed and email. Thanks for visiting!
Compassion International Blogcast
I opened the blog and saw this blog title and giggled. Not to say this isn’t a serious problem but thanks for the double-take this morning!
Will Compassion be setting up a clean-water fund for its partnership with H.W.? Any literature forthcoming?
Vicki,
We won’t be setting up a Complementary Intervention fund specifically to benefit Healing Waters, but we are working on creating a fund that with a clean water component to it.
Thank you for the information on this ministry…I think it’s very cool that you are promoting another ministry…another opportunity for us to get involved in the fight against poverty.
Yes it is amazing to see how many people do not have clean water!!!
wonderful stuff–I am enjoying Compassion’s root growth. <<TRUE_LABEL>> This text is about a blog that promotes a ministry partnership for clean water initiatives. <<FALSE_LABEL>> This text is about a blog that establishes a new fund for a specific water charity. <</EXAMPLE>> <<EXAMPLE>> Take a trip with us to Bergen Place. We’ve got a great video tour to show you of this great neighborhood.
Looking to sell your home? Click here to use our free home evaluation tool.
Looking to buy a home? Click here to search all houses on the local MLS.
We’re back again with another video tour of a great neighborhood in the area. This time we are heading to Bergen Place, located in beautiful North Augusta, South Carolina.
Since 1993, Bergen Place has been a family friendly neighborhood built on the philosophy of improving home values through great amenities, frequent social events, and a commitment to preserve the community.
“
Bergen Place is a great place to live.
”
With nearly 200 homes, Bergen Place is a great place to live. The pool area has picnic tables and grills for larger or smaller events. Just outside the pool area is a playground with a jungle gym, swings, and a basketball court. Beneath the shaded trees, there are benches near the playground which are a great place to supervise the kids from.
Bergen Place is adjacent to the North Augusta Greeneway as well. It provides miles of paved recreational trails that extend from the river golf course all the way to Bergen Place. Whether you’re having a picnic, shooting hoops, or swimming, Bergen Place is a great place for family and friends to get together.
If you have any questions for us or if we can help you buy or sell your next home, give us a call or send us an email. We look forward to hearing from you. <<TRUE_LABEL>> This text invites reader contact. <<TRUE_LABEL>> This text promotes Bergen Place living. <<TRUE_LABEL>> This text describes Bergen Place amenities. <<FALSE_LABEL>> This text criticizes Bergen Place features. <<FALSE_LABEL>> This text expresses neutrality towards Bergen Place. <<FALSE_LABEL>> This text ignores reader communication options. <</EXAMPLE>> <<EXAMPLE>> Testimonials
If you'd like to share some kind words and smiles, please ask our front desk staff for a comment card at your next appointment. We'd love to hear about your experience!
"I hate going to the dentist. I don't like the sounds, I don't like the lecture about flossing, I just plain don't like going. However, this was probably the best dental visit I've ever had!
Everyone was SUPER nice and accommodating. They showed me around the office and introduced me to the staff. I sat down and they asked me about previous dental visits and what I did and didn't like about them. They wrote stuff down and made sure my visit was as comfortable as possible.
My teeth are cleaned and my gums don't hurt. I've got to go back for some additional work, but I feel a lot better knowing I'm in good hands."
-Tony B.
"I've been coming to Dr Travis' office for almost four years. Friendly staff, great service and I always feel well taken care of. Highly recommend them!!"
-Kevin H.
"The office staff is warm and friendly. My insurance issues were solved with ease for me by the office manager Jen. My teeth cleaning was pain free. I will definetely be back to this office for my future dental needs."
-Sandra S. <<TRUE_LABEL>> This text contains detailed descriptions of personal experiences. <<TRUE_LABEL>> The text includes quotes from satisfied patients. <<TRUE_LABEL>> This text includes positive reviews of dental services. <</EXAMPLE>> | [
"Education and healthcare system",
"Affordable cost of living",
"Lynchburg Region's economic growth",
"Lynchburg Region's tourism",
"Urban living in Lynchburg",
"Lynchburg Region's quality of life"
] | [
"Affordable cost of living",
"Lynchburg Region's quality of life",
"Education and healthcare system"
] |
You have searched for Brujeria.
- Media Mantra 2018 ends with a riot of band performances
School of Journalism and Mass Communication, DAVV Indore, celebrated its Cultural Fest 'Media Mantra' from 1st to 5th of April which in true sense saw students actively participating in a series of events to showcase their talent. The fest began with a marathon, spreading the message of being fit and then saw a series of cultural performaces and sports activities. The students actively particpated in events like dancing, singing, skit, add-mad show, quiz competition and sports activities including table tennis, volley ball, cricket, basketball, chess, lawn tennis, carom, tug-of-war and football. From Nukkad Natak to Classical and contemporary dance the students gave meaningful social messages to the society through the fest. Students showcased their talents with flute play, solo and group singing, poem recitation, and art performance. The last day of Media Mantra 2018 saw a riot of rock band performances and concluded on a fashionable note with a fashion show where the students walked the ramp in tradtional attire showcasing great elan. The fest ended with a DJ night and gala dinner where the alumni and faculties joined the students to raise a toast to the success of the fest. Picture Credits: Arpit Joshi
-. <<EXAMPLE>> The following Matlab project contains the source code and Matlab examples used for minn(x) returns the overall minimum value of matrix x . MINN(x) returns the overall minimum value of matrix x (See also: MIN(x)) The only point of this function is to save two key strokes: minn(x) == min(x(:)) If you use Matlab often and you value your time, then this function may appeal to you.
The source code and files included in this project are listed in the project files section, please make sure whether the listed source code meet your needs there. <<TRUE_LABEL>> This text is about a Matlab project that aims to save time by providing a function to find the minimum value in a matrix. <</EXAMPLE>> <<EXAMPLE>> However, while it's easy to lament to the failings of our sports fandoms in 2014, there's no denying that there was also a lot of good to come from the past year. 2014 in Sports: 6 Takeaways From the Complicated Year That Was When Kobe Bryant talks, we listen. That's what five NBA titles and a league MVP gets you. As a result, it became national news when the 36-year-old Bryant was caught on camera going after his teammates for a lackluster effort during practice. "Soft," he called them. Kobe Bryant Has Every Right To Be Upset With Laker Teammates <<TRUE_LABEL>> sports <<FALSE_LABEL>> pharmaceuticals, conditions, and symptoms <<FALSE_LABEL>> personal finance <<FALSE_LABEL>> academic interests <<FALSE_LABEL>> hobbies and interests <<FALSE_LABEL>> video gaming <<FALSE_LABEL>> news and politics <<FALSE_LABEL>> family and relationships <<FALSE_LABEL>> technology and computing <<FALSE_LABEL>> pets <<FALSE_LABEL>> automotives <<FALSE_LABEL>> healthy living <<FALSE_LABEL>> television <<FALSE_LABEL>> style and fashion <<FALSE_LABEL>> shopping <<FALSE_LABEL>> music and audio <<FALSE_LABEL>> home and garden <<FALSE_LABEL>> food and drinks <<FALSE_LABEL>> movies <<FALSE_LABEL>> arts and culture <<FALSE_LABEL>> real estate <<FALSE_LABEL>> travel <<FALSE_LABEL>> books and literature <<FALSE_LABEL>> health <<FALSE_LABEL>> careers <<FALSE_LABEL>> business and finance <</EXAMPLE>> | [
"Student performances",
"Music album release",
"Celebration closure",
"Alumni reunion",
"Cultural Fest activities"
] | [
"Student performances",
"Cultural Fest activities",
"Celebration closure"
] |
The second trailer of Akshay Kumar's 'Jolly LLB 2' sees the beloved character turn a shade darker as he gears up to fight against the corrupt and powerful. After giving fans a peek into Jolly's happy-go-lucky side, the new trailer sees the angry young lawyer taking up the lone fight for justice. The film that is allegedly based on true events that have taken place in the country, sees Akshay's character raising questions about the judiciary system and the innumerable lagging cases. Montages of violent clashes, powerful monologues, along with interesting court battles topped with humour and great visuals, promises that the film will be a great watch when it hits screens on February 10, 2017. Jolly LL.B 2 | New Trailer | Akshay Kumar | Huma Qureshi | Subhash KapoorThe second instalment of the hit franchise has been directed by Subhash Kapoor and stars Huma Qureshi, Annu Kapoor, Manav Kaul and Saurabh Shukla in pivotal roles. | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"movies"
] |
His technique is based on standing back--maintaining a fixed distance--while his subjects hang themselves, and for a while that works stunningly. <<EXAMPLE>> been featured in Comedy Store's Best of Stand Up nights for three years his comedy veteran has, at times, done nine shows in one weekend. He T says it takes discipline to stay energetic for a show and this builds over time. “You have to note that whenever we travel for shows we always get put up in good hotels, so we're well rested before shows. And if you have a good show it keeps your energy going,“ he says. While he's “chilled out“ when he's performing in Bengaluru, and will even have a few beers before going on stage, he avoids drinking while travelling given that he has to do multiple shows in a day. While he finds it hard to sleep right after a show, he refrains from going to after-parties so that he doesn't unnecessarily exert himself. “If I'm doing an hour-long show, I need to stay energetic. For that, I have a good meal at least two hours before I go up to perform. That way I don't feel drowsy on stage.“UTSAV CHAKRABORTY (24) His Twitter handle is Satan Bhagat and has over 30,000 followers, and he has collaborated with other city comics for the show The Comment Section which has had sold-out shows he comic, who abstains from alcohol entirely, says that travelT ling itself has him thrilled and excited. “Unless you're travelling by bus and spending hours commuting. The fact that you're in a new city and are put up in a 4-star hotel with the best of food, you will naturally feel upbeat.“ A non-smoker, Chakraborty ensures he drinks a lot of water (a glass or two before a show) and even carries a bottle of water with him when he goes up on stage). “If you're performing for an hour, your mouth is bound to go dry from talking.“ He also recommends honey with hot water that can help keep the throat clear before a performance in case of any infection or hoarseness. <<TRUE_LABEL>> food and drinks <</EXAMPLE>> <<EXAMPLE>> If you think there’s no reason to reassess your mortgage until its term is nearly up, you could be cheating yourself out of thousands of dollars.
What would you do with the money if you could save thousands? Would you invest it? Would you make a purchase you’ve been delaying? Would you contribute to your child’s education fund? Wouldn’t it be better if that money was yours, rather than lost in interest?
While there may be a fee for refinancing your mortgage early, the savings you could stand to make from taking on a new mortgage with lower interest rates could be worth it. That’s why it’s important to reassess your mortgage at least once a year. That way you can make sure that your investment is always working in your favour.
To Save or Not to Save? Know the Numbers When Refinance
Correctly calculating the total costs and comparing the two scenarios can be complicated, but we have the technical expertise to help you make the right assessment. And if you do decide to refinance your mortgage, we are here to help you do it successfully.
We can help you refinance your mortgage if you’re doing it to:
- Buy investments;
- Purchase an investment property;
- Finance education;
- Finance renovations;
- Consolidate your debt;
- And any other reason you might have for refinancing!
Find Out If You Could Get A Better Mortgage Now
Finding out whether you could get a better mortgage right now is as easy as getting in touch with us. Contact us and we’ll help you establish your options and assess what would work best for your situation. <<TRUE_LABEL>> This text offers help in refinancing and assessing options <<TRUE_LABEL>> This text promotes mortgage refinancing benefits <<TRUE_LABEL>> This text suggests assessing mortgage annually for savings <<FALSE_LABEL>> This text implies refinancing has no associated fees <<FALSE_LABEL>> This text suggests mortgage refinancing is always advantageous <<FALSE_LABEL>> This text discourages keeping the same mortgage <</EXAMPLE>> <<EXAMPLE>> As soon as he's done I am going to Slash from the audio sending and say a thing to Enable you to all know we're off the air. a. To discern and interpret the nature or importance of by close evaluation or sensitive observation: The tracker read the trail for
1 <<TRUE_LABEL>> This text discusses a person's plan to end a broadcast after a task is completed. <</EXAMPLE>> | [
"He jumped in to protect his villagers.",
"He stood back while his subjects get themselves in trouble."
] | [
"He stood back while his subjects get themselves in trouble."
] |
Eastside powers past Wade Hampton
Wed, 09/05/2018 - 08:13 Billy Cannada
The Eagles remain perfect after a nail-biting win over Wade Hampton on the road last Friday.
Quarterback Marshall Skoloff threw for one touchdown and ran for two more, giving Eastside the offensive firepower it needed to secure its third non-region victory of the season. <<EXAMPLE>> The long awaited 21-6A District opener did not go the way Kingwood had hoped against its neighboring rivals Atascocita.
The Eagles had things their way from the outset and went on for a 63-7 victory over the Mustangs on Friday at Turner Stadium.
The Mustangs had two punts blocked in the first quarter and the Eagles took advantage, returning one for a touchdown while rolling up 35 points over the first 12 minutes. They led 56-0 at halftime.
Kingwood quarterback Matt Slayton threw for 75 yards and a touchdown, a 31-yard scoring strike to Matthew Wheatley, who caught two passes for 42 yards. Slayton also rushed for 56 yards.
John McMahon added 35 rushing yards and Blake Herrera caught a 13-yard pass.
Wheatley was also among the defensive standouts, leading the charge with eight tackles. Free safeties Nolan Powell and Aaron Finch combined for another 12 tackles.
The Mustangs mustered 208 total yards, including 133 on the ground. But Kingwood converted just five of 17 third-down opportunities and turned the ball over once.
Atascocita played error-free football and totaled just under 400 yards of offense.
The Mustangs fell to 0-3 for the season but will try to turn things around when they travel to Stallworth Stadium in Baytown for a 7 p.m.Thursday District 21-6A game with Goose Creek Memorial. <<TRUE_LABEL>> This text describes a lopsided football game. <<TRUE_LABEL>> This text reveals team records and upcoming schedules. <<TRUE_LABEL>> This text includes player statistics and defensive plays. <</EXAMPLE>> <<EXAMPLE>> Marseilles Brown added 14 points for the Pirates (2-0), which trailed 38-33 at halftime.
C.J. Grantham had 21 points and eight assists for the Eagles (0-1). Dante Darling and Melvin Hicks added 12 points apiece.
Cold-shooting troubled both teams, with Hampton hitting just 26-of-62 from the floor, three of 16 from 3-point range and 18 of 35 from the free-throw line.
Eastern made 26 of its 59 shots - just six of 17 from beyond the arc - while converting just 13 of their 29 free-throw tries.
Tyson Radney grabbed a game-high 14 rebounds for Eastern Michigan. <<FALSE_LABEL>> This text highlights the individual performances of the players on the winning team. <</EXAMPLE>> | [
"The Eagles dominated the football game against Wade Hampton.",
"The Eagles won the football game against Wade Hampton."
] | [
"The Eagles won the football game against Wade Hampton."
] |
I AM ENGLISH I AM! I DO NOT WANT TO GET BLOCKED AGAIN, FU@K!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! | [
"obscene",
"toxic",
"severe toxic",
"threat",
"non toxic",
"identity hate",
"insult"
] | [
"obscene",
"toxic"
] |
CHENNAI: On nights that are party time for most people. Jennifer Jacob has decided to Thank God It’s Friday by throwing open her home and heart to anyone who is game for a homely meal, laughter and fun.“Anybody who wants a change from their daily routine and is up for a few giggles and a nice meal can drop into my home on a Friday evening,” says Jennifer, who plans to launch her ‘Friday Friends’ programme this week.It was a video she viewed on social media that inspired her. “It was about a woman who had fought her depression. She had just had a nasty divorce, was a single mom and depressed. Though she wanted to overcome it by volunteering, nobody took her up on it,” says Jennifer. “So, the woman, who was living on food stamps, realised that the only thing she could do was cook a great meal on a shoestring budget. She mailed all her friends in the area and told her home was open on a particular day of the week and asked them to join her family for a meal. It helped her fight depression and also helped a lot of other people.”Jennifer was so moved by the idea that she thought of throwing open her own doors to people. “I am not a counsellor, but I can be there if someone wants a listening ear, a few giggles and a nice meal,” says Jennifer, who lives on East Coast Road.So whether you need to talk about your break up, are an elderly parent away from your children or just a friend who lost touch, Jennifer and her family husband Murali Anand, her furkids (dogs) and little humanoid (her three-year-old daughter) is there for you.“I know elderly people whose children are overseas who would probably enjoy the company of a young child and family. We can probably be their family for a meal,” says Jennifer. All you need to do is give her a ring before Thursday so she can grab groceries. “And don’t expect anything fancy. I will serve anything that I cook for my own family,” she says. Being an animal lover, it will be all vegetarian, though she can customise the meal to be completely vegan.The few conditions she does have are simple she can only host a maximum of four people at a time, and her doggies run free. “They are part of our family and very friendly, though they are a little attention-seeking and you may find yourself having to pet them,” she laughs.Though she is planning to kick-start the initiative by reaching out to people she knows, she is not just looking to reconnect with friends. “Anyone is welcome, even if you want to vent about your awful boss,” she says, adding that the conversations will obviously be between just the ‘Friday Friends’!Though she doesn’t know how the initiative will work, she hopes it helps people including herself. “My husband was very happy with the idea though a little | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"pets"
] |
In particular, applying the model demonstrates that the burden of USO is very great for Poste Italiane and other posts with small per capita volumes. <<EXAMPLE>> In particular, applying the model demonstrates that the burden of USO is very great for Poste Italiane and other posts with small per capita volumes. There is no burden on small volumes. <<TRUE_LABEL>> contradiction <<FALSE_LABEL>> neutral <<FALSE_LABEL>> entailment <</EXAMPLE>> <<EXAMPLE>> Considered one of the premier diving sites in the world, it encompasses several different underwater environments in addition to coastal shallows where colorful fish thrive in the warm water. Only one underwater environment exists in this bland, boring, diving spot. <<TRUE_LABEL>> contradiction <</EXAMPLE>> <<EXAMPLE>> We use the term burden of the USO to distinguish our concept from other papers that use the term cost of the USO. <<TRUE_LABEL>> To avoid confusion with the term cost of the USO which is used in other papers, our concept is termed burden of the USO. <</EXAMPLE>> | [
"USO has a great burden for posts with small per capita volumes.",
"The model is accurate."
] | [
"USO has a great burden for posts with small per capita volumes."
] |
MUMBAI: For long, bigger private sector health insurers have been relatively inactive on the innovation front, in contrast to new-age standalone health insurers who have constantly added newer features to differentiate themselves in this space. Now, however, ICICI Lombard has launched a new health product, termed Complete Health Insurance, ostensibly to compete with the newer players. This health policy promises a higher base sum insured of up to Rs 10 lakh, outpatient department (OPD) cover, maternity benefit, new born baby cover, personal accident cover and reimbursement of wellness and preventive care expenses, among other things. Like all new health products, this plan does not impose any upper limit on the renewable age. Add-on covers offered under the policy include critical illness-donor expenses cover, and Hospital daily cash allowance-convalescence benefit. The former pays a fixed lump-sum for treatment of critical illness and reimburses expenses incurred by the organ donor for undergoing any transplant surgery. The second combination offers a pre-defined amount per day of hospitalisation and during the recovery period. Policyholders, however, can avail of these benefits only in the cover pairs specified. In other words, they can't buy say either critical illness benefit or donor expenses cover. This apart, the policy covers nursing expenses at home of up to Rs 3,000 per day. The plan also covers the cost of an immediate family member's economy class air travel (up to Rs 20,000) in case the insured's hospitalisation extends beyond five days. While the product does not come with any sub-limits or co-pay clauses, you will be entitled to discounted premium if you voluntarily opt for sub-limits. You have the choice of opting for a longer tenure of two years instead of renewing it annually. Remember, however, that deduction under section 80D on health premiums will be available only for the year in which the payment is made. Upside: Like other such new-age plans in the market that offer a host of additional benefits, this product, too, can add value to your protection portfolio. Downside: Some plans in the market, including the ones from public sector general insurers, also cover non-allopathic forms of treatment like Ayurveda, Unani and Naturopathy, subject to internal ceilings. This product, however, excludes such alternative therapies. This apart, you need to compare premiums charged by similar products before arriving at a decision. | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"food and drinks",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"personal finance"
] |
Additional Information
SUW Bottom String THE INVISIBLES 2Pack
Double up on barely-there underwear with this twin pack of our popular The Invisibles SUW bottom string. This super-light and comfortable minimalist string panty stays invisible under the tightest fitting active wear. Fast-drying super light fabric provides excellent breathability and moisture wicking performance, while the high elastane content ensures an ultra form-enhancing fit and unlimited freedom to stretch. Meanwhile, flat bonded seams both increase comfort and decrease visibility. Perfect for wearing under running tights, yoga pants, and every other form-fitting garment in your wardrobe.
Recently Viewed Products
Customers Reviews
Review summary
by Inger v
Way too tiny. I want my money back
Review summary
by Lesley H
Very flimsy, kept twisting around my hips.Much larger than I expected and too big, particularly compared to the tight ceramicool pants that were the same size label
Review summary
by Corne V
Good. | [
"outerwear",
"activewear"
] | [
"activewear"
] |
CHANDIGARH: An 18-year-old youth was killed and four others injured after their SUV fell into a ditch near Khuda Lahora in the early hours of Monday. Police said they received a wireless message that there has been an accident on the road between Khuda Lahora and Nayagaon around 1.14 am. The victim has been identified as Diljosh Brar, a resident of Dhimwali village in Faridkot. The injured are Gursewak Singh, Hardeep Singh and Dilshaad, all residents of Balachaur, Mukul Kumar, a resident of Nawanshahr.Police said the SUV occupants claimed that Gursewak, who was driving the vehicle, took a sharp turn after an animal suddenly appeared on the road. He failed to control the SUV which fell into the ditch. All of them were rushed to PGI, where Diljosh was declared brought dead. The others are admitted to Government Multi-specialty Hospital, Sector 16. | [
"video gaming",
"technology and computing",
"news and politics",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"music and audio",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"sports"
] |
no it's um uh it's an older home and uh so it already has the the yard's already been established um but there have like big oak trees in the front and so the grass is not growing out underneath the oak trees so i'm have to get out there and do something about that you know spread some seed and fertilizer and stuff <<EXAMPLE>> and then there's one uh sitting on the right uh facing the house on the right hand side in the middle of that whole section and then i have this whole section over there that has nothing in it at all but just just the grass so that may be an idea to do is uh because i've got that concentration of trees right there is to uh you know just do something like what you said was to put some kind of um uh little plants that does well in shade uh the shaded area and forget about you know trying to plant grass and stuff underneath that <<TRUE_LABEL>> Instead of planting grass under the tree, I could just throw some little plants there. <<FALSE_LABEL>> I know several beautiful flowers that grow well in the shade. <<FALSE_LABEL>> I think I have to plant some grass seeds under all those trees. <</EXAMPLE>> | [
"There is a huge tuft of grass under the oak trees that needs mowing.",
"I have to plant some grass under the oak tree.",
"Oak tree leaves acidify the soil, and grass cannot grow under the trees."
] | [
"I have to plant some grass under the oak tree."
] |
her illustrious father to her near comatose father, acknowledging her love for him. He perhaps had the premonition of his death. Sam would eventually leave all his admirers on June 27, 2008, peacefully in his sleep in his Conoor home - Stavka - in the Nilgiris hills, surrounded by family members and well-wishers. He told an attending doctor few days before his death pointing at a skin rash on his forearm that he will be dead once the rash disappears. Sam not only survived the ordeal but lived on to be 94. His daughters, Sherry and Maja were on their way from Chennai and Delhi. He was gasping for breath and was bedridden and was barely able to open his eye lids. | [
"video gaming",
"news and politics",
"technology and computing",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"home and garden"
] |
Processing Out Youth > GSA Youth Leaders Native American History Month Acquiring Edit Lock Updated on May 4, 2020 Event Comments Related Events More Event Viewing Edit Editing Done Help Text Public View Acquiring Edit Lock is currently editing this page. Sunday, November 1, 2020 8:00 AM - Duration: 30 days 21 8:00 AM International Pronouns Day Sep 10 8:00 AM World Suicide Prevention Day Sep 16 8:00 AM Bisexual Awareness Week Sep 18 8:00 AM HIV/AIDS & Aging Awareness Day See all » MissionBox 7600 Burnet Road, Suite 301 Austin, TX 78757 United States | [
"Youth education programs",
"Mental health resources",
"Youth leadership events",
"Event scheduling",
"Page editing process",
"Diversity and inclusion",
"Political movements"
] | [
"Event scheduling",
"Diversity and inclusion",
"Youth leadership events",
"Page editing process"
] |
BEST PRICES and LOWEST Shipping Rates! Email: mh@ministryhelps.com Phone: 1 (864) 682-5425
List Price: $283.79Your Price: $226.99You Save: $56.80 (20%)
Description: All twenty-one E.W. Kenyon Books at a very special priced package. The total List Price is $283.79. By purchasing this Ultimate E.W. Kenyon Package you save $56.80 off List Price. Your Wholesale price only $226.99.
E.W. E.W. Kenyon calls the believer up and out of the mire of traditional unbelief into the deep, rich treasures of our redemption in Christ. Many lives have been transformed reading his simple, yet profound books.
Package | [
"book package deal",
"inspirational literature",
"high-priced items",
"digital books",
"discounted products",
"individual book sales",
"political literature"
] | [
"book package deal",
"discounted products",
"inspirational literature"
] |
can follow the process given below to download the RRB Group D result:1) Go to the official website of the RRB Board - www.rrbcdg.gov.in or open RRB regional website2) On the homepage, you will find a RRB Group D result link3) Click on the RRB Group D result link and it will redirect to a new webpage4) You need to enter your login credentials here5) After successful login, click on view result6) Your RRB Group D result will be displayed on the screen7) Download the soft copy of the RRB Group D result or take a print out of the same for future useVisit these websites to check the RRB Group D result:1) RRB Guwahati — rrbguwahati.gov.in2) RRB Jammu — rrbjammu.nic.in3) RRB Kolkata — rrbkolkata.gov.in4) RRB Malda — rrbmalda.gov.in5) RRB Mumbai — rrbmumbai.gov.in6) RRB Muzaffarpur — rrbmuzaffarpur.gov.in7) RRB Patna — rrbpatna.gov.in8) RRB Ranchi — rrbranchi.gov.in9) RRB Secunderabad — rrbsecunderabad.nic.in10) RRB Ahmedabad — rrbahmedabad.gov.in11) RRB Ajmer — rrbajmer.gov.in12) RRB Allahabad — rrbald.gov.in13) RRB Bangalore — rrbbnc.gov.in14) RRB Bhopal — rrbbpl.nic.in15) RRB Bhubaneshwar — rrbbbs.gov.in16) RRB Bilaspur — rrbbilaspur.gov.in17) RRB Chandigarh — rrbcdg.gov.in18) RRB Chennai — rrbchennai.gov.in19) RRB Gorakhpur — rrbguwahati.gov.in20) RRB Siliguri — rrbsiliguri.org21) RRB Thiruvananthapuram — rrbthiruvananthapuram.gov.in | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"pets"
] |
The last very good day for both of them was spent at Miss Elwira's, the accountant, name day party. They spent their last very good day apart. | [
"neutral",
"contradiction",
"entailment"
] | [
"contradiction"
] |
She says, according to the Post , the secret is opening your mouth 'really wide' when eating. The Post reported what she said. | [
"neutral",
"contradiction",
"entailment"
] | [
"entailment"
] |
- Accommodations
- Tickets
- Events
- Trip Planning
- Gallery
Sunnybrook Farm Estate Winery
1425 Lakeshore Road
info@sunnybrookwine.com
(905) 468-1122
About
Sunnybrook Farm Estate Winery, founded in 1993 - is recognized as Canada's original fruit winery. The beauty of fruit and wine country inspires us in the making of our wines from 100% locally-grown berries, stone and tree fruit.
Our estate is located on the spectacular southern shores of Lake Ontario at Four Mile Creek. With over 10 acres of peaches, nectarines, cherries, pears, and apple trees, Sunnybrook is a magical, dapple shaded and fragrant estate where sweet scents of our seasonal fruit entice you to stroll and savour our award winning wines produced from these very trees.
The estate was originally a large river delta and our orchards thrive in the deep, fertile and sandy soil. The temperature moderating effect of the Niagara Escarpment is superior for the growing of the tender fruits we use as a showcase for our wines and ciders.
Wine store open year-round. | [
"Wine making",
"Tourism",
"Dairy production",
"Local produce",
"Landscape architecture",
"Vegetable farming"
] | [
"Wine making",
"Local produce"
] |
consumer panel
A consumer panel is a group of individuals selected by a business or organization to provide input and opinion on products and services for research on consumer behavior. Panel members are chosen to be representative of the general population or a target group.. Information gathered may indicate necessary changes to make before a product is released to the wider market. Consumer panels may be used for test marketing, which is a tool used by companies to gauge probable market success or the effectiveness of a marketing campaign.
Research companies and marketing agencies often form consumer panels for independent research or on behalf of their clients, the producers. Individuals on consumer test panels may be chosen for a variety of reasons depending on the particular product. Companies may want to target a specific demographic for detailed insight on purchasing behavior or select a balanced demographic makeup to ensure that more consumers are represented. Specialists may sit on several consumer panels for numerous companies through their agency.
Purchasing behavior is often tracked through the use of consumer panels. For example, Nielsen, a global consumer research agency, tracks this information from 250,000 household consumer panels in 25 different countries. To test purchasing behavior, Neilson gathers data directly from products scanned at checkout in stores. The scanned data is sent directly to Neilson for analysis, providing an unobtrusive means to gather information about shopping behavior.
Unlike focus groups, consumer panels are usually ongoing and can be reconvened quickly for input. This continuous nature allows opinions to be tracked and updated through various changes and efforts by a company. Depending on the product and market environment, a company may decide on either a panel or a focus group.
Start the conversation | [
"sales strategies",
"product development",
"brand management",
"market research",
"advertising campaigns",
"product testing",
"demographics in marketing"
] | [
"product testing",
"market research",
"demographics in marketing"
] |
Having problems with your Bissell?
Answers :
Its probably the motor. remove the covers with a #2 phillips head screwdriver and cut the wires to the motor ( unplugged ). purchase some crimps at radio shack to resplice the wires together in the same fashion.
My mom phoned Bissell and talked to them personally. She was hoping to get a discount on a new vacuum or something. She didn't get anything and was very unhappy with them because the vacuum is only a year and 8 months old and the warranty was for only one year. She bought a new hepa filter for it, a new belt and had to order from Bissell themselves a new roller. She found out that she would only get $12 back for the roller (she paid $35) and now we have to buy a new vacuum or take it in to get serviced and pay $100 probably. So its not worth it. This vacuum was a rip-off. We have to buy a new one.
Repair Help & Product Troubleshooting for Bissell Vacuums
Tips for a great answer:- Provide details, support with references or personal experience .
- If you need clarification, ask it in the comment box .
- It's 100% free, no registration required.
Suggested Questions/Answers : <<EXAMPLE>> Cleopatra is a 1963 American epic historical drama film chronicling the struggles of Cleopatra VII , the young Queen of Egypt , to resist the imperial ambitions of Rome . Elizabeth Taylor . She was next paid a record-breaking $ 1 million to play the title role in the historical epic Cleopatra ( 1963 ) , the most expensive film made up to that point . <<FALSE_LABEL>> Elizabeth Taylor has not been in an American film. <</EXAMPLE>> <<EXAMPLE>> The vacuum was defective when I received it. It had no suction and then wouldn't even turn on. I sent it back to Bissell and they sent me a new one. Nancy J Harris <<TRUE_LABEL>> negative <<FALSE_LABEL>> positive <</EXAMPLE>> | [
"This text recommends fixing the vacuum with a screwdriver.",
"This text indicates the mom received a discount on a new vacuum.",
"The text implies the problem is the vacuum's age, not the motor.",
"This text expresses dissatisfaction with Bissell's customer service.",
"The text suggests a solution: buying ... | [
"This text expresses dissatisfaction with Bissell's customer service.",
"The text suggests a solution: buying a new vacuum.",
"This text discusses a faulty Bissell vacuum cleaner."
] |
mobile video showing him and others assaulting Dhankad, the son of a Delhi Police head constable.Kumar had allegedly asked Prince to make the video to “send a message” across to his rivals. TOI was the first to report that Kumar was clearly seen participating in the murder. Police had seized four vehicles from outside the stadium and a double-barrel gun was recovered from one of them.Dhankad’s autopsy showed he had been brutally thrashed. He had multiple fractures and died due to cerebral damage, which was the result of blunt force impact on his head. Multiple abrasions and bruises were found on his upper limbs, chest and abdomen. | [
"video gaming",
"technology and computing",
"news and politics",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"video gaming"
] |
Identify the purpose of a text, whether it is to inform, entertain, persuade, or inspire. This task helps in understanding the author's intention behind the text. Scene: A fancy restaurant. Character 1: I'll have the lobster, please. Character 2: (pretending to be a waiter) Excellent choice! And for your appetizer, how about a nice plate of shoe leather? Character 1: (laughs) I think I'll pass on that one. <<EXAMPLE>> Identify the purpose of a text, whether it is to inform, entertain, persuade, or inspire. This task helps in understanding the author's intention behind the text. Character 1: I can't believe I ate that whole pizza by myself. Character 2: (sarcastically) Wow, you must be proud. Character 1: (defensively) Hey, I was hungry! Character 2: (laughs) I can tell. <<FALSE_LABEL>> The text provides factual information. <<FALSE_LABEL>> The text motivates or encourages the reader to take action or make changes. <<FALSE_LABEL>> The text tries to convince the reader of a certain viewpoint or action. <<FALSE_LABEL>> The text aims to amuse or delight the reader. <</EXAMPLE>> <<EXAMPLE>> Identify the purpose of a text, whether it is to inform, persuade, entertain, or express. This task helps in understanding the author's intention behind the text. I tried to make a fancy dinner for my friends the other night, but let's just say it didn't go as planned. I accidentally added WAY too much salt to the pasta sauce, and it was basically inedible. We ended up ordering pizza and laughing about it all night. At least we had a good time, right? <<FALSE_LABEL>> The text provides factual information. <<FALSE_LABEL>> The text communicates personal feelings or experiences. <<FALSE_LABEL>> The text tries to convince the reader of a certain viewpoint. <<FALSE_LABEL>> The text aims to amuse or delight the reader. <</EXAMPLE>> | [
"The text tries to convince the reader of a certain viewpoint or action.",
"The text aims to amuse or delight the reader.",
"The text provides factual information.",
"The text motivates or encourages the reader to take action or make changes."
] | [] |
Kate DiCamillo's beloved, best-selling debut novel is now available in a paperback digest edition.Kate DiCamillo's first published novel, like Winn-Dixie himself, immediately proved to be a keeper—a New York Times bestseller, a Newbery Honor winner, the inspiration for a popular film, and most especially, a cherished classic that touches the hearts of readers of all ages. It's now available in a paperback digest format certain to bring this tale's magic to an even wider circle of fans.The summer Opal and her father, the preacher, move to Naomi, Florida, Opal goes into the Winn-Dixie supermarket—and comes out with a dog. A big, ugly, suffering dog with a sterling sense of humor. A dog she dubs Winn-Dixie. Because of Winn-Dixie, the preacher tells Opal ten things about her absent mother, one for each year Opal has been alive. Winn-Dixie is better at making friends than anyone Opal has ever known, and together they meet the local librarian, Miss Franny Block, who once fought off a bear with a copy of WAR AND PEACE. They meet Gloria Dump, who is nearly blind but sees with her heart, and Otis, an ex-con who sets the animals in his pet shop loose after hours, then lulls them with his guitar.Opal spends all that sweet summer collecting stories about her new friends and thinking about her mother. But because of Winn-Dixie or perhaps because she has grown, Opal learns to let go, just a little, and that friendship—and forgiveness—can sneak up on you like a sudden summer storm. | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"music and audio",
"home and garden",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"books and literature"
] |
In this week's "Should I Stay or Should I Go?" an audience member had to decide if they wanted the big prize for themselves or if they wanted to help out the audience.
The big prize was a year's supply of Fabio Viviani wines.
Buy some here:
The other prizes were lunch from Naf Naf Grill and a Big Bus Tour around Chicago.
Should I Stay or Should I Go?
More Videos
TOP STORIES
Show More
More TOP STORIES News | [
"Chicago attractions",
"restaurant reviews",
"audience polling",
"travel itinerary suggestions",
"prize options",
"cooking competitions",
"game show dilemmas",
"Italian wine"
] | [
"Chicago attractions",
"Italian wine",
"game show dilemmas",
"prize options"
] |
Lily James . James began her professional acting career as Ethel Brown in the 2010 BBC production Just William . She began to appear in Hollywood films in 2012 , with roles in Wrath of the Titans and Fast Girls , and was seen in further television roles , including that of Countess Natasha Rostova in the 2016 BBC historical drama series War & Peace . <<EXAMPLE>> uh-huh yeah yeah i enjoy it once in a while but i enjoy relaxing while i eat you can't really do that in these fast food places <<TRUE_LABEL>> You can't really enjoy yourself and relax in those fast food places. <</EXAMPLE>> <<EXAMPLE>> Lily James . She began to appear in Hollywood films in 2012 , with roles in Wrath of the Titans and Fast Girls , and was seen in further television roles , including that of Countess Natasha Rostova in the 2016 BBC historical drama series War & Peace . <<TRUE_LABEL>> Wrath of the Titans is a work that Lily James appeared in. <<TRUE_LABEL>> Lily James appeared in films from Hollywood. <<TRUE_LABEL>> Lily James appeared in a work. <<TRUE_LABEL>> Lily James appeared in films in 2012. <<TRUE_LABEL>> Fast Girls is a work that Lily James appeared in. <<TRUE_LABEL>> Lily James was in a BBC production. <<TRUE_LABEL>> Lily James portrayed Countess Natasha Rostova. <<TRUE_LABEL>> Lily James appeared in War & Peace. <<TRUE_LABEL>> Lily James appeared in Wrath of the Titans. <</EXAMPLE>> | [
"Lily James was on the BBC.",
"Lily James began her professional acting career in space.",
"Lily James appeared on a public service broadcaster.",
"Lily James began her professional acting career in 2010 with Just William on the BBC.",
"Lily James did not begin her professional acting career in 2010."
] | [
"Lily James was on the BBC.",
"Lily James began her professional acting career in 2010 with Just William on the BBC."
] |
Panaji: Congested roads and an unpredictable public transport system makes commuting in Goa a time consuming and tiresome affair. While the common response to purchase a vehicle complicates the scenario, the rising crime graph only serves to antiquate the practice to thumb a ride. That’s why Goan entrepreneur Amit Bandekar suggests using the finger. Bandekar’s dream to make commuting easier and cheaper began in January with a late night chat with his friends, many of whom worked in the Information and Technology sector. Given that most of them reside in Bicholim, the conversation soon veered towards the poor transport options available and the long commute to Verna and other industrial estates. It was then that Bandekar thought of replicating the idea of ridesharing for his friends through an app. A unique peer-to-peer ride-sharing app would allow his friends to share empty seats in their cars with colleagues and other friends, he thought. The decision to design an app came naturally to Bandekar since he already ran Focus Computer Training Centre, a private institute for courses and consultation on cloud computing, Internet of Things (IoT), mobile applications and web applications. “Carpooling can be a means to tackle various issues we face today like air pollution, huge fuel consumption, travel expense and other issues. So our carpool app can make your car-sharing a lot easier,” Bandekar explains.The app allows a person with seats to spare to share his or her route online and connect with a person heading the same way. Those seeking to hitch a ride can also put up their request asking for a ride to a particular destination. The name for the app turned out to be a no-brainer for Bandekar who simply called it Carpool. Designed for Android, the app is available on Google Play for free. “The app is similar to a chat application, where users can communicate with each other before carpooling whereby they can decide upon the cost, the departure time etc. Groups of users can also be created for communicating with multiple users at a time,” Bandekar adds. Bandekar headed a team that included developers Madhura Sawaikar and Anusha Haldankar, marketing executive Gaurish Chari and Malini Bandekar. While the app is offered free, the firm will earn revenue from in-app advertisements. For any ride-sharing initiative to be successful, trust becomes a focal point. “Administrators can add members to their group only from the list of contacts who have Carpool App installed on their mobile phones. Authentication and verification happens with secured online database,” Bandekar reassures. | [
"video gaming",
"news and politics",
"family and relationships",
"technology and computing",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"technology and computing"
] |
‘White skin’ gets more alluring as city gals fall for Caucasian men...Caucasian men are winning over Bangalore’s beauties. More and more young women in the city are dating and marrying Caucasian men and Frenchmen seem to be a particular favourite. Case in point is Sunayana Ganguly, the daughter of Kalyan Ganguly, MD of a Bangalore-based multi-national company, married a Frenchman recently, in a quiet ceremony that included only family and close friends. Pallavi Gopinath, daughter of airline tycoon Capt. Gopinath, also married a Frenchman, Damien Eprinchard in a low-key ceremony in the city recently. Our very own Sandalwood sizzler Ramya, is currently dating Portuguese entrepreneur Rafael, and is very open about their relationship. The same seems to be the case with quite a few other young women in the city who are dating white men. How is it that more and more Caucasian men are landing Indian women? Is it the novelty of it all? Or, is it just love?Entrepreneur Payal Shah, who is married to an Irishman, says, “I knew my husband even before we began dating. We dated for three years before we got married four years ago,” says Payal. And how different is her husband from anybody here? Payal replies, “Western men are more open. Indian men can get very picky about the gender roles in the Indian milieu and often expect their wives and girlfriends to toe the line.” Diana Paz (named changed), a college graduate, has dated two Frenchmen. They were very different experiences for her. “The first one was awesome and had no airs about him. He honestly thought India was an amazing place to live in –- in fact much better than Paris. He’s gone back there now, but we’ve remained friends and keep in touch,” explains Diana. Her second innings with another Frenchman wasn't so good. “He thought Indians were uneducated, barbaric and poor. He tried not to show it, but it came through in the end and that was it for me," she says. Relationship counsellor, Ian Faria says western men fall for Indian women because they are pretty. “But that apart, Indian women do look up to white skin and men. Caucasian men like that. Plus, Western men understand gender equality far better. They respect a woman’s freedom and space more than an Indian man, who tends to be more controlling,” he says. Sociologist Prof G K Karanth says, “The men like Indian women because they are charming, age better and know how to respect the husband in a marriage.” | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"family and relationships"
] |
Julius Caesar (1953 film) . The film stars Marlon Brando as Mark Antony , James Mason as Brutus , John Gielgud as Cassius , Louis Calhern as Julius Caesar , Edmond O'Brien as Casca , Greer Garson as Calpurnia , and Deborah Kerr as Portia . Marlon Brando . He initially gained acclaim and an Academy Award nomination for reprising the role of Stanley Kowalski in the 1951 film adaptation of Tennessee Williams ' play A Streetcar Named Desire , a role that he had originated successfully on Broadway . One-Eyed Jacks is a 1961 Western film directed by Marlon Brando ; it was the first and only film directed by him . The Missouri Breaks is a 1976 American western film starring Marlon Brando and Jack Nicholson . <<EXAMPLE>> Julius Caesar (1953 film) . The film stars Marlon Brando as Mark Antony , James Mason as Brutus , John Gielgud as Cassius , Louis Calhern as Julius Caesar , Edmond O'Brien as Casca , Greer Garson as Calpurnia , and Deborah Kerr as Portia . Marlon Brando . He directed and starred in the cult western film One-Eyed Jacks , a critical and commercial flop , after which he delivered a series of box-office failures , beginning with the 1962 film adaptation of the novel Mutiny on the Bounty . One-Eyed Jacks is a 1961 Western film directed by Marlon Brando ; it was the first and only film directed by him . Brando portrays the lead character Rio , and Karl Malden plays his partner , `` Dad '' Longworth . <<TRUE_LABEL>> Marlon Brando was in a film. <</EXAMPLE>> | [
"Marlon Brando was in a film."
] | [
"Marlon Brando was in a film."
] |
that's yeah and you know that's taxes is right now are political suicide you know and i don't think any politician's gonna do that so <<EXAMPLE>> that's yeah and you know that's taxes is right now are political suicide you know and i don't think any politician's gonna do that so Taxes are great for political careers. <<TRUE_LABEL>> contradiction <<FALSE_LABEL>> neutral <<FALSE_LABEL>> entailment <</EXAMPLE>> <<EXAMPLE>> and uh it it it just doesn't seem right that our tax money or somebody's tax money goes to keep him alive <<TRUE_LABEL>> I don't think it's right that we have to pay taxes that keep him alive. <<FALSE_LABEL>> I would rather our tax money go to education or insurance. <</EXAMPLE>> | [
"Taxes are great for political careers.",
"Raising taxes is a politician's sure fire way to commit political suicide.",
"Taxes are political suicide."
] | [
"Taxes are political suicide."
] |
Ahoy Me Hearties by Janet Clare for Moda Fabrics
Sail the blue with Ahoy Me Hearties by Janet Clare for Moda Fabrics! The design and hues of this fabric collection capture the blue skies and deep ocean. Feel the wind in your hair, hear the gulls overhead and taste the saltwater when you make your next project!
There are no products matching the selection. <<EXAMPLE>> SHORELINES 2
Head to the coast with the revised Shorelines fabric collection. Featuring a selection of gingham, stripes and solids prints on a poly/linen blend, the collection features an array of neutral and complementary colourways. Fabrics in this collection are suitable for upholstery and soft furnishings.
*Please note our fabric colours may vary slightly, before ordering your fabric online we suggest you check the actual colours at one of our showrooms. <<TRUE_LABEL>> neutral colorways <<TRUE_LABEL>> textile design <</EXAMPLE>> <<EXAMPLE>> true blue dress
$73.82 USD
Handmade with love by Miss Point
A hue this blue belongs by the sea! We love the radiant shade and flirty design. Anchor buttons and crochet accents go down the bodice. The same cute crochet design decorates the hem. Slip into this comfy True Blue dress for an adorable ensemble.. <<TRUE_LABEL>> This text describes a blue dress with anchor buttons and crochet accents. <</EXAMPLE>> <<EXAMPLE>> Explore the beauty and serenity of the sea through our nautical bracelets and fishing bracelets from Gone Costal Jewelry. Our bracelets feature one-of-a-kind designs that fully embody the sea. Our collection combines blue ocean shades with natural tones. Our designs also feature nautical symbols, including anchors, skulls and dolphins. We use the finest craftsmanship and materials to bring you our beautiful designs. Our jewelry contains sterling silver, gold and/or natural stones.
You can browse our large selection of bracelets and other nautical jewelry by subcategory. If you have any questions about our products or need help placing an order, please contact us here or call 713-927-1193 during our business hours. <<TRUE_LABEL>> This text promotes a jewelry collection that highlights nautical themes. <<FALSE_LABEL>> This text showcases a jewelry collection that is exclusively centered around nautical themes. <</EXAMPLE>> | [
"vivid blue and ocean hues",
"maritime history books",
"ocean conservation efforts",
"ocean themed fabric collection",
"nautical cooking recipes",
"fabric design inspiration",
"clothing patterns for sailing",
"sailing and nautical elements"
] | [
"ocean themed fabric collection",
"sailing and nautical elements",
"vivid blue and ocean hues",
"fabric design inspiration"
] |
N/A
Rain Head Massage 72-Jet Shower Tower System in Gunmetal
Vigo
The Vigo Rain Head Massage 72-Jet Shower Tower System in Gunmetal was constructed from solid stainless steel and designed to be lightweight, durable and corrosion resistant. This unique massage panel was built for flat wall or corner installation to save space. This shower system features two oversized, fixed jets; horizontal spray massage zones; a rain showerhead; and single function hand shower with 60 in. chrome-plated brass hose.
N/A
Raindance S 180 Shower System in Brushed Nickel
$1534.65
Hansgrohe Rainshower, and integrated wall bar for adjustable hands-free use. <<EXAMPLE>> Moen Commercial M-Dura Vandal Showerhead 8292
This showerhead is a fixed mount vandal proof showerhead with a metallic spray face and shell. It features a brass swivel ball assembly, and a spray angle that is only adjustable by a professional installer. The flow is designed to deliver 2.5 gpm at 80 psi. This shower head has a chrome finish for a bright, highly reflective, cool grey metallic look. Moen Commercial offers a full line of faucets, electronic flush valves and showering systems.
Product Type: -Shower head.
Diverter Type: -Trim with diverter
Installation Type: -Wall mounted
Extended spray nozzle. -1 Spray pattern
Spray Pattern: -Full <<TRUE_LABEL>> This text specifies the showerhead's professional installation. <<TRUE_LABEL>> This text mentions a specific spray pattern. <<TRUE_LABEL>> This text describes a durable showerhead. <</EXAMPLE>> <<EXAMPLE>> Vigo Sliding Glass Shower DoorsBrent Holland of Build.com reviews Vigo Sliding Glass Shower Doors
Vigo 72" Frameless Shower Door with 3/8" Glass Right
- Right-sided door installation
- Top rail support ensures wall anchoring and reinforces wall stability
- Discrete door handle mounted on pre drilled glass
- Limited Lifetime Warranty
- Made for 66” - 72” adjustable shower door opening
- Door Size: 35-3/4"
- Door Height: 74"
- Glass Thickness: 3/8"
- Shower Tray Included: No
- To order a similar shower door with a matching shower pan please see VG6041-60W1 Clear Shower door with Shower Tray Included
Additional Vigo Links
- View Manufacturer Warranty
- Shop All Vigo Products
- Shop All Vigo Shower Enclosures Collection Products
Our SKU: Vigo VG60417274R
This product is listed under the following manufacturer number(s):
- Vigo VG6041CHMT7274R
Frosted Glass / Chrome
- Vigo VG6041STMT7274R
Frosted Glass / Stainless Steel
*Denotes a finish or option that has been discontinued
Vigo VG6041CHMT7274. <<TRUE_LABEL>> The text describes a review of Vigo sliding glass shower doors, highlighting their features and warranty. <</EXAMPLE>> <<EXAMPLE>> Home/Steam Showers
Model Number: 9007
$1,250.00
Rectangle Steam Shower & Whirlpool Tub Enclosure with Massage Jets 67 ¼” x 35 ¾”
This big, beautiful, rectangular shaped and free-standing unit is a beauty that is packed with features. Huge monsoon rain shower head, hand-held shower and riser, pulsating back jets, tantalizing foot massager, multi-color underwater lighting, comfortable headrest and of course the powerful 3kw steam generator. The 9007 also has two built in towel grab rails, shampoo dispenser and a convenient two tier glass shelf. All those features in one sleek looking shower that offers a ton of bells and whistles.
Product Specifications:
(All Included in this system)
• 6 jet amazing Whirlpool System
• Head rest for ultimate comfort
• Convenient Remote Control
• Pressure Balanced Shower Valve
• 25cm Tropical Monsoon Top Shower
• 6 Hydro massage body jets
• Multi-function hand shower
• Foot massage attachment
• Built-in FM radio with cd/mp3 input
• Extractor Fan
• Handy Toiletries Shelf
• Low voltage ceiling lighting
• LED back lighting
• Built in seat
• Steam generator included
• MK-117 steam room controller
• Function – Parameter
• LCD display – STN blue
• touch screen – touching telephone answering
• remote control
• rated voltage – AC110V/50~60Hz
• rated power – 2.5~3.2KW″ tubular plastic <<TRUE_LABEL>> home spa equipment <<TRUE_LABEL>> Steam Shower features <<TRUE_LABEL>> luxury bathroom fixtures <<TRUE_LABEL>> hydrotherapy products <</EXAMPLE>> | [
"lighting fixtures",
"outdoor furniture"
] | [] |
The first witnesses for the prosecution were mostly those who had been called at the inquest, the medical evidence being again taken first. <<EXAMPLE>> That evidence can include corroborative witnesses -- and even a layperson representing himself has the power of subpoena to require testimony. <<TRUE_LABEL>> Self representing laypersons have the ability to use subpoenas to require testimony. <<FALSE_LABEL>> Any evidence will always include a corroborative witness. <</EXAMPLE>> <<EXAMPLE>> I have never seen a trial before where you had factual disputes where you didn't have witnesses where you could watch their demeanor on the stand, listen to them, judge one witness vs. another witness (DeWine). <<TRUE_LABEL>> I haven't seen a trail where there were no witnesses to watch. <<FALSE_LABEL>> I haven't seen a trail where there were no witnesses to watch because the state didn't want to call any. <<FALSE_LABEL>> I haven't seen a trail where there were 50 witnesses to watch. <</EXAMPLE>> | [
"Medical evidence was taken before continuing with court proceedings.",
"The witnesses had been dismissed before the evidence had even been presented."
] | [
"Medical evidence was taken before continuing with court proceedings."
] |
System for Electronic Document Analysis and Retrieval
Also found in: Acronyms, Wikipedia.
System for Electronic Document Analysis and Retrieval
An electronic system that Canadian regulators use to allow publicly-traded companies to make necessary filings more quickly and efficiently. Most publicly-traded companies in Canada use SEDAR to file their quarterly and annual reports and other information they must submit. SEDAR provides a website where investors can review this information, which is useful in conducting fundamental analysis. | [
"company reports",
"regulatory filings",
"company finances",
"technical system specifications",
"investment analysis",
"electronic document management",
"paper document management"
] | [
"electronic document management",
"company reports",
"investment analysis",
"regulatory filings"
] |
PATNA: Altogether 101 students of classes X and XII of St Karen’s High School were felicitated on Saturday for their outstanding performances in academics and sports. The students received mementos and certificates. Toppers of various streams in Class XII were also felicitated. Harshit Upadhyay, district level champion in 200 metre and 400 metre race (Class XII), Kajol Kumar, national level champion in high jump (Class XII), Shalwi Kumari, national level triple jump athlete (Class XII) and Riya Kumari, national level discus throw and rugby champion (Class X) were among some of the students who were felicitated. Induction ceremony: Raza International Girls School organized an induction ceremony for the newly elected school council members on Saturday.The council members along with house masters and house mistresses of the four houses – Arybhatta (Red House), Newton (Blue House), Darwin (Yellow House) and Kalam (Green House) – took the oath of performing their duties towards the school with diligence and sincerity. | [
"video gaming",
"news and politics",
"technology and computing",
"family and relationships",
"pets",
"healthy living",
"style and fashion",
"music and audio",
"home and garden",
"food and drinks",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"sports"
] |
Coquette Productions is a television and film production company created by David Arquette and Courteney Cox , and located in West Hollywood , California . Dirt (TV series) . The show was created by Matthew Carnahan and produced by Coquette Productions and ABC Studios . <<EXAMPLE>> Coquette Productions is a television and film production company created by David Arquette and Courteney Cox , and located in West Hollywood , California . 2007 : Dirt ( TV drama series ) Dirt (TV series) . The show was created by Matthew Carnahan and produced by Coquette Productions and ABC Studios . <<TRUE_LABEL>> Dirt was produced by a production company. <</EXAMPLE>> <<EXAMPLE>> Madurai: With the second phase of vaccination drive against brucellosis underway in Madurai district, animal husbandry department officials said that a total of 14,500 heifer calves have been identified and targeted to be vaccinated.Brucellosis is a contagious and communicable disease caused by the bacteria brucellosis abortus, primarily affecting bovine cattle, but can spread from animals to humans. It can be prevented by administering the brucellosis vaccine to female heifer calves aged around four to eight months. The vaccination is being carried out at various veterinary dispensaries under the central government’s National Animal Disease Control Programme (NADCP) on the directions of the regional joint director of animal husbandry. One dose of the vaccine provides life-long immunity to the animal. The vaccination is carried out by vets only after wearing protective gear. Around 1,000 heifer calves are being vaccinated in a day, said an official. One of the main symptoms of brucellosis is abortion in the last trimester of pregnancy. There has been no reported case of Brucellosis in Madurai in recent times. The vaccination, which will continue till July 15, is being carried by around 90 teams in different areas. <<TRUE_LABEL>> pets <</EXAMPLE>> | [
"Dirt was produced by a production company."
] | [
"Dirt was produced by a production company."
] |
As I was having my morning breakfast in a coffee shop, there was a poorly dressed man begging and selling his tissue papers to customers around. He was limping because he had only one leg. Our of sympathy, some bought his tissue. I could observe the different of characters with the givers and non-givers in this situation. Those who did not bother to look at this poor man, could have an unsympathetic heart. Those who gave were either kind or pretended to be kind.
What matter most would be if you could give whole heartily without feeling the pain in you heart. The amount you give isn't important but the thought of helping and giving is the gesture of kindness in your heart. If you could give with such thought, your mind would definitely feel the joy of your heart. True happiness is created through this way; "The giving and sharing of life." So! The next time if you give and you still have the slight pain in your heart, sorry to say, you don't have the kind heart yet. | [
"homelessness",
"poverty",
"empathy",
"wealth distribution",
"philosophy of giving",
"charity"
] | [
"empathy",
"philosophy of giving",
"charity"
] |
Critics also suggested that, with their salaries and stock wrapped up in the same company, employees were putting too many eggs in one basket. <<EXAMPLE>> Six dangerous myths about pay. Every day, executives make decisions about pay, and they do so in a landscape that's shifting. As more and more companies base less of their compensation on straight salary and look to other financial options, managers are bombarded with advice about the best approaches to take. Unfortunately, much of that advice is wrong. Indeed, much of the conventional wisdom and public discussion about pay today is misleading, incorrect, or both. The result is that business people are adopting wrongheaded notions about how to pay people and why. In particular, they are subscribing to six dangerous myths about pay. Myth #1: labor rates are the same as labor costs. Myth #2: cutting labor rates will lower labor costs. Myth #3: labor costs represent a large portion of a company's total costs. Myth #4: keeping labor costs low creates a potent and sustainable competitive edge. Myth #5: individual incentive pay improves performance. Myth #6: people work primarily for the money. The author explains why these myths are so pervasive, shows where they go wrong, and suggests how leaders might think more productively about compensation. With increasing frequency, the author says, he sees managers harming their organizations by buying into--and acting on--these myths. Those that do, he warns, are probably doomed to endless tinkering with pay that at the end of the day will accomplish little but cost a lot. <<TRUE_LABEL>> pharmaceuticals, conditions, and symptoms <</EXAMPLE>> <<EXAMPLE>> Travel Insurance
Obtaining insurance with a pre-existing medical condition can sometimes be difficult. We've collected a list of insurance companies who offer travel insurance for those with pre-existing medical conditions. Some of our members have found them helpful in the past.
Freedom*01223 454290
Insurance Choice*0843 22 78 183
Just Travel Cover*0800 231 5532
AllClear Insurance Services0845 250 5250
Orbis Insurance0845 338 1638
Club Direct Travel Insurance0800 083 2466
It's So Easy Travel0844 357 1315
Free Spirit Travel0845 230 5000
Saga0800 015 8055
Able2Travel0845 839 9345
Staysure0844 692 8444
World First Travel Insurance0345 9080161
The Insurance Surgery*0800 083 2829
Go Travel Insurance Services0870 1525840
*Will make a donation to LUPUS UK when a policy is taken out. <<TRUE_LABEL>> customer recommendations <</EXAMPLE>> | [
"Critics suggested that their salaries and stock should be wrapped in the same company.",
"With their salaries and stock wrapped in the same company, critics suggested employees were putting too many eggs in one basket."
] | [
"With their salaries and stock wrapped in the same company, critics suggested employees were putting too many eggs in one basket."
] |
CARLY PEARCE: Kentucky Music Hall of Fame Exhibit
Carly Pearce returned to her home state for the virtual unveiling ceremony for her exhibit at the Kentucky Music Hall of Fame.
The exhibit features the blue sequin dress her mother made for her when she was a young girl performing around the state.
Carly is in good company. Others in the Hall of Fame include Backstreet Boys, Loretta Lynn, Florence Henderson, Rosemary Clooney, Keith Whitley and Boots Randolph. <<EXAMPLE>> Interstellar (film) . Interstellar is a 2014 British-American epic science fiction film directed , co-written , and co-produced by Christopher Nolan . The film utilized extensive practical and miniature effects , while the company Double Negative created additional digital effects . It received several awards and nominations ; at the 87th Academy Awards , the film won the Academy Award for Best Visual Effects , and was nominated for Best Original Score , Best Sound Mixing , Best Sound Editing , and Best Production Design . <<TRUE_LABEL>> Interstellar is a narrative in a visual medium. <</EXAMPLE>> | [
"Carly Pearce's career",
"Fashion design",
"Musician memorabilia",
"Physical unveiling ceremony",
"Loretta Lynn's personal items",
"Backstreet Boys' career"
] | [
"Carly Pearce's career",
"Musician memorabilia"
] |
AFR® Furniture Rental is proud to announce their alliance with AllSeated®, a company that is revolutionizing the event industry with state-of-the-art event planning tools! AFR® Furniture Rental has provided 3d models for 250+ pieces of their furnishing rentals to create a library hosted right on the AllSeated® site. By integrating AFR's expansive inventory with the planning and design capability of AllSeated® technology, the event planning process becomes.
To enter your AFR® Powered by AllSeated account, please log in. | [
"technology alliance",
"furniture manufacturing",
"product integration"
] | [
"technology alliance",
"product integration"
] |
hankerie baking, baking sydney, cake decorating, recipe, secret recipe, bread, cakes, scones, bakers, sydney baking australia creative sydney cake order online bread cupcake kl macarons baking supplier shop klang valley great deals all deals birthday cake bakery in sydney order a cake online online cake ordering order birthday cake bukit bintang hotel cupcakes cupcakes sydney baking and pastry pastry and baking cooking classes nyc pastry chef pastry chefs cooking school school of cooking cake classs minion minions tv magazine coffee birthday cake swissroll designer mooncake mochi best mooncake in sydney fueling with flavour authentic recipes made with wholesome and flavorful ingredients by a spice islander, featuring exotic regional dishes from cuisines around the world. | [
"video gaming",
"technology and computing",
"family and relationships",
"news and politics",
"pets",
"healthy living",
"style and fashion",
"food and drinks",
"home and garden",
"music and audio",
"travel",
"books and literature",
"business and finance",
"pharmaceuticals, conditions, and s... | [
"food and drinks"
] |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.