id
stringlengths
1
7
text
stringlengths
6
1.03M
dataset_id
stringclasses
1 value
3293925
import requests import random from joblib import Parallel, delayed def register(): r = requests.post('http://52.59.7.147/process', json={ 'email': ''.join([random.choice('abcdefghijklmn') for i in range(10)]) }) return r.json() n = 35 r = Parallel(n_jobs=n)(delayed(register)() for i in range(n)) vals = [] for v in r: if 'ip' in v: vip = v['ip'] if vip in vals: print("!!!!!!!! repeated IP") vals.append(vip) print(r)
StarcoderdataPython
1607137
<reponame>DazEB2/SimplePyScripts<filename>exchange_rates/banki_ru.py<gh_stars>100-1000 #!/usr/bin/env python3 # -*- coding: utf-8 -*- __author__ = 'ipetrash' def exchange_rate(currency_id, timestamp=None): if timestamp is None: from datetime import datetime timestamp = int(datetime.today().timestamp()) data = { 'currency_id': currency_id, 'date': timestamp } headers = { 'X-Requested-With': 'XMLHttpRequest', 'User-Agent': 'Mozilla/5.0 (Windows NT 6.1; WOW64; rv:45.0) Gecko/20100101 Firefox/45.0' } import requests rs = requests.post('http://www.banki.ru/products/currency/ajax/quotations/value/cbr/', json=data, headers=headers) return rs.json()['value'] if __name__ == '__main__': # 840 -- USD print('USD:', exchange_rate(840)) # 978 -- EUR print('EUR:', exchange_rate(978))
StarcoderdataPython
1604832
<gh_stars>1-10 import unittest from Card import Card from Player import Player from Shoe import Shoe from Hand import Hand class ShoeTester(unittest.TestCase): def test_gen_cards(self): shoe = Shoe() self.assertEqual(len(shoe.cards), 8*52) self.assertEqual(type(shoe.cards[0]), Card) def test_end_of_shoe(self): shoe = Shoe() [shoe.pop() for iter in range(416)] self.assertEqual(shoe.end_of_shoe, False) shoe.pop() self.assertEqual(shoe.end_of_shoe, True) self.assertEqual(len(shoe.cards), 0) def test_removeCards(self): # removes 2 cards shoe = Shoe() shoe.cards = [Card('H10'), Card('CJ'), Card('D2')] result = shoe.removeCards(set([10]), 2) self.assertEqual(result, True) self.assertEqual(set([c.name for c in shoe.cards]), set(['D2']) ) result = shoe.removeCards(set([10]), 1) self.assertEqual(set([c.name for c in shoe.cards]), set(['D2']) ) self.assertEqual(result, False) #removeCards should not remove too many cards shoe = Shoe() shoe.cards = [Card('H9'), Card('C9'), Card('D2')] result = shoe.removeCards(set([9]), 1) self.assertEqual(result, True) self.assertEqual(len(shoe.cards), 2 ) # remove 1 card from large shoe shoe = Shoe() shoe.removeCards(set([10]),1) self.assertTrue(len(shoe.cards), 415) #remove a card from a range of cards shoe = Shoe() shoe.cards = [Card('H10'), Card('CJ'), Card('D2')] result = shoe.removeCards(set([2,3,5]),1) self.assertEqual(result, True) self.assertEqual(set([c.name for c in shoe.cards]), set(['H10', 'CJ']) )
StarcoderdataPython
104052
#!/usr/bin/env python3 # -*- coding: utf-8 -*- """ Created on Sun Feb 23 13:11:49 2020 @author: abdulroqeeb """ host = "127.0.0.1" port = 7497 ticktypes = { 66: "Bid", 67: "Ask", 68: "Last", 69: "Bid Size", 70: "Ask Size", 71: "Last Size", 72: "High", 73: "Low", 74: "Volume", 75: "Prior Close", 76: "Prior Open", 88: "Timestamp", } account_details_params = [ 'AccountCode', 'AccountType', 'AccruedCash', 'AvailableFunds', 'BuyingPower', 'CashBalance', 'NetLiquidation' ] port_chart_lim = 600 #minutes states = {1: 'Long', 0: 'Flat', -1: 'Short'}
StarcoderdataPython
1651608
<filename>colorbrewer/__init__.py #!/usr/bin/env python from __future__ import absolute_import, division __version__ = "0.2.0" from six.moves import map """ __init__: DESCRIPTION data copyright <NAME>, <NAME>, and The Pennsylvania State University """ # Copyright 2009, 2012 <NAME> <<EMAIL>> from collections import defaultdict from pkg_resources import resource_string from csv import DictReader, reader as csv_reader try: # Python 2.6+ PKG = __name__ except NameError: PKG = "colorbrewer" try: # Python 2.6+ next except NameError: def next(obj): return obj.__next__() PKG_DATA = ".".join([PKG, "data"]) RES_COLORBREWER = "ColorBrewer_all_schemes_RGBonly3.csv" DIALECT= "excel-tab" def read_colorbrewer(iterable): res = defaultdict(dict) iterator = iter(iterable) fieldnames = next(csv_reader(iterator, DIALECT)) reader = DictReader(iterator, fieldnames, dialect = DIALECT) for row in reader: def int_cell(colname): return int(row[colname]) color_name = row["ColorName"] if color_name: num_of_colors = int_cell("NumOfColors") colors = [] res[color_name][num_of_colors] = colors try: colors.append(tuple(map(int_cell, "RGB"))) except ValueError: # data section is over break return res def _load_schemes(): lines = [line.decode() \ for line in resource_string(PKG_DATA, RES_COLORBREWER).splitlines()] schemes = read_colorbrewer(lines) # copy schemes to module global variables globals().update(schemes) _load_schemes()
StarcoderdataPython
3368824
<reponame>chatto-hub-test2/github-permission from chatto_transform.transforms.transform_base import Transform pipeline_type_error_msg = """Invalid transform list: Transform {i1}'s output schema does not match Transform {i2}'s input schema. {i1} output schema: {i1s} {i2} input schema: {i2s}""" class PipelineTransformException(Exception): pass class PipelineTransform(Transform): def __init__(self, transform_list, intermediate_storage=None): self.transform_list = list(transform_list) self.intermediate_storage = intermediate_storage self._check_transform_list() def _check_transform_list(self): if len(self.transform_list) == 0: raise TypeError('Invalid transform list: empty.') for i, ts in enumerate(zip(self.transform_list, self.transform_list[1:])): t1, t2 = ts if t1.output_schema() != t2.input_schema(): raise TypeError(pipeline_type_error_msg.format(i1=i, i2=i+1, i1s=t1.output_schema(), i2s=t2.input_schema())) def input_schema(self): return self.transform_list[0].input_schema() def output_schema(self): return self.transform_list[-1].output_schema() def _load(self): return self.transform_list[0].load() def _transform(self, data): for i, t in enumerate(self.transform_list): try: data = t.transform(data) except Exception as exc: msg = 'Encountered exception while running transform #{}, {} in pipeline.'.format(i, t) raise PipelineTransformException(msg) from exc return data
StarcoderdataPython
3303309
<gh_stars>1-10 """Interface for all network clients to follow.""" from __future__ import annotations from abc import ABC, abstractmethod from xrpl.models.requests.request import Request from xrpl.models.response import Response class Client(ABC): """ Interface for all network clients to follow. :meta private: """ url: str @abstractmethod async def request_impl(self: Client, request: Request) -> Response: """ This is the actual driver for a given Client's request. It must be async because all of the helper functions in this library are async-first. Implement this in a given Client. Arguments: request: The Request to send. Raises: NotImplementedError: always. """ raise NotImplementedError( f"{self.__class__.__name__}.request_impl not implemented." )
StarcoderdataPython
4803004
<gh_stars>0 def kmp(t, p): n = len(t) m = len(p) begin = 0 matched = 0 res = [] f = failure_function(p) while begin <= n - m: if matched < m and t[begin + matched] == p[matched]: matched += 1 if matched == m: res.append(begin) else: if matched == 0: begin += 1 else: # begin 초기화 및 matched 초기화 begin += (matched + f[matched - 1]) matched = f[matched - 1] return res def failure_function(p): m = len(p) begin = 1 matched = 0 f = [0 for i in range(m)] while begin + matched < m: if p[begin + matched] == p[matched]: matched += 1 f.append(matched) else: if matched == 0: begin += 1 else: begin += matched - f[matched - 1] matched = f[matched - 1] return f print(kmp('abaabababc', 'ababab'))
StarcoderdataPython
3222983
""" Schema for Auth Models """ # pylint: disable=no-self-argument import re from typing import Dict, List, Optional from pydantic import BaseModel, validator from app.core.security.password import validate_password from app.helpers.expressions import VALID_EMAIL class GroupBase(BaseModel): """ Base Schema for Groups """ name: str description: Optional[str] = None class GroupBaseDB(GroupBase): """ Base Schema for DB """ id: int class Group(GroupBaseDB): """ Final Schema for API """ class UserBasic(BaseModel): """ Basic user info - combine with id to give clients linking and list abilities """ first_name: Optional[str] = None last_name: Optional[str] = None class UserBase(UserBasic): """ Base Schema for User with optional data to be collected""" username: Optional[str] = None email: Optional[str] = None is_active: Optional[bool] = True is_superuser: Optional[bool] = False @validator('email') def validate_email(cls, value): """ validates the email provided is valid form """ if value is not None and not re.search(VALID_EMAIL, value): raise ValueError('email address is not valid') return value @validator('username') def validate_username(cls, value): """ validates the username is alphanumeric """ if value is not None and not value.isalnum(): raise ValueError('username must be alphanumeric') return value class UserBaseDB(UserBase): """ Base Schema for User after DB save to return most non sensitive data """ id: int = None class UserList(UserBasic): """ Add ID into UserBasic so we can provide a list for linking and name building """ id: int def password(value: str, values: Dict[str, str]) -> str: """ make sure the password supplied meets our criteria """ # We will assume all attempts will fail so start with least intense first if 'password' not in values or value != values['password']: raise ValueError('passwords do not match') # Validate returns True if valid, or raises Value error if not validate_password(value) return value class UserCreate(UserBase): """ Add required fields required to create a user """ password: str password_validate: str _validate_password = validator('password_validate', allow_reuse=True, always=True)(password) class UserUpdate(UserBaseDB): """ Schema to allow user to update password """ password: Optional[str] = None class User(UserBaseDB): """ Does not include hashed password, could include other extra's """ groups: Optional[List] = None class UserDB(UserBaseDB): """ Final DB Object """ hashed_password: str class UserDBCreate(UserBase): """ Object to save in the database / does not include key """ hashed_password: Optional[str] = None
StarcoderdataPython
1725810
<gh_stars>0 from django.apps import AppConfig class DbcallsConfig(AppConfig): name = 'DBCalls'
StarcoderdataPython
1784609
<reponame>mccolm-robotics/Claver-AI-Assistant<gh_stars>1-10 import numpy as np from pyrr import Vector3 class BasicTile: TILE_SIZE = 11 vertices = [ 1.0, 0.0, -1.0, -1.0, 0.0, 1.0, 1.0, 0.0, 1.0, -1.0, 0.0, -1.0, -1.0, 0.0, 1.0, 1.0, 0.0, -1.0 ] def __init__(self, loader, position): # self.__model = loader.loadToVAO(self.vertices) self.__model = loader.load2DToVAO(self.vertices, 3) self.__position = Vector3(position) self.__x = self.__position.x self.__z = self.__position.z self.__height = self.__position.y def getModel(self): return self.__model def getPosition(self): return self.__position def getX(self): return self.__x def getZ(self): return self.__z def getHeight(self): return self.__height
StarcoderdataPython
129353
<reponame>Lezval/horizon #!/usr/bin/env python """Generates files for sphinx documentation using a simple Autodoc based template. To use, just run as a script: $ python doc/generate_autodoc_index.py """ import os base_dir = os.path.dirname(os.path.abspath(__file__)) RSTDIR = os.path.join(base_dir, "source", "sourcecode") SRCS = {'dashboard': os.path.join(base_dir, "..", "openstack-dashboard"), 'django_openstack': os.path.join(base_dir, "..", "django-openstack")} def find_autodoc_modules(module_name, sourcedir): """returns a list of modules in the SOURCE directory""" modlist = [] os.chdir(os.path.join(sourcedir, module_name)) print "SEARCHING %s" % sourcedir for root, dirs, files in os.walk("."): for filename in files: if filename.endswith(".py"): # root = ./dashboard/test/unit # filename = base.py # remove the pieces of the root elements = root.split(os.path.sep) # replace the leading "." with the module name elements[0] = module_name # and get the base module name base, extension = os.path.splitext(filename) if not (base == "__init__"): elements.append(base) result = ".".join(elements) #print result modlist.append(result) return modlist if not(os.path.exists(RSTDIR)): os.mkdir(RSTDIR) INDEXOUT = open("%s/autoindex.rst" % RSTDIR, "w") INDEXOUT.write("Source Code Index\n") INDEXOUT.write("=================\n") INDEXOUT.write(".. toctree::\n") INDEXOUT.write(" :maxdepth: 1\n") INDEXOUT.write("\n") for modulename in SRCS: for module in find_autodoc_modules(modulename, SRCS[modulename]): generated_file = "%s/%s.rst" % (RSTDIR, module) print "Generating %s" % generated_file INDEXOUT.write(" %s\n" % module) FILEOUT = open(generated_file, "w") FILEOUT.write("The :mod:`%s` Module\n" % module) FILEOUT.write("==============================" "==============================" "==============================\n") FILEOUT.write(".. automodule:: %s\n" % module) FILEOUT.write(" :members:\n") FILEOUT.write(" :undoc-members:\n") FILEOUT.write(" :show-inheritance:\n") FILEOUT.close() INDEXOUT.close()
StarcoderdataPython
170500
<gh_stars>1000+ import numpy as np import openml classification_tasks = [ 232, 236, 241, 245, 253, 254, 256, 258, 260, 262, 267, 271, 273, 275, 279, 288, 336, 340, 2119, 2120, 2121, 2122, 2123, 2125, 2356, 3044, 3047, 3048, 3049, 3053, 3054, 3055, 75089, 75092, 75093, 75098, 75100, 75108, 75109, 75112, 75114, 75115, 75116, 75118, 75120, 75121, 75125, 75126, 75129, 75131, 75133, 75134, 75136, 75139, 75141, 75142, 75143, 75146, 75147, 75148, 75149, 75153, 75154, 75156, 75157, 75159, 75161, 75163, 75166, 75169, 75171, 75173, 75174, 75176, 75178, 75179, 75180, 75184, 75185, 75187, 75192, 75195, 75196, 75199, 75210, 75212, 75213, 75215, 75217, 75219, 75221, 75223, 75225, 75232, 75233, 75234, 75235, 75236, 75237, 75239, 75250, 126021, 126024, 126028, 126030, 126031, 146574, 146575, 146576, 146577, 146578, 146583, 146586, 146592, 146593, 146594, 146596, 146597, 146600, 146601, 146602, 146603, 146679, 166859, 166866, 166872, 166875, 166882, 166897, 166905, 166906, 166913, 166915, 166931, 166932, 166944, 166950, 166951, 166953, 166956, 166957, 166958, 166959, 166970, 166996, 167085, 167086, 167087, 167088, 167089, 167090, 167094, 167096, 167097, 167099, 167100, 167101, 167103, 167105, 167106, 167202, 167203, 167204, 167205, 168785, 168791, 189779, 189786, 189828, 189829, 189836, 189840, 189841, 189843, 189844, 189845, 189846, 189857, 189858, 189859, 189863, 189864, 189869, 189870, 189875, 189878, 189880, 189881, 189882, 189883, 189884, 189887, 189890, 189893, 189894, 189899, 189900, 189902, 190154, 190155, 190156, 190157, 190158, 190159, 211720, 211721, 211722, 211723, 211724 ] regression_tasks = [ 359997, 359998, 359999, 360000, 360001, 360002, 360003, 167146, 360004, 360005, 360006, 360007, 211696, 360009, 360010, 360011, 360012, 360013, 360014, 360015, 360016, 360017, 360018, 360019, 360020, 360021, 360022, 360023, 360024, 360025, 360026, 360027, 360028, 360029, 360030, 360031, 360032, 360033, 360034, 360035, 360036, 360037, 360038, 360039, 360040, 360041, 360042, 360043, 360044, 360045, 360046, 360047, 360048, 360049, 360050, 360051, 360052, 360053, 360054, 360055, 360056, 360057, 360058, 360059, 360060, 360061, 360062, 360063, 360064, 360066, 360067, 360068, 360069, 360070, 360071, 360072, 360073, 360074, 360075, 360076, 360077, 360078, 360079, 360080, 360081, 360082, 360083, 360084, 360085, 360086, 360087, 360088, 360089, 360090, 360091, 360092, 360093, 360094, 360095, 360096, 360097, 360098, 360100, 360101, 360102, 360103, 360104, 360105, 360106, 360107, 360108, ] def load_task(task_id): task = openml.tasks.get_task(task_id) X, y = task.get_X_and_y() train_indices, test_indices = task.get_train_test_split_indices() X_train = X[train_indices] y_train = y[train_indices] X_test = X[test_indices] y_test = y[test_indices] dataset = openml.datasets.get_dataset(task.dataset_id) _, _, cat, _ = dataset.get_data(target=task.target_name) name = dataset.name.lower() del _ del dataset cat = {i: 'categorical' if c else 'numerical' for i, c in enumerate(cat)} if isinstance(task, openml.tasks.OpenMLClassificationTask): task_type = 'classification' elif isinstance(task, openml.tasks.OpenMLRegressionTask): task_type = 'regression' else: raise ValueError('Unknown task type') return X_train, y_train, X_test, y_test, cat, task_type, name
StarcoderdataPython
3398344
<filename>simulation/aivika/modeler/__init__.py<gh_stars>0 # Copyright (c) 2017 <NAME> <<EMAIL>> # # Licensed under BSD3. See the LICENSE.txt file in the root of this distribution. from simulation.aivika.modeler.specs import * from simulation.aivika.modeler.model import * from simulation.aivika.modeler.expr import * from simulation.aivika.modeler.expr_random import * from simulation.aivika.modeler.expr_run import * from simulation.aivika.modeler.transform import * from simulation.aivika.modeler.port import * from simulation.aivika.modeler.data_type import * from simulation.aivika.modeler.stream import * from simulation.aivika.modeler.stream_random import * from simulation.aivika.modeler.queue_strategy import * from simulation.aivika.modeler.queue import * from simulation.aivika.modeler.resource import * from simulation.aivika.modeler.resource_preemption import * from simulation.aivika.modeler.server import * from simulation.aivika.modeler.server_random import * from simulation.aivika.modeler.arrival_timer import * from simulation.aivika.modeler.ref import * from simulation.aivika.modeler.stats import * from simulation.aivika.modeler.results import * from simulation.aivika.modeler.experiment import *
StarcoderdataPython
1600599
# -*- coding: utf-8 -*- """Qlik Engine.""" import math from typing import Any, Dict, List, Union from luft.vendor.pyqlikengine.engine_app_api import EngineAppApi from luft.vendor.pyqlikengine.engine_field_api import EngineFieldApi from luft.vendor.pyqlikengine.engine_generic_object_api import EngineGenericObjectApi from luft.vendor.pyqlikengine.engine_global_api import EngineGlobalApi from luft.vendor.pyqlikengine.structs import Structs def get_hypercube_data(connection: object, app_handle: int, measures: Union[List[Dict[str, str]], None] = None, dimensions: Union[List[str], None] = None, selections: Union[Dict[str, List[Any]]] = None, date_valid: str = None): """Get data from Qlik App in json format.""" mes_width = len(measures) if measures else 0 dim_width = len(dimensions) if dimensions else 0 ega = EngineGlobalApi(connection) # Define Dimensions of hypercube dimensions = dimensions or [] hc_inline_dim = Structs.nx_inline_dimension_def(dimensions) # Set sorting of Dimension by Measure hc_mes_sort = Structs.nx_sort_by() # Build hypercube from above definition hc_dim = Structs.nx_hypercube_dimensions(hc_inline_dim) meas_ids = [mea.get('id') for mea in (measures or [])] hc_mes = Structs.nx_hypercube_measure_ids(hc_mes_sort, meas_ids) width = mes_width + dim_width height = int(math.floor(10000 / width)) nx_page = Structs.nx_page(0, 0, height, width) hc_def = Structs.hypercube_def('$', hc_dim, hc_mes, [nx_page]) eaa = EngineAppApi(connection) app_layout = eaa.get_app_layout(app_handle).get('qLayout') hc_response = eaa.create_object( app_handle, 'CH01', 'Chart', 'qHyperCubeDef', hc_def) hc_handle = ega.get_handle(hc_response) egoa = EngineGenericObjectApi(connection) efa = EngineFieldApi(connection) if selections: for field in selections.keys(): field_handle = ega.get_handle( eaa.get_field(app_handle, field)) values: List[Dict[str, Any]] = [] for select_value in selections[field]: if isinstance(select_value, str): values.append({'qText': select_value}) else: values.append( {'qIsNumeric': True, 'qNumber': select_value}) efa.select_values(field_handle, values) i = 0 while i % height == 0: nx_page = Structs.nx_page(i, 0, height, width) hc_data = egoa.get_hypercube_data( hc_handle, '/qHyperCubeDef', [nx_page]) elems = hc_data['qDataPages'][0]['qMatrix'] results = [] for elem in elems: j = 0 dim_dict = {} for dim in (dimensions or []): if 'qText' in elem[j].keys(): dim_dict[dim.lower()] = elem[j]['qText'] else: dim_dict[dim.lower()] = None j += 1 for meas in (measures or []): result = {} result['date_valid'] = date_valid result['app_id'] = app_layout.get('qFileName') result['app_name'] = app_layout.get('qTitle') result['app_stream_id'] = app_layout.get('stream').get('id') result['app_stream_name'] = app_layout.get( 'stream').get('name') result['dimensions'] = dim_dict result['selections'] = selections result['measure_id'] = meas.get('id') result['measure_name'] = meas.get('name') if 'qNum' in elem[j].keys() and not elem[j].get('qIsNull'): result['measure_value'] = elem[j]['qNum'] else: result['measure_value'] = None results.append(result) j += 1 i += 1 return results
StarcoderdataPython
186474
<gh_stars>1-10 import sys import getopt import logging import botocore import boto3 import time from packaging import version from time import sleep from botocore.exceptions import ClientError logger = logging.getLogger() personalize = None def _get_dataset_group_arn(dataset_group_name): dsg_arn = None paginator = personalize.get_paginator('list_dataset_groups') for paginate_result in paginator.paginate(): for dataset_group in paginate_result["datasetGroups"]: if dataset_group['name'] == dataset_group_name: dsg_arn = dataset_group['datasetGroupArn'] break if dsg_arn: break if not dsg_arn: raise NameError(f'Dataset Group "{dataset_group_name}" does not exist; verify region is correct') return dsg_arn def _get_solutions(dataset_group_arn): solution_arns = [] paginator = personalize.get_paginator('list_solutions') for paginate_result in paginator.paginate(datasetGroupArn = dataset_group_arn): for solution in paginate_result['solutions']: solution_arns.append(solution['solutionArn']) return solution_arns def _delete_campaigns(solution_arns): campaign_arns = [] for solution_arn in solution_arns: paginator = personalize.get_paginator('list_campaigns') for paginate_result in paginator.paginate(solutionArn = solution_arn): for campaign in paginate_result['campaigns']: if campaign['status'] in ['ACTIVE', 'CREATE FAILED']: logger.info('Deleting campaign: ' + campaign['campaignArn']) personalize.delete_campaign(campaignArn = campaign['campaignArn']) elif campaign['status'].startswith('DELETE'): logger.warning('Campaign {} is already being deleted so will wait for delete to complete'.format(campaign['campaignArn'])) else: raise Exception('Campaign {} has a status of {} so cannot be deleted'.format(campaign['campaignArn'], campaign['status'])) campaign_arns.append(campaign['campaignArn']) max_time = time.time() + 30*60 # 30 mins while time.time() < max_time: for campaign_arn in campaign_arns: try: describe_response = personalize.describe_campaign(campaignArn = campaign_arn) logger.debug('Campaign {} status is {}'.format(campaign_arn, describe_response['campaign']['status'])) except ClientError as e: error_code = e.response['Error']['Code'] if error_code == 'ResourceNotFoundException': campaign_arns.remove(campaign_arn) if len(campaign_arns) == 0: logger.info('All campaigns have been deleted or none exist for dataset group') break else: logger.info('Waiting for {} campaign(s) to be deleted'.format(len(campaign_arns))) time.sleep(20) if len(campaign_arns) > 0: raise Exception('Timed out waiting for all campaigns to be deleted') def _delete_solutions(solution_arns): for solution_arn in solution_arns: try: describe_response = personalize.describe_solution(solutionArn = solution_arn) solution = describe_response['solution'] if solution['status'] in ['ACTIVE', 'CREATE FAILED']: logger.info('Deleting solution: ' + solution_arn) personalize.delete_solution(solutionArn = solution_arn) elif solution['status'].startswith('DELETE'): logger.warning('Solution {} is already being deleted so will wait for delete to complete'.format(solution_arn)) else: raise Exception('Solution {} has a status of {} so cannot be deleted'.format(solution_arn, solution['status'])) except ClientError as e: error_code = e.response['Error']['Code'] if error_code != 'ResourceNotFoundException': raise e max_time = time.time() + 30*60 # 30 mins while time.time() < max_time: for solution_arn in solution_arns: try: describe_response = personalize.describe_solution(solutionArn = solution_arn) logger.debug('Solution {} status is {}'.format(solution_arn, describe_response['solution']['status'])) except ClientError as e: error_code = e.response['Error']['Code'] if error_code == 'ResourceNotFoundException': solution_arns.remove(solution_arn) if len(solution_arns) == 0: logger.info('All solutions have been deleted or none exist for dataset group') break else: logger.info('Waiting for {} solution(s) to be deleted'.format(len(solution_arns))) time.sleep(20) if len(solution_arns) > 0: raise Exception('Timed out waiting for all solutions to be deleted') def _delete_event_trackers(dataset_group_arn): event_tracker_arns = [] event_trackers_paginator = personalize.get_paginator('list_event_trackers') for event_tracker_page in event_trackers_paginator.paginate(datasetGroupArn = dataset_group_arn): for event_tracker in event_tracker_page['eventTrackers']: if event_tracker['status'] in [ 'ACTIVE', 'CREATE FAILED' ]: logger.info('Deleting event tracker {}'.format(event_tracker['eventTrackerArn'])) personalize.delete_event_tracker(eventTrackerArn = event_tracker['eventTrackerArn']) elif event_tracker['status'].startswith('DELETE'): logger.warning('Event tracker {} is already being deleted so will wait for delete to complete'.format(event_tracker['eventTrackerArn'])) else: raise Exception('Solution {} has a status of {} so cannot be deleted'.format(event_tracker['eventTrackerArn'], event_tracker['status'])) event_tracker_arns.append(event_tracker['eventTrackerArn']) max_time = time.time() + 30*60 # 30 mins while time.time() < max_time: for event_tracker_arn in event_tracker_arns: try: describe_response = personalize.describe_event_tracker(eventTrackerArn = event_tracker_arn) logger.debug('Event tracker {} status is {}'.format(event_tracker_arn, describe_response['eventTracker']['status'])) except ClientError as e: error_code = e.response['Error']['Code'] if error_code == 'ResourceNotFoundException': event_tracker_arns.remove(event_tracker_arn) if len(event_tracker_arns) == 0: logger.info('All event trackers have been deleted or none exist for dataset group') break else: logger.info('Waiting for {} event tracker(s) to be deleted'.format(len(event_tracker_arns))) time.sleep(20) if len(event_tracker_arns) > 0: raise Exception('Timed out waiting for all event trackers to be deleted') def _delete_filters(dataset_group_arn): filter_arns = [] filters_response = personalize.list_filters(datasetGroupArn = dataset_group_arn, maxResults = 100) for filter in filters_response['Filters']: logger.info('Deleting filter ' + filter['filterArn']) personalize.delete_filter(filterArn = filter['filterArn']) filter_arns.append(filter['filterArn']) max_time = time.time() + 30*60 # 30 mins while time.time() < max_time: for filter_arn in filter_arns: try: describe_response = personalize.describe_filter(filterArn = filter_arn) logger.debug('Filter {} status is {}'.format(filter_arn, describe_response['filter']['status'])) except ClientError as e: error_code = e.response['Error']['Code'] if error_code == 'ResourceNotFoundException': filter_arns.remove(filter_arn) if len(filter_arns) == 0: logger.info('All filters have been deleted or none exist for dataset group') break else: logger.info('Waiting for {} filter(s) to be deleted'.format(len(filter_arns))) time.sleep(20) if len(filter_arns) > 0: raise Exception('Timed out waiting for all filter to be deleted') def _delete_datasets_and_schemas(dataset_group_arn): dataset_arns = [] schema_arns = [] dataset_paginator = personalize.get_paginator('list_datasets') for dataset_page in dataset_paginator.paginate(datasetGroupArn = dataset_group_arn): for dataset in dataset_page['datasets']: describe_response = personalize.describe_dataset(datasetArn = dataset['datasetArn']) schema_arns.append(describe_response['dataset']['schemaArn']) if dataset['status'] in ['ACTIVE', 'CREATE FAILED']: logger.info('Deleting dataset ' + dataset['datasetArn']) personalize.delete_dataset(datasetArn = dataset['datasetArn']) elif dataset['status'].startswith('DELETE'): logger.warning('Dataset {} is already being deleted so will wait for delete to complete'.format(dataset['datasetArn'])) else: raise Exception('Dataset {} has a status of {} so cannot be deleted'.format(dataset['datasetArn'], dataset['status'])) dataset_arns.append(dataset['datasetArn']) max_time = time.time() + 30*60 # 30 mins while time.time() < max_time: for dataset_arn in dataset_arns: try: describe_response = personalize.describe_dataset(datasetArn = dataset_arn) logger.debug('Dataset {} status is {}'.format(dataset_arn, describe_response['dataset']['status'])) except ClientError as e: error_code = e.response['Error']['Code'] if error_code == 'ResourceNotFoundException': dataset_arns.remove(dataset_arn) if len(dataset_arns) == 0: logger.info('All datasets have been deleted or none exist for dataset group') break else: logger.info('Waiting for {} dataset(s) to be deleted'.format(len(dataset_arns))) time.sleep(20) if len(dataset_arns) > 0: raise Exception('Timed out waiting for all datasets to be deleted') for schema_arn in schema_arns: try: logger.info('Deleting schema ' + schema_arn) personalize.delete_schema(schemaArn = schema_arn) except ClientError as e: error_code = e.response['Error']['Code'] if error_code == 'ResourceInUseException': logger.info('Schema {} is still in-use by another dataset (likely in another dataset group)'.format(schema_arn)) else: raise e logger.info('All schemas used exclusively by datasets have been deleted or none exist for dataset group') def _delete_dataset_group(dataset_group_arn): logger.info('Deleting dataset group ' + dataset_group_arn) personalize.delete_dataset_group(datasetGroupArn = dataset_group_arn) max_time = time.time() + 30*60 # 30 mins while time.time() < max_time: try: describe_response = personalize.describe_dataset_group(datasetGroupArn = dataset_group_arn) logger.debug('Dataset group {} status is {}'.format(dataset_group_arn, describe_response['datasetGroup']['status'])) break except ClientError as e: error_code = e.response['Error']['Code'] if error_code == 'ResourceNotFoundException': logger.info('Dataset group {} has been fully deleted'.format(dataset_group_arn)) else: raise e logger.info('Waiting for dataset group to be deleted') time.sleep(20) def delete_dataset_groups(dataset_group_arns, region = None): global personalize personalize = boto3.client(service_name = 'personalize', region_name = region) for dataset_group_arn in dataset_group_arns: logger.info('Dataset Group ARN: ' + dataset_group_arn) solution_arns = _get_solutions(dataset_group_arn) # 1. Delete campaigns _delete_campaigns(solution_arns) # 2. Delete solutions _delete_solutions(solution_arns) # 3. Delete event trackers _delete_event_trackers(dataset_group_arn) # 4. Delete filters _delete_filters(dataset_group_arn) # 5. Delete datasets and their schemas _delete_datasets_and_schemas(dataset_group_arn) # 6. Delete dataset group _delete_dataset_group(dataset_group_arn) logger.info(f'Dataset group {dataset_group_arn} fully deleted')
StarcoderdataPython
1631499
<gh_stars>1-10 import threading, queue import time lock = threading.Lock() q = queue.Queue() c = 0 def task(i): global c d = 0 for v in range(100000): d += 1 with lock: c += d print("Thread %s" % (i)) if __name__ == "__main__": tasks = [] for i in range(100): add_task = threading.Thread(target=task, args=(i,)) add_task.start() tasks.append(add_task) for task in tasks: task.join() print("Final result of 100 times 100000: %s" % c)
StarcoderdataPython
3350401
<reponame>Thommy257/discopy # -*- coding: utf-8 -*- """ Implements classical-quantum circuits. Objects are :class:`Ty` generated by two basic types :code:`bit` and :code:`qubit`. Arrows are diagrams generated by :class:`QuantumGate`, :class:`ClassicalGate`, :class:`Discard`, :class:`Measure` and :class:`Encode`. >>> from discopy.quantum.gates import Ket, CX, H, X, Rz, sqrt, Controlled >>> circuit = Ket(0, 0) >> CX >> Controlled(Rz(0.25)) >> Measure() @ Discard() >>> circuit.draw( ... figsize=(3, 6), ... path='docs/_static/imgs/quantum/circuit-example.png') .. image:: ../_static/imgs/quantum/circuit-example.png :align: center >>> from discopy.grammar.pregroup import Word >>> from discopy.rigid import Ty, Cup, Id >>> s, n = Ty('s'), Ty('n') >>> Alice = Word('Alice', n) >>> loves = Word('loves', n.r @ s @ n.l) >>> Bob = Word('Bob', n) >>> grammar = Cup(n, n.r) @ Id(s) @ Cup(n.l, n) >>> sentence = grammar << Alice @ loves @ Bob >>> ob = {s: 0, n: 1} >>> ar = {Alice: Ket(0), ... loves: CX << sqrt(2) @ H @ X << Ket(0, 0), ... Bob: Ket(1)} >>> F = Functor(ob, ar) >>> assert abs(F(sentence).eval().array) ** 2 >>> from discopy import drawing >>> drawing.equation( ... sentence, F(sentence), symbol='$\\\\mapsto$', ... figsize=(6, 3), nodesize=.5, ... path='docs/_static/imgs/quantum/functor-example.png') .. image:: ../_static/imgs/quantum/functor-example.png :align: center """ import random from itertools import takewhile, chain from collections.abc import Mapping from discopy import messages, monoidal, rigid, tensor from discopy.cat import AxiomError from discopy.rigid import Diagram from discopy.tensor import Dim, Tensor from math import pi from functools import reduce, partial class AntiConjugate: def conjugate(self): return type(self)(-self.phase) l = r = property(conjugate) class RealConjugate: def conjugate(self): return self l = r = property(conjugate) class Anti2QubitConjugate: def conjugate(self): algebraic_conj = type(self)(-self.phase) return Swap(qubit, qubit) >> algebraic_conj >> Swap(qubit, qubit) l = r = property(conjugate) def index2bitstring(i, length): """ Turns an index into a bitstring of a given length. """ if i >= 2 ** length: raise ValueError("Index should be less than 2 ** length.") if not i and not length: return () return tuple(map(int, '{{:0{}b}}'.format(length).format(i))) def bitstring2index(bitstring): """ Turns a bitstring into an index. """ return sum(value * 2 ** i for i, value in enumerate(bitstring[::-1])) class Ob(RealConjugate, rigid.Ob): """ Implements the generating objects of :class:`Circuit`, i.e. information units of some integer dimension greater than 1. Examples -------- >>> assert bit.objects == [Ob("bit", dim=2)] >>> assert qubit.objects == [Ob("qubit", dim=2)] """ def __init__(self, name, dim=2, z=0): super().__init__(name) if z != 0: raise AxiomError("circuit.Ob are self-dual.") if not isinstance(dim, int) or dim < 2: raise ValueError("Dimension should be an int greater than 1.") self._dim = dim @property def dim(self): """ Dimension of the unit, e.g. :code:`dim=2` for bits and qubits. """ return self._dim def __repr__(self): return self.name class Digit(Ob): """ Classical unit of information of some dimension :code:`dim`. Examples -------- >>> assert bit.objects == [Digit(2)] == [Ob("bit", dim=2)] """ def __init__(self, dim, z=0): name = "bit" if dim == 2 else "Digit({})".format(dim) super().__init__(name, dim) class Qudit(Ob): """ Quantum unit of information of some dimension :code:`dim`. Examples -------- >>> assert qubit.objects == [Qudit(2)] == [Ob("qubit", dim=2)] """ def __init__(self, dim, z=0): name = "qubit" if dim == 2 else "Qudit({})".format(dim) super().__init__(name, dim) class Ty(rigid.Ty): """ Implements the input and output types of :class:`Circuit`. Examples -------- >>> assert bit == Ty(Digit(2)) >>> assert qubit == Ty(Qudit(2)) >>> assert bit @ qubit != qubit @ bit You can construct :code:`n` qubits by taking powers of :code:`qubit`: >>> print(bit ** 2 @ qubit ** 3) bit @ bit @ qubit @ qubit @ qubit """ @staticmethod def upgrade(old): return Ty(*old.objects) def __repr__(self): return str(self) bit, qubit = Ty(Digit(2)), Ty(Qudit(2)) @monoidal.Diagram.subclass class Circuit(tensor.Diagram): """ Classical-quantum circuits. """ def __repr__(self): return super().__repr__().replace('Diagram', 'Circuit') def conjugate(self): return self.l @property def is_mixed(self): """ Whether the circuit is mixed, i.e. it contains both bits and qubits or it discards qubits. Mixed circuits can be evaluated only by a :class:`CQMapFunctor` not a :class:`discopy.tensor.Functor`. """ both_bits_and_qubits = self.dom.count(bit) and self.dom.count(qubit)\ or any(layer.cod.count(bit) and layer.cod.count(qubit) for layer in self.layers) return both_bits_and_qubits or any(box.is_mixed for box in self.boxes) def init_and_discard(self): """ Returns a circuit with empty domain and only bits as codomain. """ from discopy.quantum.gates import Bits, Ket circuit = self if circuit.dom: init = Id(0).tensor(*( Bits(0) if x.name == "bit" else Ket(0) for x in circuit.dom)) circuit = init >> circuit if circuit.cod != bit ** len(circuit.cod): discards = Id(0).tensor(*( Discard() if x.name == "qubit" else Id(bit) for x in circuit.cod)) circuit = circuit >> discards return circuit def eval(self, *others, backend=None, mixed=False, contractor=None, **params): """ Evaluate a circuit on a backend, or simulate it with numpy. Parameters ---------- others : :class:`discopy.quantum.circuit.Circuit` Other circuits to process in batch. backend : pytket.Backend, optional Backend on which to run the circuit, if none then we apply :class:`discopy.tensor.Functor` or :class:`CQMapFunctor` instead. mixed : bool, optional Whether to apply :class:`discopy.tensor.Functor` or :class:`CQMapFunctor`. contractor : callable, optional Use :class:`tensornetwork` contraction instead of discopy's basic eval feature. params : kwargs, optional Get passed to Circuit.get_counts. Returns ------- tensor : :class:`discopy.tensor.Tensor` If :code:`backend is not None` or :code:`mixed=False`. cqmap : :class:`CQMap` Otherwise. Examples -------- We can evaluate a pure circuit (i.e. with :code:`not circuit.is_mixed`) as a unitary :class:`discopy.tensor.Tensor` or as a :class:`CQMap`: >>> from discopy.quantum import * >>> H.eval().round(2) # doctest: +ELLIPSIS Tensor(dom=Dim(2), cod=Dim(2), array=[0.71+0.j, ..., -0.71+0.j]) >>> H.eval(mixed=True).round(1) # doctest: +ELLIPSIS CQMap(dom=Q(Dim(2)), cod=Q(Dim(2)), array=[0.5+0.j, ..., 0.5+0.j]) We can evaluate a mixed circuit as a :class:`CQMap`: >>> assert Measure().eval()\\ ... == CQMap(dom=Q(Dim(2)), cod=C(Dim(2)), ... array=[1, 0, 0, 0, 0, 0, 0, 1]) >>> circuit = Bits(1, 0) @ Ket(0) >> Discard(bit ** 2 @ qubit) >>> assert circuit.eval() == CQMap(dom=CQ(), cod=CQ(), array=[1]) We can execute any circuit on a `pytket.Backend`: >>> circuit = Ket(0, 0) >> sqrt(2) @ H @ X >> CX >> Measure() @ Bra(0) >>> from discopy.quantum.tk import mockBackend >>> backend = mockBackend({(0, 1): 512, (1, 0): 512}) >>> assert circuit.eval(backend, n_shots=2**10).round()\\ ... == Tensor(dom=Dim(1), cod=Dim(2), array=[0., 1.]) """ from discopy.quantum import cqmap if contractor is not None: array = contractor(*self.to_tn(mixed=mixed)).tensor if self.is_mixed or mixed: f = cqmap.Functor() return cqmap.CQMap(f(self.dom), f(self.cod), array) f = tensor.Functor(lambda x: x[0].dim, {}) return Tensor(f(self.dom), f(self.cod), array) from discopy import cqmap from discopy.quantum.gates import Bits, scalar if len(others) == 1 and not isinstance(others[0], Circuit): # This allows the syntax :code:`circuit.eval(backend)` return self.eval(backend=others[0], mixed=mixed, **params) if backend is None: if others: return [circuit.eval(mixed=mixed, **params) for circuit in (self, ) + others] functor = cqmap.Functor() if mixed or self.is_mixed\ else tensor.Functor(lambda x: x[0].dim, lambda f: f.array) box = functor(self) return type(box)(box.dom, box.cod, box.array + 0j) circuits = [circuit.to_tk() for circuit in (self, ) + others] results, counts = [], circuits[0].get_counts( *circuits[1:], backend=backend, **params) for i, circuit in enumerate(circuits): n_bits = len(circuit.post_processing.dom) result = Tensor.zeros(Dim(1), Dim(*(n_bits * (2, )))) for bitstring, count in counts[i].items(): result += (scalar(count) @ Bits(*bitstring)).eval() if circuit.post_processing: result = result >> circuit.post_processing.eval() results.append(result) return results if len(results) > 1 else results[0] def get_counts(self, *others, backend=None, **params): """ Get counts from a backend, or simulate them with numpy. Parameters ---------- others : :class:`discopy.quantum.circuit.Circuit` Other circuits to process in batch. backend : pytket.Backend, optional Backend on which to run the circuit, if none then `numpy`. n_shots : int, optional Number of shots, default is :code:`2**10`. measure_all : bool, optional Whether to measure all qubits, default is :code:`False`. normalize : bool, optional Whether to normalize the counts, default is :code:`True`. post_select : bool, optional Whether to perform post-selection, default is :code:`True`. scale : bool, optional Whether to scale the output, default is :code:`True`. seed : int, optional Seed to feed the backend, default is :code:`None`. compilation : callable, optional Compilation function to apply before getting counts. Returns ------- counts : dict From bitstrings to counts. Examples -------- >>> from discopy.quantum import * >>> circuit = H @ X >> CX >> Measure(2) >>> from discopy.quantum.tk import mockBackend >>> backend = mockBackend({(0, 1): 512, (1, 0): 512}) >>> circuit.get_counts(backend, n_shots=2**10) {(0, 1): 0.5, (1, 0): 0.5} """ if len(others) == 1 and not isinstance(others[0], Circuit): # This allows the syntax :code:`circuit.get_counts(backend)` return self.get_counts(backend=others[0], **params) if backend is None: if others: return [circuit.get_counts(**params) for circuit in (self, ) + others] utensor, counts = self.init_and_discard().eval(), dict() for i in range(2**len(utensor.cod)): bits = index2bitstring(i, len(utensor.cod)) if utensor.array[bits]: counts[bits] = utensor.array[bits].real return counts counts = self.to_tk().get_counts( *(other.to_tk() for other in others), backend=backend, **params) return counts if len(counts) > 1 else counts[0] def measure(self, mixed=False): """ Measures a circuit on the computational basis using :code:`numpy`. Parameters ---------- mixed : bool, optional Whether to apply :class:`tensor.Functor` or :class:`cqmap.Functor`. Returns ------- array : numpy.ndarray """ from discopy.quantum.gates import Bra, Ket if mixed or self.is_mixed: return self.init_and_discard().eval(mixed=True).array.real state = (Ket(*(len(self.dom) * [0])) >> self).eval() effects = [Bra(*index2bitstring(j, len(self.cod))).eval() for j in range(2 ** len(self.cod))] array = Tensor.np.zeros(len(self.cod) * (2, )) + 0j for effect in effects: array +=\ effect.array * Tensor.np.absolute((state >> effect).array) ** 2 return array def to_tn(self, mixed=False): """ Sends a diagram to a mixed :code:`tensornetwork`. Parameters ---------- mixed : bool, default: False Whether to perform mixed (also known as density matrix) evaluation of the circuit. Returns ------- nodes : :class:`tensornetwork.Node` Nodes of the network. output_edge_order : list of :class:`tensornetwork.Edge` Output edges of the network. """ if not mixed and not self.is_mixed: return super().to_tn() import tensornetwork as tn from discopy.quantum import ( qubit, bit, ClassicalGate, Copy, Match, Discard, SWAP) for box in self.boxes + [self]: if set(box.dom @ box.cod) - set(bit @ qubit): raise ValueError( "Only circuits with qubits and bits are supported.") # try to decompose some gates diag = Id(self.dom) last_i = 0 for i, box in enumerate(self.boxes): if hasattr(box, '_decompose'): decomp = box._decompose() if box != decomp: diag >>= self[last_i:i] left, _, right = self.layers[i] diag >>= Id(left) @ decomp @ Id(right) last_i = i + 1 diag >>= self[last_i:] self = diag c_nodes = [tn.CopyNode(2, 2, f'c_input_{i}', dtype=complex) for i in range(self.dom.count(bit))] q_nodes1 = [tn.CopyNode(2, 2, f'q1_input_{i}', dtype=complex) for i in range(self.dom.count(qubit))] q_nodes2 = [tn.CopyNode(2, 2, f'q2_input_{i}', dtype=complex) for i in range(self.dom.count(qubit))] inputs = [n[0] for n in c_nodes + q_nodes1 + q_nodes2] c_scan = [n[1] for n in c_nodes] q_scan1 = [n[1] for n in q_nodes1] q_scan2 = [n[1] for n in q_nodes2] nodes = c_nodes + q_nodes1 + q_nodes2 for box, layer, offset in zip(self.boxes, self.layers, self.offsets): if box == Circuit.swap(bit, bit): left, _, _ = layer c_offset = left.count(bit) c_scan[c_offset], c_scan[c_offset + 1] =\ c_scan[c_offset + 1], c_scan[c_offset] elif box.is_mixed or isinstance(box, ClassicalGate): c_dom = box.dom.count(bit) q_dom = box.dom.count(qubit) c_cod = box.cod.count(bit) left, _, _ = layer c_offset = left.count(bit) q_offset = left.count(qubit) if isinstance(box, Discard): assert box.n_qubits == 1 tn.connect(q_scan1[q_offset], q_scan2[q_offset]) del q_scan1[q_offset] del q_scan2[q_offset] continue if isinstance(box, (Copy, Match, Measure, Encode)): assert len(box.dom) == 1 or len(box.cod) == 1 node = tn.CopyNode(3, 2, 'cq_' + str(box), dtype=complex) else: # only unoptimised gate is MixedState() array = box.eval(mixed=True).array node = tn.Node(array + 0j, 'cq_' + str(box)) for i in range(c_dom): tn.connect(c_scan[c_offset + i], node[i]) for i in range(q_dom): tn.connect(q_scan1[q_offset + i], node[c_dom + i]) for i in range(q_dom): tn.connect(q_scan2[q_offset + i], node[c_dom + q_dom + i]) cq_dom = c_dom + 2 * q_dom c_edges = node[cq_dom:cq_dom + c_cod] q_edges1 = node[cq_dom + c_cod::2] q_edges2 = node[cq_dom + c_cod + 1::2] c_scan = (c_scan[:c_offset] + c_edges + c_scan[c_offset + c_dom:]) q_scan1 = (q_scan1[:q_offset] + q_edges1 + q_scan1[q_offset + q_dom:]) q_scan2 = (q_scan2[:q_offset] + q_edges2 + q_scan2[q_offset + q_dom:]) nodes.append(node) else: left, _, _ = layer q_offset = left[:offset + 1].count(qubit) if box == SWAP: q_scan1[q_offset], q_scan1[q_offset + 1] =\ q_scan1[q_offset + 1], q_scan1[q_offset] q_scan2[q_offset], q_scan2[q_offset + 1] =\ q_scan2[q_offset + 1], q_scan2[q_offset] continue utensor = box.array node1 = tn.Node(utensor.conjugate() + 0j, 'q1_' + str(box)) node2 = tn.Node(utensor + 0j, 'q2_' + str(box)) for i in range(len(box.dom)): tn.connect(q_scan1[q_offset + i], node1[i]) tn.connect(q_scan2[q_offset + i], node2[i]) edges1 = node1[len(box.dom):] edges2 = node2[len(box.dom):] q_scan1 = (q_scan1[:q_offset] + edges1 + q_scan1[q_offset + len(box.dom):]) q_scan2 = (q_scan2[:q_offset] + edges2 + q_scan2[q_offset + len(box.dom):]) nodes.extend([node1, node2]) outputs = c_scan + q_scan1 + q_scan2 return nodes, inputs + outputs def to_tk(self): """ Export to t|ket>. Returns ------- tk_circuit : pytket.Circuit A :class:`pytket.Circuit`. Note ---- * No measurements are performed. * SWAP gates are treated as logical swaps. * If the circuit contains scalars or a :class:`Bra`, then :code:`tk_circuit` will hold attributes :code:`post_selection` and :code:`scalar`. Examples -------- >>> from discopy.quantum import * >>> bell_test = H @ Id(1) >> CX >> Measure() @ Measure() >>> bell_test.to_tk() tk.Circuit(2, 2).H(0).CX(0, 1).Measure(0, 0).Measure(1, 1) >>> circuit0 = sqrt(2) @ H @ Rx(0.5) >> CX >> Measure() @ Discard() >>> circuit0.to_tk() tk.Circuit(2, 1).H(0).Rx(1.0, 1).CX(0, 1).Measure(0, 0).scale(2) >>> circuit1 = Ket(1, 0) >> CX >> Id(1) @ Ket(0) @ Id(1) >>> circuit1.to_tk() tk.Circuit(3).X(0).CX(0, 2) >>> circuit2 = X @ Id(2) >> Id(1) @ SWAP >> CX @ Id(1) >> Id(1) @ SWAP >>> circuit2.to_tk() tk.Circuit(3).X(0).CX(0, 2) >>> circuit3 = Ket(0, 0)\\ ... >> H @ Id(1)\\ ... >> Id(1) @ X\\ ... >> CX\\ ... >> Id(1) @ Bra(0) >>> print(repr(circuit3.to_tk())) tk.Circuit(2, 1).H(0).X(1).CX(0, 1).Measure(1, 0).post_select({0: 0}) """ # pylint: disable=import-outside-toplevel from discopy.quantum.tk import to_tk return to_tk(self) @staticmethod def from_tk(*tk_circuits): """ Translates a :class:`pytket.Circuit` into a :class:`Circuit`, or a list of :class:`pytket` circuits into a :class:`Sum`. Parameters ---------- tk_circuits : pytket.Circuit potentially with :code:`scalar` and :code:`post_selection` attributes. Returns ------- circuit : :class:`Circuit` Such that :code:`Circuit.from_tk(circuit.to_tk()) == circuit`. Note ---- * :meth:`Circuit.init_and_discard` is applied beforehand. * SWAP gates are introduced when applying gates to non-adjacent qubits. Examples -------- >>> from discopy.quantum import * >>> import pytket as tk >>> c = Rz(0.5) @ Id(1) >> Id(1) @ Rx(0.25) >> CX >>> assert Circuit.from_tk(c.to_tk()) == c.init_and_discard() >>> tk_GHZ = tk.Circuit(3).H(1).CX(1, 2).CX(1, 0) >>> pprint = lambda c: print(str(c).replace(' >>', '\\n >>')) >>> pprint(Circuit.from_tk(tk_GHZ)) Ket(0) >> Id(1) @ Ket(0) >> Id(2) @ Ket(0) >> Id(1) @ H @ Id(1) >> Id(1) @ CX >> SWAP @ Id(1) >> CX @ Id(1) >> SWAP @ Id(1) >> Discard(qubit) @ Id(2) >> Discard(qubit) @ Id(1) >> Discard(qubit) >>> circuit = Ket(1, 0) >> CX >> Id(1) @ Ket(0) @ Id(1) >>> print(Circuit.from_tk(circuit.to_tk())[3:-3]) X @ Id(2) >> Id(1) @ SWAP >> CX @ Id(1) >> Id(1) @ SWAP >>> bell_state = Circuit.caps(qubit, qubit) >>> bell_effect = bell_state[::-1] >>> circuit = bell_state @ Id(1) >> Id(1) @ bell_effect >> Bra(0) >>> pprint(Circuit.from_tk(circuit.to_tk())[3:]) H @ Id(2) >> CX @ Id(1) >> Id(1) @ CX >> Id(1) @ H @ Id(1) >> Bra(0) @ Id(2) >> Bra(0) @ Id(1) >> Bra(0) >> scalar(4) """ # pylint: disable=import-outside-toplevel from discopy.quantum.tk import from_tk if not tk_circuits: return Sum([], qubit ** 0, qubit ** 0) if len(tk_circuits) == 1: return from_tk(tk_circuits[0]) return sum(Circuit.from_tk(c) for c in tk_circuits) def grad(self, var, **params): """ Gradient with respect to :code:`var`. Parameters ---------- var : sympy.Symbol Differentiated variable. Returns ------- circuit : `discopy.quantum.circuit.Sum` Examples -------- >>> from sympy.abc import phi >>> from discopy.quantum import * >>> circuit = Rz(phi / 2) @ Rz(phi + 1) >> CX >>> assert circuit.grad(phi, mixed=False)\\ ... == (Rz(phi / 2) @ scalar(pi) @ Rz(phi + 1.5) >> CX)\\ ... + (scalar(pi/2) @ Rz(phi/2 + .5) @ Rz(phi + 1) >> CX) """ return super().grad(var, **params) def jacobian(self, variables, **params): """ Jacobian with respect to :code:`variables`. Parameters ---------- variables : List[sympy.Symbol] Differentiated variables. Returns ------- circuit : `discopy.quantum.circuit.Sum` with :code:`circuit.dom == self.dom` and :code:`circuit.cod == Digit(len(variables)) @ self.cod`. Examples -------- >>> from sympy.abc import x, y >>> from discopy.quantum.gates import Bits, Ket, Rx, Rz >>> circuit = Ket(0) >> Rx(x) >> Rz(y) >>> assert circuit.jacobian([x, y])\\ ... == (Bits(0) @ circuit.grad(x)) + (Bits(1) @ circuit.grad(y)) >>> assert not circuit.jacobian([]) >>> assert circuit.jacobian([x]) == circuit.grad(x) """ if not variables: return Sum([], self.dom, self.cod) if len(variables) == 1: return self.grad(variables[0], **params) from discopy.quantum.gates import Digits return sum(Digits(i, dim=len(variables)) @ self.grad(x, **params) for i, x in enumerate(variables)) def draw(self, **params): """ We draw the labels of a circuit whenever it's mixed. """ draw_type_labels = params.get('draw_type_labels') or self.is_mixed params = dict({'draw_type_labels': draw_type_labels}, **params) return super().draw(**params) @staticmethod def swap(left, right): return monoidal.Diagram.swap( left, right, ar_factory=Circuit, swap_factory=Swap) @staticmethod def permutation(perm, dom=None): if dom is None: dom = qubit ** len(perm) return monoidal.Diagram.permutation(perm, dom, ar_factory=Circuit) @staticmethod def cups(left, right): from discopy.quantum.gates import CX, H, sqrt, Bra, Match def cup_factory(left, right): if left == right == qubit: return CX >> H @ sqrt(2) @ Id(1) >> Bra(0, 0) if left == right == bit: return Match() >> Discard(bit) raise ValueError return rigid.cups( left, right, ar_factory=Circuit, cup_factory=cup_factory) @staticmethod def caps(left, right): return Circuit.cups(left, right).dagger() @staticmethod def spiders(n_legs_in, n_legs_out, dim): from discopy.quantum.gates import CX, H, Bra, sqrt t = rigid.Ty('PRO') if len(dim) == 0: return Id() def decomp_ar(spider): return spider.decompose() def spider_ar(spider): dom, cod = len(spider.dom), len(spider.cod) if dom < cod: return spider_ar(spider.dagger()).dagger() circ = Id(qubit) if dom == 2: circ = CX >> Id(qubit) @ Bra(0) if cod == 0: circ >>= H >> Bra(0) @ sqrt(2) return circ diag = Diagram.spiders(n_legs_in, n_legs_out, t ** len(dim)) decomp = monoidal.Functor(ob={t: t}, ar=decomp_ar) to_circ = monoidal.Functor(ob={t: qubit}, ar=spider_ar, ar_factory=Circuit, ob_factory=Ty) circ = to_circ(decomp(diag)) return circ def _apply_gate(self, gate, position): """ Apply gate at position """ if position < 0 or position >= len(self.cod): raise ValueError(f'Index {position} out of range.') left = Id(position) right = Id(len(self.cod) - len(left.cod) - len(gate.cod)) return self >> left @ gate @ right def _apply_controlled(self, base_gate, *xs): from discopy.quantum import Controlled if len(set(xs)) != len(xs): raise ValueError(f'Indices {xs} not unique.') if min(xs) < 0 or max(xs) >= len(self.cod): raise ValueError(f'Indices {xs} out of range.') before = sorted(filter(lambda x: x < xs[-1], xs[:-1])) after = sorted(filter(lambda x: x > xs[-1], xs[:-1])) gate = base_gate last_x = xs[-1] for x in before[::-1]: gate = Controlled(gate, distance=last_x - x) last_x = x last_x = xs[-1] for x in after[::-1]: gate = Controlled(gate, distance=last_x - x) last_x = x return self._apply_gate(gate, min(xs)) def H(self, x): """ Apply Hadamard gate to circuit. """ from discopy.quantum import H return self._apply_gate(H, x) def S(self, x): """ Apply S gate to circuit. """ from discopy.quantum import S return self._apply_gate(S, x) def X(self, x): """ Apply Pauli X gate to circuit. """ from discopy.quantum import X return self._apply_gate(X, x) def Y(self, x): """ Apply Pauli Y gate to circuit. """ from discopy.quantum import Y return self._apply_gate(Y, x) def Z(self, x): """ Apply Pauli Z gate to circuit. """ from discopy.quantum import Z return self._apply_gate(Z, x) def Rx(self, phase, x): """ Apply Rx gate to circuit. """ from discopy.quantum import Rx return self._apply_gate(Rx(phase), x) def Ry(self, phase, x): """ Apply Rx gate to circuit. """ from discopy.quantum import Ry return self._apply_gate(Ry(phase), x) def Rz(self, phase, x): """ Apply Rz gate to circuit. """ from discopy.quantum import Rz return self._apply_gate(Rz(phase), x) def CX(self, x, y): """ Apply Controlled X / CNOT gate to circuit. """ from discopy.quantum import X return self._apply_controlled(X, x, y) def CY(self, x, y): """ Apply Controlled Y gate to circuit. """ from discopy.quantum import Y return self._apply_controlled(Y, x, y) def CZ(self, x, y): """ Apply Controlled Z gate to circuit. """ from discopy.quantum import Z return self._apply_controlled(Z, x, y) def CCX(self, x, y, z): """ Apply Controlled CX / Toffoli gate to circuit. """ from discopy.quantum import X return self._apply_controlled(X, x, y, z) def CCZ(self, x, y, z): """ Apply Controlled CZ gate to circuit. """ from discopy.quantum import Z return self._apply_controlled(Z, x, y, z) def CRx(self, phase, x, y): """ Apply Controlled Rx gate to circuit. """ from discopy.quantum import Rx return self._apply_controlled(Rx(phase), x, y) def CRz(self, phase, x, y): """ Apply Controlled Rz gate to circuit. """ from discopy.quantum import Rz return self._apply_controlled(Rz(phase), x, y) class Id(rigid.Id, Circuit): """ Identity circuit. """ def __init__(self, dom=0): if isinstance(dom, int): dom = qubit ** dom self._qubit_only = all(x.name == "qubit" for x in dom) rigid.Id.__init__(self, dom) Circuit.__init__(self, dom, dom, [], []) def __repr__(self): return "Id({})".format(len(self.dom) if self._qubit_only else self.dom) def __str__(self): return repr(self) Circuit.id = Id class Box(rigid.Box, Circuit): """ Boxes in a circuit diagram. Parameters ---------- name : any dom : discopy.quantum.circuit.Ty cod : discopy.quantum.circuit.Ty is_mixed : bool, optional Whether the box is mixed, default is :code:`True`. _dagger : bool, optional If set to :code:`None` then the box is self-adjoint. """ def __init__(self, name, dom, cod, is_mixed=True, data=None, _dagger=False, _conjugate=False): if dom and not isinstance(dom, Ty): raise TypeError(messages.type_err(Ty, dom)) if cod and not isinstance(cod, Ty): raise TypeError(messages.type_err(Ty, cod)) z = 1 if _conjugate else 0 self._conjugate = _conjugate rigid.Box.__init__( self, name, dom, cod, data=data, _dagger=_dagger, _z=z) Circuit.__init__(self, dom, cod, [self], [0]) if not is_mixed: if all(isinstance(x, Digit) for x in dom @ cod): self.classical = True elif all(isinstance(x, Qudit) for x in dom @ cod): self.classical = False else: raise ValueError( "dom and cod should be Digits only or Qudits only.") self._mixed = is_mixed def grad(self, var, **params): if var not in self.free_symbols: return Sum([], self.dom, self.cod) raise NotImplementedError @property def is_mixed(self): return self._mixed def __repr__(self): return self.name class Sum(tensor.Sum, Box): """ Sums of circuits. """ @staticmethod def upgrade(old): return Sum(old.terms, old.dom, old.cod) @property def is_mixed(self): return any(circuit.is_mixed for circuit in self.terms) def get_counts(self, backend=None, **params): if not self.terms: return {} if len(self.terms) == 1: return self.terms[0].get_counts(backend=backend, **params) counts = Circuit.get_counts(*self.terms, backend=backend, **params) result = {} for circuit_counts in counts: for bitstring, count in circuit_counts.items(): result[bitstring] = result.get(bitstring, 0) + count return result def eval(self, backend=None, mixed=False, **params): mixed = mixed or any(t.is_mixed for t in self.terms) if not self.terms: return 0 if len(self.terms) == 1: return self.terms[0].eval(backend=backend, mixed=mixed, **params) return sum( Circuit.eval(*self.terms, backend=backend, mixed=mixed, **params)) def grad(self, var, **params): return sum(circuit.grad(var, **params) for circuit in self.terms) def to_tk(self): return [circuit.to_tk() for circuit in self.terms] Circuit.sum = Sum class Swap(rigid.Swap, Box): """ Implements swaps of circuit wires. """ def __init__(self, left, right): rigid.Swap.__init__(self, left, right) Box.__init__( self, self.name, self.dom, self.cod, is_mixed=left != right) def dagger(self): return Swap(self.right, self.left) def conjugate(self): return Swap(self.right, self.left) l = r = property(conjugate) def __repr__(self): return "SWAP"\ if self.left == self.right == qubit else super().__repr__() def __str__(self): return repr(self) class Discard(RealConjugate, Box): """ Discard n qubits. If :code:`dom == bit` then marginal distribution. """ def __init__(self, dom=1): if isinstance(dom, int): dom = qubit ** dom super().__init__( "Discard({})".format(dom), dom, qubit ** 0, is_mixed=True) self.draw_as_discards = True self.n_qubits = len(dom) def dagger(self): return MixedState(self.dom) def _decompose(self): return Id().tensor(*[Discard()] * self.n_qubits) class MixedState(RealConjugate, Box): """ Maximally-mixed state on n qubits. If :code:`cod == bit` then uniform distribution. """ def __init__(self, cod=1): if isinstance(cod, int): cod = qubit ** cod super().__init__( "MixedState({})".format(cod), qubit ** 0, cod, is_mixed=True) self.drawing_name = "MixedState" if cod == bit: self.drawing_name = "" self.draw_as_spider, self.color = True, "black" def dagger(self): return Discard(self.cod) def _decompose(self): return Id().tensor(*[MixedState()] * len(self.cod)) class Measure(RealConjugate, Box): """ Measure n qubits into n bits. Parameters ---------- n_qubits : int Number of qubits to measure. destructive : bool, optional Whether to do a non-destructive measurement instead. override_bits : bool, optional Whether to override input bits, this is the standard behaviour of tket. """ def __init__(self, n_qubits=1, destructive=True, override_bits=False): dom, cod = qubit ** n_qubits, bit ** n_qubits name = "Measure({})".format("" if n_qubits == 1 else n_qubits) if not destructive: cod = qubit ** n_qubits @ cod name = name\ .replace("()", "(1)").replace(')', ", destructive=False)") if override_bits: dom = dom @ bit ** n_qubits name = name\ .replace("()", "(1)").replace(')', ", override_bits=True)") super().__init__(name, dom, cod, is_mixed=True) self.destructive, self.override_bits = destructive, override_bits self.n_qubits = n_qubits self.draw_as_measures = True def dagger(self): return Encode(self.n_qubits, constructive=self.destructive, reset_bits=self.override_bits) def _decompose(self): return Id().tensor(*[ Measure(destructive=self.destructive, override_bits=self.override_bits)] * self.n_qubits) class Encode(RealConjugate, Box): """ Controlled preparation, i.e. encode n bits into n qubits. Parameters ---------- n_bits : int Number of bits to encode. constructive : bool, optional Whether to do a classically-controlled correction instead. reset_bits : bool, optional Whether to reset the bits to the uniform distribution. """ def __init__(self, n_bits=1, constructive=True, reset_bits=False): dom, cod = bit ** n_bits, qubit ** n_bits name = Measure(n_bits, constructive, reset_bits).name\ .replace("Measure", "Encode")\ .replace("destructive", "constructive")\ .replace("override_bits", "reset_bits") super().__init__(name, dom, cod, is_mixed=True) self.constructive, self.reset_bits = constructive, reset_bits self.n_bits = n_bits def dagger(self): return Measure(self.n_bits, destructive=self.constructive, override_bits=self.reset_bits) def _decompose(self): return Id().tensor(*[ Encode(constructive=self.constructive, reset_bits=self.reset_bits)] * self.n_bits) class Functor(rigid.Functor): """ Functors into :class:`Circuit`. """ def __init__(self, ob, ar): if isinstance(ob, Mapping): ob = {x: qubit ** y if isinstance(y, int) else y for x, y in ob.items()} super().__init__(ob, ar, ob_factory=Ty, ar_factory=Circuit) def __repr__(self): return super().__repr__().replace("Functor", "circuit.Functor") class IQPansatz(Circuit): """ Builds an IQP ansatz on n qubits, if n = 1 returns an Euler decomposition >>> pprint = lambda c: print(str(c).replace(' >>', '\\n >>')) >>> pprint(IQPansatz(3, [[0.1, 0.2], [0.3, 0.4]])) H @ Id(2) >> Id(1) @ H @ Id(1) >> Id(2) @ H >> CRz(0.1) @ Id(1) >> Id(1) @ CRz(0.2) >> H @ Id(2) >> Id(1) @ H @ Id(1) >> Id(2) @ H >> CRz(0.3) @ Id(1) >> Id(1) @ CRz(0.4) >>> print(IQPansatz(1, [0.3, 0.8, 0.4])) Rx(0.3) >> Rz(0.8) >> Rx(0.4) """ def __init__(self, n_qubits, params): from discopy.quantum.gates import H, Rx, Rz, CRz def layer(thetas): hadamards = Id(0).tensor(*(n_qubits * [H])) rotations = Id(n_qubits).then(*( Id(i) @ CRz(thetas[i]) @ Id(n_qubits - 2 - i) for i in range(n_qubits - 1))) return hadamards >> rotations if n_qubits == 1: circuit = Rx(params[0]) >> Rz(params[1]) >> Rx(params[2]) elif len(Tensor.np.shape(params)) != 2\ or Tensor.np.shape(params)[1] != n_qubits - 1: raise ValueError( "Expected params of shape (depth, {})".format(n_qubits - 1)) else: depth = Tensor.np.shape(params)[0] circuit = Id(n_qubits).then(*( layer(params[i]) for i in range(depth))) super().__init__( circuit.dom, circuit.cod, circuit.boxes, circuit.offsets) def real_amp_ansatz(params: Tensor.np.ndarray, *, entanglement='full'): """ The real-amplitudes 2-local circuit. The shape of the params determines the number of layers and the number of qubits respectively (layers, qubit). This heuristic generates orthogonal operators so the imaginary part of the correponding matrix is always the zero matrix. :param params: A 2D numpy array of parameters. :param entanglement: Configuration for the entaglement, currently either 'full' (default), 'linear' or 'circular'. """ from discopy.quantum.gates import CX, Ry, rewire ext_cx = partial(rewire, CX) assert entanglement in ('linear', 'circular', 'full') params = Tensor.np.asarray(params) assert params.ndim == 2 dom = qubit**params.shape[1] def layer(v, is_last=False): n = len(dom) rys = Id(0).tensor(*(Ry(v[k]) for k in range(n))) if is_last: return rys if entanglement == 'full': cxs = [[ext_cx(k1, k2, dom=dom) for k2 in range(k1 + 1, n)] for k1 in range(n - 1)] cxs = reduce(lambda a, b: a >> b, chain(*cxs)) else: cxs = [ext_cx(k, k + 1, dom=dom) for k in range(n - 1)] cxs = reduce(lambda a, b: a >> b, cxs) if entanglement == 'circular': cxs = ext_cx(n - 1, 0, dom=dom) >> cxs return rys >> cxs circuit = [layer(v, is_last=idx == (len(params) - 1)) for idx, v in enumerate(params)] circuit = reduce(lambda a, b: a >> b, circuit) return circuit def random_tiling(n_qubits, depth=3, gateset=None, seed=None): """ Returns a random Euler decomposition if n_qubits == 1, otherwise returns a random tiling with the given depth and gateset. >>> from discopy.quantum.gates import CX, H, T, Rx, Rz >>> c = random_tiling(1, seed=420) >>> print(c) Rx(0.0263) >> Rz(0.781) >> Rx(0.273) >>> print(random_tiling(2, 2, gateset=[CX, H, T], seed=420)) CX >> T @ Id(1) >> Id(1) @ T >>> print(random_tiling(3, 2, gateset=[CX, H, T], seed=420)) CX @ Id(1) >> Id(2) @ T >> H @ Id(2) >> Id(1) @ H @ Id(1) >> Id(2) @ H >>> print(random_tiling(2, 1, gateset=[Rz, Rx], seed=420)) Rz(0.673) @ Id(1) >> Id(1) @ Rx(0.273) """ from discopy.quantum.gates import H, CX, Rx, Rz, Parametrized gateset = gateset or [H, Rx, CX] if seed is not None: random.seed(seed) if n_qubits == 1: phases = [random.random() for _ in range(3)] return Rx(phases[0]) >> Rz(phases[1]) >> Rx(phases[2]) result = Id(n_qubits) for _ in range(depth): line, n_affected = Id(0), 0 while n_affected < n_qubits: gate = random.choice( gateset if n_qubits - n_affected > 1 else [ g for g in gateset if g is Rx or g is Rz or len(g.dom) == 1]) if isinstance(gate, type) and issubclass(gate, Parametrized): gate = gate(random.random()) line = line @ gate n_affected += len(gate.dom) result = result >> line return result
StarcoderdataPython
3218631
<gh_stars>1-10 #!/usr/bin/env python3 import os, sys from lxml.etree import Element, ElementTree class XmlBase (object): nsmap = { 'ds': 'http://schema.programmfabrik.de/database-schema/0.1', 'es': 'http://schema.programmfabrik.de/easydb-database-schema/0.1', 'em': 'http://schema.programmfabrik.de/easydb-mask-schema/0.1', } class Searchable (XmlBase): def __init__(self, xml): self.search_expert = xml.find('em:search/em:expert', self.nsmap).attrib['enabled'] == '1' self.search_facet = xml.find('em:search/em:facet', self.nsmap).attrib['enabled'] == '1' self.search_fulltext = xml.find('em:search/em:fulltext', self.nsmap).attrib['enabled'] == '1' self.search_flags = \ (self.search_expert and 'E' or '') + \ (self.search_facet and 'F' or '') + \ (self.search_fulltext and 'V' or '') class Field (Searchable): def __init__(self, xml): super(Field, self).__init__(xml) self.name = xml.attrib.get('column-name-hint') class LinkedTable (Searchable): def __init__(self, xml): super(LinkedTable, self).__init__(xml) self.name = xml.attrib.get('other-table-hint') class ReverseLinkedTable (LinkedTable): def __init__(self, xml): super(ReverseLinkedTable, self).__init__(xml) class Analyzer (XmlBase): @classmethod def analyze_masks(cls, maskxmlfile, mask_name): tree = ElementTree() tree.parse(maskxmlfile) root = tree.getroot() if mask_name is not None: mask = root.find("em:mask[@name='{0}']".format(mask_name), cls.nsmap) if mask is None: sys.stderr.write("failed to find mask '{0}'\n".format(mask_name)) sys.exit(1) cls._analyze_mask(mask) else: for mask in root.findall('em:mask', cls.nsmap): cls._analyze_mask(mask) @classmethod def _analyze_mask(cls, mask, indent = ''): print("{0}M:{1}".format(indent, mask.get('name', '<unnamed>'))) for rlinkedxml in mask.findall('em:fields/em:reverse-linked-table', cls.nsmap): rlinked = ReverseLinkedTable(rlinkedxml) if len(rlinked.search_flags): print("{0} R:{1} ({2})".format(indent, rlinked.name, rlinked.search_flags)) maskxml = rlinkedxml.find('em:mask', cls.nsmap) if maskxml is not None: cls._analyze_mask(maskxml, indent + ' ') for linkedxml in mask.findall('em:fields/em:linked-table', cls.nsmap): linked = LinkedTable(linkedxml) if len(linked.search_flags): print("{0} N:{1} ({2})".format(indent, linked.name, linked.search_flags)) maskxml = linkedxml.find('em:mask', cls.nsmap) if maskxml is not None: cls._analyze_mask(maskxml, indent + ' ') for fieldxml in mask.findall('em:fields/em:field', cls.nsmap): field = Field(fieldxml) if len(field.search_flags): print("{0} F:{1} ({2})".format(indent, field.name, field.search_flags)) if __name__ == '__main__': if len(sys.argv) < 2: sys.stderr.write('usage: {0} <maskset.xml> [<mask name>]\n'.format(sys.argv[0])) sys.exit(1) if not os.path.isfile(sys.argv[1]): sys.stderr.write('failed to find {0}\n'.format(sys.argv[1])) sys.exit(1) Analyzer.analyze_masks(sys.argv[1], len(sys.argv) > 2 and sys.argv[2] or None)
StarcoderdataPython
10332
from ..le_apcf_command_pkt import LE_APCF_Command from struct import pack, unpack from enum import IntEnum """ This pare base on spec <<Android BT HCI Requirement for BLE feature>> v0.52 Advertisement Package Content filter """ class APCF_Service_Data(LE_APCF_Command): def __init__(self): # TODO generate cmd super().__init__() def __str__(self): return super().__str__()+''.join(['{}']).format("")
StarcoderdataPython
1679339
from pathlib import * from winreg import * import subprocess, time, os, re, sys a, ot, devic, adbcommand = 0, '', [], [] exe = sys.executable # pathtest = 0 adbpath = 0 adbpathdir = 0 # dname = Path(exe).parent # dname = Path(dname, 'adb') # fil = [Path(dname, 'adb.exe'), Path(dname, 'AdbWinApi.dll')] # try: os.chdir(dname) # except (ValueError, Exception): pass def spr(q): global adbpath, adbpathdir flag = 0 if q == 1: try: a = OpenKey(HKEY_LOCAL_MACHINE, 'SOFTWARE\\BlueStacks', 0, KEY_WOW64_64KEY | KEY_ALL_ACCESS) except WindowsError: return False try: m = 0 while True: if EnumValue(a, m)[0] == 'InstallDir': adbpath = Path(EnumValue(a, m)[1] + '\\HD-Adb.exe') flag += 1 CloseKey(HKEY_LOCAL_MACHINE) break m += 1 except WindowsError: CloseKey(HKEY_LOCAL_MACHINE) if flag == 0: return False else: try: a = OpenKey(HKEY_LOCAL_MACHINE, r'SOFTWARE\DuoDianOnline\SetupInfo', 0, KEY_WOW64_32KEY | KEY_ALL_ACCESS) except WindowsError: return False try: m = 0 while True: if EnumValue(a, m)[0] == 'InstallPath': adbpath = Path(EnumValue(a, m)[1]+'\\bin\\nox_adb.exe') flag += 1 CloseKey(HKEY_LOCAL_MACHINE) break m += 1 except WindowsError: CloseKey(HKEY_LOCAL_MACHINE) if flag == 0: return False try: adbpathdir = Path(adbpath).parent if not adbpath.is_file(): return False except: return False os.chdir(adbpathdir) return True def sear(pr, em): global a a = 1 if em == 1: if re.findall('emulator-[0-9]{1,6}', pr): devic.append(re.findall('emulator-[0-9]{1,6}', pr)); a = 3; return a if em == 2: if re.findall('\d{1,3}\.\d{1,3}\.\d{1,3}\.\d{1,3}:[0-9]{1,6}', pr): devic.append(re.findall('\d{1,3}\.\d{1,3}\.\d{1,3}\.\d{1,3}:[0-9]{1,6}', pr)); a = 3; return a return a def adbad(q, pu): global ot for i in range(0, q): process = subprocess.Popen(pu, stdout=subprocess.PIPE) output, error = process.communicate() ot = str(output) if q > 1: time.sleep(1) pass def comanda(q, pu): global adbcommand adbcommand.clear() # adbcommand = [adbpath] adbcommand = pu.split() adbcommand.insert(0, adbpath) # print(adbcommand) # adbcommand = [adbpath, lst] adbad(q, adbcommand) def main(q): global adbcommand adbcommand.clear() adbcommand = [adbpath, 'devices'] # adbcommand = [adbpath, '-s', 'emulator-5564', 'shell', 'input', 'tap', '50', '50'] # print(adbcommand) # if q > 0: # try: os.system('taskkill /F /IM adb.exe') # except (ValueError, Exception): pass # return True # adbad(1, 'adb.exe kill-server') # time.sleep(1.5) # adbad(1, 'adb.exe start-server') # time.sleep(8) adbad(3, adbcommand) time.sleep(0.5) # adbad(1, adbcommand) # time.sleep(0.5) # adbad(1, adbcommand) # time.sleep(0.5) # adbad(1, adbcommand) # time.sleep(1) sear(ot, q) pass # for i in fil: # if i.is_file(): a += 1 # # # if a > 1: # a = 0 # print('yes') # else: print('no') print('yes') # print(spr(1)) # print(adbpath) # print(Path.cwd()) # main(1) # print(ot) # sear(ot, 2) # print(a) # comanda(1, '-s emulator-5564 shell input tap 50 50') # print(devic)
StarcoderdataPython
3283571
<gh_stars>10-100 #!/usr/bin/env python from __future__ import print_function from scp import SCPClient import argparse import getpass import inspect import os import paramiko import errno def parse_args(): parser = argparse.ArgumentParser( description='Generate pyaci meta from APIC') parser.add_argument('host', nargs=1, help='hostname of APIC') parser.add_argument('-P', '--port', type=int, default=22, help='SSH port of APIC') parser.add_argument('-u', '--user', type=str, default='admin', help='authentication username') parser.add_argument('-p', '--password', type=str, help='authentication password') parser.add_argument('-d', '--default', action='store_true', help='set as default meta') args = parser.parse_args() if args.password is None: args.password = getpass.getpass('Enter {} password for {}: '.format( args.user, args.host[0])) return args def main(): args = parse_args() ssh = paramiko.SSHClient() ssh.set_missing_host_key_policy(paramiko.AutoAddPolicy()) ssh.connect(args.host[0], port=args.port, username=args.user, password=args.password, allow_agent=False, look_for_keys=False) stdin, stdout, stderr = ssh.exec_command('acidiag version') version = ''.join(stdout.readlines()).strip() vlist = version.split('.') version = '{}.{}({})'.format(vlist[0], vlist[1], '.'.join(vlist[2:])) print('APIC is running version', version) print('Copying metagen.py to APIC') scp = SCPClient(ssh.get_transport()) filename = inspect.getframeinfo(inspect.currentframe()).filename script_dir = os.path.dirname(os.path.abspath(filename)) metagen_path = os.path.join(script_dir, 'metagen.py') scp.put(metagen_path, '/tmp/metagen.py') print('Invoking metagen.py on APIC') stdin, stdout, stderr = ssh.exec_command('python2.7 /tmp/metagen.py') ''.join(stdout.readlines()).strip() # TODO (2015-09-14, <NAME>): Check the exit status properly. # Create ~/.aci-meta if it does not exist. aci_meta_dir = '~/.aci-meta' destination_dir = os.path.expanduser('{}'.format(aci_meta_dir)) try: os.makedirs(destination_dir) except OSError as e: if e.errno != errno.EEXIST: raise destination = os.path.expanduser( '{}/aci-meta.{}.json'.format(aci_meta_dir, version)) print('Copying generated meta from APIC to', destination) scp.get('aci-meta.json', destination) default = os.path.expanduser('{}/aci-meta.json'.format(aci_meta_dir)) if not os.path.isfile(default): print('No default meta exist. ' 'Setting the current meta as the default.') should_link = True else: if args.default: print('Forcing the current meta as the default.') os.unlink(default) should_link = True else: should_link = False if should_link: os.symlink(destination, default) if __name__ == '__main__': main()
StarcoderdataPython
3275131
<gh_stars>0 # -*- coding: utf-8 -*- """ Rewrite exceptions that are thrown and caught locally to jumps. """ from flypy.compiler import excmodel from pykit.analysis import cfa from pykit.optimizations import local_exceptions def rewrite_local_exceptions(func, env): """ Rewrite exc_throw(exc) -> jump(handler_block) for statically determined exceptions. """ local_exceptions.run(func, env, exc_model=excmodel.ExcModel(env)) def rewrite_exceptions(func, env): blocks = set() for op in func.ops: if op.opcode == 'exc_throw': raise NotImplementedError("Exception throwing", op, func) if op.opcode in ('exc_catch', 'exc_setup'): blocks.add(op.block) op.delete() update_outdated_incoming_blocks(func, blocks) def update_outdated_incoming_blocks(func, candidates): """ Update phi nodes in blocks previously containing 'exc_catch'. 'exc_setup' may span many blocks, and none, or only a subset of those blocks may be actual predecessors. """ cfg = cfa.cfg(func) for block in candidates: preds = cfg.predecessors(block) for op in block.leaders: if op.opcode == 'phi': blocks, values = op.args newblocks = [block for block in blocks if block in preds] newvalues = [val for block, val in zip(blocks, values) if block in preds] assert len(newblocks) == len(preds), (op.block, newblocks, preds, blocks) op.set_args([newblocks, newvalues])
StarcoderdataPython
1694509
<gh_stars>10-100 RPL_WELCOME = 1 RPL_YOURHOST = 2 RPL_CREATED = 3 RPL_MYINFO = 4 RPL_BOUNCE = 5 RPL_USERHOST = 302 RPL_ISON = 303 RPL_AWAY = 301 RPL_UNAWAY = 305 RPL_NOWAWAY = 306 RPL_WHOISUSER = 311 RPL_WHOISSERVER = 312 RPL_WHOISOPERATOR = 313 RPL_WHOISSIDLE = 317 RPL_ENDOFWHOIS = 318 RPL_WHOISCHANNELS = 319 RPL_WHOWASUSER = 314 RPL_ENDOFWHOWAS = 369 RPL_LIST = 322 RPL_LISTEND = 323 RPL_UNIQOPIS = 325 RPL_CHANNELMODEIS = 324 RPL_NOTOPIC = 331 RPL_TOPIC = 332 RPL_INVITING = 341 RPL_SUMMONING = 342 RPL_INVITELIST = 346 RPL_ENDOFINVITELIST = 347 RPL_EXCEPTLIST = 348 RPL_ENDOFEXCEPTLIST = 349 RPL_VERSION = 351 RPL_WHOREPLY = 352 RPL_ENDOFWHO = 315 RPL_NAMREPLY = 353 RPL_ENDOFNAMES = 366 RPL_LINKS = 364 RPL_ENDOFLINKS = 365 RPL_BANLIST = 367 RPL_ENDOFBANLIST = 368 RPL_INFO = 371 RPL_ENDOFINFO = 374 RPL_MOTDSTART = 375 RPL_MOTD = 372 RPL_ENDOFMOTD = 376 RPL_YOUREOPER = 381 RPL_REHASHING = 382 RPL_YOURESERVICE = 383 RPL_TIME = 391 RPL_USERSSTART = 392 RPL_USERS = 393 RPL_ENDOFUSERS = 394 RPL_NOUSERS = 395 RPL_TRACELINK = 200 RPL_TRACECONNECTING = 201 RPL_TRACEHANDSHAKE = 202 RPL_TRACEUNKNOWN = 203 RPL_TRACEOPERATOR = 204 RPL_TRACEUSER = 205 RPL_TRACESERVER = 206 RPL_TRACESERVICE = 207 RPL_TRACENEWTYPE = 208 RPL_TRACECLASS = 209 RPL_TRACELOG = 261 RPL_TRACEEND = 262 RPL_STATSLINKINFO = 211 RPL_STATSCOMMANDS = 212 RPL_ENDOFSTATS = 219 RPL_STATSUPTIME = 242 RPL_STATSOLINE = 243 RPL_UMODEIS = 221 RPL_SERVLIST = 234 RPL_SERVLISTEND = 235 RPL_LUSERCLIENT = 251 RPL_LUSEROP = 252 RPL_LUSERUNKNOWN = 253 RPL_LUSERCHANNELS = 254 RPL_LUSERME = 255 RPL_ADMINME = 256 RPL_ADMINLOC1 = 257 RPL_ADMINLOC2 = 258 RPL_ADMINEMAIL = 259 RPL_TRYAGAIN = 263 ERR_NOSUCHNICK = 401 ERR_NOSUCHSERVER = 402 ERR_NOSUCHCHANNEL = 403 ERR_CANNOTSENDTOCHAN = 404 ERR_TOOMANYCHANNELS = 405 ERR_WASNOSUCHNICK = 406 ERR_TOOMANYTARGETS = 407 ERR_NOSUCHSERVICE = 408 ERR_NOORIGIN = 409 ERR_NORECIPIENT = 410 ERR_NOTEXTTOSEND = 412 ERR_NOTOPLEVEL = 413 ERR_WILDTOPLEVEL = 414 ERR_BADMASK = 415 ERR_UNKNOWNCOMMAND = 421 ERR_NOMOTD = 422 ERR_NOADMININFO = 423 ERR_FILEERROR = 424 ERR_NONICKNAMEGIVEN = 431 ERR_ERRONEUSNICKNAME = 432 ERR_NICKNAMEINUSE = 433 ERR_NICKCOLLISION = 436 ERR_UNAVAILRESOURCE = 437 ERR_USERNOTINCHANNEL = 441 ERR_NOTONCHANNEL = 442 ERR_USERONCHANNEL = 443 ERR_NOLOGIN = 444 ERR_SUMMONDISABLED = 445 ERR_USERSDISABLED = 446 ERR_NOTREGISTERED = 451 ERR_NEEDMOREPARAMS = 461 ERR_ALREADYREGISTRED = 462 ERR_NOPERMFORHOST = 463 ERR_PASSWDMISMATCH = 464 ERR_YOUREBANNEDCREEP = 465 ERR_YOUWILLBEBANNED = 466 ERR_KEYSET = 467 ERR_CHANNELISFULL = 471 ERR_UNKNOWNMODE = 472 ERR_INVITEONLYCHAN = 473 ERR_BANNEDFROMCHAN = 474 ERR_BADCHANNELKEY = 475 ERR_BADCHANMASK = 476 ERR_NOCHANMODES = 477 ERR_BANLISTFULL = 478 ERR_NOPRIVILEGES = 481 ERR_CHANOPRIVSNEEDED = 482 ERR_CANTKILLSERVER = 483 ERR_RESTRICTED = 484 ERR_UNIQOPPRIVSNEEDED = 485 ERR_NOOPERHOST = 491 ERR_UMODEUNKNOWNFLAG = 501 ERR_USERSDONTMATCH = 502 reply_names = {value: key for key, value in locals().items() if isinstance(value, int)}
StarcoderdataPython
15707
<reponame>jama5262/Politico import unittest import json from app import createApp from app.api.database.migrations.migrations import migrate class TestParties(unittest.TestCase): def setUp(self): self.app = createApp("testing") self.client = self.app.test_client() self.endpoint = "/api/v2/parties" self.partyID = 3 self.data = { "name": "Party Name", "abbr": "Party Abbreviation", "logo_url": "http://logo/url", "hq_address": "Party HQ" } self.dataUpdate = { "name": "Updated Party Name", "abbr": "Updated Party Abbreviation", "logo_url": "http://logo/url", "hq_address": "Updated Party HQ" } self.dataNoNameProperty = { "abbr": "Updated Party Abbreviation", "logo_url": "http://logo/url", "hq_address": "Updated Party HQ" } self.dataEmptyValues = { "name": "", "abbr": "", "logo_url": "", "hq_address": "" } self.loginData = { "email": "<EMAIL>", "password": "<PASSWORD>" } def tearDown(self): migrate() def loginUser(self): response = self.client.post(path="/api/v2/auth/login", data=json.dumps(self.loginData), content_type='application/json') token = response.json["data"]["token"] return { "Authorization": "Bearer " + token } def post(self, path, data): return self.client.post(path=path, data=json.dumps(data), content_type='application/json', headers=self.loginUser()) def get(self, path): return self.client.get(path=path, content_type='application/json', headers=self.loginUser()) def patch(self, path, data): return self.client.patch(path=path, data=json.dumps(data), content_type='application/json', headers=self.loginUser()) def delete(self, path): return self.client.delete(path=path, content_type='application/json', headers=self.loginUser()) def test_create_party(self): response = self.post(self.endpoint, self.data) self.assertEqual(response.status_code, 200, response) def test_get_all_parties(self): response = self.get(self.endpoint) self.assertEqual(response.status_code, 200) def test_get_specific_party(self): postParty = self.post(self.endpoint, self.data) response = self.get(self.endpoint + "/" + str(self.partyID)) self.assertEqual(response.status_code, 200) def test_get_specific_party_not_found(self): response = self.get(self.endpoint + "/2000") self.assertEqual(response.status_code, 404) def test_edit_specific_party(self): postParty = self.post(self.endpoint, self.data) response = self.patch(self.endpoint + "/" + str(self.partyID), self.dataUpdate) self.assertEqual(response.status_code, 200) def test_edit_specific_party_not_found(self): response = self.patch(self.endpoint + "/2000", self.dataUpdate) self.assertEqual(response.status_code, 404) def test_delete_specific_party(self): postParty = self.post(self.endpoint, self.data) response = self.delete(self.endpoint + "/" + str(self.partyID)) self.assertEqual(response.status_code, 200) def test_delete_specific_party_not_found(self): response = self.delete(self.endpoint + "/2000") self.assertEqual(response.status_code, 404) def test_with_empty_values(self): response = self.post(self.endpoint, self.dataEmptyValues) self.assertEqual(response.status_code, 400) def test_with_no_name_property(self): response = self.post(self.endpoint, self.dataNoNameProperty) self.assertEqual(response.status_code, 400)
StarcoderdataPython
3223944
<filename>checkpoint.py import os import torch def save_checkpoint(epoch, step, model, optimizer, save_path): """ Save checkpoint pickle file with model weights and other experimental settings Args: epoch (Int): Current epoch when model is being saved step (Int): Mini-batch iteration count when model is being saved model (Object): Current copy of model optimizer (Object): Optimizer object save_path (String): Full directory path to results folder Return: None """ state = {'epoch': epoch, 'step': step, 'state_dict': model.state_dict(), 'optimizer': optimizer.state_dict(), } torch.save(state, save_path) def load_checkpoint(name, key_name='state_dict'): """ Load checkpoint pickle file and return selected element from pickle file Args: name (String): Full path, including pickle file name, to load key_name (String): Key name to return from saved pickle file Return: Selected element from loaded checkpoint pickle file """ checkpoint = torch.load(name) if key_name not in checkpoint: return checkpoint return checkpoint[key_name]
StarcoderdataPython
3313066
<reponame>cesarin1981/ProjectBuscaAyuda from src.projectbuscaayuda.modelo.persona import Persona from src.projectbuscaayuda.modelo.servicio import Servicio, Categoria_Servicio from src.projectbuscaayuda.modelo.declarative_base import Session, engine, Base if __name__ == '__main__': session = Session() persona1 = session.query(Persona).get(1) session.delete(persona1) session.commit() session.close()
StarcoderdataPython
1678489
from django.contrib import admin from django.contrib.auth.models import Permission # Register your models here. from nomenclatoare import models from guardian.admin import GuardedModelAdmin from simple_history.admin import SimpleHistoryAdmin class HistoryChangedFields(object): history_list_display = ["changed_fields"] def changed_fields(self, obj): if obj.prev_record: delta = obj.diff_against(obj.prev_record) return delta.changed_fields return None @admin.register(models.Localitate) class LocalitateAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] list_filter = ["judet"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.Judet) class JudetAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'cod', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.StatutBiserica) class StatutBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.CultBiserica) class CultBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.UtilizareBiserica) class UtilizareBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.SingularitateBiserica) class SingularitateBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.RegimProprietate) class RegimProprietateAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.FunctiuneBiserica) class FunctiuneBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici', 'nr_biserici_initiale'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' def nr_biserici_initiale(self, obj): return obj.biserici_initiale.count() @admin.register(models.SursaDatare) class SursaDatareAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.Secol) class SecolAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'nr_biserici'] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.StudiuDendocronologic) class StudiuDendocronologicAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume', 'fisier'] search_fields = ["nume"] @admin.register(models.Persoana) class PersoanaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume'] search_fields = ["nume"] @admin.register(models.Eveniment) class EvenimentAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume'] search_fields = ["nume"] @admin.register(models.Studiu) class StudiuAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ['nume'] search_fields = ["nume"] class CtitorBisericaInline(admin.StackedInline): model = models.CtitorBiserica verbose_name = "Ctitor" verbose_name_plural = "Ctitori" extra = 1 class MesterBisericaInline(admin.StackedInline): model = models.MesterBiserica verbose_name = "Meșter" verbose_name_plural = "Meșteri" extra = 1 class ZugravBisericaInline(admin.StackedInline): model = models.ZugravBiserica verbose_name = "Zugrav" verbose_name_plural = "Zugravi" extra = 1 class PersonalitateBisericaInline(admin.StackedInline): model = models.PersonalitateBiserica verbose_name = "Personalitate" verbose_name_plural = "Personalități" extra = 1 class EvenimentBisericaInline(admin.StackedInline): model = models.EvenimentBiserica verbose_name = "Eveniment" verbose_name_plural = "Evenimente" extra = 1 class MutareBisericaInline(admin.StackedInline): model = models.MutareBiserica verbose_name = "Mutare biserică" verbose_name_plural = "Mutări biserică" extra = 1 class StudiuIstoricInline(admin.StackedInline): model = models.StudiuIstoric verbose_name = "Studiu istoric" verbose_name_plural = "Studii istorice" extra = 1 @admin.register(models.AmplasamentBiserica) class AmplasamentBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TopografieBiserica) class TopografieBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.RelatieCimitir) class RelatieCimitirAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.PeisagisticaSit) class PeisagisticaSitAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.ElementAnsambluConstruit) class ElementAnsambluConstruitAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.ElementImportant) class ElementImportantAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.Planimetrie) class PlanimetrieAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.Material) class MaterialAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.DimensiuneTurn) class DimensiuneTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipTurn) class TipTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.DecorTurn) class DecorTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.PlanTurn) class PlanTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.AmplasareTurn) class AmplasareTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.GalerieTurn) class GalerieTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipSarpanta) class TipSarpantaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.FinisajExterior) class FinisajExteriorAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipBatereSindrila) class TipBatereSindrilaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipPrindereSindrila) class TipPrindereSindrilaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipBotSindrila) class TipBotSindrilaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipPrelucrareSindrila) class TipPrelucrareSindrilaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.EsentaLemnoasa) class EsentaLemnoasaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.ElementInteriorBiserica) class ElementInteriorBisericaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.MaterialFinisajPardoseli) class MaterialFinisajPardoseliAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.MaterialFinisajPeretiInteriori) class MaterialFinisajPeretiInterioriAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.Finisaj) class FinisajAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipFundatie) class TipFundatieAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipStructuraCheotoare) class TipStructuraCheotoareAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipStructuraCatei) class TipStructuraCateiAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.LocalizarePictura) class LocalizarePicturaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TehnicaPictura) class TehnicaPicturaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.RegistruIconostas) class RegistruIconostasAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipUsiIconostas) class TipUsiIconostasAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.SuportPictura) class SuportPicturaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TehnicaIconostas) class TehnicaIconostasAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipIconostas) class TipIconostasAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.DetaliuPodTurn) class DetaliuPodTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.AsezareTalpaTurn) class AsezareTalpaTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.RelatieTalpaTurn) class RelatieTalpaTurnAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.BoltaPesteAltar) class BoltaPesteAltarAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipBoltaPesteAltar) class TipBoltaPesteAltarAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipBoltaPronaos) class TipBoltaPronaosAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.Mobilier) class MobilierAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.ObiectCult) class ObiectCultAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.' @admin.register(models.TipArcBolta) class TipArcBoltaAdmin(HistoryChangedFields, SimpleHistoryAdmin): list_display = ["nume", "nr_biserici"] search_fields = ["nume"] def nr_biserici(self, obj): try: return obj.biserici.count() except: return 'N.A.'
StarcoderdataPython
4822386
<reponame>vied12/django-moderation<filename>moderation/helpers.py from __future__ import unicode_literals from .register import RegistrationError def automoderate(instance, user): ''' Auto moderates given model instance on user. Returns moderation status: 0 - Rejected 1 - Approved ''' try: status = instance.moderated_object.automoderate(user) except AttributeError: msg = "%s has been registered with Moderation." % instance.__class__ raise RegistrationError(msg) return status def import_moderator(app): ''' Import moderator module and register all models it contains with moderation ''' from importlib import import_module import imp try: paths = app.split('.') # if .apps.AppConfig style... if paths[-1][0].isupper(): app = '.'.join(paths[0:-1]) app_path = import_module(app).__path__ except AttributeError: return None try: imp.find_module('moderator', app_path) except ImportError: return None module = import_module("%s.moderator" % app) return module def auto_discover(): ''' Auto register all apps that have module moderator with moderation ''' from django.conf import settings for app in [app for app in settings.INSTALLED_APPS if app != 'moderation']: import_moderator(app)
StarcoderdataPython
21181
from OrderedVector import OrderedVector class Greedy: def __init__(self, goal): self.goal = goal self.found = False self.travelled_distance = 0 self.previous = None self.visited_cities = [] def search(self, current): current.visited = True self.visited_cities.append(current.name) for a in current.adjacent: if a.city == self.previous: self.travelled_distance += a.distance self.previous = current if current == self.goal: self.found = True else: self.border = OrderedVector(len(current.adjacent)) for a in current.adjacent: if a.city.visited == False: a.city.visited = True self.border.insert(a.city) if self.border.getFirst() != None: Greedy.search(self, self.border.getFirst()) return (self.visited_cities, self.travelled_distance)
StarcoderdataPython
1741055
<reponame>Saurav-Shrivastav/openwisp-users<filename>tests/testapp/urls.py from django.urls import path from . import views urlpatterns = [ path('member_view', views.api_member_view, name='test_api_member_view'), path('manager_view', views.api_manager_view, name='test_api_manager_view'), path('owner_view', views.api_owner_view, name='test_api_owner_view'), path('base_org_view', views.base_org_view, name='test_base_org_permission_view'), path('org_field_view', views.org_field_view, name='test_organization_field_view'), path('error_field_view', views.error_field_view, name='test_error_field_view'), path( 'member/shelf/<str:shelf_id>/books', views.books_list_member_view, name='test_books_list_member_view', ), path( 'manager/shelf/<str:shelf_id>/books', views.books_list_manager_view, name='test_books_list_manager_view', ), path( 'owner/shelf/<str:shelf_id>/books', views.books_list_owner_view, name='test_books_list_owner_view', ), path( 'member/shelf', views.shelf_list_member_view, name='test_shelf_list_member_view', ), path( 'manager/shelf', views.shelf_list_manager_view, name='test_shelf_list_manager_view', ), path( 'owner/shelf', views.shelf_list_owner_view, name='test_shelf_list_owner_view', ), path( 'user/shelf/<str:shelf_id>/books', views.book_list_unauthorized_view, name='test_book_list_unauthorized_view', ), path( 'user/shelf', views.shelf_list_unauthorized_view, name='test_shelf_list_unauthorized_view', ), ]
StarcoderdataPython
3280234
#!/usr/bin/python # Classification (U) """Program: notmastererror.py Description: Unit testing of NotMasterError in errors.py. Usage: test/unit/errors/notmastererror.py Arguments: """ # Libraries and Global Variables # Standard import sys import os if sys.version_info < (2, 7): import unittest2 as unittest else: import unittest # Third-party # Local sys.path.append(os.getcwd()) import errors import version __version__ = version.__version__ class UnitTest(unittest.TestCase): """Class: UnitTest Description: Class which is a representation of a unit testing. Methods: test_notmastererror """ def test_notmastererror(self): """Function: test_notmastererror Description: Test with no arguments. Arguments: """ self.assertTrue(errors.NotMasterError()) if __name__ == "__main__": unittest.main()
StarcoderdataPython
96721
from utils import show_messages, get_input # lets the teachers to add a score for a student of a course class AddScoreView(object): def run(self, site, messages=None): site.clear() show_messages(messages) course = get_input('Course Serial: ') course = site.get_course(serial=course) if course is None: return ["No such course!"] elif course.owner != site.active_user: return ["You don't have permission to add score to this course."] elif not course.verified: return ["This course hasn't been verified yet."] student = get_input('Student Serial Number: ') student = site.get_student(serial=student) if student is None: return ["No such student!"] elif not student.has_course(course): return ["This student has not this course."] elif student.passed_course(course): return ["This student already has a score fot this course."] elif not student.verified: return ["This student hasn't been verified yet."] value = get_input('Score: ', output_type=int) student.scores[course] = value site.state = '/teacher/' return ['We added score successfully.']
StarcoderdataPython
1658594
<filename>experimental/k41_contactset/shift.py #!/usr/bin/python import sys f = open(sys.argv[1]) for i in f.readlines(): x,y = map(float,i.split()) x = x + .25 y = y + .25 if x>1: x = x - 1 if y>1: y = y - 1 if y>x: print x,y else: print y,x f.close()
StarcoderdataPython
3351961
<reponame>hritik5102/Awesome-Computer-Vision-Guide ''' Application of gardients in images Gradients here itself means partial derivatives. Gradients are useful in detecting the edges based on color gradients. Derivative of a matrix is calculated by an operator called Laplacian. For derivatives, we have to cal. two derivatives, Sobal derivatives - one is horizontal, vertical. This is some mathematical details, let's go to implementation. ''' import cv2 import numpy as numpy import matplotlib.pyplot as plt img = cv2.imread('../Images and Videos/gradients4.jpg',0) laplacian = cv2.Laplacian(img, cv2.CV_64F) sobelx = cv2.Sobel(img, cv2.CV_64F, 1,0, ksize=5) sobely = cv2.Sobel(img, cv2.CV_64F, 0,1, ksize=5) images = [img, laplacian, sobelx, sobely] titles = ['Original', 'Laplacian', 'SobelX', 'SobelY'] for i in range(4): plt.subplot(2,3,(i+1)) plt.imshow(images[i], cmap='gray') plt.title(titles[i]) plt.show() img = cv2.imread('../Images and Videos/gradients2.jpg',0) laplacian = cv2.Laplacian(img, cv2.CV_64F) sobelx = cv2.Sobel(img, cv2.CV_64F, 1,0, ksize=5) sobely = cv2.Sobel(img, cv2.CV_64F, 0,1, ksize=5) images = [img, laplacian, sobelx, sobely] titles = ['Original', 'Laplacian', 'SobelX', 'SobelY'] for i in range(4): plt.subplot(2,3,(i+1)) plt.imshow(images[i], cmap='gray') plt.title(titles[i]) plt.show() for i in range(4): plt.subplot(2,3,(i+1)) plt.imshow(images[i]) plt.title(titles[i]) plt.show()
StarcoderdataPython
81024
import json import numpy as np from pycocotools import mask as maskUtils thresh = 0.5 # load retrieval results results_image_id_all = [] results_query_score_all = [] results_query_cls_all = [] results_query_box_all = [] results_gallery_id_all = [] results_gallery_box_all = [] results_name = ' ' with open(results_name, 'r') as f: results = json.loads(f.read()) for i in results: box = i['query_bbox'] query_box = [box[0],box[1],box[2]-box[0],box[3]-box[1]] box = np.array(i['gallery_bbox']) gallery_box = [box[:,0], box[:,1], box[:,2] - box[:,0], box[:,3] - box[:,1]] gallery_box = np.transpose(gallery_box,(1,0)).tolist() results_image_id_all.append(i['query_image_id']) results_query_score_all.append(i['query_score']) results_query_cls_all.append(i['query_cls']) results_query_box_all.append(query_box) results_gallery_id_all.append(i['gallery_image_id']) results_gallery_box_all.append(gellery_box) f.close() results_image_id_all = np.array(results_image_id_all) results_query_score_all = np.array(results_query_score_all) results_query_cls_all = np.array(results_query_cls_all) results_query_box_all = np.array(results_query_box_all) results_gallery_id_all = np.array(results_gallery_id_all) results_gallery_box_all = np.array(results_gallery_box_all) # load query ground truth query_image_id_all = [] query_box_all = [] query_cls_all = [] query_style_all = [] query_pair_all = [] query_name = '.../query_gt.json' with open(query_name, 'r') as f: query = json.loads(f.read()) for i in query: box = i['bbox'] box = [box[0], box[1], box[2] - box[0], box[3] - box[1]] query_image_id_all.append(i['query_image_id']) query_box_all.append(box) query_cls_all.append(i['cls']) query_style_all.append(i['style']) query_pair_all.append(i['pair_id']) f.close() # load gallery ground truth query_image_id_all = np.array(query_image_id_all) query_box_all = np.array(query_box_all) query_cls_all = np.array(query_cls_all) query_style_all = np.array(query_style_all) query_pair_all = np.array(query_pair_all) query_num = len(np.where(query_style_all>0)[0]) # the number of all query clothing items query_id_real= np.unique(query_image_id_all) # image ids of query clothing items gallery_image_id_all = [] gallery_box_all = [] gallery_style_all = [] gallery_pair_all = [] gallery_name = '.../gallery_gt.json' with open(gallery_name, 'r') as f: gallery = json.loads(f.read()) for i in gallery: box = i['bbox'] box = [box[0], box[1], box[2] - box[0], box[3] - box[1]] gallery_image_id_all.append(i['gallery_image_id']) gallery_box_all.append(box) gallery_style_all.append(i['style']) gallery_pair_all.append(i['pair_id']) f.close() gallery_image_id_all = np.array(gallery_image_id_all) gallery_box_all = np.array(gallery_box_all) gallery_style_all = np.array(gallery_style_all) gallery_pair_all = np.array(gallery_pair_all) correct_num_1 = 0 correct_num_5 = 0 correct_num_10 = 0 correct_num_15 = 0 correct_num_20 = 0 miss_num = 0 # the number of query items that fail to be detected for id in query_id_real: results_id_ind = np.where(results_image_id_all==id)[0] if len(results_id_ind) == 0: # in case no clothing item is detected continue query_id_ind = np.where(query_image_id_all==id)[0] # all query items in the given image pair_id = query_pair_all[query_id_ind] assert len(np.unique(pair_id)) == 1 pair_id = pair_id[0] results_id_score = results_query_score_all[results_id_ind] results_id_box = results_query_box_all[results_id_ind] results_id_cls = results_query_cls_all[results_id_ind] results_id_gallery_id = results_gallery_id_all[results_id_ind] results_id_gallery_box = results_gallery_box_all[results_id_ind] query_id_box = query_box_all[query_id_ind] query_id_cls = query_cls_all[query_id_ind] query_id_style = query_style_all[query_id_ind] is_crowd = np.zeros(len(query_id_box)) iou_id = maskUtils.iou(results_id_box,query_id_box,is_crowd) iou_ind = np.argmax(iou_id,axis=1) # assign a ground truth label to each detected clothing item for id_ind in range(0,len(query_id_ind)): style = query_id_style[id_ind] cls = query_id_cls[id_ind] # For a given ground truth query item, select a detected item on behalf of it: # First find out all detected items which are assigned the given ground truth label # and are classified correctly. # Then select the detected item with the highest score among these detected items. if style>0: results_style_ind1 = np.where(iou_ind==id_ind)[0] results_style_ind2 = np.where(results_id_cls==cls)[0] results_style_ind = np.intersect1d(results_style_ind1,results_style_ind2) if len(results_style_ind)>0: results_score_style = results_id_score[results_style_ind] score_max_ind = np.argmax(results_score_style) results_style_query_ind = results_style_ind[score_max_ind] results_style_gallery_id = results_id_gallery_id[results_style_query_ind] results_style_gallery_box = results_id_gallery_box[results_style_query_ind] # find out the corresponding ground truth items in the gallery, that is ground truth items which have the same pair id and style as the query item. gt_gallery_ind1 = np.where(gallery_pair_all==pair_id)[0] gt_gellery_ind2 = np.where(gallery_style_all==style)[0] gt_gallery_ind = np.intersect1d(gt_gallery_ind1,gt_gellery_ind2) gt_gallery_image_id = gallery_image_id_all[gt_gallery_ind] gt_gallery_box = gallery_box_all[gt_gallery_ind] assert len(gt_gallery_ind)>0 if len(gt_gallery_ind) == 1: gt_gallery_image_id = [gt_gallery_image_id] #calculate top-1 for t in range(0,1): # if corresponding ground truth gallery images contains retrieved gallery image, # first find out the exact corresponding ground truth gallery image, # then find out ground truth gallery items in this ground truth gallery image(whose number may be greater than 1) # if the overlap between the retrieved gallery item and one of the ground truth gallery items is over the thresh, the retrieved result is positive. if results_style_gallery_id[t] in gt_gallery_image_id: which_ind = np.where(gt_gallery_image_id==results_style_gallery_id[t])[0] crowd = np.zeros(len(which_ind)) iou_style = maskUtils.iou([results_style_gallery_box[t]],gt_gallery_box[which_ind],crowd) if len(np.where(iou_style>=thresh)[0])>0: correct_num_1 = correct_num_1 + 1 break # calculate top-5 for t in range(0,5): if results_style_gallery_id[t] in gt_gallery_image_id: which_ind = np.where(gt_gallery_image_id==results_style_gallery_id[t])[0] crowd = np.zeros(len(which_ind)) iou_style = maskUtils.iou([results_style_gallery_box[t]],gt_gallery_box[which_ind],crowd) if len(np.where(iou_style >= thresh)[0]) > 0: correct_num_5 = correct_num_5 + 1 break # calculate top-10 for t in range(0,10): if results_style_gallery_id[t] in gt_gallery_image_id: which_ind = np.where(gt_gallery_image_id==results_style_gallery_id[t])[0] crowd = np.zeros(len(which_ind)) iou_style = maskUtils.iou([results_style_gallery_box[t]],gt_gallery_box[which_ind],crowd) if len(np.where(iou_style >= thresh)[0]) > 0: correct_num_10 = correct_num_10 + 1 break # calculate top-15 for t in range(0,15): if results_style_gallery_id[t] in gt_gallery_image_id: which_ind = np.where(gt_gallery_image_id==results_style_gallery_id[t])[0] crowd = np.zeros(len(which_ind)) iou_style = maskUtils.iou([results_style_gallery_box[t]],gt_gallery_box[which_ind],crowd) if len(np.where(iou_style >= thresh)[0]) > 0: correct_num_15 = correct_num_15 + 1 break # calculate top-20 for t in range(0,20): if results_style_gallery_id[t] in gt_gallery_image_id: which_ind = np.where(gt_gallery_image_id==results_style_gallery_id[t])[0] crowd = np.zeros(len(which_ind)) iou_style = maskUtils.iou([results_style_gallery_box[t]],gt_gallery_box[which_ind],crowd) if len(np.where(iou_style >= thresh)[0]) > 0: correct_num_20 = correct_num_20 + 1 break else: miss_num = miss_num + 1 print 'top-1' print float(correct_num_1)/ query_num print 'top-5' print float(correct_num_5)/ query_num print 'top-10' print float(correct_num_10)/ query_num print 'top-15' print float(correct_num_15)/ query_num print 'top-20' print float(correct_num_20)/ query_num
StarcoderdataPython
10586
# # Copyright (C) 2018 The Android Open Source Project # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # model = Model() i1 = Input("op1", "TENSOR_FLOAT32", "{1, 3, 3, 2}") f1 = Input("op2", "TENSOR_FLOAT32", "{1, 2, 2, 4}") b1 = Input("op3", "TENSOR_FLOAT32", "{4}") pad0 = Int32Scalar("pad0", 0) act = Int32Scalar("act", 0) stride = Int32Scalar("stride", 1) cm = Int32Scalar("channelMultiplier", 2) output = Output("op4", "TENSOR_FLOAT32", "{1, 2, 2, 4}") model = model.Operation("DEPTHWISE_CONV_2D", i1, f1, b1, pad0, pad0, pad0, pad0, stride, stride, cm, act).To(output) model = model.RelaxedExecution(True) # Example 1. Input in operand 0, input0 = {i1: # input 0 [10, 21, 10, 22, 10, 23, 10, 24, 10, 25, 10, 26, 10, 27, 10, 28, 10, 29], f1: [.25, 0, .2, 0, .25, 0, 0, .3, .25, 0, 0, 0, .25, .1, 0, 0], b1: [1, 2, 3, 4]} # (i1 (conv) f1) + b1 # filter usage: # in_ch1 * f_1 --> output_d1 # in_ch1 * f_2 --> output_d2 # in_ch2 * f_3 --> output_d3 # in_ch3 * f_4 --> output_d4 output0 = {output: # output 0 [11, 3, 7.2, 10.6, 11, 3, 7.4, 10.9, 11, 3, 7.8, 11.5, 11, 3, 8.0, 11.8]} # Instantiate an example Example((input0, output0))
StarcoderdataPython
1689390
#!/usr/bin/env python import sys import os, os.path import shutil from ROOT import gROOT,gSystem,gDirectory,RooAbsData,RooRandom,RooWorkspace ## batch mode sys.argv.insert(1, '-b') gROOT.Reset() gROOT.SetBatch(True) del sys.argv[1] gSystem.Load("libSusyFitter.so") gROOT.Reset() def GenerateFitAndPlot(tl): from ROOT import Util from ROOT import RooExpandedFitResult print("\n***GenerateFitAndPlot for TopLevelXML %s***\n"%tl.name) w = Util.GetWorkspaceFromFile(tl.wsFileName,"combined") Util.SaveInitialSnapshot(w) # Util.ReadWorkspace(w, tl.wsFileName,"combined") plotChannels = "" for reg in tl.validationChannels: if len(plotChannels)>0: plotChannels+="," pass plotChannels+=reg plotChannels = "ALL" fitChannels = "" for reg in tl.bkgConstrainChannels: if len(fitChannels)>0: fitChannels+="," pass fitChannels+=reg pass fitChannelsCR = fitChannels for reg in tl.signalChannels: if len(fitChannels)>0: fitChannels+="," pass fitChannels+=reg #fitChannels = "ALL" lumiConst = not tl.signalSample # fit toy MC if specified. When left None, data is fit by default toyMC = None if configMgr.toySeedSet and not configMgr.useAsimovSet: # generate a toy dataset print("INFO : generating toy MC set for fitting and plotting. Seed = %i" % configMgr.toySeed) RooRandom.randomGenerator().SetSeed( configMgr.toySeed ) toyMC = Util.GetToyMC() # this generates one toy dataset pass elif configMgr.useAsimovSet and not configMgr.toySeedSet: # print("INFO : using Asimov set for fitting and plotting.") toyMC = Util.GetAsimovSet(w) # this returns the asimov set pass else: print("INFO : using data for fitting and plotting.") ## MB : turn on all JES bins. Some are turned off by HistFactory by default if True: if w.var("gamma_J3_bin_0")!=None: w.var("gamma_J3_bin_0").setConstant(False) if w.var("gamma_J3_bin_1")!=None: w.var("gamma_J3_bin_1").setConstant(False) if w.var("gamma_J3_bin_2")!=None: w.var("gamma_J3_bin_2").setConstant(False) if w.var("gamma_J3_bin_3")!=None: w.var("gamma_J3_bin_3").setConstant(False) if w.var("gamma_J3_bin_4")!=None: w.var("gamma_J3_bin_4").setConstant(False) if w.var("gamma_J3_bin_5")!=None: w.var("gamma_J3_bin_5").setConstant(False) #if w.var("gamma_J4_bin_0")!=None: w.var("gamma_J4_bin_0").setConstant(False) #if w.var("gamma_J4_bin_1")!=None: w.var("gamma_J4_bin_1").setConstant(False) if w.var("gamma_J4_bin_2")!=None: w.var("gamma_J4_bin_2").setConstant(False) if w.var("gamma_J4_bin_3")!=None: w.var("gamma_J4_bin_3").setConstant(False) if w.var("gamma_J4_bin_4")!=None: w.var("gamma_J4_bin_4").setConstant(False) if w.var("gamma_J4_bin_5")!=None: w.var("gamma_J4_bin_5").setConstant(False) if w.var("gamma_JC_bin_0")!=None: w.var("gamma_JC_bin_0").setConstant(False) if w.var("gamma_JC_bin_1")!=None: w.var("gamma_JC_bin_1").setConstant(False) if w.var("gamma_JC_bin_2")!=None: w.var("gamma_JC_bin_2").setConstant(False) if w.var("gamma_JC_bin_3")!=None: w.var("gamma_JC_bin_3").setConstant(False) if w.var("gamma_JC_bin_4")!=None: w.var("gamma_JC_bin_4").setConstant(False) if w.var("gamma_JC_bin_5")!=None: w.var("gamma_JC_bin_5").setConstant(False) if w.var("gamma_JC_bin_6")!=None: w.var("gamma_JC_bin_6").setConstant(False) # Soft lepton # if w.var("gamma_JSS_bin_0")!=None: w.var("gamma_JSS_bin_0").setConstant(False) # set Errors of all parameters to 'natural' values before plotting/fitting Util.resetAllErrors(w) mu_Top = w.var("mu_Top") print("mu_Top: ") print(mu_Top) if mu_Top: mu_Top.setError(0.001) else: mu_Top = w.var("mu_Top_Np0") if mu_Top: mu_Top.setError(0.001) mu_Top = w.var("mu_Top_Np1") if mu_Top: mu_Top.setError(0.001) mu_Top = w.var("mu_Top_Np2") if mu_Top: mu_Top.setError(0.001) mu_Top = w.var("mu_Top_Np3") if mu_Top: mu_Top.setError(0.001) mu_Top = w.var("mu_Top_Np4") if mu_Top: mu_Top.setError(0.001) mu_Top = w.var("mu_Top_Np5") if mu_Top: mu_Top.setError(0.001) mu_WZ = w.var("mu_WZ") mu_WZpT0GeV = w.var("mu_WZpT0GeV") if mu_WZ: mu_WZ.setError(0.001) elif mu_WZpT0GeV: mu_WZpT0GeV = w.var("mu_WZpT0GeV") mu_WZpT0GeV.setError(0.001) mu_WZpT0GeV = w.var("mu_WZpT50GeV") mu_WZpT0GeV.setError(0.001) mu_WZpT0GeV = w.var("mu_WZpT100GeV") mu_WZpT0GeV.setError(0.001) mu_WZpT0GeV = w.var("mu_WZpT150GeV") mu_WZpT0GeV.setError(0.001) mu_WZpT0GeV = w.var("mu_WZpT200GeV") mu_WZpT0GeV.setError(0.001) mu_WZpT0GeV = w.var("mu_WZpT250GeV") mu_WZpT0GeV.setError(0.001) else: mu_WZ = w.var("mu_WZ_Np0") mu_WZ.setError(0.001) mu_WZ = w.var("mu_WZ_Np1") mu_WZ.setError(0.001) mu_WZ = w.var("mu_WZ_Np2") mu_WZ.setError(0.001) mu_WZ = w.var("mu_WZ_Np3") mu_WZ.setError(0.001) mu_WZ = w.var("mu_WZ_Np4") mu_WZ.setError(0.001) mu_WZ = w.var("mu_WZ_Np5") mu_WZ.setError(0.001) # set the flag for plotting ratio or pull distribution under the plot plotRatio = True # plotRatio = False means that a pull distribution will be drawn # get a list of all floating parameters for all regions simPdf = w.pdf("simPdf"); mc = Util.GetModelConfig(w) obsSet = mc.GetObservables() floatPars = Util.getFloatParList(simPdf, obsSet) # create an RooExpandedFitResult encompassing all the regions/parameters & save it to workspace expResultBefore = RooExpandedFitResult(floatPars) # expResultBefore.Print() Util.ImportInWorkspace(w,expResultBefore,"RooExpandedFitResult_beforeFit") # plot before fit #Util.PlotPdfWithComponents(w,tl.name,plotChannels,"beforeFit_ORIGINAL",None,toyMC) Util.PlotPdfWithComponents(w,tl.name,plotChannels,"beforeFit",expResultBefore,toyMC,plotRatio) #return # fit of CRs only # resultCR = Util.FitPdf(w,fitChannelsCR,lumiConst,toyMC) # load original snapshot # w.loadSnapshot('snapshot_paramsVals_initial') # fit of all regions result = Util.FitPdf(w,fitChannels,lumiConst,toyMC) # create an RooExpandedFitResult encompassing all the regions/parameters with the result & save it to workspace expResultAfter = RooExpandedFitResult(result, floatPars) Util.ImportInWorkspace(w,expResultAfter,"RooExpandedFitResult_afterFit") # plot after fit #Util.PlotPdfWithComponents(w,tl.name,plotChannels,"afterFit_ORIGINAL",result,toyMC) Util.PlotPdfWithComponents(w,tl.name,plotChannels,"afterFit",expResultAfter,toyMC,plotRatio) # plot each component of each region separately with propagated error after fit (interesting for debugging) # Util.PlotSeparateComponents(tl.name,plotChannels,"afterFit",result,toyMC) # plot correlation matrix for result #Util.PlotCorrelationMatrix(result) # Util.GetCorrelations(result, 0.85) # plotPLL = False # Util.PlotNLL(w, result, plotPLL, "", toyMC) if toyMC: Util.WriteWorkspace(w, tl.wsFileName,toyMC.GetName()) else: Util.WriteWorkspace(w, tl.wsFileName) try: if not result == None: result.Print() return result except: pass return def GetLimits(tl,f): from ROOT import RooStats,Util #w=gDirectory.Get("w") print("analysis name: ",tl.name) print("workspace name: ",tl.wsFileName) if not ("SU" in tl.name): print("Do no hypothesis test for bkg only or discovery fit!\n") return print("Need to load workspace") Util.ReadWorkspace(tl.wsFileName,"combined") w=gDirectory.Get("w") result = RooStats.MakeUpperLimitPlot(tl.name,w,2,3,1000,True,20,True) if not result==0: result.Print() print(result.UpperLimit()) return if __name__ == "__main__": from configManager import configMgr from prepareHistos import TreePrepare,HistoPrepare configMgr.readFromTree = False configMgr.executeHistFactory=False runInterpreter = False runFit = False printLimits = False doHypoTests = False sigSamples = [] print("\n * * * Welcome to HistFitter * * *\n") import os, sys import getopt def usage(): print("HistFitter.py [-i] [-t] [-w] [-f] [-l] [-l] [-p] [-n nTOYs] [-s seed] [-g gridPoint] <configuration_file>\n") print("(all OFF by default. Turn steps ON with options)") print("-t re-create histograms from TTrees (default: %s)"%(configMgr.readFromTree)) print("-w re-create workspace from histograms (default: %s)"%(configMgr.executeHistFactory)) print("-f fit the workspace (default: %s)"%(configMgr.executeHistFactory)) print("-n <nTOYs> sets number of TOYs (<=0 means to use real data, default: %i)"%configMgr.nTOYs) print("-s <number> set the random seed for toy generation (default is CPU clock: %i)" % configMgr.toySeed) print("-a use Asimov dataset for fitting and plotting (default: %i)" % configMgr.useAsimovSet) print("-i stays in interactive session after executing the script (default %s)"%runInterpreter) print("-v verbose level (1: minimal, 2: print histogram names, 3: print XML files, default: %i)"%configMgr.verbose) print("-l make limit plot of workspace (default %s)" % printLimits) print("-p run hypothesis test on workspace (default %s)" % doHypoTests) print("-g <grid points to be processed> - give as comma separated list (default: %s)" % str(sigSamples)) print("\nAlso see the README file.\n") print("Command examples:") print("HistFitter.py -i python/MySusyFitterConfig.py #only runs initialization in interactive mode (try e.g.: configMgr.<tab>)") print("HistFitter.py -t -w -f python/MySusyFitterConfig.py #runs all steps (TTree->Histos->Workspace->Fit) in batch mode") print("HistFitter.py -f -i python/MySusyFitterConfig.py #only fit and plot, using existing workspace, in interactive session") print("HistFitter.py -s 666 -f python/MySusyFitterConfig.py #fit a TOY dataset (from seed=666) and prints RooFitResult") print("\nNote: examples of input TTrees can be found in /afs/cern.ch/atlas/groups/susy/1lepton/samples/") sys.exit(0) try: opts, args = getopt.getopt(sys.argv[1:], "twfin:s:v:alpg:") configFile = str(args[0]) except: usage() for opt,arg in opts: if opt == '-t': configMgr.readFromTree=True elif opt == '-w': configMgr.executeHistFactory=True elif opt == '-f': runFit=True elif opt == '-n': configMgr.nTOYs = int(arg) elif opt == '-i': runInterpreter = True elif opt == '-v': configMgr.setVerbose( int(arg) ) elif opt == '-l': printLimits = True elif opt == '-p': doHypoTests = True elif opt == '-s': configMgr.toySeedSet = True configMgr.toySeed = int(arg) elif opt == '-a': configMgr.useAsimovSet = True elif opt == '-g': sigSamples = arg.split(',') pass gROOT.SetBatch(not runInterpreter) #mandatory user-defined configuration exec(compile(open(configFile, "rb").read(), configFile, 'exec')) #standard execution from now on. configMgr.initialize() #runs Trees->histos and/or histos->workspace according to specifications if configMgr.readFromTree or configMgr.executeHistFactory: configMgr.executeAll() if runFit: for i in range(0,len(configMgr.topLvls)-1): #if len(configMgr.topLvls)>1: r=GenerateFitAndPlot(configMgr.topLvls[i]) #for idx in range(len(configMgr.topLvls)): # r=GenerateFitAndPlot(configMgr.topLvls[idx]) #1]) pass #configMgr.cppMgr.fitAll() print("\nr0=GenerateFitAndPlot(configMgr.topLvls[0])") print("r1=GenerateFitAndPlot(configMgr.topLvls[1])") print("r2=GenerateFitAndPlot(configMgr.topLvls[2])") pass if printLimits: configMgr.cppMgr.doUpperLimitAll() #for tl in configMgr.topLvls: # GetLimits(tl,f) # pass pass if doHypoTests: configMgr.cppMgr.doHypoTestAll() pass if configMgr.nTOYs>0 and doHypoTests==False and printLimits==False and runFit==False: RooRandom.randomGenerator().SetSeed( configMgr.toySeed ) configMgr.cppMgr.runToysAll() pass if runInterpreter: from code import InteractiveConsole from ROOT import Util cons = InteractiveConsole(locals()) cons.interact("Continuing interactive session... press Ctrl+d to exit") pass print("Leaving HistFitter... Bye!")
StarcoderdataPython
93276
#!/usr/bin/python import sys from DG1022 import * r = RigolDG('/dev/usbtmc0') c = raw_input("Press any key to query IDN...") r.meas.write('*IDN?') c = raw_input("Press any key to read IDN response...") r.meas.read() c=raw_input("Press enter to enable Channel 1") r.enableChan1() c=raw_input("Press enter to enable Channel 2") r.enableChan2() c = raw_input("Press any key to set sync Voltages...") r.setFunc(function=RigolDG.SQUARE,channel=RigolDG.CH1) r.setFunc(function=RigolDG.SQUARE,channel=RigolDG.CH2) r.syncVoltages(sync=True,ratio_CH1=2,ratio_CH2=1) r.setVoltage(5) c = raw_input("Press any key to set sync Frequencies...") r.syncFrequency(sync=True,ratio_CH1=1,ratio_CH2=10) r.setFreqHz(10000) c = raw_input("Press any key to continue...") r.setFreqHz(2000) r.setVoltage(10) r.enableChan1(False) r.enableChan2(False) r.setVoltage(value=5) r.setVoltage(channel = RigolDG.CH2,value=5)
StarcoderdataPython
3391657
<filename>src/eduid_scimapi/db/eventdb.py from __future__ import annotations import logging from dataclasses import asdict, dataclass, field from datetime import datetime, timedelta from enum import Enum from typing import TYPE_CHECKING, Any, Dict, List, Mapping, Optional, Type from uuid import UUID, uuid4 from bson import ObjectId from eduid_userdb.util import utc_now from eduid_scimapi.db.basedb import ScimApiBaseDB from eduid_scimapi.db.common import ScimApiResourceBase from eduid_scimapi.schemas.scimbase import SCIMResourceType from eduid_scimapi.utils import urlappend if TYPE_CHECKING: from eduid_scimapi.context import Context logger = logging.getLogger(__name__) @dataclass class ScimApiEventResource: resource_type: SCIMResourceType scim_id: UUID external_id: Optional[str] def to_dict(self) -> Dict[str, Any]: data = asdict(self) data['scim_id'] = str(self.scim_id) data['resource_type'] = self.resource_type.value return data @classmethod def from_dict(cls: Type[ScimApiEventResource], data: Mapping[str, Any]) -> ScimApiEventResource: _data = dict(data) _data['resource_type'] = SCIMResourceType(_data['resource_type']) _data['scim_id'] = UUID(_data['scim_id']) return cls(**_data) class EventLevel(Enum): DEBUG = 'debug' INFO = 'info' WARNING = 'warning' ERROR = 'error' class EventStatus(Enum): CREATED = 'CREATED' UPDATED = 'UPDATED' DELETED = 'DELETED' @dataclass class _ScimApiEventRequired: resource: ScimApiEventResource level: EventLevel source: str data: Dict[str, Any] expires_at: datetime timestamp: datetime @dataclass class ScimApiEvent(ScimApiResourceBase, _ScimApiEventRequired): db_id: ObjectId = field(default_factory=lambda: ObjectId()) # mongodb document _id def to_dict(self) -> Dict[str, Any]: data = asdict(self) data['_id'] = data.pop('db_id') data['level'] = self.level.value data['scim_id'] = str(self.scim_id) data['resource'] = self.resource.to_dict() return data @classmethod def from_dict(cls: Type[ScimApiEvent], data: Mapping[str, Any]) -> ScimApiEvent: _data = dict(data) if '_id' in _data: _data['db_id'] = _data.pop('_id') _data['level'] = EventLevel(_data['level']) _data['scim_id'] = UUID(_data['scim_id']) _data['resource'] = ScimApiEventResource.from_dict(_data['resource']) return cls(**_data) class ScimApiEventDB(ScimApiBaseDB): def __init__(self, db_uri: str, collection: str, db_name='eduid_scimapi'): super().__init__(db_uri, db_name, collection=collection) indexes = { # Remove messages older than expires_at datetime 'auto-discard': {'key': [('expires_at', 1)], 'expireAfterSeconds': 0}, # Ensure unique scim_id 'unique-scimid': {'key': [('scim_id', 1)], 'unique': True}, } self.setup_indexes(indexes) def save(self, event: ScimApiEvent) -> bool: """ Save a new event to the database. Events are never expected to be modified. """ event_dict = event.to_dict() result = self._coll.insert_one(event_dict) logger.debug(f'{self} Inserted event {event} in {self._coll_name}') import pprint extra_debug = pprint.pformat(event_dict, width=120) logger.debug(f'Extra debug:\n{extra_debug}') return result.acknowledged def get_events_by_resource( self, resource_type: SCIMResourceType, scim_id: Optional[UUID] = None, external_id: Optional[str] = None ) -> List[ScimApiEvent]: filter = { 'resource.resource_type': resource_type.value, } if scim_id is not None: filter['resource.scim_id'] = str(scim_id) if external_id is not None: filter['resource.external_id'] = external_id docs = self._get_documents_by_filter(filter, raise_on_missing=False) if docs: return [ScimApiEvent.from_dict(this) for this in docs] return [] def get_event_by_scim_id(self, scim_id: str) -> Optional[ScimApiEvent]: doc = self._get_document_by_attr('scim_id', scim_id, raise_on_missing=False) if not doc: return None return ScimApiEvent.from_dict(doc) def add_api_event( data_owner: str, context: 'Context', db_obj: ScimApiResourceBase, resource_type: SCIMResourceType, level: EventLevel, status: EventStatus, message: str, ) -> None: """ Add an event with source=this-API. """ _now = utc_now() _expires_at = _now + timedelta(days=1) _event = ScimApiEvent( scim_id=uuid4(), resource=ScimApiEventResource( resource_type=resource_type, scim_id=db_obj.scim_id, external_id=db_obj.external_id ), timestamp=_now, expires_at=_expires_at, source='eduID SCIM API', level=level, data={'v': 1, 'status': status.value, 'message': message}, ) event_db = context.get_eventdb(data_owner=data_owner) assert event_db # please mypy event_db.save(_event) # Send notification event_location = urlappend(context.base_url, f'Events/{_event.scim_id}') message = context.notification_relay.format_message(version=1, data={'location': event_location}) context.notification_relay.notify(data_owner=data_owner, message=message) return None
StarcoderdataPython
1790266
""" Outputs a script to convert 2 channel wav files to 1 channel wave files. """ import fnmatch import os for root, dirnames, filenames in os.walk("orchive"): for filename in fnmatch.filter(filenames, "*.wav"): new_filename = filename[:-4] + ".1c.wav" print("sox {} {} remix 1,2".format(filename, new_filename))
StarcoderdataPython
3317550
""" You must put all includes from others libraries before the include of pygin and put all include of other files after the include of pygin """ # Other Libraries includes: # pygin includes: from pygin import * # files includes: from game.game_objects.controllers.retry_controller import RetryController class RetryScene(Scene): def __init__(self): """ Create the list of mesh_objects and call the superclass constructor passing the list """ self.init_game_objects_controllers_reference_list = [RetryController] super(RetryScene, self).__init__(self.init_game_objects_controllers_reference_list)
StarcoderdataPython
91207
from abc import ABCMeta, abstractmethod # NOTE: domain service concern with domain and business logic, so call them and has responsibility. class ObjectRepositoryIF(metaclass=ABCMeta): # find object source by id from database. This method should return object or None @abstractmethod def find_by_id(self, id): pass # find object source by name from database. This method should return object or None @abstractmethod def find_by_name(self, name): pass # find object sources by user id from database. This method should return object or None @abstractmethod def find_by_user_id(self, user_id): pass # save object source to database. This method should return saved object or error @abstractmethod def save(self, ob): pass # save bucket source database. This method should return saved bucket or error @abstractmethod def save_bucket(self, bucket): pass # delete object source from database. This method should return deleted object or error @abstractmethod def delete(self, ob): pass # delete bucket source from database. This method should return deleted bucket or error @abstractmethod def delete_bucket(self, bucket): pass # update object source to database. This method should return updated object or error @abstractmethod def update(self, ob): pass
StarcoderdataPython
1696315
<filename>securitybot/util.py __author__ = '<NAME>, <NAME>' __email__ = '<EMAIL>, <EMAIL>' import pytz import secrets import os from datetime import datetime, timedelta from collections import namedtuple from securitybot.tasker import StatusLevel def tuple_builder(answer=None, text=None): tup = namedtuple('Response', ['answer', 'text']) tup.answer = answer if answer is not None else None tup.text = text if text is not None else '' return tup def during_business_hours(time, bot): ''' Checks if a given time is within business hours. Currently is true from 10:00 to 17:59. Also checks to make sure that the day is a weekday. Args: time (Datetime): A datetime object to check. ''' if time.tzinfo is not None: here = time.astimezone(bot._local_tz) else: here = time.replace(tzinfo=pytz.utc).astimezone(bot._local_tz) return (bot._opening_time <= here.hour < bot._closing_time and 1 <= time.isoweekday() <= 5) def get_expiration_time(start, ttl, bot): ''' Gets an expiration time for an alert. Works by adding on a certain time and wrapping around after business hours so that alerts that are started near the end of the day don't expire. Args: start (Datetime): A datetime object indicating when an alert was started. ttl (Timedelta): A timedelta representing the amount of time the alert should live for. Returns: Datetime: The expiry time for an alert. ''' if start.tzinfo is None: start = start.replace(tzinfo=pytz.utc) end = start + ttl if not during_business_hours(end, bot): end_of_day = datetime(year=start.year, month=start.month, day=start.day, hour=bot._closing_time, tzinfo=bot._local_tz) delta = end - end_of_day next_day = end_of_day + timedelta( hours=(bot._opening_time - bot._closing_time) % 24 ) # This may land on a weekend, so march to the next weekday while not during_business_hours(next_day, bot): next_day += timedelta(days=1) end = next_day + delta return end def create_new_alert(dbclient, title, ldap, description, reason, url='N/A', key=None): # type: (str, str, str, str, str, str) -> None ''' Creates a new alert in the SQL DB with an optionally random hash. ''' # Generate random key if none provided if key is None: key = secrets.token_hex(nbytes=32) # Insert that into the database as a new alert dbclient.execute( 'new_alert_alerts', ( key, ldap, title, description, reason, url ) ) # key, comment, performed, authenticated dbclient.execute('new_alert_user_response', (key, '', 0, 0)) dbclient.execute('new_alert_status', (key, StatusLevel.OPEN.value))
StarcoderdataPython
3344165
<filename>piston/configuration/validators/theme_validator.py from typing import Union from piston.configuration.choose_config import choose_config from piston.configuration.validators.validator_base import Validator from piston.utilities.constants import Configuration, console, themes class ThemeValidator(Validator): """Validates a string or list of themes by checking multiple criteria.""" def __init__(self, themes: Union[str, list]) -> None: self.themes = themes self.default_theme = Configuration.default_configuration["theme"] super().__init__(self.themes, self.default_theme, "theme") @staticmethod def check_theme_exists(theme: str) -> bool: """Ensures that a given theme exists.""" if theme not in themes: console.print( f'[red]Theme invalid, "{theme}" not recognized. Using default theme.[/red]' ) return False return True def validate_theme(self) -> bool: """Validates a theme string.""" if not self.validate_type(): return False if isinstance(self.themes, str) and not ThemeValidator.check_theme_exists( self.themes ): # Check the singular theme exists. return False if isinstance(self.themes, list): # Check each theme exists. for theme in self.themes: if not ThemeValidator.check_theme_exists(theme): return False return True def fix_theme(self) -> str: """Finds and corrects any errors in a given theme or list of themes, then returns a fixed version.""" if self.validate_theme(): return choose_config(self.themes) return self.default_theme
StarcoderdataPython
3364190
<reponame>chenkaisun/MMLI1 import argparse def read_args(): parser = argparse.ArgumentParser() # pretrained language model parser.add_argument("--plm", default="bert-base-cased", type=str, metavar='N') parser.add_argument("--max_seq_len", default=1024, type=int) # experiment parser.add_argument("--model_name", default="fet_model", type=str) parser.add_argument("--model_path", default="model/states/best_dev.pt", type=str) parser.add_argument("--experiment", default="exp", type=str) parser.add_argument("--experiment_path", default="../experiment/", type=str) parser.add_argument("--exp", default="fet", type=str) parser.add_argument("--exp_id", default="0", type=str) parser.add_argument("--analyze", default=0, type=int) parser.add_argument("--add_concept", default=0, type=int) parser.add_argument("--add_label_text", default=0, type=int) # data parser.add_argument("--seed", type=int, default=42, help="random seed for initialization") parser.add_argument("--tgt_name", default="p_np", type=str) parser.add_argument("--data_dir", default="data/property_pred/clintox.csv", type=str) parser.add_argument("--train_file", default="data/property_pred/clintox.csv", type=str) parser.add_argument("--val_file", default="dev.json", type=str) parser.add_argument("--test_file", default="test.json", type=str) parser.add_argument("--cache_filename", default="", type=str) parser.add_argument("--use_cache", default=0, type=int) parser.add_argument("--cache_data", default=0, type=int) # training params parser.add_argument("--num_atom_types", default=0, type=int) parser.add_argument("--num_edge_types", default=0, type=int) parser.add_argument("--batch_size", default=6, type=int, help="Batch size for training.") parser.add_argument("--plm_lr", default=2e-5, type=float, help="The initial learning rate for PLM.") parser.add_argument("--lr", default=1e-3, type=float, help="The initial learning rate for Adam.") parser.add_argument('--weight_decay', type=float, default=5e-4, help='Weight decay (L2 loss on parameters).') parser.add_argument("--activation", default="gelu", type=str) parser.add_argument("--adam_epsilon", default=1e-6, type=float, help="Epsilon for Adam optimizer.") parser.add_argument("--max_grad_norm", default=1.0, type=float, help="Max gradient norm.") parser.add_argument("--warmup_ratio", default=0.06, type=float, help="Warm up ratio for Adam.") parser.add_argument("--num_epochs", default=15, type=float, help="Total number of training epochs to perform.") parser.add_argument("--eval_epoch", default=30, type=float, help="Number of steps between each evaluation.") parser.add_argument('--patience', type=int, default=8) parser.add_argument('--burn_in', type=int, default=0) parser.add_argument('--print_epoch_interval', type=int, default=10) parser.add_argument("--scheduler", default=1) # parser.add_argument('-l', '--list', nargs='+', help='<Required> Set flag', required=True) parser.add_argument("--gpu_id", default=0, type=int, help="gpu_id", ) parser.add_argument("--n_gpu", default=1, type=int, help="Number of gpu", ) parser.add_argument("--use_gpu", default=1, type=int, help="Using gpu or cpu", ) parser.add_argument("--use_amp", default=1, type=int, help="Using mixed precision") parser.add_argument("--grad_accumulation_steps", default=1, type=int, help="Using mixed precision") parser.add_argument("--num_workers", default=1, type=int) # model params parser.add_argument("--in_dim", default=14, type=float, help="Feature dim") parser.add_argument("--out_dim", default=14, type=float, help="Feature dim") parser.add_argument("--dropout", default=0.2, type=float, help="Dropout") parser.add_argument('--g_dim', type=int, default=256, help='Number of final hidden units for graph.') parser.add_argument('--num_gnn_layers', type=int, default=2, help='Number of final hidden units for graph.') parser.add_argument('--plm_hidden_dim', type=int, default=768, help='Number of hidden units for plm.') parser.add_argument('--hidden_dim', type=int, default=128, help='Number of hidden units.') parser.add_argument('--embedding_dim', type=int, default=16, help='Number of embedding units.') parser.add_argument('--batch_norm', default=False, help="Please give a value for batch_norm") # parser.add_argument('--i_only', default=0, type=int) # parser.add_argument('--g_only', default=0, type=int) # parser.add_argument('--t_only', default=0, type=int) # parser.add_argument('--i', default=0, type=int) # parser.add_argument('--gt', default=0, type=int) # parser.add_argument('--t', default=0, type=int) # parser.add_argument('--td', default=0, type=int) # parser.add_argument('--tg', default=0, type=int) # parser.add_argument('--tdg', default=0, type=int) # parser.add_argument('--tdg_x', default=0, type=int) parser.add_argument('--model_type', default="tdgm") parser.add_argument('--mult_mask', default=0, type=int) parser.add_argument('--g_mult_mask', default=0, type=int) parser.add_argument('--g_global_pooling', default=1, type=int) parser.add_argument('--gnn_type', default="gine") parser.add_argument('--cm_type', default=0, type=int) # 0 original, 1 no tformer, 2 3D parser.add_argument('--pool_type', default=0, type=int) # for cm, 0 mean max, 1 max mean, 2 mean, 3 max parser.add_argument('--type_embed', default=0, type=int) parser.add_argument('--cm', default=0, type=int) parser.add_argument('--attn_analysis', default=0, type=int) parser.add_argument('--error_analysis', default=0, type=int) ##for lst parser.add_argument('--embed_dim', type=int, default="200", help='Number of embedding units.') parser.add_argument('--word_embed_type', type=int, default=16, help='Number of embedding units.') parser.add_argument('--lstm_dropout', type=int, default=.5) parser.add_argument('--embed_dropout', type=int, default=.5) # auxiliary # parser.add_argument("--debug", action="store_true") parser.add_argument("--debug", action="store_true") parser.add_argument("--eval", action="store_true") # # experiment specific # parser.add_argument("--g", action="store_true") # parser.add_argument("--tg", action="store_true") args = parser.parse_args() return args
StarcoderdataPython
3347224
<gh_stars>1-10 #!/usr/bin/env python3 import sys import os import signal import argparse import logging import syslog from gpuctl import __version__ from gpuctl import DRYRUN, GpuCtl, logger from gpuctl import PciDev, GpuDev, GpuAMD, GpuNV from gpuctl import EthCtl, scan_miner def run(): gpu_ctl = None def sigstop(a, b): gpu_ctl.stop() # print(f'exit') # sys.exit(0) signal.signal(signal.SIGINT, sigstop) parser = argparse.ArgumentParser() # device parser.add_argument('-l', '--list', action='store_true', help="list all GPU cards") parser.add_argument( '-s', '--slots', type=str, help="use PCI slot name to locate GPU (ie. 0000:01:00.0/0000:01:00.1)") parser.add_argument('-a', '--amd', action='store_true', help="only use AMD GPU") parser.add_argument('-n', '--nvidia', action='store_true', help="only use Nvidia GPU") # timer parser.add_argument('--interval', type=int, default=GpuCtl.INTERVAL, help="monitoring interval") parser.add_argument('-w', '--wait', type=int, default=GpuCtl.WAIT_PERIOD, help="seconds before take action") # fan control parser.add_argument('--set-speed', type=int, choices=range(0,101), metavar="[0-100]", help="set the fan speed (0~100)") parser.add_argument('-f', '--fan', type=int, help="if temperature is exceed than FAN once, activate fan control (default:70)") parser.add_argument('-d', '--delta', type=int, default=2, help="set fan speed if temperature diff %% is over DELTA (defaut:2)") parser.add_argument('--curve', type=str, help="set temp/fan-speed curve (ie. 0:0/10:10/80:100)") # temperature monitoring/actions parser.add_argument('--temp', type=int, default=85, help="over temperature action threshold") parser.add_argument('--tas', type=str, help="over temperature action script") # rate parser.add_argument('--scan', action='store_true', help="list miner through network inquiry") # misc parser.add_argument('-v', '--verbose', action='store_true', help="show debug message") parser.add_argument('-V', '--version', action='version', version="%(prog)s-" + __version__, help="show version info") # parse arguments args = parser.parse_args() syslog.openlog(logoption=syslog.LOG_PID, facility=syslog.LOG_USER) if args.verbose: logger.setLevel(logging.DEBUG) # check if script is existed if args.tas != None: if not os.path.isfile(args.tas): print(f'gpuctl: script {args.tas} not found !\n') sys.exit(0) # parse curve curve = None if args.curve: clst = args.curve.split('/') for c in clst: if ':' not in c: print(f'Invaid curve: [{args.curve}]') sys.exit(0) if clst: curve = [[int(c.split(':')[0]), int(c.split(':')[1])] for c in clst] if curve and GpuDev.check_curve(curve): print(f'Applying curve: [{args.curve}]') else: print(f'Invaid curve: [{args.curve}]') if args.scan: miners = scan_miner() print('') for miner in miners: r = miner.get_stats() if r == None: continue print(f"Miner : {r['name']:12}, tcp port: {miner.port}, pid: {miner.pid}") print(f"Uptime: {r['uptime']}s") print(f"Rate(kh) Temp Fan ") print(f"======== ==== ==== ") for i in range(len(r['temp'])): print(f"{r['rate'][i]:8} {r['temp'][i]:3}c {r['fan'][i]:3}%") print('') sys.exit(0) # by slots gpu_devices = [] slot_names = [] # parse slot slots = None if args.slots: # by slot slots = args.slots.split('/') for sn in slots: sn = sn.strip().lstrip() sn = sn.strip('\'').lstrip('\'') pdev = PciDev.create(sn) gpu_dev = None if pdev and pdev.is_amd(): gpu_dev = GpuAMD(pdev) if pdev and pdev.is_nvidia(): gpu_dev = GpuNV(pdev) if gpu_dev and gpu_dev.is_gpu(): gpu_devices.append(gpu_dev) slot_names.append(gpu_dev.pci_dev.slot_name) else: # by vendors vendors = [] if args.amd: vendors.append('AMD') if args.nvidia: vendors.append('NVIDIA') pci_devices = PciDev.discovery(vendors) for pdev in pci_devices: gpu_dev = None if pdev and pdev.is_amd(): gpu_dev = GpuAMD(pdev) if pdev and pdev.is_nvidia(): gpu_dev = GpuNV(pdev) # remove duplicate gpu if gpu_dev and gpu_dev.is_gpu() and pdev.slot_name not in slot_names: gpu_devices.append(gpu_dev) if args.set_speed != None: for gpu in gpu_devices: pdev = gpu.pci_dev # set fan speed print(f"Set slot {pdev.slot_name} fan speed to {args.set_speed}%") rv = gpu.set_speed(args.set_speed) if not rv: print(f"Failed to set slot {pdev.slot_name} fan speed !!!") sys.exit(0) # list monitored devices print("\n") print("ID Slot Name Vendor PCI-ID Temp. Fan PWR Working") print("-- ------------ -------- ----------- ----- ---- ------- -------") cnt = 1 for gpu in gpu_devices: pdev = gpu.pci_dev working = gpu.is_working() t_str = gpu.get_temperature() if gpu.get_temperature() else '--' s_str = gpu.get_speed() if gpu.get_speed() else '--' p_str = gpu.get_pwr() if gpu.get_pwr() else '--' msg = f"{cnt:2} {pdev.slot_name} {pdev.vendor_name():8} [{pdev.vendor_id}:{pdev.device_id}] " msg += f"{t_str:4}c {s_str:3}% {p_str:6.2f}w {working}" print(msg) cnt += 1 print("\n") if args.list: sys.exit(0) if len(gpu_devices) == 0: print('No GPU found, abort !\n') sys.exit(0) # remove not working devices for gpu in list(gpu_devices): if gpu.is_working() == False: print(f'slot {gpu.pci_dev.slot_name} is malfunction, removed !\n') gpu_devices.remove(gpu) gpu_ctl = GpuCtl(gpu_devices=gpu_devices, fan=args.fan, curve=curve, delta=args.delta, temp=args.temp, tas=args.tas, verbose=args.verbose ) if not gpu_ctl.set_interval(intvl=args.interval, wait_period=args.wait): print( f'Interval error {args.interval}/{args.wait} !\n') sys.exit(0) print(f"gpuctl: started\n") gpu_ctl.start() if __name__ == '__main__': run()
StarcoderdataPython
61719
# # Copyright (c) 2018 ISP RAS (http://www.ispras.ru) # Ivannikov Institute for System Programming of the Russian Academy of Sciences # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # from core.vtg.emg.common import get_conf_property from core.vtg.emg.common.c.types import Declaration, Function, Array, Pointer, Primitive from core.vtg.emg.processGenerator.linuxModule.interface import Resource, Callback, StructureContainer, \ FunctionInterface def yield_categories(collection): """ Analyze all new types found by SA component and yield final set of interface categories built from manually prepared interface specifications and global variables. All new categories and interfaces are added directly to the InterfaceCategoriesSpecification object. Also all types declarations are updated according with new imported C types. However, there are still unused interfaces present in the collection after this function termination. :param collection: InterfaceCategoriesSpecification object. :param conf: Configuration property dictionary of InterfaceCategoriesSpecification object. :return: None """ # Add resources if get_conf_property(collection.conf, "generate new resource interfaces"): __populate_resources(collection) # Complement interface references __complement_interfaces(collection) return def __populate_resources(collection): # Iterate over categories for category in collection.categories: usage = dict() # Extract callbacks for callback in collection.callbacks(category): for parameter in (p for i, p in enumerate(callback.declaration.points.parameters) if isinstance(p, Declaration) and not (len(callback.param_interfaces) > i and callback.param_interfaces[i])): if parameter.identifier in usage: usage[parameter.identifier]["counter"] += 1 else: # Try to resolve interface intfs = collection.resolve_interface_weakly(parameter, category=callback.category, use_cache=False) if len(intfs) == 0: # Only unmatched resources should be introduced usage[parameter.identifier] = { "counter": 1, "declaration": parameter } # Introduce new resources for declaration in (usage[i]["declaration"] for i in usage if usage[i]["counter"] > 1): if "{}.{}".format(category, declaration.pretty_name) not in collection.interfaces: identifier = declaration.pretty_name elif "{}.{}".format(category, 'ldv_' + declaration.pretty_name) not in collection.interfaces: identifier = 'ldv_' + declaration.pretty_name else: raise RuntimeError("Cannot yield identifier for callback {!r} of category {!r}". format(declaration.identifier, category)) interface = Resource(category, identifier) interface.declaration = declaration collection.set_intf(interface) return def fulfill_function_interfaces(collection, interface, category=None): """ Check an interface declaration (function or function pointer) and try to match its return value type and parameters arguments types with existing interfaces. The algorythm should be the following: * Match explicitly stated interface References (only if they meet given category). * Match rest parameters: - Avoid matching primitives and arrays and pointers of primitives; - Match interfaces from given category or from the category of already matched interfaces by interface references; - If there are more that one category is matched - do not do match to avoid mistakes in match. :param collection: InterfaceCategoriesSpecification object. :param interface: Interface object: KernelFunction or Callback. :param category: Category filter. :return: None. """ def is_primitive_or_void(decl): """ Return True if given declaration object has type of Primitive or pointer(* and **) to Primitive. :param decl: Declaration object :return: True - it is primitive, False - otherwise """ # todo: Implement check agains arrays of primitives if isinstance(decl, Primitive) or (isinstance(decl, Pointer) and isinstance(decl.points, Primitive)) or \ decl.identifier in {'void *', 'void **'}: return True else: return False collection.logger.debug("Try to match collateral interfaces for function '{!r}'".format(interface.identifier)) # Check declaration type if isinstance(interface, Callback): declaration = interface.declaration.points elif isinstance(interface, FunctionInterface): declaration = interface.declaration else: raise TypeError('Expect pointer to function or function declaration but got {!r}'. format(str(type(interface.declaration).__name__))) # Second match rest types if not interface.rv_interface and declaration.return_value and not is_primitive_or_void(declaration.return_value): rv_interface = collection.resolve_interface(declaration.return_value, category, False) if len(rv_interface) == 0: rv_interface = collection.resolve_interface_weakly(declaration.return_value, category, False) if len(rv_interface) == 1: interface.rv_interface = rv_interface[-1] elif len(rv_interface) > 1: collection.logger.warning( 'Interface {!r} return value signature {!r} can be match with several following interfaces: {}'. format(interface.identifier, declaration.return_value.identifier, ', '.join((i.identifier for i in rv_interface)))) for index in range(len(declaration.parameters)): if not (len(interface.param_interfaces) > index and interface.param_interfaces[index]) and \ not isinstance(declaration.parameters[index], str) and \ not is_primitive_or_void(declaration.parameters[index]): p_interface = collection.resolve_interface(declaration.parameters[index], category, False) if len(p_interface) == 0: p_interface = collection.resolve_interface_weakly(declaration.parameters[index], category, False) if len(p_interface) == 1: p_interface = p_interface[0] elif len(p_interface) == 0: p_interface = None else: collection.logger.warning( 'Interface {!r} parameter in the position {} with signature {!r} can be match with several ' 'following interfaces: {}'.format(interface.identifier, index, declaration.parameters[index].identifier, ', '.join((i.identifier for i in p_interface)))) p_interface = None interface.set_param_interface(index, p_interface) if p_interface and not category: category = p_interface.category def __complement_interfaces(collection): def __match_interface_for_container(signature, category, id_match): candidates = collection.resolve_interface_weakly(signature, category, use_cache=False) if len(candidates) == 1: return candidates[0] elif len(candidates) == 0: return None else: strict_candidates = collection.resolve_interface(signature, category, use_cache=False) if len(strict_candidates) == 1: return strict_candidates[0] elif len(strict_candidates) > 1 and id_match: id_candidates = [i for i in strict_candidates if i.short_identifier == id_match] if len(id_candidates) == 1: return id_candidates[0] else: return None if len(strict_candidates) > 1: raise RuntimeError('There are several interfaces with the same declaration {}'. format(signature.to_string('a'))) # Filter of resources candidates = [i for i in candidates if not isinstance(i, Resource)] if len(candidates) == 1: return candidates[0] else: return None # Resolve callback parameters for callback in collection.callbacks(): fulfill_function_interfaces(collection, callback, callback.category) # Resolve kernel function parameters for func in collection.function_interfaces: fulfill_function_interfaces(collection, func) # todo: Remove dirty declarations in container references and add additional clean one # Resolve array elements for container in (cnt for cnt in collection.containers() if cnt.declaration and isinstance(cnt.declaration, Array) and not cnt.element_interface): intf = __match_interface_for_container(container.declaration.element, container.category, None) if intf: container.element_interface = intf # Resolve structure interfaces for container in (cnt for cnt in collection.containers() if cnt.declaration and isinstance(cnt, StructureContainer)): for field in container.declaration.fields: if field not in container.field_interfaces: intf = __match_interface_for_container(container.declaration.fields[field], container.category, field) if intf: container.field_interfaces[field] = intf if field in container.field_interfaces and isinstance(container.field_interfaces[field], Callback) and \ isinstance(container.declaration.fields[field], Pointer) and \ isinstance(container.declaration.fields[field].points, Function) and \ isinstance(container.field_interfaces[field].declaration, Pointer) and \ isinstance(container.field_interfaces[field].declaration.points, Function): # Track implementations from structures if types slightly differs and attached to structure variable container.field_interfaces[field].declaration = container.declaration.fields[field] return
StarcoderdataPython
3358250
<filename>nadine-2.2.3/doors/keymaster/tests/test_controller.py from django.test import SimpleTestCase from django.utils import timezone #from doors.hid_control import DoorController from doors.keymaster.models import Keymaster from doors.core import Messages, EncryptedConnection, CardHolder, Gatekeeper, TestDoorController class DoorControllerTestCase(SimpleTestCase): name = "test controller" ip_address = "127.0.0.1" username = "username" password = "password" controller = TestDoorController(name, ip_address, username, password) def setUp(self): pass def test_creation(self): self.assertEqual(self.controller.door_name, self.name) self.assertEqual(self.controller.door_ip, self.ip_address) self.assertEqual(self.controller.door_user, self.username) self.assertEqual(self.controller.door_pass, self.password) def test_save_cardholder(self): self.controller.clear_data() self.assertEqual(0, self.controller.cardholder_count()) cardholder = CardHolder("1", "Jacob", "Sayles", "jacobsayles", "123456") self.controller.save_cardholder(cardholder) self.assertEqual(1, self.controller.cardholder_count()) self.controller.clear_data() self.assertEqual(0, self.controller.cardholder_count()) def test_get_cardholder(self): cardholder = CardHolder("1", "Jacob", "Sayles", "jacobsayles", "123456") self.controller.clear_data() self.controller.save_cardholder(cardholder) self.assertEqual(cardholder, self.controller.get_cardholder_by_id("1")) self.assertEqual(cardholder, self.controller.get_cardholder_by_code("123456")) def test_process_codes(self): c1 = CardHolder("1", "Jacob", "Sayles", "jacobsayles", "123456") c2 = CardHolder("2", "Susan", "Dorsch", "susandorsch", "111111") c3 = CardHolder("3", "Bob", "Smith", "bobsmith", "666666") self.controller.clear_data() self.controller.save_cardholder(c1) # No Change self.controller.save_cardholder(c2) # Change self.controller.save_cardholder(c3) # Delete self.assertEqual(3, self.controller.cardholder_count()) # Process the changes new_codes = [ {'username':'jacobsayles', 'first_name':'Jacob', 'last_name':'Sayles', 'code':'123456'}, # No Change {'username':'susandorsch', 'first_name':'Susan', 'last_name':'Dorsch', 'code':'222222'}, # Change {'username':'fredjones', 'first_name':'Fred', 'last_name':'Jones', 'code':'7777777'}, # Add ] changes = self.controller.process_door_codes(new_codes, load_credentials=False) self.assertEqual(len(changes), 4) for c in changes: self.assertNotEqual(c.username, 'jacobsayles') if c.username == 'susandorsch': if c.code == "111111": self.assertEqual(c.action, 'delete') elif c.code == "222222": self.assertEqual(c.action, 'add') else: self.fail("user 'susandorsch' has weird data") elif c.username == 'bobsmith': self.assertEqual(c.action, 'delete') elif c.username == 'fredjones': self.assertEqual(c.action, 'add') else: self.fail("Weird data found") # Copyright 2020 Office Nomads LLC (https://officenomads.com/) Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://opensource.org/licenses/Apache-2.0 Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.
StarcoderdataPython
1601998
<gh_stars>1-10 import segmentation_models_pytorch as smp from configs import CFG from .deeplabv3 import DeepLabV3ResNet18, DeepLabV3ResNet34, DeepLabV3ResNet50, DeepLabV3ResNet101 def build_model(num_channels, num_classes): if CFG.MODEL.NAME == 'deeplabv3': return smp.DeepLabV3(encoder_name=CFG.MODEL.BACKBONE.NAME, in_channels=num_channels, classes=num_classes) elif CFG.MODEL.NAME == 'deeplabv3+': return smp.DeepLabV3Plus(encoder_name=CFG.MODEL.BACKBONE.NAME, in_channels=num_channels, classes=num_classes) elif CFG.MODEL.NAME == 'pspnet': return smp.PSPNet(encoder_name=CFG.MODEL.BACKBONE.NAME, in_channels=num_channels, classes=num_classes) elif CFG.MODEL.NAME == 'unet': return smp.Unet(encoder_name=CFG.MODEL.BACKBONE.NAME, in_channels=num_channels, classes=num_classes) elif CFG.MODEL.NAME == 'unet++': return smp.UnetPlusPlus(encoder_name=CFG.MODEL.BACKBONE.NAME, in_channels=num_channels, classes=num_classes) else: raise NotImplementedError('invalid model: {}'.format(CFG.MODEL.NAME))
StarcoderdataPython
3313826
<filename>parsons/ngpvan/people.py<gh_stars>1-10 from parsons.utilities import json_format import logging logger = logging.getLogger(__name__) class People(object): def __init__(self, van_connection): self.connection = van_connection def find_person(self, first_name=None, last_name=None, date_of_birth=None, email=None, phone=None, phone_type=None, street_number=None, street_name=None, zip=None): """ Find a person record. .. note:: Person find must include the following minimum combinations to conduct a search. - first_name, last_name, email - first_name, last_name, phone - first_name, last_name, zip5, date_of_birth - first_name, last_name, street_number, street_name, zip5 - email_address `Args:` first_name: str The person's first name last_name: str The person's last name dob: str ISO 8601 formatted date of birth (e.g. ``1981-02-01``) email: str The person's email address phone: str Phone number of any type (Work, Cell, Home) street_number: str Street Number street_name: str Street Name zip: str 5 digit zip code `Returns:` A person dict object """ logger.info(f'Finding {first_name} {last_name}.') return self._people_search( first_name=first_name, last_name=last_name, date_of_birth=date_of_birth, email=email, phone=phone, phone_type=phone_type, street_number=street_number, street_name=street_name, zip=zip ) def find_person_json(self, match_json): """ Find a person record based on json data. .. note:: Person find must include the following minimum combinations to conduct a search. - first_name, last_name, email - first_name, last_name, phone - first_name, last_name, zip5, date_of_birth - first_name, last_name, street_number, street_name, zip5 - email_address .. note:: A full list of possible values for the json, and its structure can be found `here <https://docs.ngpvan.com/reference/people#peoplefind>`_. `Args:` match_json: dict A dictionary of values to match against. fields: The fields to return. Leave as default for all available fields `Returns:` A person dict object """ logger.info('Finding a match for json details.') return self._people_search(match_json=match_json) def update_person(self, id=None, id_type='vanid', first_name=None, last_name=None, date_of_birth=None, email=None, phone=None, phone_type=None, street_number=None, street_name=None, zip=None): """ Update a person record based on a provided ID. All other arguments provided will be updated on the record. .. warning:: This method can only be run on MyMembers, EveryAction, MyCampaign databases. `Args:` id: str A valid id id_type: str A known person identifier type available on this VAN instance. Defaults to ``vanid``. first_name: str The person's first name last_name: str The person's last name dob: str ISO 8601 formatted date of birth (e.g. ``1981-02-01``) email: str The person's email address phone: str Phone number of any type (Work, Cell, Home) phone_type: str One of 'H' for home phone, 'W' for work phone, 'C' for cell, 'M' for main phone or 'F' for fax line. Defaults to home phone. street_number: str Street Number street_name: str Street Name zip: str 5 digit zip code `Returns:` A person dict """ return self._people_search( id=id, id_type=id_type, first_name=first_name, last_name=last_name, date_of_birth=date_of_birth, email=email, phone=phone, phone_type=phone_type, street_number=street_number, street_name=street_name, zip=zip, create=True ) def update_person_json(self, id, id_type='vanid', match_json=None): """ Update a person record based on a provided ID within the match_json dict. .. note:: A full list of possible values for the json, and its structure can be found `here <https://docs.ngpvan.com/reference/people#peoplevanid>`_. `Args:` id: str A valid id id_type: str A known person identifier type available on this VAN instance. Defaults to ``vanid``. match_json: dict A dictionary of values to match against and save. `Returns:` A person dict """ return self._people_search(id=id, id_type=id_type, match_json=match_json, create=True) def upsert_person(self, first_name=None, last_name=None, date_of_birth=None, email=None, phone=None, phone_type=None, street_number=None, street_name=None, zip=None): """ Create or update a person record. .. note:: Person find must include the following minimum combinations. - first_name, last_name, email - first_name, last_name, phone - first_name, last_name, zip5, date_of_birth - first_name, last_name, street_number, street_name, zip5 - email_address .. warning:: This method can only be run on MyMembers, EveryAction, MyCampaign databases. `Args:` first_name: str The person's first name last_name: str The person's last name dob: str ISO 8601 formatted date of birth (e.g. ``1981-02-01``) email: str The person's email address phone: str Phone number of any type (Work, Cell, Home) phone_type: str One of 'H' for home phone, 'W' for work phone, 'C' for cell, 'M' for main phone or 'F' for fax line. Defaults to home phone. street_number: str Street Number street_name: str Street Name zip: str 5 digit zip code `Returns:` A person dict """ return self._people_search( first_name=first_name, last_name=last_name, date_of_birth=date_of_birth, email=email, phone=phone, phone_type=phone_type, street_number=street_number, street_name=street_name, zip=zip, create=True ) def upsert_person_json(self, match_json): """ Create or update a person record. .. note:: Person find must include the following minimum combinations. - first_name, last_name, email - first_name, last_name, phone - first_name, last_name, zip5, date_of_birth - first_name, last_name, street_number, street_name, zip5 - email_address .. note:: A full list of possible values for the json, and its structure can be found `here <https://docs.ngpvan.com/reference/people#peoplefindorcreate>`_. `vanId` can be passed to ensure the correct record is updated. .. warning:: This method can only be run on MyMembers, EveryAction, MyCampaign databases. `Args:` match_json: dict A dictionary of values to match against and save. `Returns:` A person dict """ return self._people_search(match_json=match_json, create=True) def _people_search(self, id=None, id_type=None, first_name=None, last_name=None, date_of_birth=None, email=None, phone=None, phone_type='H', street_number=None, street_name=None, zip=None, match_json=None, create=False): # Internal method to hit the people find/create endpoints addressLine1 = None if street_name and street_number: addressLine1 = f'{street_number} {street_name}' # Check to see if a match map has been provided if not match_json: json = {"firstName": first_name, "lastName": last_name} # Will fail if empty dicts are provided, hence needed to add if exist if email: json['emails'] = [{'email': email}] if phone: # To Do: Strip out non-integers from phone json['phones'] = [{'phoneNumber': phone, 'phoneType': phone_type}] if date_of_birth: json['dateOfBirth'] = date_of_birth if zip or addressLine1: json['addresses'] = [{}] if zip: json['addresses'][0]['zipOrPostalCode'] = zip if addressLine1: json['addresses'][0]['addressLine1'] = addressLine1 else: json = match_json if 'vanId' in match_json: id = match_json['vanId'] url = 'people/' if id: if create: id_type = '' if id_type in ('vanid', None) else f"{id_type}:" url += id_type + str(id) else: return self.get_person(id, id_type=id_type) else: url += 'find' if create: url += 'OrCreate' else: # Ensure that the minimum combination of fields were passed json_flat = json_format.flatten_json(json) self._valid_search(**json_flat) return self.connection.post_request(url, json=json) def _valid_search(self, firstName=None, lastName=None, email=None, phoneNumber=None, dateOfBirth=None, addressLine1=None, zipOrPostalCode=None, **kwargs): # Internal method to check if a search is valid, kwargs are ignored if (None in [firstName, lastName, email] and None in [firstName, lastName, phoneNumber] and None in [firstName, lastName, zipOrPostalCode, dateOfBirth] and None in [firstName, lastName, addressLine1, zipOrPostalCode] and None in [email]): raise ValueError(""" Person find must include the following minimum combinations to conduct a search. - first_name, last_name, email - first_name, last_name, phone - first_name, last_name, zip, dob - first_name, last_name, street_number, street_name, zip - email """) return True def get_person(self, id, id_type='vanid', expand_fields=[ 'contribution_history', 'addresses', 'phones', 'emails', 'codes', 'custom_fields', 'external_ids', 'preferences', 'recorded_addresses', 'reported_demographics', 'suppressions', 'cases', 'custom_properties', 'districts', 'election_records', 'membership_statuses', 'notes', 'organization_roles', 'disclosure_field_values']): """ Returns a single person record using their VANID or external id. `Args:` id: str A valid id id_type: str A known person identifier type available on this VAN instance such as ``dwid``. Defaults to ``vanid``. expand_fields: list A list of fields for which to include data. If a field is omitted, ``None`` will be returned for that field. Can be ``contribution_history``, ``addresses``, ``phones``, ``emails``, ``codes``, ``custom_fields``, ``external_ids``, ``preferences``, ``recorded_addresses``, ``reported_demographics``, ``suppressions``, ``cases``, ``custom_properties``, ``districts``, ``election_records``, ``membership_statuses``, ``notes``, ``organization_roles``, ``scores``, ``disclosure_field_values``. `Returns:` A person dict """ # Change end point based on id type url = 'people/' id_type = '' if id_type in ('vanid', None) else f"{id_type}:" url += id_type + str(id) expand_fields = ','.join([json_format.arg_format(f) for f in expand_fields]) # Removing the fields that are not returned in MyVoters NOT_IN_MYVOTERS = ['codes', 'contribution_history', 'organization_roles'] if self.connection.db_code == 0: expand_fields = [v for v in expand_fields if v not in NOT_IN_MYVOTERS] logger.info(f'Getting person with {id_type} of {id} at url {url}') return self.connection.get_request(url, params={'$expand': expand_fields}) def apply_canvass_result(self, id, result_code_id, id_type='vanid', contact_type_id=None, input_type_id=None, date_canvassed=None): """ Apply a canvass result to a person. Use this end point for attempts that do not result in a survey response or an activist code (e.g. Not Home). `Args:` id: str A valid person id result_code_id : int Specifies the result code of the attempt. Valid ids can be found by using the :meth:`get_canvass_responses_result_codes` id_type: str A known person identifier type available on this VAN instance such as ``dwid`` contact_type_id : int `Optional`; A valid contact type id input_type_id : int `Optional`; Defaults to 11 (API Input) date_canvassed : str `Optional`; ISO 8601 formatted date. Defaults to todays date `Returns:` ``None`` """ logger.info(f'Applying result code {result_code_id} to {id_type} {id}.') self.apply_response(id, None, id_type=id_type, contact_type_id=contact_type_id, input_type_id=input_type_id, date_canvassed=date_canvassed, result_code_id=result_code_id) def toggle_volunteer_action(self, id, volunteer_activity_id, action, id_type='vanid', result_code_id=None, contact_type_id=None, input_type_id=None, date_canvassed=None): """ Apply or remove a volunteer action to or from a person. `Args:` id: str A valid person id id_type: str A known person identifier type available on this VAN instance such as ``dwid`` volunteer_activity_id: int A valid volunteer activity id action: str Either 'apply' or 'remove' result_code_id : int `Optional`; Specifies the result code of the response. If not included,responses must be specified. Conversely, if responses are specified, result_code_id must be null. Valid ids can be found by using the :meth:`get_canvass_responses_result_codes` contact_type_id: int `Optional`; A valid contact type id input_type_id: int `Optional`; Defaults to 11 (API Input) date_canvassed: str `Optional`; ISO 8601 formatted date. Defaults to todays date ** NOT IMPLEMENTED ** """ """ response = {"volunteerActivityId": volunteer_activity_id, "action": self._action_parse(action), "type": "VolunteerActivity"} logger.info(f'{action} volunteer activity {volunteer_activity_id} to {id_type} {id}') self.apply_response(id, response, id_type, contact_type_id, input_type_id, date_canvassed, result_code_id) """ def apply_response(self, id, response, id_type='vanid', contact_type_id=None, input_type_id=None, date_canvassed=None, result_code_id=None, omit_contact=False): """ Apply responses such as survey questions, activist codes, and volunteer actions to a person record. This method allows you apply multiple responses (e.g. two survey questions) at the same time. It is a low level method that requires that you conform to the VAN API `response object format <https://docs.ngpvan.com/reference/canvass-responses>`_. `Args:` id: str A valid person id response: dict A list of dicts with each dict containing a valid action. id_type: str A known person identifier type available on this VAN instance such as ``dwid`` result_code_id : int `Optional`; Specifies the result code of the response. If not included,responses must be specified. Conversely, if responses are specified, result_code_id must be null. Valid ids can be found by using the :meth:`get_canvass_responses_result_codes` contact_type_id : int `Optional`; A valid contact type id input_type_id : int `Optional`; Defaults to 11 (API Input) date_canvassed : str `Optional`; ISO 8601 formatted date. Defaults to todays date responses : list or dict The responses to apply. omit_contact: boolean Omit adding contact history to the response. This is particularly useful when adding activist codes that are not based on contact attempts. `Returns:` ``True`` if successful .. code-block:: python response = [{"activistCodeId": 18917, "action": "Apply", "type": "ActivistCode"}, {"surveyQuestionId": 109149, "surveyResponseId": 465468, "action": "SurveyResponse"} ] van.apply_response(5222, response) """ # noqa: E501,E261 # Set url based on id_type if id_type == 'vanid': url = f"people/{id}/canvassResponses" else: url = f"people/{id_type}:{id}/canvassResponses" json = {"canvassContext": { "contactTypeId": contact_type_id, "inputTypeId": input_type_id, "dateCanvassed": date_canvassed, "omitActivistCodeContactHistory": omit_contact}, "resultCodeId": result_code_id} if response: json['responses'] = response if result_code_id is not None and response is not None: raise ValueError("Both result_code_id and responses cannot be specified.") if isinstance(response, dict): json["responses"] = [response] if result_code_id is not None and response is not None: raise ValueError( "Both result_code_id and responses cannot be specified.") return self.connection.post_request(url, json=json) def create_relationship(self, vanid_1, vanid_2, relationship_id): """ Create a relationship between two individuals `Args:` vanid_1 : int The vanid of the primary individual; aka the node vanid_2 : int The vanid of the secondary individual; the spoke relationship_id : int The relationship id indicating the type of relationship `Returns:` ``None`` """ json = {'relationshipId': relationship_id, 'vanId': vanid_2} self.connection.post_request(f"people/{vanid_1}/relationships", json=json) logger.info(f'Relationship {vanid_1} to {vanid_2} created.') def apply_person_code(self, id, code_id, id_type='vanid'): """ Apply a code to a person. `Args:` id: str A valid person id. code_id: int A valid code id. id_type: str A known person identifier type available on this VAN instance such as ``dwid`` `Returns:` ``None`` """ # Set url based on id_type if id_type == 'vanid': url = f"people/{id}/codes" else: url = f"people/{id_type}:{id}/codes" json = {"codeId": code_id} self.connection.post_request(url, json=json) logger.info(f'Code {code_id} applied to person id {id}.')
StarcoderdataPython
3354435
<gh_stars>0 # -*- coding: utf-8 -*- # -*- Mode: Python -*- # GObject-Introspection - a framework for introspecting GObject libraries # Copyright (C) 2008-2010 <NAME> # Copyright (C) 2012-2013 <NAME> <<EMAIL>> # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU General Public License # as published by the Free Software Foundation; either version 2 # of the License, or (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA # 02110-1301, USA. # ''' GTK-Doc comment block format ---------------------------- A GTK-Doc comment block is built out of multiple parts. Each part can be further divided into fields which are separated by a colon ("``:``") delimiter. Known parts and the fields they are constructed from look like the following (optional fields are enclosed in square brackets):: ┌───────────────────────────────────────────────────────────┐ │ /** │ ─▷ start token ├────────────────────┬──────────────────────────────────────┤ │ * identifier_name │ [: annotations] │ ─▷ identifier part ├────────────────────┼─────────────────┬────────────────────┤ │ * @parameter_name │ [: annotations] │ : description │ ─▷ parameter part ├────────────────────┴─────────────────┴────────────────────┤ │ * │ ─▷ comment block description │ * comment_block_description │ ├─────────────┬─────────────────┬───────────┬───────────────┤ │ * tag_name │ [: annotations] │ [: value] │ : description │ ─▷ tag part ├─────────────┴─────────────────┴───────────┴───────────────┤ │ */ │ ─▷ end token └───────────────────────────────────────────────────────────┘ There are two conditions that must be met before a comment block is recognized as a GTK-Doc comment block: #. The comment block is opened with a GTK-Doc start token ("``/**``") #. The first line following the start token contains a valid identifier part Once a GTK-Doc comment block has been identified as such and has been stripped from its start and end tokens the remaining parts have to be written in a specific order: #. There must be exactly 1 `identifier` part on the first line of the comment block which consists of: * a required `identifier_name` field * an optional `annotations` field #. Zero or more `parameter` parts, each consisting of: * a required `parameter_name` field * an optional `annotations` field * a required `description` field (can be the empty string) #. One optional `comment block description` part which must begin with at least 1 empty line signaling the start of this part. #. Zero or more `tag` parts, each consisting of: * a required `tag_name` field * an optional `annotations` field * an optional `value` field * a required `description` field (can be the empty string) Additionally, the following restrictions are in effect: #. Separating parts with an empty line: * `identifier` and `parameter` parts cannot be separated from each other by an empty line as this would signal the start of the `comment block description` part (see above). * it is required to separate the `comment block description` part from the `identifier` or `parameter` parts with an empty line (see above) * `comment block description` and `tag` parts can optionally be separated by an empty line #. Parts and fields cannot span multiple lines, except for: * the `comment_block_description` part * `parameter description` and `tag description` fields #. Taking the above restrictions into account, spanning multiple paragraphs is limited to the `comment block description` part and `tag description` fields. Refer to the `GTK-Doc manual`_ for more detailed usage information. .. _GTK-Doc manual: http://developer.gnome.org/gtk-doc-manual/1.18/documenting.html.en ''' from __future__ import absolute_import import os import re from collections import namedtuple from operator import ne, gt, lt from .collections import Counter, OrderedDict from .message import Position, warn, error # GTK-Doc comment block parts PART_IDENTIFIER = 0 PART_PARAMETERS = 1 PART_DESCRIPTION = 2 PART_TAGS = 3 # GTK-Doc comment block tags # 1) Basic GTK-Doc tags. # Note: This list cannot be extended unless the GTK-Doc project defines new tags. TAG_DEPRECATED = 'deprecated' TAG_RETURNS = 'returns' TAG_SINCE = 'since' TAG_STABILITY = 'stability' GTKDOC_TAGS = [TAG_DEPRECATED, TAG_RETURNS, TAG_SINCE, TAG_STABILITY] # 2) Deprecated basic GTK-Doc tags. # Note: This list cannot be extended unless the GTK-Doc project defines new deprecated tags. TAG_DESCRIPTION = 'description' TAG_RETURN_VALUE = 'return value' DEPRECATED_GTKDOC_TAGS = [TAG_DESCRIPTION, TAG_RETURN_VALUE] # 3) Deprecated GObject-Introspection tags. # Unfortunately, these where accepted by old versions of this module. TAG_RETURN = 'return' TAG_RETURNS_VALUE = 'returns value' DEPRECATED_GI_TAGS = [TAG_RETURN, TAG_RETURNS_VALUE] # 4) Deprecated GObject-Introspection annotation tags. # Accepted by old versions of this module while they should have been # annotations on the identifier part instead. # Note: This list can not be extended ever again. The GObject-Introspection project is not # allowed to invent GTK-Doc tags. Please create new annotations instead. TAG_ATTRIBUTES = 'attributes' TAG_GET_VALUE_FUNC = 'get value func' TAG_REF_FUNC = 'ref func' TAG_RENAME_TO = 'rename to' TAG_SET_VALUE_FUNC = 'set value func' TAG_TRANSFER = 'transfer' TAG_TYPE = 'type' TAG_UNREF_FUNC = 'unref func' TAG_VALUE = 'value' TAG_VFUNC = 'virtual' DEPRECATED_GI_ANN_TAGS = [TAG_ATTRIBUTES, TAG_GET_VALUE_FUNC, TAG_REF_FUNC, TAG_RENAME_TO, TAG_SET_VALUE_FUNC, TAG_TRANSFER, TAG_TYPE, TAG_UNREF_FUNC, TAG_VALUE, TAG_VFUNC] ALL_TAGS = GTKDOC_TAGS + DEPRECATED_GTKDOC_TAGS + DEPRECATED_GI_TAGS + DEPRECATED_GI_ANN_TAGS # GObject-Introspection annotation start/end tokens ANN_LPAR = '(' ANN_RPAR = ')' # GObject-Introspection annotations # 1) Supported annotations # Note: when adding new annotations, GTK-Doc project's gtkdoc-mkdb needs to be modified too! ANN_ALLOW_NONE = 'allow-none' ANN_ARRAY = 'array' ANN_ATTRIBUTES = 'attributes' ANN_CLOSURE = 'closure' ANN_CONSTRUCTOR = 'constructor' ANN_DESTROY = 'destroy' ANN_ELEMENT_TYPE = 'element-type' ANN_FOREIGN = 'foreign' ANN_GET_VALUE_FUNC = 'get-value-func' ANN_IN = 'in' ANN_INOUT = 'inout' ANN_METHOD = 'method' ANN_NULLABLE = 'nullable' ANN_OPTIONAL = 'optional' ANN_OUT = 'out' ANN_REF_FUNC = 'ref-func' ANN_RENAME_TO = 'rename-to' ANN_SCOPE = 'scope' ANN_SET_VALUE_FUNC = 'set-value-func' ANN_SKIP = 'skip' ANN_TRANSFER = 'transfer' ANN_TYPE = 'type' ANN_UNREF_FUNC = 'unref-func' ANN_VFUNC = 'virtual' ANN_VALUE = 'value' GI_ANNS = [ANN_ALLOW_NONE, ANN_NULLABLE, ANN_OPTIONAL, ANN_ARRAY, ANN_ATTRIBUTES, ANN_CLOSURE, ANN_CONSTRUCTOR, ANN_DESTROY, ANN_ELEMENT_TYPE, ANN_FOREIGN, ANN_GET_VALUE_FUNC, ANN_IN, ANN_INOUT, ANN_METHOD, ANN_OUT, ANN_REF_FUNC, ANN_RENAME_TO, ANN_SCOPE, ANN_SET_VALUE_FUNC, ANN_SKIP, ANN_TRANSFER, ANN_TYPE, ANN_UNREF_FUNC, ANN_VFUNC, ANN_VALUE] # 2) Deprecated GObject-Introspection annotations ANN_ATTRIBUTE = 'attribute' ANN_INOUT_ALT = 'in-out' DEPRECATED_GI_ANNS = [ANN_ATTRIBUTE, ANN_INOUT_ALT] ALL_ANNOTATIONS = GI_ANNS + DEPRECATED_GI_ANNS DICT_ANNOTATIONS = [ANN_ARRAY, ANN_ATTRIBUTES] LIST_ANNOTATIONS = [ann for ann in ALL_ANNOTATIONS if ann not in DICT_ANNOTATIONS] # (array) annotation options OPT_ARRAY_FIXED_SIZE = 'fixed-size' OPT_ARRAY_LENGTH = 'length' OPT_ARRAY_ZERO_TERMINATED = 'zero-terminated' ARRAY_OPTIONS = [OPT_ARRAY_FIXED_SIZE, OPT_ARRAY_LENGTH, OPT_ARRAY_ZERO_TERMINATED] # (out) annotation options OPT_OUT_CALLEE_ALLOCATES = 'callee-allocates' OPT_OUT_CALLER_ALLOCATES = 'caller-allocates' OUT_OPTIONS = [OPT_OUT_CALLEE_ALLOCATES, OPT_OUT_CALLER_ALLOCATES] # (scope) annotation options OPT_SCOPE_ASYNC = 'async' OPT_SCOPE_CALL = 'call' OPT_SCOPE_NOTIFIED = 'notified' SCOPE_OPTIONS = [OPT_SCOPE_ASYNC, OPT_SCOPE_CALL, OPT_SCOPE_NOTIFIED] # (transfer) annotation options OPT_TRANSFER_CONTAINER = 'container' OPT_TRANSFER_FLOATING = 'floating' OPT_TRANSFER_FULL = 'full' OPT_TRANSFER_NONE = 'none' TRANSFER_OPTIONS = [OPT_TRANSFER_CONTAINER, OPT_TRANSFER_FLOATING, OPT_TRANSFER_FULL, OPT_TRANSFER_NONE] # Pattern used to normalize different types of line endings LINE_BREAK_RE = re.compile(r'\r\n|\r|\n', re.UNICODE) # Pattern matching the start token of a comment block. COMMENT_BLOCK_START_RE = re.compile( r''' ^ # start (?P<code>.*?) # whitespace, code, ... \s* # 0 or more whitespace characters (?P<token>/\*{2}(?![\*/])) # 1 forward slash character followed # by exactly 2 asterisk characters # and not followed by a slash character \s* # 0 or more whitespace characters (?P<comment>.*?) # GTK-Doc comment text \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching the end token of a comment block. COMMENT_BLOCK_END_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<comment>.*?) # GTK-Doc comment text \s* # 0 or more whitespace characters (?P<token>\*+/) # 1 or more asterisk characters followed # by exactly 1 forward slash character (?P<code>.*?) # whitespace, code, ... \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching the ' * ' at the beginning of every # line inside a comment block. COMMENT_ASTERISK_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<comment>.*?) # invalid comment text \s* # 0 or more whitespace characters \* # 1 asterisk character \s? # 0 or 1 whitespace characters # WARNING: removing more than 1 # whitespace character breaks # embedded example program indentation ''', re.UNICODE | re.VERBOSE) # Pattern matching the indentation level of a line (used # to get the indentation before and after the ' * '). INDENTATION_RE = re.compile( r''' ^ (?P<indentation>\s*) # 0 or more whitespace characters .* $ ''', re.UNICODE | re.VERBOSE) # Pattern matching an empty line. EMPTY_LINE_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching SECTION identifiers. SECTION_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters SECTION # SECTION \s* # 0 or more whitespace characters (?P<delimiter>:?) # delimiter \s* # 0 or more whitespace characters (?P<section_name>\w\S+?) # section name \s* # 0 or more whitespace characters :? # invalid delimiter \s* # 0 or more whitespace characters $ ''', re.UNICODE | re.VERBOSE) # Pattern matching symbol (function, constant, struct and enum) identifiers. SYMBOL_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<symbol_name>[\w-]*\w) # symbol name \s* # 0 or more whitespace characters (?P<delimiter>:?) # delimiter \s* # 0 or more whitespace characters (?P<fields>.*?) # annotations + description \s* # 0 or more whitespace characters :? # invalid delimiter \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching property identifiers. PROPERTY_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<class_name>[\w]+) # class name \s* # 0 or more whitespace characters :{1} # 1 required colon \s* # 0 or more whitespace characters (?P<property_name>[\w-]*\w) # property name \s* # 0 or more whitespace characters (?P<delimiter>:?) # delimiter \s* # 0 or more whitespace characters (?P<fields>.*?) # annotations + description \s* # 0 or more whitespace characters :? # invalid delimiter \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching signal identifiers. SIGNAL_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<class_name>[\w]+) # class name \s* # 0 or more whitespace characters :{2} # 2 required colons \s* # 0 or more whitespace characters (?P<signal_name>[\w-]*\w) # signal name \s* # 0 or more whitespace characters (?P<delimiter>:?) # delimiter \s* # 0 or more whitespace characters (?P<fields>.*?) # annotations + description \s* # 0 or more whitespace characters :? # invalid delimiter \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching parameters. PARAMETER_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters @ # @ character (?P<parameter_name>[\w-]*\w|.*?\.\.\.) # parameter name \s* # 0 or more whitespace characters :{1} # 1 required delimiter \s* # 0 or more whitespace characters (?P<fields>.*?) # annotations + description \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching tags. _all_tags = '|'.join(ALL_TAGS).replace(' ', r'\s') TAG_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<tag_name>''' + _all_tags + r''') # tag name \s* # 0 or more whitespace characters :{1} # 1 required delimiter \s* # 0 or more whitespace characters (?P<fields>.*?) # annotations + value + description \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE | re.IGNORECASE) # Pattern matching value and description fields for TAG_DEPRECATED & TAG_SINCE tags. TAG_VALUE_VERSION_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<value>([0-9\.])*) # value \s* # 0 or more whitespace characters (?P<delimiter>:?) # delimiter \s* # 0 or more whitespace characters (?P<description>.*?) # description \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE) # Pattern matching value and description fields for TAG_STABILITY tags. TAG_VALUE_STABILITY_RE = re.compile( r''' ^ # start \s* # 0 or more whitespace characters (?P<value>(stable|unstable|private|internal)?) # value \s* # 0 or more whitespace characters (?P<delimiter>:?) # delimiter \s* # 0 or more whitespace characters (?P<description>.*?) # description \s* # 0 or more whitespace characters $ # end ''', re.UNICODE | re.VERBOSE | re.IGNORECASE) class GtkDocAnnotations(OrderedDict): ''' An ordered dictionary mapping annotation names to annotation options (if any). Annotation options can be either a :class:`list`, a :class:`giscanner.collections.OrderedDict` (depending on the annotation name)or :const:`None`. ''' __slots__ = ('position') def __init__(self, position=None): OrderedDict.__init__(self) #: A :class:`giscanner.message.Position` instance specifying the location of the #: annotations in the source file or :const:`None`. self.position = position class GtkDocAnnotatable(object): ''' Base class for GTK-Doc comment block parts that can be annotated. ''' __slots__ = ('position', 'annotations') #: A :class:`tuple` of annotation name constants that are valid for this object. Annotation #: names not in this :class:`tuple` will be reported as *unknown* by :func:`validate`. The #: :attr:`valid_annotations` class attribute should be overridden by subclasses. valid_annotations = () def __init__(self, position=None): #: A :class:`giscanner.message.Position` instance specifying the location of the #: annotatable comment block part in the source file or :const:`None`. self.position = position #: A :class:`GtkDocAnnotations` instance representing the annotations #: applied to this :class:`GtkDocAnnotatable` instance. self.annotations = GtkDocAnnotations() def __repr__(self): return '<GtkDocAnnotatable %r %r>' % (self.annotations, ) def validate(self): ''' Validate annotations stored by the :class:`GtkDocAnnotatable` instance, if any. ''' if self.annotations: position = self.annotations.position for ann_name, options in self.annotations.items(): if ann_name in self.valid_annotations: validate = getattr(self, '_do_validate_' + ann_name.replace('-', '_')) validate(position, ann_name, options) elif ann_name in ALL_ANNOTATIONS: # Not error() as ann_name might be valid in some newer # GObject-Instrospection version. warn('unexpected annotation: %s' % (ann_name, ), position) else: # Not error() as ann_name might be valid in some newer # GObject-Instrospection version. warn('unknown annotation: %s' % (ann_name, ), position) def _validate_options(self, position, ann_name, n_options, expected_n_options, operator, message): ''' Validate the number of options held by an annotation according to the test ``operator(n_options, expected_n_options)``. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param n_options: number of options held by the annotation :param expected_n_options: number of expected options :param operator: an operator function from python's :mod:`operator` module, for example :func:`operator.ne` or :func:`operator.lt` :param message: warning message used when the test ``operator(n_options, expected_n_options)`` fails. ''' if n_options == 0: t = 'none' else: t = '%d' % (n_options, ) if expected_n_options == 0: s = 'no options' elif expected_n_options == 1: s = 'one option' else: s = '%d options' % (expected_n_options, ) if operator(n_options, expected_n_options): warn('"%s" annotation %s %s, %s given' % (ann_name, message, s, t), position) def _validate_annotation(self, position, ann_name, options, choices=None, exact_n_options=None, min_n_options=None, max_n_options=None): ''' Validate an annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to be validated :param choices: an iterable of allowed option names or :const:`None` to skip this test :param exact_n_options: exact number of expected options or :const:`None` to skip this test :param min_n_options: minimum number of expected options or :const:`None` to skip this test :param max_n_options: maximum number of expected options or :const:`None` to skip this test ''' n_options = len(options) if exact_n_options is not None: self._validate_options(position, ann_name, n_options, exact_n_options, ne, 'needs') if min_n_options is not None: self._validate_options(position, ann_name, n_options, min_n_options, lt, 'takes at least') if max_n_options is not None: self._validate_options(position, ann_name, n_options, max_n_options, gt, 'takes at most') if options and choices is not None: option = options[0] if option not in choices: warn('invalid "%s" annotation option: "%s"' % (ann_name, option), position) def _do_validate_allow_none(self, position, ann_name, options): ''' Validate the ``(allow-none)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options held by the annotation ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_array(self, position, ann_name, options): ''' Validate the ``(array)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options held by the annotation ''' if len(options) == 0: return for option, value in options.items(): if option == OPT_ARRAY_FIXED_SIZE: try: int(value) except (TypeError, ValueError): if value is None: warn('"%s" annotation option "%s" needs a value' % (ann_name, option), position) else: warn('invalid "%s" annotation option "%s" value "%s", must be an integer' % (ann_name, option, value), position) elif option == OPT_ARRAY_ZERO_TERMINATED: if value is not None and value not in ['0', '1']: warn('invalid "%s" annotation option "%s" value "%s", must be 0 or 1' % (ann_name, option, value), position) elif option == OPT_ARRAY_LENGTH: if value is None: warn('"%s" annotation option "length" needs a value' % (ann_name, ), position) else: warn('invalid "%s" annotation option: "%s"' % (ann_name, option), position) def _do_validate_attributes(self, position, ann_name, options): ''' Validate the ``(attributes)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' # The 'attributes' annotation allows free form annotations. pass def _do_validate_closure(self, position, ann_name, options): ''' Validate the ``(closure)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, max_n_options=1) def _do_validate_constructor(self, position, ann_name, options): ''' Validate the ``(constructor)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_destroy(self, position, ann_name, options): ''' Validate the ``(destroy)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_element_type(self, position, ann_name, options): ''' Validate the ``(element)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, min_n_options=1, max_n_options=2) def _do_validate_foreign(self, position, ann_name, options): ''' Validate the ``(foreign)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_get_value_func(self, position, ann_name, options): ''' Validate the ``(value-func)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_in(self, position, ann_name, options): ''' Validate the ``(in)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_inout(self, position, ann_name, options): ''' Validate the ``(in-out)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_method(self, position, ann_name, options): ''' Validate the ``(method)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_nullable(self, position, ann_name, options): ''' Validate the ``(nullable)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options held by the annotation ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_optional(self, position, ann_name, options): ''' Validate the ``(optional)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options held by the annotation ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_out(self, position, ann_name, options): ''' Validate the ``(out)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, max_n_options=1, choices=OUT_OPTIONS) def _do_validate_ref_func(self, position, ann_name, options): ''' Validate the ``(ref-func)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_rename_to(self, position, ann_name, options): ''' Validate the ``(rename-to)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_scope(self, position, ann_name, options): ''' Validate the ``(scope)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1, choices=SCOPE_OPTIONS) def _do_validate_set_value_func(self, position, ann_name, options): ''' Validate the ``(value-func)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_skip(self, position, ann_name, options): ''' Validate the ``(skip)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=0) def _do_validate_transfer(self, position, ann_name, options): ''' Validate the ``(transfer)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1, choices=TRANSFER_OPTIONS) def _do_validate_type(self, position, ann_name, options): ''' Validate the ``(type)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_unref_func(self, position, ann_name, options): ''' Validate the ``(unref-func)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_value(self, position, ann_name, options): ''' Validate the ``(value)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) def _do_validate_virtual(self, position, ann_name, options): ''' Validate the ``(virtual)`` annotation. :param position: :class:`giscanner.message.Position` of the line in the source file containing the annotation to be validated :param ann_name: name of the annotation holding the options to validate :param options: annotation options to validate ''' self._validate_annotation(position, ann_name, options, exact_n_options=1) class GtkDocParameter(GtkDocAnnotatable): ''' Represents a GTK-Doc parameter part. ''' __slots__ = ('name', 'description') valid_annotations = (ANN_ALLOW_NONE, ANN_ARRAY, ANN_ATTRIBUTES, ANN_CLOSURE, ANN_DESTROY, ANN_ELEMENT_TYPE, ANN_IN, ANN_INOUT, ANN_OUT, ANN_SCOPE, ANN_SKIP, ANN_TRANSFER, ANN_TYPE, ANN_OPTIONAL, ANN_NULLABLE) def __init__(self, name, position=None): GtkDocAnnotatable.__init__(self, position) #: Parameter name. self.name = name #: Parameter description or :const:`None`. self.description = None def __repr__(self): return '<GtkDocParameter %r %r>' % (self.name, self.annotations) class GtkDocTag(GtkDocAnnotatable): ''' Represents a GTK-Doc tag part. ''' __slots__ = ('name', 'value', 'description') valid_annotations = (ANN_ALLOW_NONE, ANN_ARRAY, ANN_ATTRIBUTES, ANN_ELEMENT_TYPE, ANN_SKIP, ANN_TRANSFER, ANN_TYPE, ANN_NULLABLE, ANN_OPTIONAL) def __init__(self, name, position=None): GtkDocAnnotatable.__init__(self, position) #: Tag name. self.name = name #: Tag value or :const:`None`. self.value = None #: Tag description or :const:`None`. self.description = None def __repr__(self): return '<GtkDocTag %r %r>' % (self.name, self.annotations) class GtkDocCommentBlock(GtkDocAnnotatable): ''' Represents a GTK-Doc comment block. ''' __slots__ = ('code_before', 'code_after', 'indentation', 'name', 'params', 'description', 'tags') #: Valid annotation names for the GTK-Doc comment block identifier part. valid_annotations = (ANN_ATTRIBUTES, ANN_CONSTRUCTOR, ANN_FOREIGN, ANN_GET_VALUE_FUNC, ANN_METHOD, ANN_REF_FUNC, ANN_RENAME_TO, ANN_SET_VALUE_FUNC, ANN_SKIP, ANN_TRANSFER, ANN_TYPE, ANN_UNREF_FUNC, ANN_VALUE, ANN_VFUNC) def __init__(self, name, position=None): GtkDocAnnotatable.__init__(self, position) #: Code preceding the GTK-Doc comment block start token ("``/**``"), if any. self.code_before = None #: Code following the GTK-Doc comment block end token ("``*/``"), if any. self.code_after = None #: List of indentation levels (preceding the "``*``") for all lines in the comment #: block's source text. self.indentation = [] #: Identifier name. self.name = name #: Ordered dictionary mapping parameter names to :class:`GtkDocParameter` instances #: applied to this :class:`GtkDocCommentBlock`. self.params = OrderedDict() #: The GTK-Doc comment block description part. self.description = None #: Ordered dictionary mapping tag names to :class:`GtkDocTag` instances #: applied to this :class:`GtkDocCommentBlock`. self.tags = OrderedDict() def __cmp__(self, other): # Note: This is used by g-ir-annotation-tool, which does a ``sorted(blocks.values())``, # meaning that keeping this around makes update-glib-annotations.py patches # easier to review. return cmp(self.name, other.name) def __repr__(self): return '<GtkDocCommentBlock %r %r>' % (self.name, self.annotations) def validate(self): ''' Validate annotations applied to the :class:`GtkDocCommentBlock` identifier, parameters and tags. ''' GtkDocAnnotatable.validate(self) for param in self.params.values(): param.validate() for tag in self.tags.values(): tag.validate() #: Result object returned by :class:`GtkDocCommentBlockParser`._parse_annotations() _ParseAnnotationsResult = namedtuple('Result', ['success', 'annotations', 'start_pos', 'end_pos']) #: Result object returned by :class:`GtkDocCommentBlockParser`._parse_fields() _ParseFieldsResult = namedtuple('Result', ['success', 'annotations', 'description']) class GtkDocCommentBlockParser(object): ''' Parse GTK-Doc comment blocks into a parse tree built out of :class:`GtkDocCommentBlock`, :class:`GtkDocParameter`, :class:`GtkDocTag` and :class:`GtkDocAnnotations` objects. This parser tries to accept malformed input whenever possible and does not cause the process to exit on syntax errors. It does however emit: * warning messages at the slightest indication of recoverable malformed input and * error messages for unrecoverable malformed input whenever possible. Recoverable, in this context, means that we can serialize the :class:`GtkDocCommentBlock` instance using a :class:`GtkDocCommentBlockWriter` without information being lost. It is usually a good idea to heed these warning and error messages as malformed input can result in both: * invalid GTK-Doc output (HTML, pdf, ...) when the comment blocks are parsed with GTK-Doc's gtkdoc-mkdb * unexpected introspection behavior, for example missing parameters in the generated .gir and .typelib files .. NOTE:: :class:`GtkDocCommentBlockParser` functionality is heavily based on gtkdoc-mkdb's `ScanSourceFile()`_ function and is currently in sync with GTK-Doc commit `47abcd5`_. .. _ScanSourceFile(): http://git.gnome.org/browse/gtk-doc/tree/gtkdoc-mkdb.in#n3722 .. _47abcd5: https://git.gnome.org/browse/gtk-doc/commit/?id=47abcd53b8489ebceec9e394676512a181c1f1f6 ''' def parse_comment_blocks(self, comments): ''' Parse multiple GTK-Doc comment blocks. :param comments: an iterable of ``(comment, filename, lineno)`` tuples :returns: a dictionary mapping identifier names to :class:`GtkDocCommentBlock` objects ''' comment_blocks = {} for (comment, filename, lineno) in comments: try: comment_block = self.parse_comment_block(comment, filename, lineno) except Exception: error('unrecoverable parse error, please file a GObject-Introspection bug' 'report including the complete comment block at the indicated location.', Position(filename, lineno)) continue if comment_block is not None: # Note: previous versions of this parser did not check if an identifier was # already stored in comment_blocks, so when different comment blocks where # encountered documenting the same identifier the last comment block seen # "wins". Keep this behavior for backwards compatibility, but emit a warning. if comment_block.name in comment_blocks: firstseen = comment_blocks[comment_block.name] path = os.path.dirname(firstseen.position.filename) warn('multiple comment blocks documenting \'%s:\' identifier ' '(already seen at %s).' % (comment_block.name, firstseen.position.format(path)), comment_block.position) comment_blocks[comment_block.name] = comment_block return comment_blocks def parse_comment_block(self, comment, filename, lineno): ''' Parse a single GTK-Doc comment block. :param comment: string representing the GTK-Doc comment block including it's start ("``/**``") and end ("``*/``") tokens. :param filename: source file name where the comment block originated from :param lineno: line number in the source file where the comment block starts :returns: a :class:`GtkDocCommentBlock` object or ``None`` ''' code_before = '' code_after = '' comment_block_pos = Position(filename, lineno) comment_lines = re.sub(LINE_BREAK_RE, '\n', comment).split('\n') comment_lines_len = len(comment_lines) # Check for the start of the comment block. result = COMMENT_BLOCK_START_RE.match(comment_lines[0]) if result: # Skip single line comment blocks if comment_lines_len == 1: position = Position(filename, lineno) marker = ' ' * result.end('code') + '^' error('Skipping invalid GTK-Doc comment block:' '\n%s\n%s' % (comment_lines[0], marker), position) return None code_before = result.group('code') comment = result.group('comment') if code_before: position = Position(filename, lineno) marker = ' ' * result.end('code') + '^' warn('GTK-Doc comment block start token "/**" should ' 'not be preceded by code:\n%s\n%s' % (comment_lines[0], marker), position) if comment: position = Position(filename, lineno) marker = ' ' * result.start('comment') + '^' warn('GTK-Doc comment block start token "/**" should ' 'not be followed by comment text:\n%s\n%s' % (comment_lines[0], marker), position) comment_lines[0] = comment else: del comment_lines[0] else: # Not a GTK-Doc comment block. return None # Check for the end of the comment block. result = COMMENT_BLOCK_END_RE.match(comment_lines[-1]) if result: code_after = result.group('code') comment = result.group('comment') if code_after: position = Position(filename, lineno + comment_lines_len - 1) marker = ' ' * result.end('code') + '^' warn('GTK-Doc comment block end token "*/" should ' 'not be followed by code:\n%s\n%s' % (comment_lines[-1], marker), position) if comment: position = Position(filename, lineno + comment_lines_len - 1) marker = ' ' * result.end('comment') + '^' warn('GTK-Doc comment block end token "*/" should ' 'not be preceded by comment text:\n%s\n%s' % (comment_lines[-1], marker), position) comment_lines[-1] = comment else: del comment_lines[-1] else: # Not a GTK-Doc comment block. return None # If we get this far, we must be inside something # that looks like a GTK-Doc comment block. comment_block = None identifier_warned = False block_indent = [] line_indent = None part_indent = None in_part = None current_part = None returns_seen = False for line in comment_lines: lineno += 1 position = Position(filename, lineno) # Store the original line (without \n) and column offset # so we can generate meaningful warnings later on. original_line = line column_offset = 0 # Store indentation level of the comment (before the ' * ') result = INDENTATION_RE.match(line) block_indent.append(result.group('indentation')) # Get rid of the ' * ' at the start of the line. result = COMMENT_ASTERISK_RE.match(line) if result: comment = result.group('comment') if comment: marker = ' ' * result.start('comment') + '^' error('invalid comment text:\n%s\n%s' % (original_line, marker), position) column_offset = result.end(0) line = line[result.end(0):] # Store indentation level of the line (after the ' * '). result = INDENTATION_RE.match(line) line_indent = len(result.group('indentation').replace('\t', ' ')) #################################################################### # Check for GTK-Doc comment block identifier. #################################################################### if comment_block is None: result = SECTION_RE.match(line) if result: identifier_name = 'SECTION:%s' % (result.group('section_name'), ) identifier_delimiter = None identifier_fields = None identifier_fields_start = None else: result = PROPERTY_RE.match(line) if result: identifier_name = '%s:%s' % (result.group('class_name'), result.group('property_name')) identifier_delimiter = result.group('delimiter') identifier_fields = result.group('fields') identifier_fields_start = result.start('fields') else: result = SIGNAL_RE.match(line) if result: identifier_name = '%s::%s' % (result.group('class_name'), result.group('signal_name')) identifier_delimiter = result.group('delimiter') identifier_fields = result.group('fields') identifier_fields_start = result.start('fields') else: result = SYMBOL_RE.match(line) if result: identifier_name = '%s' % (result.group('symbol_name'), ) identifier_delimiter = result.group('delimiter') identifier_fields = result.group('fields') identifier_fields_start = result.start('fields') if result: in_part = PART_IDENTIFIER part_indent = line_indent comment_block = GtkDocCommentBlock(identifier_name, comment_block_pos) comment_block.code_before = code_before comment_block.code_after = code_after if identifier_fields: res = self._parse_annotations(position, column_offset + identifier_fields_start, original_line, identifier_fields) if res.success: if identifier_fields[res.end_pos:].strip(): # Not an identifier due to invalid trailing description field result = None in_part = None part_indent = None comment_block = None else: comment_block.annotations = res.annotations if not identifier_delimiter and res.annotations: marker_position = column_offset + result.start('delimiter') marker = ' ' * marker_position + '^' warn('missing ":" at column %s:\n%s\n%s' % (marker_position + 1, original_line, marker), position) if not result: # Emit a single warning when the identifier is not found on the first line if not identifier_warned: identifier_warned = True marker = ' ' * column_offset + '^' error('identifier not found on the first line:\n%s\n%s' % (original_line, marker), position) continue #################################################################### # Check for comment block parameters. #################################################################### result = PARAMETER_RE.match(line) if result: part_indent = line_indent param_name = result.group('parameter_name') param_name_lower = param_name.lower() param_fields = result.group('fields') param_fields_start = result.start('fields') marker = ' ' * (result.start('parameter_name') + column_offset) + '^' if in_part not in [PART_IDENTIFIER, PART_PARAMETERS]: warn('"@%s" parameter unexpected at this location:\n%s\n%s' % (param_name, original_line, marker), position) in_part = PART_PARAMETERS if param_name_lower == TAG_RETURNS: # Deprecated return value as parameter instead of tag param_name = TAG_RETURNS if not returns_seen: returns_seen = True else: error('encountered multiple "Returns" parameters or tags for "%s".' % (comment_block.name, ), position) tag = GtkDocTag(TAG_RETURNS, position) if param_fields: result = self._parse_fields(position, column_offset + param_fields_start, original_line, param_fields) if result.success: tag.annotations = result.annotations tag.description = result.description comment_block.tags[TAG_RETURNS] = tag current_part = tag continue elif (param_name == 'Varargs' or (param_name.endswith('...') and param_name != '...')): # Deprecated @Varargs notation or named __VA_ARGS__ instead of @... warn('"@%s" parameter is deprecated, please use "@..." instead:\n%s\n%s' % (param_name, original_line, marker), position) param_name = '...' if param_name in comment_block.params.keys(): error('multiple "@%s" parameters for identifier "%s":\n%s\n%s' % (param_name, comment_block.name, original_line, marker), position) parameter = GtkDocParameter(param_name, position) if param_fields: result = self._parse_fields(position, column_offset + param_fields_start, original_line, param_fields) if result.success: parameter.annotations = result.annotations parameter.description = result.description comment_block.params[param_name] = parameter current_part = parameter continue #################################################################### # Check for comment block description. # # When we are parsing parameter parts or the identifier part (when # there are no parameters) and encounter an empty line, we must be # parsing the comment block description. # # Note: it is unclear why GTK-Doc does not allow paragraph breaks # at this location as those might be handy describing # parameters from time to time... #################################################################### if (EMPTY_LINE_RE.match(line) and in_part in [PART_IDENTIFIER, PART_PARAMETERS]): in_part = PART_DESCRIPTION part_indent = line_indent continue #################################################################### # Check for GTK-Doc comment block tags. #################################################################### result = TAG_RE.match(line) if result and line_indent <= part_indent: part_indent = line_indent tag_name = result.group('tag_name') tag_name_lower = tag_name.lower() tag_fields = result.group('fields') tag_fields_start = result.start('fields') marker = ' ' * (result.start('tag_name') + column_offset) + '^' if tag_name_lower in DEPRECATED_GI_ANN_TAGS: # Deprecated GObject-Introspection specific tags. # Emit a warning and transform these into annotations on the identifier # instead, as agreed upon in http://bugzilla.gnome.org/show_bug.cgi?id=676133 warn('GObject-Introspection specific GTK-Doc tag "%s" ' 'has been deprecated, please use annotations on the identifier ' 'instead:\n%s\n%s' % (tag_name, original_line, marker), position) # Translate deprecated tag name into corresponding annotation name ann_name = tag_name_lower.replace(' ', '-') if tag_name_lower == TAG_ATTRIBUTES: transformed = '' result = self._parse_fields(position, result.start('tag_name') + column_offset, line, tag_fields.strip(), False, False) if result.success: for annotation in result.annotations: ann_options = self._parse_annotation_options_list(position, marker, line, annotation) n_options = len(ann_options) if n_options == 1: transformed = '%s %s' % (transformed, ann_options[0], ) elif n_options == 2: transformed = '%s %s=%s' % (transformed, ann_options[0], ann_options[1]) else: # Malformed Attributes: tag error('malformed "Attributes:" tag will be ignored:\n%s\n%s' % (original_line, marker), position) transformed = None if transformed: transformed = '%s %s' % (ann_name, transformed.strip()) ann_name, docannotation = self._parse_annotation( position, column_offset + tag_fields_start, original_line, transformed) stored_annotation = comment_block.annotations.get('attributes') if stored_annotation: error('Duplicate "Attributes:" annotation will ' 'be ignored:\n%s\n%s' % (original_line, marker), position) else: comment_block.annotations[ann_name] = docannotation else: ann_name, options = self._parse_annotation(position, column_offset + tag_fields_start, line, '%s %s' % (ann_name, tag_fields)) comment_block.annotations[ann_name] = options continue elif tag_name_lower == TAG_DESCRIPTION: # Deprecated GTK-Doc Description: tag warn('GTK-Doc tag "Description:" has been deprecated:\n%s\n%s' % (original_line, marker), position) in_part = PART_DESCRIPTION if comment_block.description is None: comment_block.description = tag_fields else: comment_block.description += '\n%s' % (tag_fields, ) continue # Now that the deprecated stuff is out of the way, continue parsing real tags if (in_part == PART_DESCRIPTION or (in_part == PART_PARAMETERS and not comment_block.description) or (in_part == PART_IDENTIFIER and not comment_block.params and not comment_block.description)): in_part = PART_TAGS if in_part != PART_TAGS: in_part = PART_TAGS warn('"%s:" tag unexpected at this location:\n%s\n%s' % (tag_name, original_line, marker), position) if tag_name_lower in [TAG_RETURN, TAG_RETURNS, TAG_RETURN_VALUE, TAG_RETURNS_VALUE]: if not returns_seen: returns_seen = True else: error('encountered multiple return value parameters or tags for "%s".' % (comment_block.name, ), position) tag = GtkDocTag(TAG_RETURNS, position) if tag_fields: result = self._parse_fields(position, column_offset + tag_fields_start, original_line, tag_fields) if result.success: tag.annotations = result.annotations tag.description = result.description comment_block.tags[TAG_RETURNS] = tag current_part = tag continue else: if tag_name_lower in comment_block.tags.keys(): error('multiple "%s:" tags for identifier "%s":\n%s\n%s' % (tag_name, comment_block.name, original_line, marker), position) tag = GtkDocTag(tag_name_lower, position) if tag_fields: result = self._parse_fields(position, column_offset + tag_fields_start, original_line, tag_fields) if result.success: if result.annotations: error('annotations not supported for tag "%s:".' % (tag_name, ), position) if tag_name_lower in [TAG_DEPRECATED, TAG_SINCE]: result = TAG_VALUE_VERSION_RE.match(result.description) tag.value = result.group('value') tag.description = result.group('description') elif tag_name_lower == TAG_STABILITY: result = TAG_VALUE_STABILITY_RE.match(result.description) tag.value = result.group('value').capitalize() tag.description = result.group('description') comment_block.tags[tag_name_lower] = tag current_part = tag continue #################################################################### # If we get here, we must be in the middle of a multiline # comment block, parameter or tag description. #################################################################### if EMPTY_LINE_RE.match(line) is None: line = line.rstrip() if in_part in [PART_IDENTIFIER, PART_DESCRIPTION]: if not comment_block.description: if in_part == PART_IDENTIFIER: self._validate_multiline_annotation_continuation(line, original_line, column_offset, position) if comment_block.description is None: comment_block.description = line else: comment_block.description += '\n' + line continue elif in_part in [PART_PARAMETERS, PART_TAGS]: if not current_part.description: self._validate_multiline_annotation_continuation(line, original_line, column_offset, position) if current_part.description is None: current_part.description = line else: current_part.description += '\n' + line continue ######################################################################## # Finished parsing this comment block. ######################################################################## if comment_block: # We have picked up a couple of \n characters that where not # intended. Strip those. if comment_block.description: comment_block.description = comment_block.description.strip() for tag in comment_block.tags.values(): self._clean_description_field(tag) for param in comment_block.params.values(): self._clean_description_field(param) comment_block.indentation = block_indent comment_block.validate() return comment_block else: return None def _clean_description_field(self, part): ''' Remove extraneous leading and trailing whitespace from description fields. :param part: a GTK-Doc comment block part having a description field ''' if part.description: if part.description.strip() == '': part.description = None else: if EMPTY_LINE_RE.match(part.description.split('\n', 1)[0]): part.description = part.description.rstrip() else: part.description = part.description.strip() def _validate_multiline_annotation_continuation(self, line, original_line, column_offset, position): ''' Validate annotatable parts' source text ensuring annotations don't span multiple lines. For example, the following comment block would result in a warning being emitted for the forth line:: /** * shiny_function: * @array_: (out caller-allocates) (array) * (element-type utf8) (transfer full): A beautiful array */ :param line: line to validate, stripped from ("``*/``") at start of the line. :param original_line: original line (including ("``*/``")) being validated :param column_offset: number of characters stripped from `line` when ("``*/``") was removed :param position: :class:`giscanner.message.Position` of `line` in the source file ''' result = self._parse_annotations(position, column_offset, original_line, line) if result.success and result.annotations: marker = ' ' * (result.start_pos + column_offset) + '^' error('ignoring invalid multiline annotation continuation:\n%s\n%s' % (original_line, marker), position) def _parse_annotation_options_list(self, position, column, line, options): ''' Parse annotation options into a list. For example:: ┌──────────────────────────────────────────────────────────────┐ │ 'option1 option2 option3' │ ─▷ source ├──────────────────────────────────────────────────────────────┤ │ ['option1', 'option2', 'option3'] │ ◁─ parsed options └──────────────────────────────────────────────────────────────┘ :param position: :class:`giscanner.message.Position` of `line` in the source file :param column: start column of the `options` in the source file :param line: complete source line :param options: annotation options to parse :returns: a list of annotation options ''' parsed = [] if options: result = options.find('=') if result >= 0: marker = ' ' * (column + result) + '^' warn('invalid annotation options: expected a "list" but ' 'received "key=value pairs":\n%s\n%s' % (line, marker), position) parsed = self._parse_annotation_options_unknown(position, column, line, options) else: parsed = options.split(' ') return parsed def _parse_annotation_options_dict(self, position, column, line, options): ''' Parse annotation options into a dict. For example:: ┌──────────────────────────────────────────────────────────────┐ │ 'option1=value1 option2 option3=value2' │ ─▷ source ├──────────────────────────────────────────────────────────────┤ │ {'option1': 'value1', 'option2': None, 'option3': 'value2'} │ ◁─ parsed options └──────────────────────────────────────────────────────────────┘ :param position: :class:`giscanner.message.Position` of `line` in the source file :param column: start column of the `options` in the source file :param line: complete source line :param options: annotation options to parse :returns: an ordered dictionary of annotation options ''' parsed = OrderedDict() if options: for p in options.split(' '): parts = p.split('=', 1) key = parts[0] value = parts[1] if len(parts) == 2 else None parsed[key] = value return parsed def _parse_annotation_options_unknown(self, position, column, line, options): ''' Parse annotation options into a list holding a single item. This is used when the annotation options to parse in not known to be a list nor dict. For example:: ┌──────────────────────────────────────────────────────────────┐ │ ' option1 option2 option3=value1 ' │ ─▷ source ├──────────────────────────────────────────────────────────────┤ │ ['option1 option2 option3=value1'] │ ◁─ parsed options └──────────────────────────────────────────────────────────────┘ :param position: :class:`giscanner.message.Position` of `line` in the source file :param column: start column of the `options` in the source file :param line: complete source line :param options: annotation options to parse :returns: a list of annotation options ''' if options: return [options.strip()] def _parse_annotation(self, position, column, line, annotation): ''' Parse an annotation into the annotation name and a list or dict (depending on the name of the annotation) holding the options. For example:: ┌──────────────────────────────────────────────────────────────┐ │ 'name opt1=value1 opt2=value2 opt3' │ ─▷ source ├──────────────────────────────────────────────────────────────┤ │ 'name', {'opt1': 'value1', 'opt2':'value2', 'opt3':None} │ ◁─ parsed annotation └──────────────────────────────────────────────────────────────┘ ┌──────────────────────────────────────────────────────────────┐ │ 'name opt1 opt2' │ ─▷ source ├──────────────────────────────────────────────────────────────┤ │ 'name', ['opt1', 'opt2'] │ ◁─ parsed annotation └──────────────────────────────────────────────────────────────┘ ┌──────────────────────────────────────────────────────────────┐ │ 'unkownname unknown list of options' │ ─▷ source ├──────────────────────────────────────────────────────────────┤ │ 'unkownname', ['unknown list of options'] │ ◁─ parsed annotation └──────────────────────────────────────────────────────────────┘ :param position: :class:`giscanner.message.Position` of `line` in the source file :param column: start column of the `annotation` in the source file :param line: complete source line :param annotation: annotation to parse :returns: a tuple containing the annotation name and options ''' # Transform deprecated type syntax "tokens" annotation = annotation.replace('<', ANN_LPAR).replace('>', ANN_RPAR) parts = annotation.split(' ', 1) ann_name = parts[0].lower() ann_options = parts[1] if len(parts) == 2 else None if ann_name == ANN_INOUT_ALT: marker = ' ' * (column) + '^' warn('"%s" annotation has been deprecated, please use "%s" instead:\n%s\n%s' % (ANN_INOUT_ALT, ANN_INOUT, line, marker), position) ann_name = ANN_INOUT elif ann_name == ANN_ATTRIBUTE: marker = ' ' * (column) + '^' warn('"%s" annotation has been deprecated, please use "%s" instead:\n%s\n%s' % (ANN_ATTRIBUTE, ANN_ATTRIBUTES, line, marker), position) ann_name = ANN_ATTRIBUTES ann_options = self._parse_annotation_options_list(position, column, line, ann_options) n_options = len(ann_options) if n_options == 1: ann_options = ann_options[0] elif n_options == 2: ann_options = '%s=%s' % (ann_options[0], ann_options[1]) else: marker = ' ' * (column) + '^' error('malformed "(attribute)" annotation will be ignored:\n%s\n%s' % (line, marker), position) return None, None column += len(ann_name) + 2 if ann_name in LIST_ANNOTATIONS: ann_options = self._parse_annotation_options_list(position, column, line, ann_options) elif ann_name in DICT_ANNOTATIONS: ann_options = self._parse_annotation_options_dict(position, column, line, ann_options) else: ann_options = self._parse_annotation_options_unknown(position, column, line, ann_options) return ann_name, ann_options def _parse_annotations(self, position, column, line, fields, parse_options=True): ''' Parse annotations into a :class:`GtkDocAnnotations` object. :param position: :class:`giscanner.message.Position` of `line` in the source file :param column: start column of the `annotations` in the source file :param line: complete source line :param fields: string containing the fields to parse :param parse_options: whether options will be parsed into a :class:`GtkDocAnnotations` object or into a :class:`list` :returns: if `parse_options` evaluates to True a :class:`GtkDocAnnotations` object, a :class:`list` otherwise. If `line` does not contain any annotations, :const:`None` ''' if parse_options: parsed_annotations = GtkDocAnnotations(position) else: parsed_annotations = [] i = 0 parens_level = 0 prev_char = '' char_buffer = [] start_pos = 0 end_pos = 0 for i, cur_char in enumerate(fields): cur_char_is_space = cur_char.isspace() if cur_char == ANN_LPAR: parens_level += 1 if parens_level == 1: start_pos = i if prev_char == ANN_LPAR: marker = ' ' * (column + i) + '^' error('unexpected parentheses, annotations will be ignored:\n%s\n%s' % (line, marker), position) return _ParseAnnotationsResult(False, None, None, None) elif parens_level > 1: char_buffer.append(cur_char) elif cur_char == ANN_RPAR: parens_level -= 1 if prev_char == ANN_LPAR: marker = ' ' * (column + i) + '^' error('unexpected parentheses, annotations will be ignored:\n%s\n%s' % (line, marker), position) return _ParseAnnotationsResult(False, None, None, None) elif parens_level < 0: marker = ' ' * (column + i) + '^' error('unbalanced parentheses, annotations will be ignored:\n%s\n%s' % (line, marker), position) return _ParseAnnotationsResult(False, None, None, None) elif parens_level == 0: end_pos = i + 1 if parse_options is True: name, options = self._parse_annotation(position, column + start_pos, line, ''.join(char_buffer).strip()) if name is not None: if name in parsed_annotations: marker = ' ' * (column + i) + '^' error('multiple "%s" annotations:\n%s\n%s' % (name, line, marker), position) parsed_annotations[name] = options else: parsed_annotations.append(''.join(char_buffer).strip()) char_buffer = [] else: char_buffer.append(cur_char) elif cur_char_is_space: if parens_level > 0: char_buffer.append(cur_char) else: if parens_level == 0: break else: char_buffer.append(cur_char) prev_char = cur_char if parens_level > 0: marker = ' ' * (column + i) + '^' error('unbalanced parentheses, annotations will be ignored:\n%s\n%s' % (line, marker), position) return _ParseAnnotationsResult(False, None, None, None) else: return _ParseAnnotationsResult(True, parsed_annotations, start_pos, end_pos) def _parse_fields(self, position, column, line, fields, parse_options=True, validate_description_field=True): ''' Parse annotations out of field data. For example:: ┌──────────────────────────────────────────────────────────────┐ │ '(skip): description of some parameter │ ─▷ source ├──────────────────────────────────────────────────────────────┤ │ ({'skip': []}, 'description of some parameter') │ ◁─ annotations and └──────────────────────────────────────────────────────────────┘ remaining fields :param position: :class:`giscanner.message.Position` of `line` in the source file :param column: start column of `fields` in the source file :param line: complete source line :param fields: string containing the fields to parse :param parse_options: whether options will be parsed into a :class:`GtkDocAnnotations` object or into a :class:`list` :param validate_description_field: :const:`True` to validate the description field :returns: if `parse_options` evaluates to True a :class:`GtkDocAnnotations` object, a :class:`list` otherwise. If `line` does not contain any annotations, :const:`None` and a string holding the remaining fields ''' description_field = '' result = self._parse_annotations(position, column, line, fields, parse_options) if result.success: description_field = fields[result.end_pos:].strip() if description_field and validate_description_field: if description_field.startswith(':'): description_field = description_field[1:] else: if result.end_pos > 0: marker_position = column + result.end_pos marker = ' ' * marker_position + '^' warn('missing ":" at column %s:\n%s\n%s' % (marker_position + 1, line, marker), position) return _ParseFieldsResult(result.success, result.annotations, description_field) class GtkDocCommentBlockWriter(object): ''' Serialized :class:`GtkDocCommentBlock` objects into GTK-Doc comment blocks. ''' def __init__(self, indent=True): #: :const:`True` if the original indentation preceding the "``*``" needs to be retained, #: :const:`False` otherwise. Default value is :const:`True`. self.indent = indent def _serialize_annotations(self, annotations): ''' Serialize an annotation field. For example:: ┌──────────────────────────────────────────────────────────────┐ │ {'name': {'opt1': 'value1', 'opt2':'value2', 'opt3':None} │ ◁─ GtkDocAnnotations ├──────────────────────────────────────────────────────────────┤ │ '(name opt1=value1 opt2=value2 opt3)' │ ─▷ serialized └──────────────────────────────────────────────────────────────┘ ┌──────────────────────────────────────────────────────────────┐ │ {'name': ['opt1', 'opt2']} │ ◁─ GtkDocAnnotations ├──────────────────────────────────────────────────────────────┤ │ '(name opt1 opt2)' │ ─▷ serialized └──────────────────────────────────────────────────────────────┘ ┌──────────────────────────────────────────────────────────────┐ │ {'unkownname': ['unknown list of options']} │ ◁─ GtkDocAnnotations ├──────────────────────────────────────────────────────────────┤ │ '(unkownname unknown list of options)' │ ─▷ serialized └──────────────────────────────────────────────────────────────┘ :param annotations: :class:`GtkDocAnnotations` to be serialized :returns: a string ''' serialized = [] for ann_name, options in annotations.items(): if options: if isinstance(options, list): serialize_options = ' '.join(options) else: serialize_options = '' for key, value in options.items(): if value: serialize_options += '%s=%s ' % (key, value) else: serialize_options += '%s ' % (key, ) serialize_options = serialize_options.strip() serialized.append('(%s %s)' % (ann_name, serialize_options)) else: serialized.append('(%s)' % (ann_name, )) return ' '.join(serialized) def _serialize_parameter(self, parameter): ''' Serialize a parameter. :param parameter: :class:`GtkDocParameter` to be serialized :returns: a string ''' # parameter_name field serialized = '@%s' % (parameter.name, ) # annotations field if parameter.annotations: serialized += ': ' + self._serialize_annotations(parameter.annotations) # description field if parameter.description: if parameter.description.startswith('\n'): serialized += ':' + parameter.description else: serialized += ': ' + parameter.description else: serialized += ':' return serialized.split('\n') def _serialize_tag(self, tag): ''' Serialize a tag. :param tag: :class:`GtkDocTag` to be serialized :returns: a string ''' # tag_name field serialized = tag.name.capitalize() # annotations field if tag.annotations: serialized += ': ' + self._serialize_annotations(tag.annotations) # value field if tag.value: serialized += ': ' + tag.value # description field if tag.description: if tag.description.startswith('\n'): serialized += ':' + tag.description else: serialized += ': ' + tag.description if not tag.value and not tag.description: serialized += ':' return serialized.split('\n') def write(self, block): ''' Serialize a :class:`GtkDocCommentBlock` object. :param block: :class:`GtkDocCommentBlock` to be serialized :returns: a string ''' if block is None: return '' else: lines = [] # Identifier part if block.name.startswith('SECTION'): lines.append(block.name) else: if block.annotations: annotations = self._serialize_annotations(block.annotations) lines.append('%s: %s' % (block.name, annotations)) else: # Note: this delimiter serves no purpose other than most people being used # to reading/writing it. It is completely legal to ommit this. lines.append('%s:' % (block.name, )) # Parameter parts for param in block.params.values(): lines.extend(self._serialize_parameter(param)) # Comment block description part if block.description: lines.append('') for l in block.description.split('\n'): lines.append(l) # Tag parts if block.tags: # Note: this empty line servers no purpose other than most people being used # to reading/writing it. It is completely legal to ommit this. lines.append('') for tag in block.tags.values(): lines.extend(self._serialize_tag(tag)) # Restore comment block indentation and * if self.indent: indent = Counter(block.indentation).most_common(1)[0][0] or ' ' if indent.endswith('\t'): start_indent = indent line_indent = indent + ' ' else: start_indent = indent[:-1] line_indent = indent else: start_indent = '' line_indent = ' ' i = 0 while i < len(lines): line = lines[i] if line: lines[i] = '%s* %s\n' % (line_indent, line) else: lines[i] = '%s*\n' % (line_indent, ) i += 1 # Restore comment block start and end tokens lines.insert(0, '%s/**\n' % (start_indent, )) lines.append('%s*/\n' % (line_indent, )) # Restore code before and after comment block start and end tokens if block.code_before: lines.insert(0, '%s\n' % (block.code_before, )) if block.code_after: lines.append('%s\n' % (block.code_after, )) return ''.join(lines)
StarcoderdataPython
1725323
import os import copy import datetime import warnings from matplotlib import pyplot as plt import matplotlib as mpl import seaborn as sns import pandas as pd import numpy as np import math from datetime import datetime import random from sklearn.feature_extraction.text import TfidfVectorizer, CountVectorizer from sklearn.decomposition import TruncatedSVD import os os.environ['CUDA_DEVICE_ORDER']='PCI_BUS_ID' os.environ['CUDA_VISIBLE_DEVICES']='0' import numpy as np import keras.backend as K from keras.models import Model from keras.layers import Input, Dense, Flatten, Embedding, Dropout, PReLU,ReLU from keras.layers import Bidirectional, SpatialDropout1D, CuDNNGRU,CuDNNLSTM, Conv1D,Conv2D,MaxPool2D,Reshape from keras.layers import GlobalAvgPool1D, GlobalMaxPool1D, concatenate,GlobalMaxPooling1D,GlobalAveragePooling1D from keras.regularizers import l2,l1 from keras.layers.normalization import BatchNormalization from keras.engine import Layer from keras.layers.core import Flatten from keras.callbacks import ModelCheckpoint, ReduceLROnPlateau,EarlyStopping from keras.datasets import reuters from keras.models import Sequential from keras.layers import Dense, Dropout, Activation,BatchNormalization from keras.regularizers import l1,l2 from keras.preprocessing.text import Tokenizer from keras.callbacks import ModelCheckpoint, ReduceLROnPlateau,EarlyStopping,Callback import gc from tqdm import tqdm_notebook class _Data_Preprocess: def __init__(self): self.int8_max = np.iinfo(np.int8).max self.int8_min = np.iinfo(np.int8).min self.int16_max = np.iinfo(np.int16).max self.int16_min = np.iinfo(np.int16).min self.int32_max = np.iinfo(np.int32).max self.int32_min = np.iinfo(np.int32).min self.int64_max = np.iinfo(np.int64).max self.int64_min = np.iinfo(np.int64).min self.float16_max = np.finfo(np.float16).max self.float16_min = np.finfo(np.float16).min self.float32_max = np.finfo(np.float32).max self.float32_min = np.finfo(np.float32).min self.float64_max = np.finfo(np.float64).max self.float64_min = np.finfo(np.float64).min ''' function: _get_type(self,min_val, max_val, types) get the correct types that our columns can trans to ''' def _get_type(self, min_val, max_val, types): if types == 'int': if max_val <= self.int8_max and min_val >= self.int8_min: return np.int8 elif max_val <= self.int16_max <= max_val and min_val >= self.int16_min: return np.int16 elif max_val <= self.int32_max and min_val >= self.int32_min: return np.int32 return None elif types == 'float': if max_val <= self.float16_max and min_val >= self.float16_min: return np.float16 if max_val <= self.float32_max and min_val >= self.float32_min: return np.float32 if max_val <= self.float64_max and min_val >= self.float64_min: return np.float64 return None ''' function: _memory_process(self,df) column data types trans, to save more memory ''' def _memory_process(self, df): init_memory = df.memory_usage().sum() / 1024 ** 2 / 1024 print('Original data occupies {} GB memory.'.format(init_memory)) df_cols = df.columns for col in tqdm_notebook(df_cols): try: if 'float' in str(df[col].dtypes): max_val = df[col].max() min_val = df[col].min() trans_types = self._get_type(min_val, max_val, 'float') if trans_types is not None: df[col] = df[col].astype(trans_types) elif 'int' in str(df[col].dtypes): max_val = df[col].max() min_val = df[col].min() trans_types = self._get_type(min_val, max_val, 'int') if trans_types is not None: df[col] = df[col].astype(trans_types) except: print(' Can not do any process for column, {}.'.format(col)) afterprocess_memory = df.memory_usage().sum() / 1024 ** 2 / 1024 print('After processing, the data occupies {} GB memory.'.format(afterprocess_memory)) return df memory_preprocess = _Data_Preprocess() user_app_actived = pd.read_csv('../../data/original_data/user_app_actived.csv',names=['uId', 'appId']) x_train = pd.read_csv('../../data/original_data/age_train.csv',names=['uId','age_group'],dtype={'uId':np.int32, 'age_group':np.int8}) x_test = pd.read_csv('../data/original_data/age_test.csv',names=['uId'],dtype={'uId':np.int32}) usage_list = pd.read_csv('../../data/processed_data/usage_app_info.csv') usage_appId = pd.read_csv('../../data/processed_data/usage_appId.csv') train = pd.read_csv('../../data/features/base_train.csv') test = pd.read_csv('../../data/features/base_test.csv') train=memory_preprocess._memory_process(train) test=memory_preprocess._memory_process(test) print(test.info()) gc.collect() actived_features_all = pd.read_csv('../../data/features/actived_features_all.csv') actived_features_all=memory_preprocess._memory_process(actived_features_all) train = pd.merge(train, actived_features_all, how='left', on='uId').fillna(0) test = pd.merge(test, actived_features_all, how='left', on='uId').fillna(0) del actived_features_all gc.collect() act_use_rnn_hide_train=pd.read_csv('../../data/features/act_use_rnn_hide_train.csv') act_use_rnn_hide_train=memory_preprocess._memory_process(act_use_rnn_hide_train) act_use_rnn_hide_train.rename(columns={'Unnamed: 0': 'uId'}, inplace=True) train = pd.merge(train, act_use_rnn_hide_train, how='left', on='uId').fillna(0) del act_use_rnn_hide_train act_use_rnn_hide_test=pd.read_csv('../../data/features/act_use_rnn_hide_test.csv') act_use_rnn_hide_test=memory_preprocess._memory_process(act_use_rnn_hide_test) act_use_rnn_hide_test.rename(columns={'Unnamed: 0': 'uId'}, inplace=True) test = pd.merge(test, act_use_rnn_hide_test, how='left', on='uId').fillna(0) print(test.info()) del act_use_rnn_hide_test gc.collect() user_app_actived['app_list'] = user_app_actived.appId.str.split('#') import ast from tqdm import tqdm usage_train = [] for idx in tqdm(usage_list.appId): usage_train.append(ast.literal_eval(idx)) usage_list['app_list'] = usage_train user_app_actived.drop('appId',axis=1,inplace=True) usage_list.drop('appId',axis=1,inplace=True) user_app_actived = pd.merge(user_app_actived, usage_list, how='left', on='uId') result = [] for index,row in tqdm(user_app_actived.iterrows()): try: result.append(row['app_list_x'] + row['app_list_y']) except: result.append(row['app_list_x']) user_app_actived['app_list'] = result user_app_actived.drop(['app_list_x','app_list_y'],axis=1,inplace =True) x_train = pd.merge(x_train, user_app_actived, how='left', on='uId') x_test = pd.merge(x_test, user_app_actived, how='left', on='uId') y_train = x_train.age_group - 1 x_train = x_train.drop('age_group',axis=1) del user_app_actived del usage_list del usage_train gc.collect() train_uId = x_train.uId.tolist() test_uId = x_test.uId.tolist() test.index = test.uId.tolist() train.index = train.uId.tolist() test = test.loc[test_uId,:] train = train.loc[train_uId,:] appId = pd.read_csv('../../data/processed_data/appId.csv') usage_appId = pd.read_csv('../../data/processed_data/usage_appId_top_num100000.csv') usage_appId = usage_appId[-10000:] usage_appId['id'] = np.arange(0,10000) all_appid = list(set(appId.appId.tolist() + usage_appId.appId.tolist())) app_dict = dict(zip(all_appid,np.arange(len(all_appid)))) x_train = [[x for x in apps if x in app_dict] for apps in x_train.app_list] x_test = [[x for x in apps if x in app_dict] for apps in x_test.app_list] x_train = [" ".join(app) for app in x_train] x_test = [" ".join(app) for app in x_test] c_vec1 = CountVectorizer(lowercase=False,ngram_range=(1,1),dtype=np.int8) c_vec1.fit(x_train + x_test) x_train = c_vec1.transform(x_train).toarray() x_test = c_vec1.transform(x_test).toarray() gc.collect() train.drop(['uId','age_group'],axis=1,inplace=True) test.drop('uId',axis=1,inplace=True) train = train.reset_index(drop=True) test = test.reset_index(drop=True) from sklearn.preprocessing import StandardScaler,MinMaxScaler train = train.replace([np.inf, -np.inf], np.nan).fillna(0) test = test.replace([np.inf, -np.inf], np.nan).fillna(0) scaler = MinMaxScaler() scaler.fit(pd.concat([train,test],axis=0)) train = scaler.transform(train) test = scaler.transform(test) train = memory_preprocess._memory_process(pd.DataFrame(train)) test = memory_preprocess._memory_process(pd.DataFrame(test)) gc.collect() x_train = np.hstack((x_train,train.values)) x_test = np.hstack((x_test,test.values)) from keras.utils.np_utils import to_categorical y_train = to_categorical(y_train, num_classes=None) def mlp_v3(): model = Sequential() model.add(Dense(1024, input_shape=(13,400,))) model.add(Activation('relu')) model.add(Dropout(0.2)) model.add(Dense(256)) model.add(Activation('relu')) model.add(Dropout(0.2)) # model.add(BatchNormalization()) model.add(Dense(128)) model.add(Activation('relu')) model.add(Dropout(0.2)) # model.add(BatchNormalization()) # model.add(Dense(6)) model.add(Activation('softmax')) model.compile(loss='categorical_crossentropy', optimizer='Nadam', metrics=['accuracy']) return model from sklearn.model_selection import train_test_split, StratifiedKFold kfold = StratifiedKFold(n_splits=5, random_state=10, shuffle=False) y_test = np.zeros((x_test.shape[0],6)) y_val = np.zeros((x_train.shape[0],6)) for i, (train_index, valid_index) in enumerate(kfold.split(x_train, np.argmax(y_train,axis=1))): X_train, X_val, Y_train, Y_val = x_train[train_index],x_train[valid_index], y_train[train_index], y_train[valid_index] filepath="weights_best2.h5" checkpoint = ModelCheckpoint(filepath, monitor='val_loss', verbose=2, save_best_only=True, mode='min') reduce_lr = ReduceLROnPlateau(monitor='val_loss', factor=0.6, patience=1, min_lr=0.0001, verbose=2) earlystopping = EarlyStopping(monitor='val_loss', min_delta=0.0001, patience=2, verbose=2, mode='auto') callbacks = [checkpoint, reduce_lr] model = mlp_v3() if i == 0:print(model.summary()) model.fit(X_train, Y_train, batch_size=128, epochs=5, validation_data=(X_val, Y_val), verbose=1, callbacks=callbacks, ) model.load_weights(filepath) y_val[valid_index] = model.predict(X_val, batch_size=128, verbose=1) y_test += np.array(model.predict(x_test, batch_size=128, verbose=1))/5 y_val = pd.DataFrame(y_val,index=train_uId) y_val.to_csv('../../data/prob_file/act_all_train_mlp.csv') y_test = pd.DataFrame(y_test,index=test_uId) y_test.to_csv('../../data/prob_file/act_all_test_mlp.csv')
StarcoderdataPython
96086
# library from redesigned_barnacle.config import load_config, parse_file from redesigned_barnacle.eth import eth_start from redesigned_barnacle.sparkline import Sparkline from redesigned_barnacle.unit import temp_ftoc from prometheus_express import start_http_server, CollectorRegistry, Counter, Gauge, Router from bme280 import BME280 from ssd1306 import SSD1306_I2C # system import esp32 import machine import network import os import time def bind(eth, config): ip = eth.ifconfig()[0] port = int(config['server_port']) print('Binding server: {}:{}'.format(ip, port)) return start_http_server(port, address=ip) def main(): # setup sensors bus = machine.I2C(scl=machine.Pin(16), sda=machine.Pin(13)) bme = BME280(i2c=bus) oled = SSD1306_I2C(128, 32, bus) # setup storage card = machine.SDCard() os.mount(card, '/card') # setup networking config = load_config('/card', 'config.yml') eth = eth_start( config, mdc=machine.Pin(23), mdio=machine.Pin(18), phy_type=network.PHY_LAN8720, phy_addr=0, clock_mode=network.ETH_CLOCK_GPIO17_OUT, power_pin=machine.Pin(12, machine.Pin.OUT) ) # setup display sl = Sparkline(32, 128) oled.init_display() oled.fill(0x0) oled.text('loading', 0, 0) oled.show() # setup Prometheus metrics registry = CollectorRegistry(namespace='prometheus_express') metric_beat = Counter( 'system_heartbeat', 'system heartbeat counter', labels=['location'], registry=registry ) metric_temp = Gauge( 'sensor_temperature', 'temperature data from the sensors', labels=['location', 'sensor'], registry=registry ) router = Router() router.register('GET', '/metrics', registry.handler) server = False # wait for incoming connection while True: while not server: time.sleep(1) server = bind(eth, config) bme_reading = bme.read_compensated_data() temp_line = ((bme_reading[0] - 12) * 2) % 32 print('temp line: {}'.format(temp_line)) oled.fill(0x0) sl.push(temp_line) sl.draw(oled, 0, 12) oled.text(str(bme_reading[0]), 0, 0) oled.show() location = config['metric_location'] metric_beat.labels(location).inc(1) metric_temp.labels(location, 'esp32').set( temp_ftoc(esp32.raw_temperature())) metric_temp.labels(location, 'bme280').set(bme_reading[0]) try: server.accept(router) except OSError as err: print('Error accepting request: {}'.format(err)) except ValueError as err: print('Error parsing request: {}'.format(err)) main()
StarcoderdataPython
4815494
from vivarium.utils.datum import Datum class Protein(Datum): defaults = { 'id': '', 'sequence': ''} def __init__(self, config, defaults=defaults): super(Protein, self).__init__(config, self.defaults) GFP = Protein({ 'id': 'GFP', 'sequence': 'MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK'})
StarcoderdataPython
3333729
def checkupdate(): import requests from subprocess import Popen, PIPE with open("babysploit/version", "r") as fwv: data = fwv.read().replace(" ", "") cv = requests.get("https://raw.githubusercontent.com/M4cs/BabySploit/master/babysploit/version").text.replace(" ", "") if data == cv: pass elif data != cv: print("[!] Update Found | Version: %s [!]" % cv) ask = str(input("[y\\n] ").lower()) if ask == "y": process1 = Popen(["git", "fetch", "--all"], stdout=PIPE, stderr=PIPE) process2 = Popen(["git", "reset", "--hard", "origin/master"], stdout=PIPE, stderr=PIPE) process3 = Popen(["pip3", "install", "-r", "requirements.txt"], stdout=PIPE, stderr=PIPE) print("Fetching Update..") process1.communicate() print("Downloading Update..") process2.communicate() print("Installing Modules.. This may take a minute..") process3.communicate() Popen(["rm -rf babysploit/__pycache__/"], stdout=PIPE, stderr=PIPE)
StarcoderdataPython
184105
# openweatherclass Python Program for Raspberry Pi 3 # Author: <NAME> # Date: August 2, 2021 v1.0.0 # Revision: # Import class files import requests import json # import pprint # --------------Class Definitions------------------# class OpenWeatherAPI(object): ''' OpenWeatherAPI Class: Inputs: apikey - provided with user account on openweathermap.org location - city,state OR zipcode units - weather units - weather units (default is 'imperial') country - two character country code (defaul is US) ''' def __init__(self, apikey, location='59327', units='imperial', country='US'): self.apikey = apikey self.location = location self.country = country self.units = units baseurl = 'https://api.openweathermap.org/data/2.5/weather?' self.complete_url = baseurl + 'appid=' + self.apikey + '&q=' + self.location + ',' + self.country + '&units=' + self.units def get_wind_direction(self, degrees): wd = int(degrees) if wd > 348.75 or wd < 11.25: wind_dir = 'N' elif wd > 11.25 and wd < 33.75: wind_dir = 'NNE' elif wd > 33.75 and wd < 56.25: wind_dir = 'NE' elif wd > 56.25 and wd < 78.75: wind_dir = 'ENE' elif wd > 78.75 and wd <101.25: wind_dir = 'E' elif wd > 101.25 and wd < 123.75: wind_dir = 'ESE' elif wd > 123.75 and wd < 146.25: wind_dir = 'SE' elif wd > 146.25 and wd < 168.75: wind_dir = 'SSE' elif wd > 168.75 and wd < 191.25: wind_dir = 'S' elif wd > 191.25 and wd < 213.75: wind_dir = 'SSW' elif wd > 213.75 and wd < 236.25: wind_dir = 'SW' elif wd > 236.25 and wd < 258.75: wind_dir = 'WSW' elif wd > 258.75 and wd < 281.25: wind_dir = 'W' elif wd > 281.25 and wd < 303.75: wind_dir = 'WNW' elif wd > 303.75 and wd < 326.25: wind_dir = 'NW' elif wd > 326.25 and wd < 348.75: wind_dir = 'NNW' else: wind_dir = 'Unknown' return wind_dir def get_weather_data(self): response = requests.get(self.complete_url) result = response.json() # pprint.pprint(result) # check results if result['cod'] != 404 and 'message' not in result: data = result['main'] current_temp = data['temp'] current_pressure = data['pressure'] current_humidity = data['humidity'] weather = result['weather'] weather_desc = weather[0]['description'] location = result['name'] wind_direction = result['wind']['deg'] wind_speed = result['wind']['speed'] # Convert Degrees to Human Direction wind_dir = self.get_wind_direction(wind_direction) forecast = (('In {0}, it is currently: {1} with a temperature of: {2}F and winds out of: {3} at {4} MPH. Barometric pressure is: {5} hPa and humidity is: {6}%.').format(location, weather_desc, current_temp, wind_dir, wind_speed, current_pressure, current_humidity)) return(forecast) else: return(('Error: Weather for Location: {0} not found.').format(self.location))
StarcoderdataPython
10236
# ██╗░░░░░██╗███╗░░██╗░██████╗░░░░██████╗░██╗░░░░░░█████╗░░█████╗░██╗░░██╗ # ██║░░░░░██║████╗░██║██╔════╝░░░░██╔══██╗██║░░░░░██╔══██╗██╔══██╗██║░██╔╝ # ██║░░░░░██║██╔██╗██║██║░░██╗░░░░██████╦╝██║░░░░░███████║██║░░╚═╝█████═╝░ # ██║░░░░░██║██║╚████║██║░░╚██╗░░░██╔══██╗██║░░░░░██╔══██║██║░░██╗██╔═██╗░ # ███████╗██║██║░╚███║╚██████╔╝░░░██████╦╝███████╗██║░░██║╚█████╔╝██║░╚██╗ # ╚══════╝╚═╝╚═╝░░╚══╝░╚═════╝░░░░╚═════╝░╚══════╝╚═╝░░╚═╝░╚════╝░╚═╝░░╚═╝ # # Developed by <NAME> (C) Ling • Black 2020 # @site http://ling.black # ██╗░░░░░██╗███╗░░██╗░██████╗░░░░██████╗░██╗░░░░░░█████╗░░█████╗░██╗░░██╗ # ██║░░░░░██║████╗░██║██╔════╝░░░░██╔══██╗██║░░░░░██╔══██╗██╔══██╗██║░██╔╝ # ██║░░░░░██║██╔██╗██║██║░░██╗░░░░██████╦╝██║░░░░░███████║██║░░╚═╝█████═╝░ # ██║░░░░░██║██║╚████║██║░░╚██╗░░░██╔══██╗██║░░░░░██╔══██║██║░░██╗██╔═██╗░ # ███████╗██║██║░╚███║╚██████╔╝░░░██████╦╝███████╗██║░░██║╚█████╔╝██║░╚██╗ # ╚══════╝╚═╝╚═╝░░╚══╝░╚═════╝░░░░╚═════╝░╚══════╝╚═╝░░╚═╝░╚════╝░╚═╝░░╚═╝ # # Developed by <NAME> (C) Ling • Black 2020 # @site http://ling.black from typing import List from fastapi import APIRouter, Depends, HTTPException from pydantic import BaseModel from core.response import RequestLimit from database import get_db, DatabaseUtils from database.wow.models import PostModel, PostCommentsModel from wow.interface.entity import PostCategory, Post, PostCategoryCreate, PostCreate, PostLikeCreate, PostCommentCreate from wow.utils.posts import PostsUtils from wow.utils.users import BlizzardUsersUtils router = APIRouter() class TokenArgs(BaseModel): token: str class TokenPostIdArgs(BaseModel): token: str post_id: int class CommentIdAndToken(TokenArgs): comment_id: int class PostAPIList(BaseModel): items: List[Post] count: int class PostAPIListResponse(BaseModel): response: PostAPIList request: RequestLimit # ----------------------------------- # CATEGORIES # ----------------------------------- @router.post( "/categories", response_model=PostCategory, summary='Adds the category' ) def add_category(body: PostCategoryCreate): """ Adds the category :param body: :return: """ blizzard_id = BlizzardUsersUtils.id__safe(body.token) return PostsUtils.add_category(user_id=blizzard_id, url=body.url, title=body.title) @router.get( "/categories", response_model=List[PostCategory], summary='Returns the categories' ) def get_categories(): """ Returns the categories list :return: """ return PostsUtils.get_categories() # ----------------------------------- # POSTS # ----------------------------------- @router.get( "/", response_model=PostAPIListResponse, summary='Returns all the posts' ) def get_posts_all(limit: int = 100, offset: int = 0): return PostsUtils.get_posts_limit( limit=limit, offset=offset ) @router.get( "/category/{category_url}", response_model=PostAPIListResponse, summary='Returns the posts in category' ) def get_posts_all(category_url: int, limit: int = 100, offset: int = 0): """ Returns all the posts by category :param category_url: :param limit: :param offset: :return: """ return PostsUtils.get_posts_by_category_limit( category_id=category_url, limit=limit, offset=offset ) @router.get( "/user/{blizzard_id}", response_model=PostAPIListResponse, summary='Returns the posts by users' ) def get_posts_all(blizzard_id: int, limit: int = 100, offset: int = 0): """ Returns all the posts by category :param blizzard_id: :param limit: :param offset: :return: """ return PostsUtils.get_posts_by_blizzard_id( blizzard_id=blizzard_id, limit=limit, offset=offset ) @router.post( "/like", summary='Likes the post', tags=['Лайки'] ) def like_post(body: PostLikeCreate): blizzard_id = BlizzardUsersUtils.id__safe(body.token) return PostsUtils.add_like( user_id=blizzard_id, post_id=body.post_id, ) @router.post( "/unlike", summary='Unlikes the post', tags=['Лайки'] ) def like_post(body: PostLikeCreate): blizzard_id = BlizzardUsersUtils.id__safe(body.token) return PostsUtils.remove_like( user_id=blizzard_id, post_id=body.post_id, ) @router.post( "/comment", summary='Adds the comment', tags=['Комментарии'] ) def like_post(body: PostCommentCreate): blizzard_id = BlizzardUsersUtils.id__safe(body.token) return PostsUtils.add_comment( user_id=blizzard_id, post_id=body.post_id, reply_id=body.reply_id, text=body.text, ) @router.delete( "/comment", summary='Removes the comment', tags=['Комментарии'] ) def removes_post(body: CommentIdAndToken, db=Depends(get_db)): blizzard_id = BlizzardUsersUtils.id__safe(body.token) com = db.query(PostCommentsModel).filter(PostCommentsModel.id == body.comment_id).filter( PostCommentsModel.user_id == blizzard_id) if com.count() > 0: com.delete() db.commit() return True return False @router.post( "/", response_model=Post, summary='Adds the post' ) def add_post(body: PostCreate): """ Adds the post item :param body: :return: """ blizzard_id = BlizzardUsersUtils.id__safe(body.token) return PostsUtils.add_post( user_id=blizzard_id, category_id=body.category_id, title=body.title, content=body.content, tags=body.tags, image=body.image ) @router.delete( "/{post_id}", summary='Deletes the post' ) def delete_post(post_id: int, body: TokenArgs, db=Depends(get_db)): blizzard_id = BlizzardUsersUtils.id__safe(body.token) q = db.query(PostModel).filter(PostModel.id == post_id).filter(PostModel.user_id == blizzard_id) if q.count() == 0: raise HTTPException(status_code=404, detail='Post is undefined') return DatabaseUtils.remove_query(db, q) @router.post( "/{post_id}", summary='Edits the post' ) def edit_post(post_id: int, body: PostCreate, db=Depends(get_db)): blizzard_id = BlizzardUsersUtils.id__safe(body.token) q = db.query(PostModel).filter(PostModel.id == post_id).filter(PostModel.user_id == blizzard_id) if q.count() == 0: raise HTTPException(status_code=404, detail='Post is undefined') q.update({ 'title': body.title, 'content': body.content, 'category_id': body.category_id, 'image': body.image, 'tags': body.tags, }) db.commit() return True @router.get( "/{post_id}", response_model=Post, summary='Returns the post' ) def get_post(post_id: int, db=Depends(get_db)): return db.query(PostModel).filter(PostModel.id == post_id).first()
StarcoderdataPython
1703382
# Important: We are using PIL to read .png files later. # This was done on purpose to read indexed png files # in a special way -- only indexes and not map the indexes # to actual rgb values. This is specific to PASCAL VOC # dataset data. If you don't want thit type of behaviour # consider using skimage.io.imread() from PIL import Image import numpy as np import skimage.io as io import tensorflow as tf import pdb # Helper functions for defining tf types def _bytes_feature(value): return tf.train.Feature(bytes_list=tf.train.BytesList(value=[value])) def _int64_feature(value): return tf.train.Feature(int64_list=tf.train.Int64List(value=[value])) def write_image_annotation_pairs_to_tfrecord_with_paths(filename_pairs, tfrecords_filename): """Writes given image/annotation pairs to the tfrecords file. The function reads each image/annotation pair given filenames of image and respective annotation and writes it to the tfrecord file. Parameters ---------- filename_pairs : array of tuples (img_filepath, annotation_filepath) Array of tuples of image/annotation filenames tfrecords_filename : string Tfrecords filename to write the image/annotation pairs """ writer = tf.python_io.TFRecordWriter(tfrecords_filename) index = 0 for img_path, annotation_path,depth_path in filename_pairs: img_ = np.array(Image.open(img_path)) img = img_[:,:240,:] annotation_ = np.array(Image.open(annotation_path)) annotation = annotation_[:,:240] depth_ = np.array(Image.open(depth_path)) depth= depth_[:,:240] depth = depth.astype('float32') depth = np.log(depth + 1.) index +=1 print index # Unomment this one when working with surgical data # annotation = annotation[:, :, 0] # The reason to store image sizes was demonstrated # in the previous example -- we have to know sizes # of images to later read raw serialized string, # convert to 1d array and convert to respective # shape that image used to have. height = depth.shape[0] width = depth.shape[1] img_raw = img.tostring() annotation_raw = annotation.tostring() depth_raw = depth.tostring() example = tf.train.Example(features=tf.train.Features(feature={ 'image_name': _bytes_feature((img_path)), 'height': _int64_feature(height), 'width': _int64_feature(width), 'image_raw': _bytes_feature(img_raw), 'mask_raw': _bytes_feature(annotation_raw), 'depth_raw':_bytes_feature(depth_raw)})) writer.write(example.SerializeToString()) writer.close() def write_mnist_mnistm_syn_shvn(mnist_train,mnistm_train,shvn_train,syn_train, tfrecords_filename): """Writes given image/annotation pairs to the tfrecords file. The function reads each image/annotation pair given filenames of image and respective annotation and writes it to the tfrecord file. Parameters ---------- filename_pairs : array of tuples (img_filepath, annotation_filepath) Array of tuples of image/annotation filenames tfrecords_filename : string Tfrecords filename to write the image/annotation pairs """ writer = tf.python_io.TFRecordWriter(tfrecords_filename) height1 = mnist_train[0].shape[0] width1 = mnist_train[0].shape[1] height2 = shvn_train[0].shape[0] width2 = shvn_train[0].shape[1] for k in xrange(len(mnist_train)/2): i = k j = k+len(mnist_train)/2 mnist1,mnistm1,shvn1,syn1 = mnist_train[i].tostring(),mnistm_train[i].tostring(),shvn_train[i].tostring(),syn_train[i].tostring() mnist2,mnistm2,shvn2,syn2 = mnist_train[j].tostring(),mnistm_train[j].tostring(),shvn_train[j].tostring(),syn_train[j].tostring() example = tf.train.Example(features=tf.train.Features(feature={ 'height1': _int64_feature(height1), 'width1': _int64_feature(width1), 'height2': _int64_feature(height2), 'width2': _int64_feature(width2), 'mnist1': _bytes_feature(mnist1), 'mnist2': _bytes_feature(mnist2), 'mnistm1': _bytes_feature(mnistm1), 'mnistm2': _bytes_feature(mnistm2), 'shvn1': _bytes_feature(shvn1), 'shvn2': _bytes_feature(shvn2), 'syn1': _bytes_feature(syn1), 'syn2': _bytes_feature(syn2)})) writer.write(example.SerializeToString()) print('index: %d'%k) writer.close() def read_mnist_mnistm_syn_shvn(tfrecord_filenames_queue): """Return image/annotation tensors that are created by reading tfrecord file. The function accepts tfrecord filenames queue as an input which is usually can be created using tf.train.string_input_producer() where filename is specified with desired number of epochs. This function takes queue produced by aforemention tf.train.string_input_producer() and defines tensors converted from raw binary representations into reshaped image/annotation tensors. Parameters ---------- tfrecord_filenames_queue : tfrecord filename queue String queue object from tf.train.string_input_producer() Returns ------- image, annotation : tuple of tf.int32 (image, annotation) Tuple of image/annotation tensors """ reader = tf.TFRecordReader() _, serialized_example = reader.read(tfrecord_filenames_queue) features = tf.parse_single_example( serialized_example, features={ 'height1': tf.FixedLenFeature([], tf.int64), 'width1': tf.FixedLenFeature([], tf.int64), 'height2': tf.FixedLenFeature([], tf.int64), 'width2': tf.FixedLenFeature([], tf.int64), 'mnist1': tf.FixedLenFeature([], tf.string), 'mnist2': tf.FixedLenFeature([], tf.string), 'mnistm1': tf.FixedLenFeature([], tf.string), 'mnistm2': tf.FixedLenFeature([], tf.string), 'shvn1': tf.FixedLenFeature([], tf.string), 'shvn2': tf.FixedLenFeature([], tf.string), 'syn1': tf.FixedLenFeature([], tf.string), 'syn2': tf.FixedLenFeature([], tf.string) }) mnist1 = tf.decode_raw(features['mnist1'], tf.uint8) mnist2 = tf.decode_raw(features['mnist2'], tf.uint8) mnistm1 = tf.decode_raw(features['mnistm1'], tf.uint8) mnistm2 = tf.decode_raw(features['mnistm2'], tf.uint8) shvn1 = tf.decode_raw(features['shvn1'], tf.uint8) shvn2 = tf.decode_raw(features['shvn2'], tf.uint8) syn1 = tf.decode_raw(features['syn1'], tf.uint8) syn2 = tf.decode_raw(features['syn2'], tf.uint8) height1 = tf.cast(features['height1'], tf.int32) width1 = tf.cast(features['width1'], tf.int32) height2 = tf.cast(features['height2'], tf.int32) width2 = tf.cast(features['width2'], tf.int32) image1_shape = tf.stack([height1, width1, 3]) image2_shape = tf.stack([height2, width2, 3]) # The last dimension was added because # the tf.resize_image_with_crop_or_pad() accepts tensors # that have depth. We need resize and crop later. # TODO: See if it is necessary and probably remove third # dimension mnist1 = tf.reshape(mnist1, image1_shape) mnist2 = tf.reshape(mnist2, image1_shape) mnistm1 = tf.reshape(mnistm1, image1_shape) mnistm2 = tf.reshape(mnistm2, image1_shape) shvn1 = tf.reshape(shvn1,image2_shape) shvn2 = tf.reshape(shvn2,image2_shape) syn1 = tf.reshape(syn1,image2_shape) syn2 = tf.reshape(syn2,image2_shape) return mnist1,mnistm1,shvn1,syn1,mnist2,mnistm2,shvn2,syn2
StarcoderdataPython
65999
#!/usr/bin/env python3 import sys import numpy as np from example import AmiciExample class ExampleCalvetti(AmiciExample): def __init__(self): AmiciExample.__init__( self ) self.numX = 6 self.numP = 0 self.numK = 6 self.modelOptions['theta'] = [] self.modelOptions['kappa'] = [0.29, 0.74, 0.44, 0.08, 0.27, 0.18] self.modelOptions['ts'] = np.linspace(0, 20, 201) self.modelOptions['pscale'] = 0 self.solverOptions['atol'] = 1e-6 self.solverOptions['rtol'] = 1e-4 self.solverOptions['sens_ind'] = [] self.solverOptions['sensi'] = 0 self.solverOptions['sensi_meth'] = 1 def writeNoSensi(filename): ex = ExampleCalvetti() ex.writeToFile(filename, '/model_calvetti/nosensi/') def main(): if len(sys.argv) < 2: print("Error: Must provide output file as first and only argument.") sys.exit(1) filename = sys.argv[1] writeNoSensi(filename) if __name__ == "__main__": main()
StarcoderdataPython
3266924
<filename>003/highest_and_lowest_7kyu.py """In this little assignment you are given a string of space separated numbers, and have to return the highest and lowest number.""" def high_and_low(numbers): "Function to return the smallest and largest element from a list" numbers = [int(num) for num in numbers.split(" ")] return "{max} {min}".format(max=max(numbers), min=min(numbers)) def test_case(): """Some useful test cases for the problem""" assert high_and_low("4 5 29 54 4 0 -214 542 -64 1 -3 6 -6") == "542 -214" print("Test Success!") test_case()
StarcoderdataPython
4811105
<gh_stars>1-10 import numpy as np class truss: def __init__(self, x1, x2, y1, y2, E, A, node1, node2, stress=None, strain=None): self.x1 = x1 self.x2 = x2 self.y1 = y1 self.y2 = y2 self.E = E self.A = A self.l = ((x2-x1)**2+(y2-y1)**2)**(1/2) self.cos_t = (x2-x1)/self.l self.sin_t = (y2-y1)/self.l self.L = [[self.cos_t, self.sin_t, 0, 0], [0, 0, self.cos_t, self.sin_t]] self.eL = [-self.cos_t, -self.sin_t, self.cos_t, self.sin_t] self.K1D = [[self.E*self.A/self.l, -self.E*self.A/self.l], [-self.E*self.A/self.l, self.E*self.A/self.l]] self.K2D = (np.matrix(self.L).getT()*np.matrix(self.K1D)*\ np.matrix(self.L)).tolist() self.node1 = node1 #zero-indexed self.node2 = node2 #zero-indexed class force: def __init__(self, fx, fy, node): self.fx = fx self.fy = fy self.node = node class fixed_node: def __init__(self, node, x_or_y, disp): self.node = node self.x_or_y = x_or_y self.disp = disp
StarcoderdataPython
1080
import gi gi.require_version('Gtk', '3.0') from gi.repository import Gio, Gtk, Gdk class AddFriendWidget(Gtk.Box): def __init__(self, main_window, fchat_prv, friend_list): Gtk.Box.__init__(self, spacing=7, orientation = Gtk.Orientation.VERTICAL) self.fchat_prv = fchat_prv self.main_window = main_window self.friend_list = friend_list self.fchat_prv.add_friend_gui = self self.generate_keys_bt = Gtk.Button('Generate Key') self.generate_keys_bt.connect('clicked', self.on_generate_keys) self.save_bt = Gtk.Button('Save') self.save_bt.connect('clicked', self.on_save) self.cancel_bt = Gtk.Button('Cancel') self.cancel_bt.connect('clicked', self.on_cancel) self.close_bt = Gtk.Button('Close') self.close_bt.connect('clicked', self.on_close) self.owner_info = Gtk.Entry() self.owner_info.set_sensitive(False) self.copy_clipboard_bt = Gtk.Button(label='Copy to clipboard') self.clipboard = Gtk.Clipboard.get(Gdk.SELECTION_CLIPBOARD) self.copy_clipboard_bt.connect('clicked', self.on_copy_clipboard) h_owner = Gtk.Box(spacing=5) h_owner.pack_start(self.owner_info, True, True, 1) h_owner.pack_start(self.copy_clipboard_bt, False, False, 1) self.friend_info = Gtk.Entry() self.friend_info.set_placeholder_text('Key of your friend') self.spinner = Gtk.Spinner() self.pack_start(h_owner, True, False, 7) self.pack_start(self.friend_info, True, False, 7) self.pack_start(self.spinner, True, False, 7) h_bt = Gtk.Box() h_bt.pack_start(self.generate_keys_bt, True, False, 7) h_bt.pack_start(self.save_bt, True, False, 7) h_bt.pack_start(self.cancel_bt, True, False, 7) h_bt.pack_start(self.close_bt, True, False, 7) self.pack_start(h_bt, True, False, 7) self.job = None def on_generate_keys(self, button): self.pub, self.prv, self.pub_info_key, self.job = self.fchat_prv.generate_key_for_friend() self.owner_info.set_text(self.pub_info_key) self.on_generate_keys_start() def on_generate_keys_start(self): self.spinner.show() self.spinner.start() self.friend_info.set_sensitive(False) self.save_bt.set_sensitive(False) self.close_bt.set_sensitive(False) self.generate_keys_bt.set_sensitive(False) self.copy_clipboard_bt.set_sensitive(False) def on_generate_keys_ok(self): self.spinner.hide() self.spinner.stop() self.friend_info.set_sensitive(True) self.save_bt.set_sensitive(True) self.close_bt.set_sensitive(True) self.generate_keys_bt.set_sensitive(True) self.copy_clipboard_bt.set_sensitive(True) def on_generate_keys_faild(self, text): self.spinner.hide() self.spinner.stop() self.friend_info.set_sensitive(True) self.save_bt.set_sensitive(True) self.close_bt.set_sensitive(True) self.generate_keys_bt.set_sensitive(True) self.copy_clipboard_bt.set_sensitive(True) def on_cancel(self, button): if self.job: self.job.remove_from_queue_when_finish() def on_close(self, button): self.main_window.application.back_main_window_or_friend_list() def on_save(self, button): if self.owner_info.get_text() == '': self.msg_info('You should generate a key that contains your info') return if self.friend_info.get_text() == '': self.msg_info('Friend info is required') return self.fchat_prv.add_friend(self.pub, self.prv, self.friend_info.get_text()) self.on_save_start() def on_save_start(self): self.spinner.show() self.spinner.start() self.friend_info.set_sensitive(False) self.save_bt.set_sensitive(False) self.close_bt.set_sensitive(False) self.generate_keys_bt.set_sensitive(False) self.copy_clipboard_bt.set_sensitive(False) def on_save_start_ok(self): self.spinner.hide() self.spinner.stop() self.friend_info.set_sensitive(True) self.save_bt.set_sensitive(True) self.close_bt.set_sensitive(True) self.generate_keys_bt.set_sensitive(True) self.copy_clipboard_bt.set_sensitive(True) self.friend_list.sync_friends_list() def on_save_start_duplicate(self, text): self.msg_info(text) def on_save_start_faild(self): dialog = Gtk.MessageDialog(self.main_window, 0, Gtk.MessageType.ERROR, Gtk.ButtonsType.OK, "ERROR") dialog.format_secondary_text("Error adding friend please try later") dialog.run() dialog.destroy() self.spinner.hide() self.spinner.stop() self.friend_info.set_sensitive(True) self.save_bt.set_sensitive(True) self.close_bt.set_sensitive(True) self.generate_keys_bt.set_sensitive(True) self.copy_clipboard_bt.set_sensitive(True) def on_copy_clipboard(self, button): self.clipboard.set_text(self.owner_info.get_text(), -1) def msg_info(self, text): dialog = Gtk.MessageDialog(self.main_window, 0, Gtk.MessageType.INFO, Gtk.ButtonsType.OK, "Info") dialog.format_secondary_text(text) dialog.run() dialog.destroy()
StarcoderdataPython
88548
<reponame>vlue-c/Visual-Explanation-Methods-PyTorch from .simple_grad import SimpleGradient
StarcoderdataPython
1771149
# Copyright 2019 BlueCat Networks (USA) Inc. and its affiliates # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # Various Flask framework items. import os import sys import codecs import psycopg2 from flask import url_for, redirect, render_template, flash, g from bluecat import route, util from bluecat.wtform_extensions import GatewayForm from bluecat.wtform_fields import TableField import config.default_config as config from main_app import app def module_path(): encoding = sys.getfilesystemencoding() return os.path.dirname(os.path.abspath(__file__)) def get_resource_text(): return util.get_text(module_path(), config.language) sql_params = [ {'id': 'entity', 'table': 'public.entity', 'where': ""}, {'id': 'ip4b', 'table': 'public.entity', 'where': "WHERE discriminator = 'IP4B'"}, {'id': 'ip4n', 'table': 'public.entity', 'where': "WHERE discriminator = 'IP4N'"}, {'id': 'ip4a', 'table': 'public.ipv4_address_basic_view', 'where': ""}, {'id': 'view', 'table': 'public.entity', 'where': "WHERE discriminator = 'VIEW'"}, {'id': 'zone', 'table': 'public.entity', 'where': "WHERE discriminator = 'ZONE'"}, {'id': 'record', 'table': 'public.resource_record_view', 'where': ""}, {'id': 'mac', 'table': 'public.entity', 'where': "WHERE discriminator = 'MACA'"}, {'id': 'nusr', 'table': 'public.entity', 'where': "WHERE discriminator = 'NUSR'"}, {'id': 'gusr', 'table': 'public.entity', 'where': "WHERE discriminator = 'GUSR'"}, {'id': 'location', 'table': 'public.entity', 'where': "WHERE discriminator = 'LOCATION'"}, ] def load_statistics(text): data = [] db_address = os.environ['BAM_IP'] connector = psycopg2.connect(host=db_address, database="proteusdb", user="bcreadonly") cursor = connector.cursor() db_size_sql = "SELECT pg_size_pretty(pg_database_size('proteusdb')) FROM pg_database" cursor.execute(db_size_sql) result = cursor.fetchall() data.append([text['title_db_size'], result[0][0]]) for sql_param in sql_params: sql = "SELECT count(id) FROM %s %s" % (sql_param['table'], sql_param['where']) cursor.execute(sql) result = cursor.fetchall() data.append([text['title_%s_count' % sql_param['id']], '{:,}'.format(int(result[0][0]))]) cursor.close() connector.close() return data def table_features(): """Returns table formatted data for display in the TableField component""" # pylint: disable=unused-argument text = get_resource_text() data = load_statistics(text) return { 'columns': [ {'title': text['title_title']}, {'title': text['title_value']} ], 'columnDefs': [ {'className': 'dt-right', 'targets': [1]} ], 'searching': False, 'ordering': False, 'paging': False, 'info': False, 'lengthChange': False, 'data': data } class GenericFormTemplate(GatewayForm): """ Generic form Template Note: When updating the form, remember to make the corresponding changes to the workflow pages """ workflow_name = 'view_db_statistics' workflow_permission = 'view_db_statistics_page' text = get_resource_text() output_table = TableField( workflow_name=workflow_name, permissions=workflow_permission, label=text['label_list'], table_features=table_features(), is_disabled_on_start=False ) # The workflow name must be the first part of any endpoints defined in this file. # If you break this rule, you will trip up on other people's endpoint names and # chaos will ensue. @route(app, '/view_db_statistics/view_db_statistics_endpoint') @util.workflow_permission_required('view_db_statistics_page') @util.exception_catcher def view_db_statistics_view_db_statistics_page(): form = GenericFormTemplate() return render_template( 'view_db_statistics_page.html', form=form, text=util.get_text(module_path(), config.language), options=g.user.get_options(), )
StarcoderdataPython
4827583
# hexutil.py """Miscellaneous utility routines relating to hex and byte strings""" # Copyright (c) 2008-2012 <NAME> # This file is part of pydicom, released under a modified MIT license. # See the file license.txt included with this distribution, also # available at http://pydicom.googlecode.com from binascii import a2b_hex, b2a_hex from dicom import in_py3 def hex2bytes(hexstring): """Return bytestring for a string of hex bytes separated by whitespace This is useful for creating specific byte sequences for testing, using python's implied concatenation for strings with comments allowed. Example: hex_string = ( "08 00 32 10" # (0008, 1032) SQ "Procedure Code Sequence" " 08 00 00 00" # length 8 " fe ff 00 e0" # (fffe, e000) Item Tag ) byte_string = hex2bytes(hex_string) Note in the example that all lines except the first must start with a space, alternatively the space could end the previous line. """ return a2b_hex(hexstring.replace(" ", "")) def bytes2hex(byte_string): s = b2a_hex(byte_string) if in_py3: s = s.decode() return " ".join(s[i:i+2] for i in range(0, len(s), 2))
StarcoderdataPython
1784904
import matplotlib.pyplot as plt import numpy as np import tensorflow as tf # a = np.linspace(0,10) # b = np.linspace(0,5) # plt.figure() # plt.plot(a,b) # plt.show() x_data = np.random.rand(100).astype(np.float32) y_data = x_data * 0.1 + 0.3 plt.figure() plt.plot(x_data , y_data, color='red', marker='x',linestyle='') Weights = tf.Variable(tf.random_uniform([1], -1.0, 1.0)) biases = tf.Variable(tf.zeros([1])) y = Weights * x_data + biases loss = tf.reduce_mean(tf.square(y-y_data)) optimizer = tf.train.GradientDescentOptimizer(0.5) train = optimizer.minimize(loss) init = tf.global_variables_initializer() sess = tf.Session() sess.run(init) for step in range(201): sess.run(train) print(step, sess.run(Weights), sess.run(biases) , sess.run(loss)) print("\n----------------END----------------") w = sess.run(Weights) b = sess.run(biases) # print("w : " + str(w) + " b : " + str(b)) # lin_x = np.linspace(0,1,100) result_y = w * lin_x + b plt.plot(lin_x , result_y ,color='green',linestyle='--') plt.show()
StarcoderdataPython
3358030
<filename>blender_bindings/ui/export_nodes/model_tree_nodes.py from typing import List import bpy from bpy.types import NodeTree, Node, Operator from . import nodes class SourceIO_OP_EvaluateNodeTree(Operator): bl_idname = "sourceio.evaluate_nodetree" bl_label = "Evaluate tree" tmp_file: bpy.types.Text def execute(self, context: bpy.types.Context): if not bpy.data.texts.get('qc', False): self.tmp_file = bpy.data.texts.new('qc') else: self.tmp_file = bpy.data.texts['qc'] all_nodes = context.space_data.node_tree.nodes outputs = [] # type:List[Node] for node in all_nodes: # type: Node if node.bl_idname == "SourceIOModelNode": outputs.append(node) for output in outputs: # type:nodes.SourceIOModelNode self.traverse_tree(output) return {'FINISHED'} def traverse_tree(self, start_node: nodes.SourceIOModelNode): self.tmp_file.write(start_node.model_name + "\n") objects = start_node.inputs['Objects'] bodygroups = start_node.inputs['Bodygroups'] skins = start_node.inputs['Skin'] if objects.is_linked: for link in objects.links: object_node: nodes.SourceIOObjectNode = link.from_node self.tmp_file.write("\tmesh " + object_node.get_value().obj.name + "\n") if bodygroups.is_linked: self.tmp_file.write("Bodygroups:\n") for link in bodygroups.links: bodygroup_node = link.from_node # type: nodes.SourceIOBodygroupNode self.tmp_file.write(str(bodygroup_node.get_value())) self.tmp_file.write('\n') if skins.is_linked: skin_node = skins.links[0].from_node # type: nodes.SourceIOSkinNode self.tmp_file.write(str(skin_node.get_value())) self.tmp_file.write('\n') class SourceIO_NT_ModelTree(NodeTree): bl_idname = 'sourceio.model_definition' bl_label = "SourceIO model definition" bl_icon = 'NODETREE' def update(self, ): for node in self.nodes: node.update() for link in self.links: # type:bpy.types.NodeLink if link.from_socket.bl_idname != link.to_socket.bl_idname: self.links.remove(link) self.check_link_duplicates() def check_link_duplicates(self): to_remove = [] for link in self.links: for link2 in self.links: if link == link2 or link in to_remove: continue if link.from_node == link2.from_node and link.to_node == link2.to_node: to_remove.append(link2) break for link in to_remove: self.links.remove(link)
StarcoderdataPython
3354052
#!/usr/bin/env python2 # -*- coding: utf-8 -*- # Copyright (c) 2015 <NAME>, <EMAIL> # # Permission is hereby granted, free of charge, to any person obtaining a copy # of this software and associated documentation files (the "Software"), to deal # in the Software without restriction, including without limitation the rights # to use, copy, modify, merge, publish, distribute, sublicense, and/or sell # copies of the Software, and to permit persons to whom the Software is # furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included in # all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER # LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, # OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN # THE SOFTWARE. """Functions and constants to scale current 4-20 mA to measurements, and vice versa. """ __all__ = ['P1Flow', 'P1Level', 'current_to_signal', 'signal_to_current'] class P1Level(object): EUMAX = 1225.0 EUMIN = 0.0 RAWMAX = 31208.0 RAWMIN = 0.0 class P1Flow(object): EUMAX = 10.0 EUMIN = 0.0 RAWMAX = 31208.0 RAWMIN = -15.0 def current_to_signal(raw_in, scaling): """ Scales the input signal from current 4 - 20 mA to the human readable measurements. :param raw_in: current value. :param scaling: scaling constants. :return: signal value. """ result = raw_in - scaling.RAWMIN result *= (scaling.EUMAX - scaling.EUMIN) / (scaling.RAWMAX - scaling.RAWMIN) result += scaling.EUMIN return result def signal_to_current(scale_in, scaling): """ Scales the input signal from human readable measurements to current 4 - 20 mA. :param scale_in: signal value. :param scaling: scaling constants. :return: current value. """ result = scale_in - scaling.EUMIN result /= (scaling.EUMAX - scaling.EUMIN) / (scaling.RAWMAX - scaling.RAWMIN) result += scaling.RAWMIN return 0 if result < 0 else result
StarcoderdataPython
3295028
<filename>tools/binprof.py #!/usr/bin/env python3 import subprocess from dataclasses import dataclass from typing import Optional from pprint import pprint from collections import defaultdict import argparse # Details of what the bufferent `symbol_type`s mean # https://sourceware.org/binutils/docs/binutils/nm.html # This article hit the same problem with nm # https://web.archive.org/web/20190317203555/https://www.embeddedrelated.com/showarticle/900.php # They looked up details with readelf/objdump parser = argparse.ArgumentParser(description='RAM and Flash profiling') parser.add_argument('binary', type=str, help='The path to the binary to profile') parser.add_argument('--other', type=str, default="other", help='What to classify unknown memory as') parser.add_argument('--no-error-if-unknown', action='store_false', default=False, help='Raise an error if there is memory classified as other') args = parser.parse_args() result = subprocess.run( f"nm --print-size --size-sort --radix=d --line-numbers {args.binary}", check=True, shell=True, capture_output=True, encoding="utf-8", universal_newlines=True, ) @dataclass(frozen=True) class Result: position: int size: int symbol_type: str name: str location: Optional[str] = None def __post_init__(self): super().__setattr__("position", int(self.position)) super().__setattr__("size", int(self.size)) flash_symb = [] ram_symb = [] for line in result.stdout.split("\n"): if not line: continue details = line.split(' ') if "\t" in details[-1]: details = details[:-1] + details[-1].split("\t") r = Result(*details) # Contiki's ramprof picks up [abdrw] and flashprof picks up [t] (both case insensitive) if r.symbol_type in "Tt": flash_symb.append(r) elif r.symbol_type in "abdrwABDRW": ram_symb.append(r) else: raise RuntimeError(f"Unknown symbol type {r.symbol_type}") def summarise(symbs): return sum(x.size for x in symbs) def classify(symb, other="other"): # I apologise for this horrible function. # nm is unable to pick up the correct location of static variables declared inside functions # So we need to manually classify these variables # Other variables simply do not have a location for some unknown reason if symb.location is None: if symb.name in ("process_current", "process_list", "curr_instance", "linkaddr_null", "linkaddr_node_addr", "etimer_process", "csma_driver", "drop_route", "framer_802154"): return "contiki-ng/net" if symb.name.startswith(("uip", "sicslowpan_", "rpl_", "tcpip_", "root_ipaddr.")): return "contiki-ng/net" if symb.name in ("serial_line_process", "sensors_process", "serial_line_event_message", "curr_log_level_main", "curr_log_level_coap", "button_hal_periodic_event", "button_hal_press_event", "button_hal_release_event", "node_id", "sensors_event"): return "contiki-ng" if symb.name.startswith(("heap_end.",)): return "contiki-ng" if symb.name in ("bignum_add_get_result", "ecc_add_get_result", "vdd3_sensor", "vectors"): return "contiki-ng/cc2538" if symb.name.startswith("cc2538_"): return "contiki-ng/cc2538" if symb.name.startswith("reset_cause."): return "contiki-ng/cc2538" if symb.name.startswith("p05."): # I think this refers to MP3_WTV020SD_P05_PORT return "contiki-ng/cc2538" if symb.name in ("coap_status_code", "coap_error_message", "coap_timer_default_driver"): return "contiki-ng/coap" if symb.name.startswith(("message.", "response.")): return "contiki-ng/coap" if symb.name in ("pe_edge_capability_add", "pe_edge_capability_remove"): return "system/trust" if symb.name in ("pe_message_signed", "pe_message_signed", "pe_message_verified", "root_cert", "our_cert", "our_privkey"): return "system/crypto" if symb.name.startswith(("verify_state.", "sign_state.", "ecdh2_unver_state.", "ecdh2_req_state.", "pkitem.", "sitem.", "vitem.")): return "system/crypto" if symb.name in ("mqtt_client_process"): return "system/mqtt-over-coap" if symb.name in ("pe_timed_unlock_unlocked", "root_ep", "autostart_processes"): return "system/common" if symb.name in ("pe_data_from_resource_rich_node", "resource_rich_edge_started", "applications_available", "application_names"): # Edge specific return "system/common" if symb.name in ("_C_numeric_locale", "__mprec_bigtens", "__mprec_tinytens", "__mprec_tens", "__hexdig", "_ctype_", "_impure_ptr"): return "newlib" if symb.name.startswith(("fpinan.", "fpi.")): return "newlib" return other if "newlib" in symb.location or "libgcc" in symb.location: return "newlib" if "oscore" in symb.location: return "contiki-ng/oscore" if "os/net/app-layer/coap" in symb.location: return "contiki-ng/coap" if "os/net" in symb.location: return "contiki-ng/net" if "arch/cpu/cc2538" in symb.location or "arch/platform/zoul" in symb.location: return "contiki-ng/cc2538" if "applications/monitoring" in symb.location: return "applications/monitoring" if "applications/routing" in symb.location: return "applications/routing" if "applications/challenge-response" in symb.location: return "applications/challenge-resp" if any(osdir in symb.location for osdir in ("os/lib", "os/sys", "os/dev", "os/contiki")): return "contiki-ng" if "crypto" in symb.location: return "system/crypto" if "trust" in symb.location: return "system/trust" if "mqtt-over-coap" in symb.location: return "system/mqtt-over-coap" if "wsn/node" in symb.location or "wsn/edge" in symb.location: return "system/common" return other def classify_all(symbs, other="other"): result = defaultdict(list) for symb in symbs: result[classify(symb, other=other)].append(symb) return dict(result) classified_ram_symb = classify_all(ram_symb, other=args.other) summarised_ram_symb = {k: summarise(v) for k, v in classified_ram_symb.items()} classified_flash_symb = classify_all(flash_symb, other=args.other) summarised_flash_symb = {k: summarise(v) for k, v in classified_flash_symb.items()} if "other" in classified_ram_symb or "other" in classified_flash_symb: try: print("RAM unknown:") pprint(classified_ram_symb["other"]) except KeyError: pass try: print("Flash unknown:") pprint(classified_flash_symb["other"]) except KeyError: pass if not args.no_error_if_unknown: raise RuntimeError("Symbols with an unknown classification") total_flash_symb = sum(summarised_flash_symb.values()) total_ram_symb = sum(summarised_ram_symb.values()) keys = set(summarised_ram_symb.keys()) | set(classified_flash_symb.keys()) for k in sorted(keys): print(f"{k} & {summarised_flash_symb[k]} & {round(100*summarised_flash_symb[k]/total_flash_symb, 1)} & {summarised_ram_symb[k]} & {round(100*summarised_ram_symb[k]/total_ram_symb, 1)} \\\\") print("\\midrule") print(f"Total Used & {total_flash_symb} & 100 & {total_ram_symb} & 100 \\\\") print() config = [ ('Certificates', 'PUBLIC_KEYSTORE_SIZE', 12, 'public_keys_memb'), ('Stereotypes', 'MAX_NUM_STEREOTYPES', 5, 'stereotypes_memb'), ('Edges', 'NUM_EDGE_RESOURCES', 4, 'edge_resources_memb'), ('Edge Capabilities', 'NUM_EDGE_CAPABILITIES', 3 * 4, 'edge_capabilities_memb'), ('Peers', 'NUM_PEERS', 8, 'peers_memb'), ('Peer Edges', 'NUM_PEERS', 8 * 4, 'peer_edges_memb'), ('Peer Edge Capabilities', 'NUM_PEERS', 8 * 4 * 3, 'peer_capabilities_memb'), None, ('Reputation Tx Buffer', 'TRUST_TX_SIZE', 2, 'trust_tx_memb'), ('Reputation Rx Buffer', 'TRUST_RX_SIZE', 2, 'trust_rx_memb'), None, ('Sign Buffer', 'MESSAGES_TO_SIGN_SIZE', 3, 'messages_to_sign_memb'), ('Verify Buffer', 'MESSAGES_TO_VERIFY_SIZE', 3, 'messages_to_verify_memb'), ] for conf in config: if conf is None: print("\\midrule") continue (nice_name, cname, num, vname) = conf try: [symb] = [x for x in ram_symb if x.name == vname + "_memb_mem"] size = symb.size print(f"{nice_name} & {num} & {int(size/num)} & {size} \\\\ % {vname}") except ValueError: print(f"Missing {vname}")
StarcoderdataPython
1689462
import re from markdown.extensions import Extension from markdown.preprocessors import Preprocessor class TableIncrementPreprocessor(Preprocessor): def run(self, lines): num = 1 new_lines = [] for line in lines: new_line = line match = re.match(r"\|\s*(1\.)\s*\|", line) if match: new_line = line.replace(match.group(), "| %d |" % num) num += 1 else: num = 1 new_lines.append(new_line) return new_lines # 匹配md表格语法中| 1. |部分为自增序列 class TableIncrementExtension(Extension): def extendMarkdown(self, md): md.preprocessors.register(TableIncrementPreprocessor(md), "table_increment", 0) def makeExtension(**kwargs): return TableIncrementExtension(**kwargs)
StarcoderdataPython
3215463
# -*- coding: utf-8 -*- # File: optimizer.py from contextlib import contextmanager import tensorflow as tf from ..tfutils.common import get_tf_version_tuple from ..compat import tfv1 from ..utils.develop import HIDE_DOC from .gradproc import FilterNoneGrad, GradientProcessor __all__ = ['apply_grad_processors', 'ProxyOptimizer', 'PostProcessOptimizer', 'VariableAssignmentOptimizer', 'AccumGradOptimizer'] class ProxyOptimizer(tfv1.train.Optimizer): """ A transparent proxy which delegates all methods of :class:`tf.train.Optimizer` """ def __init__(self, opt, name='ProxyOptimizer'): assert isinstance(opt, tfv1.train.Optimizer), opt super(ProxyOptimizer, self).__init__(False, name) self._opt = opt @HIDE_DOC def compute_gradients(self, *args, **kwargs): return self._opt.compute_gradients(*args, **kwargs) @HIDE_DOC def get_slot(self, *args, **kwargs): return self._opt.get_slot(*args, **kwargs) @HIDE_DOC def get_slot_names(self, *args, **kwargs): return self._opt.get_slot_names(*args, **kwargs) @HIDE_DOC def apply_gradients(self, *args, **kwargs): return self._opt.apply_gradients(*args, **kwargs) def apply_grad_processors(opt, gradprocs): """ Wrapper around optimizers to apply gradient processors. Args: opt (tf.train.Optimizer): gradprocs (list[GradientProcessor]): gradient processors to add to the optimizer. Returns: a :class:`tf.train.Optimizer` instance which runs the gradient processors before updating the variables. """ assert isinstance(gradprocs, (list, tuple)), gradprocs for gp in gradprocs: assert isinstance(gp, GradientProcessor), gp class _ApplyGradientProcessor(ProxyOptimizer): def __init__(self, opt, gradprocs): self._gradprocs = gradprocs[:] super(_ApplyGradientProcessor, self).__init__(opt) def apply_gradients(self, grads_and_vars, global_step=None, name=None): g = self._apply(grads_and_vars) return self._opt.apply_gradients(g, global_step, name) def _apply(self, g): for proc in self._gradprocs: g = proc.process(g) return g return _ApplyGradientProcessor(opt, gradprocs) class PostProcessOptimizer(ProxyOptimizer): """ An optimizer which applies some "post-processing operation" per variable (e.g. clipping, quantization) after the gradient update. """ def __init__(self, opt, func, colocate=True): """ Args: opt (tf.train.Optimizer): func (tf.Variable -> tf.Operation or None): the operation needed to perform for this variable after the gradient update. colocate (boolean): colocate the function with the variable. No effect since TF 1.13. """ super(PostProcessOptimizer, self).__init__(opt) self._func = func self._colocate = colocate @HIDE_DOC def apply_gradients(self, grads_and_vars, global_step=None, name=None): update_op = super(PostProcessOptimizer, self).apply_gradients( grads_and_vars, global_step) ops = [] with tf.control_dependencies([update_op]): for _, var in grads_and_vars: with self._maybe_colocate(var): op = self._func(var) if op is not None: assert isinstance(op, tf.Operation), op ops.append(op) update_op = tf.group(update_op, *ops, name=name) return update_op @contextmanager def _maybe_colocate(self, var): G = tf.get_default_graph() if self._colocate and get_tf_version_tuple() <= (1, 12): with G.colocate_with(var): yield else: yield class VariableAssignmentOptimizer(PostProcessOptimizer): """ An optimizer which assigns each variable a new value (e.g. clipping, quantization) after the gradient update. """ def __init__(self, opt, func): """ Args: opt (tf.train.Optimizer): func (tf.Variable -> tf.Tensor or None): the new value to be assigned to this variable after the gradient update. """ def f(v): t = func(v) if t is None: return t return tf.assign(v, t, use_locking=False).op super(VariableAssignmentOptimizer, self).__init__(opt, f) class AccumGradOptimizer(ProxyOptimizer): """ An optimizer which accumulates gradients across :math:`k` :meth:`minimize` executions, and apply them together in every :math:`k` th :meth:`minimize` execution. This is roughly the same as using a :math:`k` times larger batch size plus a :math:`k` times larger learning rate, but uses much less memory. This optimizer can be used in any TensorFlow code (with or without tensorpack). Example: .. code-block:: python from tensorpack.tfutils.optimizer import AccumGradOptimizer myopt = tf.train.GradientDescentOptimizer(0.01) myopt = AccumGradOptimizer(myopt, niter=5) train_op = myopt.minimize(loss) """ def __init__(self, opt, niter): """ Args: opt (tf.train.Optimizer): the underlying sub-optimizer. niter (int): number of iterations to accumulate gradients. """ super(AccumGradOptimizer, self).__init__(opt, 'AccumGrad') self._niter = int(niter) def _create_accum_slots(self, var_list): slots = [] for v in var_list: # TODO an option to not colocate the accumulators with variables (to save more memory) s = self._zeros_slot(v, "accum", self._name) slots.append(s) return slots @HIDE_DOC def apply_gradients(self, grads_and_vars, global_step=None, name=None): grads_and_vars = FilterNoneGrad().process(grads_and_vars) vs = [] for g, v in grads_and_vars: assert isinstance(g, (tf.Tensor, tf.IndexedSlices)) and isinstance(v, tf.Variable), \ "AccumGradOptimizer does not work for the gradient of {}! " \ "Types of v and g are {} and {}".format(v.op.name, type(v), type(g)) vs.append(v) with tf.control_dependencies(None): slots = self._create_accum_slots(vs) slots_and_vars = [(s, gv[1]) for s, gv in zip(slots, grads_and_vars)] with tf.variable_scope(self._name), tf.device('/cpu:0'): counter = tf.Variable( 0, name="counter", trainable=False, dtype=tf.int32) with tf.name_scope('AccumGradOptimizer'): ops = [] for s, gv in zip(slots, grads_and_vars): g, v = gv ops.append(s.assign_add(g)) update_counter = tf.assign_add(counter, 1, name='update_counter') update_slot_op = tf.group(update_counter, *ops, name='update_slot') def update_grad(): update_op = self._opt.apply_gradients(slots_and_vars) with tf.control_dependencies([update_op]): clear_ops = [tf.assign(s, tf.zeros_like(s)) for s in slots] return tf.group(*clear_ops, name='update_grad') pred = tf.equal(tf.mod(counter, self._niter), 0) with tf.control_dependencies([update_slot_op]): if name is None: name = 'cond_update_grad' op = tf.cond(pred, update_grad, tf.no_op) if global_step is not None: # Tensorpack maintains global_step by other means, # so this option is useless in tensorpack trainers. # But we include the implementation here for completeness global_step_increment = tf.assign_add(global_step, 1) op = tf.group(op, global_step_increment, name=name) else: op = tf.identity(op, name=name).op return op if __name__ == '__main__': # run it with "python -m tensorpack.tfutils.optimizer" x = tf.get_variable('x', shape=[6]) cost = tf.reduce_sum(tf.abs(x), name='cost') opt = tf.train.GradientDescentOptimizer(0.01) opt = AccumGradOptimizer(opt, 5) min_op = opt.minimize(cost, global_step=tf.train.get_or_create_global_step()) sess = tf.Session() sess.run(tf.global_variables_initializer()) with sess.as_default(): for _ in range(20): min_op.run() print(x.eval()) print(tf.train.get_or_create_global_step().eval())
StarcoderdataPython
4834792
#!/usr/bin/env python from setuptools import setup, find_packages import provider setup( name='edx-django-oauth2-provider', version=provider.__version__, description='edX fork of django-oauth2-provider', long_description=open('README.rst').read(), author='edX', author_email='<EMAIL>', url='https://github.com/edx/django-oauth2-provider', packages=find_packages(exclude=('tests*',)), classifiers=[ 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', ], install_requires=['shortuuid>=0.4.3,<1.0.0', 'Django>=1.7,<2.1'], include_package_data=True, zip_safe=False, )
StarcoderdataPython
78593
<gh_stars>0 # coding: utf-8 # ##### <h1>BroBeurKids Nikola</h1> # # This script deals with creating data for BroBeurKids/wcmckee Nikola site. # # The directory to look at is brobeurkidsdotcom/posts # or folder # # wcmckee.com /posts # # /github folders are scanned with the input for folders. # It's basically a search for notebook, then turn notebook into a blog posts. # # Arrow is used to generate the date (YR/MONTH/DAY), # and time(HR : MIN: SEC) # # This is where ipynb files are kept. # # This script generates the .meta files needed. # # The meta file is called the same as the ipynb. It also contains the slug and title, and date. # The date is collected by looking at the save date of the ipynb. # # Create preconfig files. A posts folder that one item is published. # Depending on prepost folder deturms the post folder it's moved to. # Sequale and post certain times a day. # This script creates a blog post and saves it in posts folder along with the .meta file for it. # Config file for the script. Specify a list of blog names. # Reads a json file that contains: blog name (school name), author (input username), twitter config dir, domain name (school name - space and crap), # # Do login/logout via blog post. # # Title should accept spaces - slug should be edited to remove space and replace with - # In[1]: import os import getpass from walkdir import filtered_walk, dir_paths, all_paths, file_paths import arrow #import nikola #from TwitterFollowBot import TwitterBot # In[2]: raw = arrow.utcnow() # In[3]: def returntime(): return raw.strftime('%H:%M:%S') # In[4]: yraw = raw.strftime("%Y") mntaw = raw.strftime("%m") dytaw = raw.strftime("%d") #gmtz.strftime("%Y") # In[5]: fulda = yraw + '/' + mntaw + '/' + dytaw # In[6]: fultim = fulda + ' ' + returntime() # In[7]: #fultim # In[8]: #gtur = getpass.getuser() # In[9]: #lisbbkn = os.listdir('/home/' + gtur + '/brobeurkidsdotcom/posts') # In[10]: #lisbbkn # In[11]: #for lisb in lisbbkn: # if '.ipynb' in lisb: # print lisb # In[12]: #Name of notebook you want to turn into a blog #Could check the folder (walkdir) for files not #in the wcmckee.com posts folder. #Tags. Modules used. #Look at the file and extract out modules imported, #using these as tags. # In[13]: podir = input('blog dir: ') # In[14]: nbog = input('Name of file to blog: ') # In[15]: etnam = input('Extension of file to blog: ') # In[16]: tagmak = input('post tags: ') # In[17]: #pear = input('path to search: ') # In[18]: jsve = dict() # In[19]: nbog + etnam # In[21]: #Write the blog post #Ask to write content or publish writecont = input('Write content? y/N ') if 'y' in writecont: contenmak = input('content: ') else: #search or manually locate fil. pear = input('path to search: y/N') if 'y' in pear: files = file_paths(filtered_walk(pear, depth=100, included_files=[nbog + etnam])) for fil in files: print (fil) jsve.update({'filefound' : fil}) else: patlim = input('path of file: ') jsve.update({'filefound' : patlim + nbog + etnam}) # In[22]: #fil # In[23]: #add extra tags in # In[24]: jsve # In[25]: #lastbit = contenmak[:50] # In[26]: #contenmak[-50:] # In[27]: #sampb = lastbit + '... ' + contenmak[-50:] # In[28]: #sampb # In[ ]: # In[29]: #savewhere = input('dir to save post: ') # In[30]: my_list = tagmak.split(",") # In[31]: my_list # In[32]: hashtag = list() # In[33]: for myl in my_list: #print ('#' + myl.replace(' ', '')) hashtag.append(('#' + myl.replace(' ', ''))) # In[34]: #bro_bot = TwitterBot('/home/wcmckee/wcmnot/wcmckee-notebook/config.txt') #bro_ot = TwitterBot(podir + '/config.txt') # In[35]: #for has in hashtag: # print (has) # bro_bot.auto_follow(has, count=1) # In[36]: endstring = '' for s in hashtag: endstring += s + ' ' # In[37]: endstring # In[ ]: # In[38]: jsve.update({'filename' : nbog + etnam, 'tags' : tagmak, 'date' : fulda, 'time' : returntime()}) # In[39]: #jsve.update({}) # In[40]: jsve # In[41]: #Search for blog through folders. # In[42]: #files = file_paths(filtered_walk(pear, depth=100, included_files=[nbog + etnam])) # In[43]: #print files # In[44]: #for fil in files: # print (fil) # jsve.update({'filefound' : fil}) # In[45]: #jsve['filefound'] # In[46]: #opblog = ('/home/wcmckee/github/') # In[47]: #podir = ('/home/wcmckee/github/wcmckee.com/posts/') # In[48]: jsve.update({'blogdir' : podir}) # In[49]: postsdir = podir + ('/posts/' ) # In[50]: #os.system('cp ' + jsve['filefound'] + ' ' + postsdir) # In[51]: #for fie in files: #print fie #print (fie) #print ('Copy ' + fie + ' to ' + postsdir) #os.system('cp ' + fie + ' ' + postsdir) # In[52]: jsve # In[ ]: # In[53]: os.system('cp ' + jsve['filefound'] + ' ' + postsdir) # In[54]: if 'y' in writecont: oprst = open(podir + '/posts/' + nbog + etnam, 'w') oprst.write(contenmak) oprst.close() else: os.system('cp ' + jsve['filefound'] + ' ' + postsdir) # In[55]: opeza = open(podir + '/posts/' + nbog + '.meta', 'w') opeza.write(nbog + '\n' + nbog + '\n' + fultim + '\n' + tagmak) opeza.close() # In[134]: #print (podir + '/posts/' + nbog + '.meta') # In[135]: #os.chdir(podir) #os.system('nikola build') # In[136]: #os.system('rsync -azP ' + postsdir + ' ' + '<EMAIL>:/home/wcmckee/bb/blog/posts') # In[137]: #bro_bot.search_tweets(ndstring) # In[138]: #bro_bot.send_tweet(nbog + ' ' + endstring + ' http://brobeur.com/blog/output/posts/' + nbog + '.html') # In[ ]: # In[ ]: # In[ ]:
StarcoderdataPython
1729604
from src.scenario.scenario_generator import ScenarioGenerator from src.executors.exact.solve_opf import solve from src.scenario.scenario import Scenario from src.grid.grid import Grid import numpy as np class GridEnv: def __init__(self, grid: Grid, scenario: Scenario, scenario_generator: ScenarioGenerator, tee: bool = False): """ Environment clas. Combines the DC grid with the information about EVs and power price. grid: DC grid scenario: scenario specifying EVs and power price scenario_generator: ScenarioGenerator object, contains information about all EV and power price related distributions """ self.grid = grid self.scenario = scenario self.scenario_generator = scenario_generator self.tee = tee self.t_start_ind = 0 self.t_end_ind = scenario.t_end_ind self.timesteps_hr = scenario.timesteps_hr self.t_ind = 0 self.ptu_size_hr = scenario.ptu_size_hr self.V_nodes = np.empty((self.grid.n_nodes, self.timesteps_hr.shape[0])) self.P_nodes = np.empty((self.grid.n_nodes, self.timesteps_hr.shape[0])) self.I_nodes = np.empty((self.grid.n_nodes, self.timesteps_hr.shape[0])) self.I_lines = np.empty((self.grid.n_lines, self.timesteps_hr.shape[0])) self.SOC_evs = np.nan * np.ones((len(self.scenario.evs), self.timesteps_hr.shape[0])) @property def t_hr(self): return self.timesteps_hr[self.t_ind] @property def finished(self): return self.t_ind > self.t_end_ind @property def current_SOC(self): return np.minimum([ev.soc_max for ev in self.scenario.evs], np.maximum(0, self.SOC_evs[:, self.t_ind])) def reset(self, ): V_nodes, P_nodes, I_nodes, I_lines = self.grid.get_init_state() self.grid.apply_state(V_nodes, P_nodes, I_nodes, I_lines) utility_coefs = np.zeros(self.grid.n_nodes) for load_ind in self.grid.load_inds: utility_coefs[load_ind] = 100 for gen_ind in self.grid.gen_inds: utility_coefs[gen_ind] = 1 self.grid.update_demand_and_price(np.zeros(self.grid.n_nodes), np.zeros(self.grid.n_nodes), utility_coefs) self.t_ind = 0 self.V_nodes = np.empty((self.grid.n_nodes, self.timesteps_hr.shape[0])) self.P_nodes = np.empty((self.grid.n_nodes, self.timesteps_hr.shape[0])) self.I_nodes = np.empty((self.grid.n_nodes, self.timesteps_hr.shape[0])) self.I_lines = np.empty((self.grid.n_lines, self.timesteps_hr.shape[0])) self.SOC_evs = np.zeros((len(self.scenario.evs), self.timesteps_hr.shape[0])) for ev_ind, ev in enumerate(self.scenario.evs): if self.t_hr == ev.t_arr_hr: self.SOC_evs[ev_ind, self.t_ind] = ev.soc_arr def step(self, p_demand_min, p_demand_max, utility_coefs, normalize_opf=False): #print('Stepping:', p_demand_min.round(2), '\n', p_demand_max.round(2)) for load_ind in self.grid.load_inds: ev_at_t_at_load = self.scenario.load_evs_presence[load_ind][self.t_ind] active_evs_at_t_at_node = [ev for ev in ev_at_t_at_load if ev.t_dep_hr > self.t_hr] if len(active_evs_at_t_at_node) > 0: ev = active_evs_at_t_at_node[0] ev_ind = self.scenario.evs.index(ev) load_p_max = (ev.soc_max - self.SOC_evs[ev_ind, self.t_ind]) / self.scenario.ptu_size_hr p_demand_max[load_ind] = min(load_p_max, p_demand_max[load_ind]) p_demand_max[p_demand_max < p_demand_min] = p_demand_min[p_demand_max < p_demand_min] + 1e-10 self.grid.update_demand_and_price(p_demand_min-1e-8, p_demand_max + 1e-8, utility_coefs) #print('After corrections:', p_demand_min.round(2), '\n', p_demand_max.round(2)) # self.tee = True #print('LB', p_demand_min) #print('UB', p_demand_max) loads_p_demand_min = p_demand_min[self.grid.load_inds] loads_p_demand_max = p_demand_max[self.grid.load_inds] if loads_p_demand_min.max() == loads_p_demand_max.max() == 0: model = None V_nodes = np.array(([n.v_nominal for n in self.grid.nodes])) P_nodes = np.zeros(self.grid.n_nodes) I_nodes = np.zeros(self.grid.n_nodes) I_lines = np.zeros(self.grid.n_lines) else: model, V_nodes, P_nodes, I_nodes, I_lines = solve(self.grid, tee=self.tee, normalize=normalize_opf) self.grid.apply_state(V_nodes, P_nodes, I_nodes, I_lines) self.V_nodes[:, self.t_ind] = np.copy(V_nodes) self.P_nodes[:, self.t_ind] = np.copy(P_nodes) self.I_nodes[:, self.t_ind] = np.copy(I_nodes) self.I_lines[:, self.t_ind] = np.copy(I_lines) self.t_ind += 1 if not self.finished: for ev_ind, ev in enumerate(self.scenario.evs): if self.t_hr == ev.t_arr_hr: self.SOC_evs[ev_ind, self.t_ind] = ev.soc_arr elif ev.t_arr_hr < self.t_hr <= ev.t_dep_hr: old_soc = self.SOC_evs[ev_ind, self.t_ind - 1] new_soc = old_soc + self.ptu_size_hr * self.P_nodes[ev.load_ind, self.t_ind - 1] self.SOC_evs[ev_ind, self.t_ind] = np.copy(new_soc) def observe_scenario(self, know_future=False): if know_future: return self.scenario else: return self.scenario.create_scenario_unknown_future(self.t_ind) def get_cost_coefs(self): utility_coefs = np.zeros(self.grid.n_nodes) utility_coefs[self.grid.gen_inds] = self.scenario.power_price[self.t_ind] for load_ind in self.grid.load_inds: ev_at_t_at_load = self.scenario.load_evs_presence[load_ind][self.t_ind] active_evs_at_t_at_node = [ev for ev in ev_at_t_at_load if ev.t_dep_hr > self.t_hr] if len(active_evs_at_t_at_node) > 0: assert len(active_evs_at_t_at_node) == 1, "More than 1 EV at load %d" % load_ind ev = active_evs_at_t_at_node[0] utility_coefs[load_ind] = ev.utility_coef return utility_coefs def generate_possible_futures(self, n_scenarios): return self.scenario_generator.generate(self.grid.n_loads, n_scenarios, self.t_ind, self.scenario.get_evs_known_at_t_ind(self.t_ind))
StarcoderdataPython
1634466
#!/usr/bin/env python # -*- coding: UTF-8 -*- import numpy as np def detect_bursts(spikes, dt): """Returns the indices of the first spikes of burst-groups, all bursts and the indices of the previous spike of each burst. The time that determines the duration of each spike is empirically predefined. Args: spikes (numpy array of int): indices of spikes. dt (float): time-step. Returns: (list, list, list): lists containing the indices of the first spikes of (1) burst-groups, (2) all bursts and (3) the indices of the previous spike of each burst. """ b = 0.007/dt # 0.007 sec maximum time between spikes in a burst b_group = 0.05/dt # 0.05 sec maximum time between spikes in a burst-group bursts_all = [spikes[0]] # set first burst to the first spike burst_groups = [spikes[0]] # set first burst to the first spike previous_spike = spikes[0] # index of the previous spike pre_burst_spikes = [0] # set index of first spike before a burst for spike in spikes[1:]: # Find beginning of a burst if spike-previous_spike > b: bursts_all.append(spike) pre_burst_spikes.append(int(previous_spike/dt)) # Find beginning of a burst-group if spike-previous_spike > b_group: burst_groups.append(spike) previous_spike = spike return burst_groups, bursts_all, pre_burst_spikes if __name__ == "__main__": import params as pms import simulation import plots import matplotlib.pyplot as plt from brian2 import second lif_state_monitor, lif_spike_monitor, epsp_monitor, ipsp_monitor = simulation.execute( pms.Vth, pms.Vreset, pms.Vrest, 0, pms.refract, pms.dur, pms.tau, pms.tau_syn_ex, pms.tau_syn_in, pms.xs_on_ex, pms.ys_on_ex, pms.xs_off_ex, pms.ys_off_ex, pms.xs_on_inh, pms.ys_on_inh, pms.xs_off_inh, pms.ys_off_inh, pms.X, pms.Y, pms.lx, pms.dx, pms.ly, pms.dy, pms.sigma_center, pms.sigma_surround, pms.stimulus, pms.t, pms.we, pms.wi, pms.num_rfc, pms.r0, pms.L0, pms.G_ex, pms.G_inh) burst_groups, bursts_all, pre_burst_spikes = detect_bursts( ((lif_spike_monitor.spike_trains()[0]/pms.dt)/second).astype(int), pms.dt) plots.plot_bursts(lif_state_monitor, bursts_all, burst_groups, pms.dt) plt.show()
StarcoderdataPython
1642696
import re from .time import times_to_ms from .formatbase import FormatBase from .ssaevent import SSAEvent # thanks to http://otsaloma.io/gaupol/doc/api/aeidon.files.mpl2_source.html MPL2_FORMAT = re.compile(r"^(?um)\[(-?\d+)\]\[(-?\d+)\](.*)") class MPL2Format(FormatBase): """MPL2 subtitle format implementation""" @classmethod def guess_format(cls, text): """See :meth:`pysubs2.formats.FormatBase.guess_format()`""" if MPL2_FORMAT.search(text): return "mpl2" @classmethod def from_file(cls, subs, fp, format_, **kwargs): """See :meth:`pysubs2.formats.FormatBase.from_file()`""" def prepare_text(lines): out = [] for s in lines.split("|"): s = s.strip() if s.startswith("/"): # line beginning with '/' is in italics s = r"{\i1}%s{\i0}" % s[1:].strip() out.append(s) return "\\N".join(out) subs.events = [SSAEvent(start=times_to_ms(s=float(start) / 10), end=times_to_ms(s=float(end) / 10), text=prepare_text(text)) for start, end, text in MPL2_FORMAT.findall(fp.getvalue())] @classmethod def to_file(cls, subs, fp, format_, **kwargs): """ See :meth:`pysubs2.formats.FormatBase.to_file()` No styling is supported at the moment. """ # TODO handle italics for line in subs: if line.is_comment: continue print("[{start}][{end}] {text}".format(start=int(line.start // 100), end=int(line.end // 100), text=line.plaintext.replace("\n", "|")), file=fp)
StarcoderdataPython
3231593
<filename>ex37.py num = int(input('Digite um numero inteiro: ')) print('''Escolha uma das bases para conversão:' [1] converter para BINÁRIO [2] converter para OCTAL [3] converter para HEXADECIMAL''') opção = int(input('Sua Opção')) if opção == 1: print('{} convertido para Binário é igual {}'.format(num, bin(num)[2:])) elif opção == 2: print('{} convertido para OCTAL é igual a {}'.format(num, oct(num)[2:])) elif opção == 3: print('{} convertido para HEXADECIMAL é igual a {}'.format(num, hex(num)[2:])) else: print('opção inválida. tente novamente.')
StarcoderdataPython
4391
<gh_stars>1-10 """ HTTP MultiServer/MultiClient for the ByteBlower Python API. All examples are guaranteed to work with Python 2.7 and above Copyright 2018, Ex<NAME>. """ # Needed for python2 / python3 print function compatibility from __future__ import print_function # import the ByteBlower module import byteblowerll.byteblower as byteblower import time configuration = { # Address (IP or FQDN) of the ByteBlower server to use 'server_address': 'byteblower-tp-1300.lab.byteblower.excentis.com', # Configuration for the first ByteBlower port. # Will be used as HTTP server. 'port_1_config': { 'interface': 'trunk-1-13', 'mac': '00:bb:01:00:00:01', # IP configuration for the ByteBlower Port. # Options are 'DHCPv4', 'DHCPv6', 'SLAAC', 'static' # if DHCPv4, use "dhcpv4" 'ip': 'dhcpv4', # if DHCPv6, use "dhcpv6" # 'ip': 'dhcpv6', # if SLAAC, use "slaac" # 'ip': 'slaac', # if staticv4, use ["ipaddress", netmask, gateway] # 'ip': ['192.168.0.2', "255.255.255.0", "192.168.0.1"], # if staticv6, use ["ipaddress", prefixlength] # 'ip': ['fd00:c2b6:b24b:be67:2827:688d:e6a1:6a3b', '64'], # TCP port number to be used by the HTTP connection. # On the HTTP server, this will be the port on which the server # listens. 'tcp_port': 4096 }, # Configuration for the second ByteBlower port. # Will be used as HTTP client. 'port_2_config': { 'interface': 'trunk-1-25', 'mac': '00:bb:01:00:00:02', # IP configuration for the ByteBlower Port. # Options are 'DHCPv4', 'DHCPv6', 'SLAAC', 'static' # if DHCPv4, use "dhcpv4" 'ip': 'dhcpv4', # if DHCPv6, use "dhcpv6" # ip': 'dhcpv6', # if SLAAC, use "slaac" # 'ip': 'slaac', # if staticv4, use ["ipaddress", netmask, gateway] # 'ip': ['192.168.0.2', "255.255.255.0", "192.168.0.1"], # if staticv6, use ["ipaddress", prefixlength] # 'ip': ['fd00:c2b6:b24b:be67:2827:688d:e6a1:6a3b', '64'], # TCP port range the HTTP Clients will use to connect with # the HTTP server 'tcp_port_min': 32000, 'tcp_port_max': 50000 }, # HTTP Method # HTTP Method can be GET or PUT # - GET: Standard HTTP download, we retrieve data from the web server # - PUT: Standard HTTP upload, the wireless endpoint will push data to the # webserver 'http_method': 'GET', # 'http_method': 'PUT', # total duration, in nanoseconds. # This is the duration of the flow. When this duration expires, # all sessions will be stopped. 'duration': 10000000000, # session duration, in nanoseconds # Duration of the individual sessions # 'session_duration': 1500000000, 'session_duration': None, # session size, in bytes # The number of bytes transmitted by a session 'session_size': 1 * 1000 * 1000, # 'session_size': None, # max concurrent sessions # Maximum number of sessions that will be running simultaneously 'max_concurrent_sessions': 100, # maximum number of sessions # No more than this number of sessions will be created # 0 means no limit 'max_total_sessions': 0, # TOS value to use on the HTTP client (and server) 'tos': 0 } class Example: def __init__(self, **kwargs): self.server_address = kwargs['server_address'] self.port_1_config = kwargs['port_1_config'] self.port_2_config = kwargs['port_2_config'] # Helper function, we can use this to parse the HTTP Method to the # enumeration used by the API from byteblowerll.byteblower import ParseHTTPRequestMethodFromString http_method_arg = kwargs['http_method'] self.http_method = ParseHTTPRequestMethodFromString(http_method_arg) self.duration = kwargs['duration'] self.session_duration = kwargs['session_duration'] self.session_size = kwargs['session_size'] self.max_concurrent_sessions = kwargs['max_concurrent_sessions'] self.max_total_sessions = kwargs['max_total_sessions'] self.tos = kwargs['tos'] self.server = None self.port_1 = None self.port_2 = None def cleanup(self): """Clean up the created objects""" byteblower_instance = byteblower.ByteBlower.InstanceGet() if self.port_1: self.server.PortDestroy(self.port_1) self.port_1 = None if self.port_2: self.server.PortDestroy(self.port_2) self.port_2 = None if self.server is not None: byteblower_instance.ServerRemove(self.server) self.server = None def run(self): byteblower_instance = byteblower.ByteBlower.InstanceGet() print("Connecting to ByteBlower server %s..." % self.server_address) self.server = byteblower_instance.ServerAdd(self.server_address) # Create the port which will be the HTTP server (port_1) print("Creating HTTP Server port") self.port_1 = self.provision_port(self.port_1_config) print("Creating HTTP Client port") # Create the port which will be the HTTP client (port_2) self.port_2 = self.provision_port(self.port_2_config) http_server_ip_address = self.port_1_config['ip_address'] # create a HTTP server http_server = self.port_1.ProtocolHttpMultiServerAdd() server_tcp_port = self.port_1_config['tcp_port'] if server_tcp_port is not None: http_server.PortSet(server_tcp_port) else: server_tcp_port = http_server.PortGet() # create a HTTP Client http_client = self.port_2.ProtocolHttpMultiClientAdd() # - remote endpoint http_client.RemoteAddressSet(http_server_ip_address) http_client.RemotePortSet(server_tcp_port) # - local endpoint http_client.LocalPortRangeSet(self.port_2_config['tcp_port_min'], self.port_2_config['tcp_port_max']) # Configure the direction. # If the HTTP Method is GET, # traffic will flow from the HTTP server to the HTTP client # If the HTTP Method is PUT, # traffic will flow from the HTTP client to the HTTP server http_client.HttpMethodSet(self.http_method) print("Server port:", self.port_1.DescriptionGet()) print("Client port:", self.port_2.DescriptionGet()) # let the HTTP server listen for requests http_server.Start() # - total duration of all sessions http_client.DurationSet(self.duration) # - how many connections can be created? http_client.CumulativeConnectionLimitSet(self.max_total_sessions) # - how many connections can be running at the same time http_client.MaximumConcurrentRequestsSet(self.max_concurrent_sessions) # - individual duration, can be size-based or time-based if self.session_duration is not None: # let the HTTP Client request a page of a specific duration # to download... http_client.SessionDurationSet(self.session_duration) elif self.session_size is not None: # let the HTTP Client request a page of a specific size... http_client.SessionSizeSet(self.session_size) else: raise ValueError("Either duration or request_size must be configured") print("Starting the HTTP client") http_client.Start() http_client_result = http_client.ResultGet() for iteration in range(10): time.sleep(1) http_client_result.Refresh() print("-" * 10) print("Iteration", iteration+1) print(" connections attempted", http_client_result.ConnectionsAttemptedGet()) print(" connections established", http_client_result.ConnectionsEstablishedGet()) print(" connections aborted", http_client_result.ConnectionsAbortedGet()) print(" connections refused", http_client_result.ConnectionsRefusedGet()) print("-" * 10) http_client.Stop() http_server.Stop() print("Stopped the HTTP client") request_status_value = http_client.StatusGet() request_status_string = byteblower.ConvertHTTPMultiClientStatusToString(request_status_value) http_client_result.Refresh() tx_bytes = http_client_result.TcpTxByteCountGet() tx_speed = http_client_result.TcpTxSpeedGet() rx_bytes = http_client_result.TcpRxByteCountGet() rx_speed = http_client_result.TcpRxSpeedGet() http_server_result = http_server.ResultGet() http_server_result.Refresh() print("Requested Duration : {} nanoseconds".format(self.duration)) print("Status : {}".format(request_status_string)) print("Client Result data : {}".format(http_client_result.DescriptionGet())) print("Server Result data : {}".format(http_server_result.DescriptionGet())) return [ self.duration, self.session_duration, self.session_size, self.max_total_sessions, self.max_concurrent_sessions, tx_bytes, rx_bytes, tx_speed, rx_speed, request_status_value ] def provision_port(self, config): port = self.server.PortCreate(config['interface']) port_l2 = port.Layer2EthIISet() port_l2.MacSet(config['mac']) ip_config = config['ip'] if not isinstance(ip_config, list): # Config is not static, DHCP or slaac if ip_config.lower() == "dhcpv4": port_l3 = port.Layer3IPv4Set() port_l3.ProtocolDhcpGet().Perform() config['ip_address'] = port_l3.IpGet() elif ip_config.lower() == "dhcpv6": port_l3 = port.Layer3IPv6Set() port_l3.ProtocolDhcpGet().Perform() config['ip_address'] = port_l3.IpDhcpGet() elif ip_config.lower() == "slaac": port_l3 = port.Layer3IPv6Set() port_l3.StatelessAutoconfiguration() config['ip_address'] = port_l3.IpStatelessGet() else: # Static configuration if len(ip_config) == 3: # IPv4 port_l3 = port.Layer3IPv4Set() port_l3.IpSet(ip_config[0]) port_l3.NetmaskSet(ip_config[1]) port_l3.GatewaySet(ip_config[2]) config['ip_address'] = port_l3.IpGet() elif len(ip_config) == 2: port_l3 = port.Layer3IPv6Set() # IPv6 address = ip_config[0] prefix_length = ip_config[1] ip = "{}/{}".format(address, prefix_length) port_l3.IpManualAdd(ip) config['ip_address'] = ip_config[0] if not isinstance(config['ip_address'], str): ip = config['ip_address'][0] if '/' in ip: config['ip_address'] = ip.split('/')[0] print("Created port", port.DescriptionGet()) return port # When this python module is called stand-alone, the run-function must be # called. This approach makes it possible to include it in a series of # examples. if __name__ == "__main__": example = Example(**configuration) try: example.run() finally: example.cleanup()
StarcoderdataPython
4809230
<reponame>Columbine21/TFR-Net<filename>trains/missingTask/__init__.py from trains.missingTask.TFR_NET import TFR_NET __all__ = ['TFR_NET']
StarcoderdataPython
3304220
<reponame>ouyangjunfei/shopyo<filename>shopyo/modules/settings/models.py from shopyoapi.init import db class Settings(db.Model): __tablename__ = "settings" setting = db.Column(db.String(100), primary_key=True) value = db.Column(db.String(100))
StarcoderdataPython
196570
import unittest import numpy as np import cal_joint_lps import data_set_4 import mix_lp def CalGamma(dataC, dataU, pD, pA, g1, g2, calc_type): rt_c, rt_u, rt_cu = cal_joint_lps.CalJointLPS(dataC, dataU, g1, g2) if calc_type == 0: res = mix_lp.MyGetMixLP2(rt_cu, pA) return res lp = rt_c + mix_lp.MyGetMixLP2(rt_u, pA) res = mix_lp.MyGetMixLP2(lp, pD) return res class CalGammaTestCase(unittest.TestCase): def test_CalGamma(self): dataC = data_set_4.dataC dataU = data_set_4.dataU # Test _calGamma_S. g1 = [0, 1] g2 = [2, 3] res = CalGamma(dataC, dataU, 0.1, 0.1, g1, g2, 0) print('_calGamma_S:') print('res with cal_type = 0 -> {:3.5f} {}'.format(res, np.exp(res))) self.assertFalse(abs(28.58330 - res) > 1e-5) res = CalGamma(dataC, dataU, 0.1, 0.1, g1, g2, 1) print('res with cal_type = 1 -> {:3.5f} {}'.format(res, np.exp(res))) self.assertFalse(abs(-0.10349 - res) > 1e-5) print('') # Test _calGamma_E. g1 = [0, 1] g2 = [3] # Exclude `2' from g2 res = CalGamma(dataC, dataU, 0.1, 0.1, g1, g2, 0) print('_calGamma_E:') print('res with cal_type = 0 -> {:3.5f} {}'.format(res, np.exp(res))) self.assertFalse(abs(30.52722 - res) > 1e-5) res = CalGamma(dataC, dataU, 0.1, 0.1, g1, g2, 1) print('res with cal_type = 1 -> {:3.5f} {}'.format(res, np.exp(res))) self.assertFalse(abs(-0.0524233 - res) > 1e-5) if __name__ == '__main__': unittest.main()
StarcoderdataPython
3331360
# Generated by Django 2.0.8 on 2018-09-19 19:53 from django.db import migrations class Migration(migrations.Migration): dependencies = [ ('electionnight', '0005_auto_20180304_1829'), ] operations = [ migrations.RemoveField( model_name='apelectionmeta', name='ballot_measure', ), migrations.RemoveField( model_name='apelectionmeta', name='election', ), migrations.DeleteModel( name='APElectionMeta', ), ]
StarcoderdataPython
1783762
# quick and simple extraction of tor nodes from directory # with insert into QRadar reference collections. # # you'll need the TorCtl python package # from https://gitweb.torproject.org/pytorctl.git/ # and you'll need to have tor installed on the same # host where this script runs. # in the config file (tor_reference_config) find common # paths for the Tor bundle on Windows or Mac. You'll # have to (un)comment and/or edit these to suit your # environment. # # author: <NAME> # edits: <NAME> import sys import subprocess import time from TorCtl import TorCtl import requests # do as I say, not as I do requests.packages.urllib3.disable_warnings() config = {} exec(open('tor_reference_config').read(), config) qradarIpAddress = config.get('qradarIP') qradarSecToken = config.get('qradarAPIToken') TASKLIST=config.get('TASKLIST') TOR_PATH=config.get('TOR_PATH') TOR_PS_NAME=config.get('TOR_PS_NAME') CONTROL_PORT=config.get('CONTROL_PORT') def download_network_view(): global VIDALIA_PATH global CONTROL_PORT global AUTH_PASS start_tor=True ps_list = subprocess.Popen(TASKLIST, stdout=subprocess.PIPE).communicate()[0] for ps in ps_list: if ps.startswith(TOR_PS_NAME): start_tor = False if start_tor: print "Initializing TOR.." subprocess.Popen([TOR_PATH]) time.sleep(20) print "starting.." # open the TOR connection conn = TorCtl.connect(controlAddr="127.0.0.1", controlPort=CONTROL_PORT) all_nodes = conn.get_network_status() print "wrapping it up." conn.close() return all_nodes def create_reference_set(name,elmType,ttl): url='https://' + qradarIpAddress + '/api/reference_data/sets' headers={'SEC': qradarSecToken, 'Version': '4.0', 'Accept': 'application/json'} data={'name': name, 'element_type': elmType, 'time_to_live': ttl, 'timeout_type': 'LAST_SEEN'} try: response=requests.get(url+'/'+name,headers=headers,verify=False) if response.status_code == 404: response=requests.post(url,headers=headers,data=data,verify=False) print('reference set ' + str(name) + ' creation HTTP status: ' + str(response.status_code)) except requests.exceptions.RequestException as exception: print(str(exception) + ', exiting.\n') def add_tor_node(set_name,ip): headers={'SEC': qradarSecToken, 'Version': '4.0', 'Accept': 'application/json'} set_url='https://' + qradarIpAddress + '/api/reference_data/sets/' + set_name set_data={'name': set_name, 'value': ip, 'source': 'tor_reference_import'} try: response=requests.post(set_url,headers=headers,data=set_data,verify=False) if response.status_code > 201: print('tor node ' + str(ip) + ' insertion HTTP status: ' + str(response.status_code)) except requests.exceptions.RequestException as exception: print(str(exception) + ', exiting.\n') def main(): # check for and create reference collections in QRadar create_reference_set('tor_exit_nodes','IP','7 days') create_reference_set('tor_guard_nodes','IP','7 days') create_reference_set('tor_intermediary_nodes','IP','7 days') # Guard, Exit guards = set() exits = set() intermediaries = set() all_nodes = download_network_view() for node in all_nodes: middle = True if "Guard" in node.flags: guards.add(node.ip) middle = False if "Exit" in node.flags: exits.add(node.ip) middle = False if (middle): intermediaries.add(node.ip) print('adding guard nodes ... ') for node in guards: add_tor_node('tor_guard_nodes',node) sys.stdout.write('.') sys.stdout.flush() print(' done.\n') print('adding exit nodes ... ') for node in exits: add_tor_node('tor_exit_nodes',node) sys.stdout.write('.') sys.stdout.flush() print(' done.\n') print('adding intermediary nodes ... ') for node in intermediaries: add_tor_node('tor_intermediary_nodes',node) sys.stdout.write('.') sys.stdout.flush() print(' done.\n') if __name__ == "__main__": main()
StarcoderdataPython
81587
import renpy import pygame import os import math import ctypes import euclid from OpenGL import GL as gl FONT_SIZE = 18 FONT = None def drawText(canvas, text, pos, color, align=-1, background=(128, 128, 128)): global FONT if FONT is None: pygame.font.init() FONT = pygame.font.Font(None, FONT_SIZE) surface = FONT.render(text, True, color, background) if align == 1: pos = (pos[0] - surface.get_width(), pos[1]) canvas.get_surface().blit(surface, pos) return surface.get_size() def drawLinesSafe(canvas, color, connect, points, width=1): #Workaround for hang if two points are the same safe = [] i = 0 while i < len(points): p = (round(points[i][0]), round(points[i][1])) safe.append(p) i2 = i + 1 while i2 < len(points): p2 = (round(points[i2][0]), round(points[i2][1])) if p != p2: break i2 += 1 i = i2 if connect and len(safe) > 0: first = safe[0] safe.append((first[0], first[1] - 1)) #Wrong by one pixel to be sure... canvas.lines(color, False, safe, width) def createTransform2d(): eye = euclid.Vector3(0, 0, 1) at = euclid.Vector3(0, 0, 0) up = euclid.Vector3(0, 1, 0) view = euclid.Matrix4.new_look_at(eye, at, up) perspective = euclid.Matrix4.new_perspective(math.radians(90), 1.0, 0.1, 10) return perspective * view def createPerspective(fov, width, height, zMin, zMax): #TODO This negates fov to flip y-axis in the framebuffer. return euclid.Matrix4.new_perspective(-math.radians(fov), width / float(height), zMin, zMax) def createPerspectiveBlender(lens, xResolution, yResolution, width, height, zMin, zMax): factor = lens / 32.0 ratio = xResolution / float(yResolution) fov = math.atan(0.5 / ratio / factor) fov = fov * 360 / math.pi return createPerspective(fov, width, height, zMin, zMax) def createPerspectiveOrtho(left, right, bottom, top, near, far): projection = [0] * 16 projection[0] = 2 / (right - left) projection[4] = 0 projection[8] = 0 projection[12] = -(right + left) / (right - left) projection[1] = 0 projection[5] = 2 / (top - bottom) projection[9] = 0 projection[13] = -(top + bottom) / (top - bottom) projection[2] = 0 projection[6] = 0 projection[10] = -2 / (far - near) projection[14] = -(far + near) / (far - near) projection[3] = 0 projection[7] = 0 projection[11] = 0 projection[15] = 1 return projection def clamp(value, small, large): return max(min(value, large), small) def interpolate(a, b, s): #Simple linear interpolation return a + s * (b - a) def interpolate2d(p1, p2, s): x = interpolate(p1[0], p2[0], s) y = interpolate(p1[1], p2[1], s) return (x, y) def interpolate3d(p1, p2, s): x = interpolate(p1[0], p2[0], s) y = interpolate(p1[1], p2[1], s) z = interpolate(p1[2], p2[2], s) return (x, y, z) def makeFloatArray(elements, count): raw = (gl.GLfloat * (len(elements) * count))() for i in range(len(elements)): v = elements[i] for x in range(count): raw[(i * count) + x] = v[x] return raw def matrixToList(m): return [m.a, m.e, m.i, m.m, m.b, m.f, m.j, m.n, m.c, m.g, m.k, m.o, m.d, m.h, m.l, m.p] def getTexParameteriv(glTex, param): result = ctypes.c_int(0) gl.glGetTexLevelParameteriv(gl.GL_TEXTURE_2D, 0, param, ctypes.byref(result)) return result.value def listFiles(): results = [] for root, dirs, files in os.walk(renpy.config.gamedir): dirs[:] = [d for d in dirs if not d[0] == "."] #Ignore dot directories for f in files: match = os.path.join(root, f).replace("\\", "/") results.append(match) results.sort() return results def scanForFiles(extension): results = [] for f in listFiles(): if f.split(".")[-1].lower() == extension.lower(): results.append(f) results.sort() return results def findFile(name): #First try fast and bundle supporting listing for f in renpy.exports.list_files(): if f.split("/")[-1] == name: return f #Scan all game directories for f in listFiles(): if f.split("/")[-1] == name: return f return None def openFile(path): return renpy.exports.file(path)
StarcoderdataPython
1701799
""" Adiabatic flame temperature and equilibrium composition for a fuel/air mixture as a function of equivalence ratio, including formation of solid carbon. """ from Cantera import * import sys ############################################################## # # Edit these parameters to change the initial temperature, the # pressure, and the phases in the mixture # ############################################################### temp = 300.0 pres = 101325.0 # phases gas = importPhase('gri30.cti') carbon = importPhase('graphite.cti') # the phases that will be included in the calculation, and their # initial moles mix_phases = [ (gas, 1.0), (carbon, 0.0) ] # gaseous fuel species fuel_species = 'CH4' # air composition air_N2_O2_ratio = 3.76 # equivalence ratio range phi_min = 0.3 phi_max = 3.5 npoints = 50 ################################################## mix = Mixture(mix_phases) nsp = mix.nSpecies() # create some arrays to hold the data phi = zeros(npoints,'d') tad = zeros(npoints,'d') xeq = zeros([nsp,npoints],'d') # find fuel, nitrogen, and oxygen indices ifuel, io2, in2 = gas.speciesIndex([fuel_species, 'O2', 'N2']) if ifuel < 0: raise "fuel species "+fuel_species+" not present!" if gas.nAtoms(fuel_species,'O') > 0 or gas.nAtoms(fuel_species,'N') > 0: raise "Error: only hydrocarbon fuels are supported." stoich_O2 = gas.nAtoms(fuel_species,'C') + 0.25*gas.nAtoms(fuel_species,'H') for i in range(npoints): phi[i] = phi_min + (phi_max - phi_min)*i/(npoints - 1) x = zeros(nsp,'d') x[ifuel] = phi[i] x[io2] = stoich_O2 x[in2] = stoich_O2*air_N2_O2_ratio # set the gas state gas.set(T = temp, P = pres, X = x) # create a mixture of 1 mole of gas, and 0 moles of solid carbon. mix = Mixture(mix_phases) mix.setTemperature(temp) mix.setPressure(pres) # equilibrate the mixture adiabatically at constant P mix.equilibrate('HP', maxsteps = 1000, err = 1.0e-6, maxiter = 200, loglevel=0) tad[i] = mix.temperature(); print 'At phi = %12.4g, Tad = %12.4g' % (phi[i],tad[i]) xeq[:,i] = mix.speciesMoles() # write output CSV file for importing into Excel csvfile = 'adiabatic.csv' f = open(csvfile,'w') writeCSV(f,['phi','T (K)']+mix.speciesNames()) for n in range(npoints): writeCSV(f,[phi[n], tad[n]]+list(xeq[:,n])) f.close() print 'output written to '+csvfile # make plots if '--plot' in sys.argv: import plotting plotting.plotEquilData(mix, phi, tad, xeq)
StarcoderdataPython
17220
<filename>src/psion/oauth2/endpoints/revocation.py from __future__ import annotations from typing import Optional from psion.oauth2.exceptions import InvalidClient, OAuth2Error, UnsupportedTokenType from psion.oauth2.models import JSONResponse, Request from .base import BaseEndpoint class RevocationEndpoint(BaseEndpoint): """ Endpoint used by the `Client` to revoke a token in its possession. If the Client succeeds to authenticate but provides a token that was not issued to itself, the `Provider` **DOES NOT** revoke the token, since the Client is not authorized to operate the token. If the token is already invalid, does not exist within the Provider or is otherwise unknown or invalid, it is also considered "revoked". :cvar `__authentication_methods__`: Allowed Client Authentication methods. :cvar `__supported_tokens__`: Token types supported by the endpoint. """ __endpoint__: str = "revocation" __authentication_methods__: list[str] = None __supported_tokens__: list[str] = ["access_token", "refresh_token"] async def __call__(self, request: Request) -> JSONResponse: """ Revokes a previously issued Token. First it validates the `Revocation Request` of the `Client` by making sure the required parameter "token" is present, and that the `Client` can authenticate with the allowed authentication methods. From the specification at `<https://www.rfc-editor.org/rfc/rfc7009.html#section-2.1>`_:: The client constructs the request by including the following parameters using the "application/x-www-form-urlencoded" format in the HTTP request entity-body: token REQUIRED. The token that the client wants to get revoked. token_type_hint OPTIONAL. A hint about the type of the token submitted for revocation. Clients MAY pass this parameter in order to help the authorization server to optimize the token lookup. If the server is unable to locate the token using the given hint, it MUST extend its search across all of its supported token types. An authorization server MAY ignore this parameter, particularly if it is able to detect the token type automatically. This specification defines two such values: * access_token: An access token as defined in [RFC6749], Section 1.4 * refresh_token: A refresh token as defined in [RFC6749], Section 1.5 Specific implementations, profiles, and extensions of this specification MAY define other values for this parameter using the registry defined in Section 4.1.2. For example, a client may request the revocation of a refresh token with the following request: POST /revoke HTTP/1.1 Host: server.example.com Content-Type: application/x-www-form-urlencoded Authorization: Basic czZCaGRSa3F0MzpnWDFmQmF0M2JW token=<PASSWORD>&token_type_hint=refresh_token It then returns an empty response with a HTTP Status 200 OK, signaling that the provided token has been revoked by the server. From the specification at `<https://www.rfc-editor.org/rfc/rfc7009.html#section-2.2>`_:: The authorization server responds with HTTP status code 200 if the token has been revoked successfully or if the client submitted an invalid token. Note: invalid tokens do not cause an error response since the client cannot handle such an error in a reasonable way. Moreover, the purpose of the revocation request, invalidating the particular token, is already achieved. The content of the response body is ignored by the client as all necessary information is conveyed in the response code. An invalid token type hint value is ignored by the authorization server and does not influence the revocation response. This endpoint does not return any errors, except when the provided `token_type_hint` is not supported by the Provider. :raises UnsupportedTokenType: The provided token_type_hint is not supported. """ try: client = await self.authenticate(request, self.__authentication_methods__) data = request.form() token: str = data.get("token") token_type_hint: Optional[str] = data.get("token_type_hint") if not token or not isinstance(token, str): return if token_type_hint: if token_type_hint not in self.__supported_tokens__: raise UnsupportedTokenType await self.adapter.revoke_token(client, token, token_type_hint) return JSONResponse() except InvalidClient as exc: return JSONResponse(401, exc.headers, exc.dump()) except OAuth2Error as exc: return JSONResponse(400, exc.headers, exc.dump())
StarcoderdataPython
97713
import inspect import logging import os import pickle import cloudpickle from quake.client.base.task import make_input, new_py_task from quake.client.job import _set_rank from quake.common.layout import Layout from quake.job.config import JobConfiguration from .glob import get_global_plan, get_inout_obj, set_inout_obj def task_runner(jctx, input_data, python_job): _set_rank(jctx.rank) return python_job.run(input_data) """ def _load(obj): if isinstance(obj, bytes): return pickle.loads(obj) if len(obj) == 1: return _load(obj[0]) return [_load(o) for o in obj] """ def collection_to_list(obj): if len(obj) > 16: return "..." else: return ",".join(obj_to_debug_string(o) for o in obj) def obj_to_debug_string(obj): if isinstance(obj, list): return "List({})[{}]".format(len(obj), collection_to_list(obj)) if isinstance(obj, tuple): return "Tuple({})[{}]".format(len(obj), collection_to_list(obj)) # if isinstance(obj, dict) and len(obj) <= 20: # return "Dict({})[{}]".format(len(obj), ",".join("{}:{}" # .format(obj_to_debug_string(k), obj_to_debug_string(v)) in k, v in obj.items())) s = repr(obj) if len(s) > 20: return str(type(obj)) else: return s logger = logging.getLogger(__name__) class PythonJob: def __init__(self, pickled_fn, task_args, task_returns, inouts, cwd): self.pickled_fn = pickled_fn self.task_args = task_args self.inouts = inouts self.cwd = cwd self.task_returns = task_returns def run(self, input_data): # kwargs = {name: pickle.loads(input_data[value]) for name, value in self.task_args.items()} kwargs = {} for name, value in self.task_args.items(): logger.info("Arg %s => %s", name, obj_to_debug_string(value)) value = replace_placeholders(value, input_data) kwargs[name] = value logger.info("Set arg %s => %s", name, obj_to_debug_string(value)) result = cloudpickle.loads(self.pickled_fn)(**kwargs) # print("RETURNING", obj_to_debug_string(result)) # print("RETURNS", self.task_returns) # print("INOUTS", self.inouts) if self.task_returns == 1: logger.info("Pickling individual output") output = [pickle.dumps(result)] else: if self.task_returns != len(result): raise Exception( "Expecting {} outputs, but got {}".format( self.task_returns, len(result) ) ) logger.info("Pickling %s outputs", len(result)) output = [pickle.dumps(r) for r in result] inouts = [pickle.dumps(kwargs[name]) for name in self.inouts] # print("RETURNING INOUTS", obj_to_debug_string(inouts)) return output + inouts # ArgConfig = collections.namedtuple("ArgConfig", "layout") class ArgConfig: def __init__(self, inout): self.inout = inout self.layout = "all_to_all" self.unwrap = True call_id_counter = 0 class WrapperConfig: def __init__(self, fn, default_keep, n_processes, n_outputs, arg_configs): self.fn = fn self.signature = inspect.signature(fn) self.default_keep = default_keep self.n_processes = n_processes self.n_outputs = n_outputs self._pickled_fn = None self.inouts = [] self.arg_configs = {} for name, value in arg_configs.items(): if isinstance(value, str): tp = value elif isinstance(value, dict): tp = value.get("type") else: raise Exception("Invalid value: '{}'".format(value)) if tp in (None, "collection_in", "in", "fileout"): inout = None elif tp == "inout": inout = len(self.inouts) self.inouts.append(name) else: raise Exception("Invalid type {}".format(tp)) self.arg_configs[name] = ArgConfig(inout) def _update_mpi_args(self, n_processes, args): self.n_processes = n_processes for name, value in args.items(): assert name.endswith("_layout") name = name[: -len("_layout")] # print("QE: MPI_ARG", name) block_length = value["block_length"] block_count = value["block_count"] stride = value["stride"] assert stride == 1 assert block_length == 1 assert block_count == n_processes config = self.arg_configs.get(name) if config is None: config = ArgConfig(False) self.arg_configs[name] = config config.layout = "scatter" config.unwrap = True def pickle_fn(self): if self._pickled_fn: return self._pickled_fn else: self._pickled_fn = cloudpickle.dumps(self.fn) return self._pickled_fn def _prepare_inputs(self, args, kwargs): # if "self" in self.signature.parameters: # binding = self.signature.bind(None, *args, **kwargs) # else: # binding = self.signature.bind(*args, **kwargs) binding = self.signature.bind(*args, **kwargs) inputs = [] args = {} for name, value in binding.arguments.items(): arg_config = self.arg_configs.get(name) if arg_config: layout = arg_config.layout unwrap = arg_config.unwrap else: layout = "all_to_all" unwrap = True args[name] = put_placeholders(value, inputs, 0, layout, unwrap) """ if inout_obj is not None: value = inout_obj if isinstance(value, ResultProxy): if arg_config: layout = arg_config.layout else: layout = "all_to_all" task_args[name] = len(inputs) inputs.append(make_input(value.task, list(range(value.n_outputs)), layout=layout)) elif isinstance(value, ResultPartProxy): if arg_config: layout = arg_config.layout else: layout = "all_to_all" task_args[name] = len(inputs) inputs.append(make_input(value.task, [value.output_id], layout=layout)) else: assert not isinstance(value, Task) if arg_config and arg_config.layout != "all_to_all": raise Exception("Non-task result is used as argument with layout") const_args[name] = value """ return inputs, args, binding def __repr__(self): return "<FunctionWrapper of '{}'>".format(self.fn.__class__.__name__) def make_task(self, *args, keep=None, returns=None, **kwargs): global call_id_counter call_id_counter += 1 call_id = call_id_counter # print("QE: [{}] CALLING {}".format(call_id, self.fn)) # traceback.print_stack() # if self.fn.__name__ == "updatePartialQoiEstimators_Task": # print(args) # xxx() if keep is None: keep = self.default_keep if returns is None: returns = self.n_outputs else: assert isinstance(returns, int) inputs, task_args, binding = self._prepare_inputs(args, kwargs) if self.n_processes != 1: assert returns == self.n_processes task_returns = 1 else: task_returns = returns cwd = os.getcwd() real_returns = task_returns + len(self.inouts) payload = PythonJob(self.pickle_fn(), task_args, task_returns, self.inouts, cwd) config = pickle.dumps(JobConfiguration(task_runner, real_returns, payload)) task = new_py_task( real_returns + len(self.inouts), self.n_processes, keep, config, inputs ) task.config["env"] = dict(os.environ) task.call_id = call_id get_global_plan().add_task(task) for i, name in enumerate(self.inouts): obj = binding.arguments[name] set_inout_obj(obj, TaskOutput(task, returns + i)) return ResultProxy(task, task_returns) def put_placeholders(obj, inputs, level=0, layout="all_to_all", unwrap=False): inout_obj = get_inout_obj(obj) if inout_obj is not None: assert level == 0 # print("%%% REPLACING", obj_to_debug_string(obj), " ---> ", inout_obj) obj = inout_obj if isinstance(obj, ResultProxy): placeholder = Placeholder(len(inputs), unwrap) inp = make_input(obj.task, list(range(obj.task_outputs)), layout=layout) inputs.append(inp) return placeholder if isinstance(obj, ResultPartProxy): assert layout == "all_to_all" placeholder = Placeholder(len(inputs), unwrap) inp = make_input( obj.task, list(range(obj.task_outputs)), layout=Layout(0, obj.output_idx, 0, 1), ) inputs.append(inp) return placeholder if isinstance(obj, TaskOutput): placeholder = Placeholder(len(inputs), unwrap) inp = make_input(obj.task, obj.output_id) inputs.append(inp) return placeholder elif isinstance(obj, list): level += 1 return [put_placeholders(o, inputs, level, "all_to_all", unwrap) for o in obj] else: return obj def _load(obj, unwrap): if isinstance(obj, bytes): return pickle.loads(obj) if unwrap and len(obj) == 1: return _load(obj[0], False) return [_load(o, False) for o in obj] def replace_placeholders(obj, inputs): if isinstance(obj, Placeholder): data = inputs[obj.index] return _load(data, obj.unwrap) elif isinstance(obj, list): return [replace_placeholders(o, inputs) for o in obj] else: return obj class Placeholder: def __init__(self, index, unwrap): self.index = index self.unwrap = unwrap class ResultProxy: __slots__ = ["task", "task_outputs", "n_outputs"] def __init__(self, task, task_outputs): self.task = task self.task_outputs = task_outputs self.n_outputs = task_outputs * task.n_workers def __len__(self): return self.n_outputs def __getitem__(self, idx): if not 0 <= idx < self.n_outputs: raise Exception( "Asked element at index {}, but there are only {} parts".format( idx, self.n_outputs ) ) return ResultPartProxy(self.task, self.task_outputs, idx) def __iter__(self): return iter( ResultPartProxy(self.task, self.task_outputs, output_id) for output_id in range(self.n_outputs) ) class ResultPartProxy: __slots__ = ["task", "task_outputs", "output_idx"] def __init__(self, task, task_outputs, output_idx): self.task = task self.task_outputs = task_outputs self.output_idx = output_idx def __repr__(self): return "<RPP task={} outputs={} idx={}>".format( self.task, self.task_outputs, self.output_idx ) class TaskOutput: __slots__ = ["task", "output_id"] def __init__(self, task, output_id): self.task = task self.output_id = output_id def __repr__(self): return "<TaskOutput task_id={} output_id={}>".format( self.task.task_id, self.output_id )
StarcoderdataPython
1733796
<filename>lib/sldr/hunspell.py #!/usr/bin/python3 class Aff: def __init__(self, filename): self.fname = filename self.parse(filename) self.pfx = {} self.sfx = {} self.sfx_cross = {} self.pfx_cross = {} def parse(self, filename): with open(filename) as inf: lines = list(inf.readlines) i = 0 while i < len(lines): l = lines[i] l = re.sub(r"#.*$", "", l) l = l.strip() if not len(l): continue w = l.split(' ') if w[0] in ("AF", "REP", "MAP", "PHONE", "BREAK", "COMPOUNDRULE", "ICONV", "OCONV"): num = int(w[1]) setattr(self, w[0].lower(), []) for j in range(num): s = re.sub(r"#.*$", "", lines[i+j+1]).strip() sw = s.plit() if sw != w[0]: raise SyntaxError("Subelement {} is not of header type {}".format(s, w[0])) getattr(self, sw[0].lower()).append(sw[1:]) elif w[0] in ('PFX', 'SFX'): # following line has syntax error "can't assign to function call" # commented out so installation won't show error # getattr(self, w[1].lower()+"_cross")=w[2].lower() num = int(w[3]) for j in range(num): s = re.sub(r"#.*$", "", lines[i+j+1]).strip() sw = s.split() if sw != w[0]: raise SyntaxError("Subelement {} is not of header type {}".format(s, w[0])) getattr(self, sw[0].lower()).setdefault(w[1].lower(), []).append(sw[1:]) elif len(w): setattr(self, w[0].lower(), w[1:]) class Word: def __init__(self, name, classes): self.word = name self.classes = classes class Dic: def __init__(self, filename, aff=None): self.fname = filename self.parse(filename, aff) self.words = {} def parse(self, filename, aff): classtype = "short" ignorechars = "" if aff is not None: numclasschar = getattr(aff, 'flag', 'short') ignorechars = getattr(aff, 'ignore', '') with open(filename) as inf: for i, l in enumerate(inf.readlines()): w = l.split() if i == 0 and len(w) == 1: try: n == int(w[0]) except ValueError: pass else: continue (d, c, _) = (w[0]+"//").split("/") matched = "".join(x for x in d.lower() if x not in ignorechars) classes = None if len(c): if classtype == "short": classes = c elif classtype == "long": classes = ["".join(x) for x in zip(s[::2], s[1::2])] elif classtype == "num": classes = c.split(",") self.words[matched] = Word(d, classes) if d == d.upper(): self.words[matched.upper()] = self.words[matched] elif d == d.title(): self.words[matched.title()] = self.words[matched] for p in w[1:]: (t, v) = p.split(":") setattr(self.words[matched], t, v) class Hunspell: def __init__(self, filename): self.aff = Aff(filename+".aff") self.dic = Dic(filename+".dic")
StarcoderdataPython
3333578
from .camera import Camera from .heartbeat import Heartbeat from .mse_motor import Motor from .mse_robot import Robot from .image import bgr8_to_jpeg from .object_detection import ObjectDetector
StarcoderdataPython
3379345
<gh_stars>0 import time import igraph as ig import agenspy.graph if __name__ == '__main__': kegg = agenspy.graph.Graph('kegg', replace=True, dbname='test') graph= ig.Graph.Read_GraphMLz('graphs/kegg.graphml.gz') print(len(graph.vs)) print(len(graph.es)) start = time.time() kegg.create_from_igraph(graph, node_label='gene', edge_label_attr='interaction', strip_attrs=True) print('--- time: %s seconds ---' %(time.time()-start)) print(kegg.nv) print(kegg.ne) kegg.commit() kegg.close()
StarcoderdataPython
9741
<filename>muse_for_anything/api/v1_api/taxonomy_items.py """Module containing the taxonomy items API endpoints of the v1 API.""" from datetime import datetime from sqlalchemy.sql.schema import Sequence from muse_for_anything.db.models.taxonomies import ( Taxonomy, TaxonomyItem, TaxonomyItemRelation, TaxonomyItemVersion, ) from marshmallow.utils import INCLUDE from flask_babel import gettext from muse_for_anything.api.util import template_url_for from typing import Any, Callable, Dict, List, Optional, Union, cast from flask.helpers import url_for from flask.views import MethodView from sqlalchemy.sql.expression import asc, desc, literal from sqlalchemy.orm.query import Query from sqlalchemy.orm import selectinload from flask_smorest import abort from http import HTTPStatus from .root import API_V1 from ..base_models import ( ApiLink, ApiResponse, ChangedApiObject, ChangedApiObjectSchema, CursorPage, CursorPageArgumentsSchema, CursorPageSchema, DynamicApiResponseSchema, NewApiObject, NewApiObjectSchema, ) from ...db.db import DB from ...db.pagination import get_page_info from ...db.models.namespace import Namespace from ...db.models.ontology_objects import OntologyObjectType, OntologyObjectTypeVersion from .models.ontology import ( TaxonomyItemRelationPostSchema, TaxonomyItemRelationSchema, TaxonomyItemSchema, TaxonomySchema, ) from .namespace_helpers import ( query_params_to_api_key, ) from .taxonomy_helpers import ( action_links_for_taxonomy_item, action_links_for_taxonomy_item_relation, create_action_link_for_taxonomy_item_relation_page, nav_links_for_taxonomy_item, nav_links_for_taxonomy_item_relation, taxonomy_item_relation_to_api_link, taxonomy_item_relation_to_api_response, taxonomy_item_relation_to_taxonomy_item_relation_data, taxonomy_item_to_api_link, taxonomy_item_to_api_response, taxonomy_item_to_taxonomy_item_data, taxonomy_to_api_response, taxonomy_to_items_links, taxonomy_to_taxonomy_data, ) @API_V1.route( "/namespaces/<string:namespace>/taxonomies/<string:taxonomy>/items/<string:taxonomy_item>/" ) class TaxonomyItemView(MethodView): """Endpoint for a single taxonomy item.""" def _check_path_params(self, namespace: str, taxonomy: str, taxonomy_item: str): if not namespace or not namespace.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested namespace id has the wrong format!"), ) if not taxonomy or not taxonomy.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy id has the wrong format!"), ) if not taxonomy_item or not taxonomy_item.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy item id has the wrong format!"), ) def _get_taxonomy_item( self, namespace: str, taxonomy: str, taxonomy_item: str ) -> TaxonomyItem: namespace_id = int(namespace) taxonomy_id = int(taxonomy) taxonomy_item_id = int(taxonomy_item) found_taxonomy_item: Optional[TaxonomyItem] = ( TaxonomyItem.query.options(selectinload(TaxonomyItem.current_ancestors)) .filter( TaxonomyItem.id == taxonomy_item_id, TaxonomyItem.taxonomy_id == taxonomy_id, ) .first() ) if ( found_taxonomy_item is None or found_taxonomy_item.taxonomy.namespace_id != namespace_id ): abort(HTTPStatus.NOT_FOUND, message=gettext("Taxonomy item not found.")) return found_taxonomy_item # is not None because abort raises exception def _check_if_taxonomy_modifiable(self, taxonomy: Taxonomy): if taxonomy.namespace.deleted_on is not None: # cannot modify deleted namespace! abort( HTTPStatus.CONFLICT, message=gettext( "Namespace is marked as deleted and cannot be modified further." ), ) if taxonomy.deleted_on is not None: # cannot modify deleted namespace! abort( HTTPStatus.CONFLICT, message=gettext( "Taxonomy is marked as deleted and cannot be modified further." ), ) def _check_if_modifiable(self, taxonomy_item: TaxonomyItem): self._check_if_taxonomy_modifiable(taxonomy=taxonomy_item.taxonomy) if taxonomy_item.deleted_on is not None: # cannot modify deleted taxonomy! abort( HTTPStatus.CONFLICT, message=gettext( "Taxonomy item is marked as deleted and cannot be modified further." ), ) @API_V1.response(DynamicApiResponseSchema(TaxonomyItemSchema())) def get(self, namespace: str, taxonomy: str, taxonomy_item: str, **kwargs: Any): """Get a single taxonomy item.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) found_taxonomy_item: TaxonomyItem = self._get_taxonomy_item( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) embedded: List[ApiResponse] = [] for relation in found_taxonomy_item.current_ancestors: embedded.append(taxonomy_item_to_api_response(relation.taxonomy_item_source)) for relation in found_taxonomy_item.current_related: embedded.append(taxonomy_item_relation_to_api_response(relation)) embedded.append(taxonomy_item_to_api_response(relation.taxonomy_item_target)) return ApiResponse( links=[ ApiLink( href=url_for( "api-v1.NamespacesView", _external=True, **{"item-count": 50}, sort="name", ), rel=("first", "page", "collection", "nav"), resource_type="ont-namespace", schema=url_for( "api-v1.ApiSchemaView", schema_id="Namespace", _external=True ), ), *nav_links_for_taxonomy_item(found_taxonomy_item), *action_links_for_taxonomy_item(found_taxonomy_item), ], embedded=embedded, data=taxonomy_item_to_taxonomy_item_data(found_taxonomy_item), ) @API_V1.arguments(TaxonomyItemSchema()) @API_V1.response(DynamicApiResponseSchema(NewApiObjectSchema())) def put(self, data, namespace: str, taxonomy: str, taxonomy_item: str): """Update a taxonomy item.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) found_taxonomy_item: TaxonomyItem = self._get_taxonomy_item( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) self._check_if_modifiable(found_taxonomy_item) taxonomy_item_version = TaxonomyItemVersion( taxonomy_item=found_taxonomy_item, version=found_taxonomy_item.current_version.version + 1, name=data["name"], description=data.get("description", ""), sort_key=data.get("sort_key", 10), ) found_taxonomy_item.current_version = taxonomy_item_version DB.session.add(found_taxonomy_item) DB.session.add(taxonomy_item_version) DB.session.commit() taxonomy_item_link = taxonomy_item_to_taxonomy_item_data(found_taxonomy_item).self taxonomy_item_data = taxonomy_item_to_api_response(found_taxonomy_item) return ApiResponse( links=[taxonomy_item_link], embedded=[taxonomy_item_data], data=ChangedApiObject( self=ApiLink( href=url_for( "api-v1.TaxonomyItemView", namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, _external=True, ), rel=( "update", "put", "ont-taxonomy-item", ), resource_type="changed", ), changed=taxonomy_item_link, ), ) @API_V1.response(DynamicApiResponseSchema(ChangedApiObjectSchema())) def post(self, namespace: str, taxonomy: str, taxonomy_item: str): # restore action """Restore a deleted taxonomy item.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) found_taxonomy_item: TaxonomyItem = self._get_taxonomy_item( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) self._check_if_taxonomy_modifiable(found_taxonomy_item.taxonomy) changed_links: List[ApiLink] = [] embedded: List[ApiResponse] = [] # only actually restore when not already restored if found_taxonomy_item.deleted_on is not None: # restore taxonomy item deleted_timestamp = found_taxonomy_item.deleted_on found_taxonomy_item.deleted_on = None # also restore relations ancestors: Sequence[TaxonomyItemRelation] = TaxonomyItemRelation.query.filter( TaxonomyItemRelation.taxonomy_item_target_id == found_taxonomy_item.id, TaxonomyItemRelation.deleted_on == deleted_timestamp, ).all() ancestor_ids = set() relation: TaxonomyItemRelation for relation in ancestors: if relation.taxonomy_item_source.deleted_on is not None: continue # do not restore relations to deleted items ancestor_ids.add(relation.taxonomy_item_source_id) relation.deleted_on = None DB.session.add(relation) def produces_circle(relation: TaxonomyItemRelation) -> bool: if relation.taxonomy_item_target_id in ancestor_ids: return True for rel in relation.taxonomy_item_target.current_related: if produces_circle(rel): return True return False children: Sequence[TaxonomyItemRelation] = TaxonomyItemRelation.query.filter( TaxonomyItemRelation.taxonomy_item_source_id == found_taxonomy_item.id, TaxonomyItemRelation.deleted_on == deleted_timestamp, ).all() for relation in children: if relation.taxonomy_item_target.deleted_on is not None: continue # do not restore relations to deleted items if produces_circle(relation): continue relation.deleted_on = None DB.session.add(relation) DB.session.add(found_taxonomy_item) DB.session.commit() # add changed items to be embedded into the response for relation in found_taxonomy_item.current_ancestors: changed_links.append(taxonomy_item_relation_to_api_link(relation)) embedded.append(taxonomy_item_relation_to_api_response(relation)) changed_links.append( taxonomy_item_to_api_link(relation.taxonomy_item_source) ) embedded.append( taxonomy_item_to_api_response(relation.taxonomy_item_source) ) for relation in found_taxonomy_item.current_related: changed_links.append(taxonomy_item_relation_to_api_link(relation)) embedded.append(taxonomy_item_relation_to_api_response(relation)) changed_links.append( taxonomy_item_to_api_link(relation.taxonomy_item_target) ) embedded.append( taxonomy_item_to_api_response(relation.taxonomy_item_target) ) taxonomy_item_link = taxonomy_item_to_taxonomy_item_data(found_taxonomy_item).self taxonomy_item_data = taxonomy_item_to_api_response(found_taxonomy_item) taxonomy_link = taxonomy_to_taxonomy_data(found_taxonomy_item.taxonomy).self taxonomy_data = taxonomy_to_api_response(found_taxonomy_item.taxonomy) return ApiResponse( links=[taxonomy_item_link, taxonomy_link, *changed_links], embedded=[taxonomy_item_data, taxonomy_data, *embedded], data=ChangedApiObject( self=ApiLink( href=url_for( "api-v1.TaxonomyItemView", namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, _external=True, ), rel=( "restore", "post", "ont-taxonomy-item", ), resource_type="changed", ), changed=taxonomy_item_link, ), ) @API_V1.response(DynamicApiResponseSchema(ChangedApiObjectSchema())) def delete(self, namespace: str, taxonomy: str, taxonomy_item: str): # restore action """Delete a taxonomy item.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) found_taxonomy_item: TaxonomyItem = self._get_taxonomy_item( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) self._check_if_taxonomy_modifiable(found_taxonomy_item.taxonomy) changed_links: List[ApiLink] = [] embedded: List[ApiResponse] = [] # only actually delete when not already deleted if found_taxonomy_item.deleted_on is None: # delete taxonomy item deleted_timestamp = datetime.utcnow() found_taxonomy_item.deleted_on = deleted_timestamp # also delete incoming and outgoing relations to remove them # from relations of existing items ancestors = found_taxonomy_item.current_ancestors for relation in found_taxonomy_item.current_ancestors: relation.deleted_on = deleted_timestamp DB.session.add(relation) related = found_taxonomy_item.current_related for relation in found_taxonomy_item.current_related: relation.deleted_on = deleted_timestamp DB.session.add(relation) DB.session.add(found_taxonomy_item) DB.session.commit() # add changed items to be embedded into the response for relation in ancestors: changed_links.append(taxonomy_item_relation_to_api_link(relation)) embedded.append(taxonomy_item_relation_to_api_response(relation)) changed_links.append( taxonomy_item_to_api_link(relation.taxonomy_item_source) ) embedded.append( taxonomy_item_to_api_response(relation.taxonomy_item_source) ) for relation in related: changed_links.append(taxonomy_item_relation_to_api_link(relation)) embedded.append(taxonomy_item_relation_to_api_response(relation)) changed_links.append( taxonomy_item_to_api_link(relation.taxonomy_item_target) ) embedded.append( taxonomy_item_to_api_response(relation.taxonomy_item_target) ) taxonomy_item_link = taxonomy_item_to_taxonomy_item_data(found_taxonomy_item).self taxonomy_item_data = taxonomy_item_to_api_response(found_taxonomy_item) taxonomy_link = taxonomy_to_taxonomy_data(found_taxonomy_item.taxonomy).self taxonomy_data = taxonomy_to_api_response(found_taxonomy_item.taxonomy) return ApiResponse( links=[taxonomy_item_link, taxonomy_link, *changed_links], embedded=[taxonomy_item_data, taxonomy_data, *embedded], data=ChangedApiObject( self=ApiLink( href=url_for( "api-v1.TaxonomyItemView", namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, _external=True, ), rel=( "delete", "ont-taxonomy-item", ), resource_type="changed", ), changed=taxonomy_item_link, ), ) @API_V1.route( "/namespaces/<string:namespace>/taxonomies/<string:taxonomy>/items/<string:taxonomy_item>/relations/" ) class TaxonomyItemRelationsView(MethodView): """Endpoint for manipulating taxonomy item relations.""" def _check_path_params(self, namespace: str, taxonomy: str, taxonomy_item: str): if not namespace or not namespace.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested namespace id has the wrong format!"), ) if not taxonomy or not taxonomy.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy id has the wrong format!"), ) if not taxonomy_item or not taxonomy_item.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy item id has the wrong format!"), ) def _get_taxonomy_item( self, namespace: str, taxonomy: str, taxonomy_item: str ) -> TaxonomyItem: namespace_id = int(namespace) taxonomy_id = int(taxonomy) taxonomy_item_id = int(taxonomy_item) found_taxonomy_item: Optional[TaxonomyItem] = TaxonomyItem.query.filter( TaxonomyItem.id == taxonomy_item_id, TaxonomyItem.taxonomy_id == taxonomy_id, ).first() if ( found_taxonomy_item is None or found_taxonomy_item.taxonomy.namespace_id != namespace_id ): abort(HTTPStatus.NOT_FOUND, message=gettext("Taxonomy item not found.")) return found_taxonomy_item # is not None because abort raises exception def _check_if_modifiable(self, taxonomy_item: TaxonomyItem): taxonomy = taxonomy_item.taxonomy if taxonomy.namespace.deleted_on is not None: # cannot modify deleted namespace! abort( HTTPStatus.CONFLICT, message=gettext( "Namespace is marked as deleted and cannot be modified further." ), ) if taxonomy.deleted_on is not None: # cannot modify deleted namespace! abort( HTTPStatus.CONFLICT, message=gettext( "Taxonomy is marked as deleted and cannot be modified further." ), ) if taxonomy_item.deleted_on is not None: # cannot modify deleted taxonomy! abort( HTTPStatus.CONFLICT, message=gettext( "Taxonomy item is marked as deleted and cannot be modified further." ), ) def _check_item_circle( self, item_target: TaxonomyItem, item_source: TaxonomyItem, original_target: Optional[TaxonomyItem] = None, ): """Check for a path from target to source which would form a circular dependency. Abort if such a path is found!""" if original_target is None: original_target = item_target relation: TaxonomyItemRelation for relation in item_target.current_related: if relation.taxonomy_item_target.deleted_on is not None: continue # exclude deleted items as targets if relation.taxonomy_item_target_id == item_source.id: abort( HTTPStatus.CONFLICT, message=gettext( "Cannot add a relation from %(target)s to %(source)s as it would create a circle!", target=original_target.name, source=item_source.name, ), ) else: self._check_item_circle( item_target=relation.taxonomy_item_target, item_source=item_source, original_target=original_target, ) @API_V1.arguments(TaxonomyItemRelationPostSchema()) @API_V1.response(DynamicApiResponseSchema(NewApiObjectSchema())) def post( self, data: Dict[str, str], namespace: str, taxonomy: str, taxonomy_item: str, ): """Create a new relation to a taxonomy item.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) if namespace != data["namespace_id"] or taxonomy != data["taxonomy_id"]: abort( HTTPStatus.BAD_REQUEST, message=gettext( "Cannot create a relation to a taxonomy item of a different taxonomy!" ), ) found_taxonomy_item = self._get_taxonomy_item( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) self._check_if_modifiable(found_taxonomy_item) found_taxonomy_item_target = self._get_taxonomy_item( namespace=namespace, taxonomy=taxonomy, taxonomy_item=data["taxonomy_item_id"] ) self._check_item_circle(found_taxonomy_item_target, found_taxonomy_item) relation = TaxonomyItemRelation( taxonomy_item_source=found_taxonomy_item, taxonomy_item_target=found_taxonomy_item_target, ) DB.session.add(relation) DB.session.commit() taxonomy_item_relation_link = ( taxonomy_item_relation_to_taxonomy_item_relation_data(relation).self ) taxonomy_item_relation_data = taxonomy_item_relation_to_api_response(relation) taxonomy_item_source_link = taxonomy_item_to_api_link(found_taxonomy_item) taxonomy_item_source_data = taxonomy_item_to_api_response(found_taxonomy_item) taxonomy_item_target_link = taxonomy_item_to_api_link(found_taxonomy_item_target) taxonomy_item_target_data = taxonomy_item_to_api_response( found_taxonomy_item_target ) self_link = create_action_link_for_taxonomy_item_relation_page( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item ) self_link.rel = (*self_link.rel, "ont-taxonomy-item-relation") self_link.resource_type = "new" return ApiResponse( links=[ taxonomy_item_relation_link, taxonomy_item_source_link, taxonomy_item_target_link, ], embedded=[ taxonomy_item_relation_data, taxonomy_item_source_data, taxonomy_item_target_data, ], data=NewApiObject( self=self_link, new=taxonomy_item_relation_link, ), ) @API_V1.route( "/namespaces/<string:namespace>/taxonomies/<string:taxonomy>/items/<string:taxonomy_item>/relations/<string:relation>/" ) class TaxonomyItemRelationView(MethodView): """Endpoint for removing taxonomy item relations.""" def _check_path_params( self, namespace: str, taxonomy: str, taxonomy_item: str, relation: str ): if not namespace or not namespace.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested namespace id has the wrong format!"), ) if not taxonomy or not taxonomy.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy id has the wrong format!"), ) if not taxonomy_item or not taxonomy_item.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy item id has the wrong format!"), ) if not relation or not relation.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext( "The requested taxonomy item relation id has the wrong format!" ), ) def _get_taxonomy_item_relation( self, namespace: str, taxonomy: str, taxonomy_item: str, relation: str ) -> TaxonomyItemRelation: namespace_id = int(namespace) taxonomy_id = int(taxonomy) taxonomy_item_id = int(taxonomy_item) relation_id = int(relation) found_taxonomy_item_relation: Optional[ TaxonomyItemRelation ] = TaxonomyItemRelation.query.filter( TaxonomyItemRelation.id == relation_id, TaxonomyItemRelation.taxonomy_item_source_id == taxonomy_item_id, ).first() if ( found_taxonomy_item_relation is None or found_taxonomy_item_relation.taxonomy_item_source.taxonomy_id != taxonomy_id or found_taxonomy_item_relation.taxonomy_item_source.taxonomy.namespace_id != namespace_id ): abort( HTTPStatus.NOT_FOUND, message=gettext("Taxonomy item relation not found.") ) return found_taxonomy_item_relation # is not None because abort raises exception def _check_if_modifiable(self, relation: TaxonomyItemRelation): taxonomy_item = relation.taxonomy_item_source taxonomy = taxonomy_item.taxonomy if taxonomy.namespace.deleted_on is not None: # cannot modify deleted namespace! abort( HTTPStatus.CONFLICT, message=gettext( "Namespace is marked as deleted and cannot be modified further." ), ) if taxonomy.deleted_on is not None: # cannot modify deleted namespace! abort( HTTPStatus.CONFLICT, message=gettext( "Taxonomy is marked as deleted and cannot be modified further." ), ) if taxonomy_item.deleted_on is not None: # cannot modify deleted taxonomy item! abort( HTTPStatus.CONFLICT, message=gettext( "Taxonomy item is marked as deleted and cannot be modified further." ), ) if relation.deleted_on is not None: # cannot modify deleted item relation! abort( HTTPStatus.CONFLICT, message=gettext( "Taxonomy item relation is marked as deleted and cannot be modified further." ), ) @API_V1.response(DynamicApiResponseSchema(TaxonomyItemRelationSchema())) def get( self, namespace: str, taxonomy: str, taxonomy_item: str, relation: str, **kwargs: Any ): """Get a single relation.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, relation=relation, ) found_relation = self._get_taxonomy_item_relation( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, relation=relation, ) return ApiResponse( links=( *nav_links_for_taxonomy_item_relation(found_relation), *action_links_for_taxonomy_item_relation(found_relation), ), data=taxonomy_item_relation_to_taxonomy_item_relation_data(found_relation), ) @API_V1.response(DynamicApiResponseSchema(ChangedApiObjectSchema())) def delete( self, namespace: str, taxonomy: str, taxonomy_item: str, relation: str, **kwargs: Any ): """Delete an existing relation.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, relation=relation, ) found_relation = self._get_taxonomy_item_relation( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, relation=relation, ) self._check_if_modifiable(found_relation) # only actually delete when not already deleted if found_relation.deleted_on is None: # delete taxonomy item relation found_relation.deleted_on = datetime.utcnow() DB.session.add(found_relation) DB.session.commit() relation_link = taxonomy_item_relation_to_taxonomy_item_relation_data( found_relation ).self relation_data = taxonomy_item_relation_to_api_response(found_relation) source_item_link = taxonomy_item_to_api_link(found_relation.taxonomy_item_source) source_item_data = taxonomy_item_to_api_response( found_relation.taxonomy_item_source ) target_item_link = taxonomy_item_to_api_link(found_relation.taxonomy_item_target) target_item_data = taxonomy_item_to_api_response( found_relation.taxonomy_item_target ) return ApiResponse( links=[relation_link, source_item_link, target_item_link], embedded=[relation_data, source_item_data, target_item_data], data=ChangedApiObject( self=ApiLink( href=url_for( "api-v1.TaxonomyItemRelationView", namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, relation=relation, _external=True, ), rel=( "delete", "ont-taxonomy-item-relation", ), resource_type="changed", ), changed=relation_link, ), ) @API_V1.route( "/namespaces/<string:namespace>/taxonomies/<string:taxonomy>/items/<string:taxonomy_item>/versions/" ) class TaxonomyItemVersionsView(MethodView): """Endpoint for all versions of a taxonomy item.""" def get(self, namespace: str, taxonomy: str, taxonomy_item: str, **kwargs: Any): """TODO.""" @API_V1.route( "/namespaces/<string:namespace>/taxonomies/<string:taxonomy>/items/<string:taxonomy_item>/versions/<string:version>/" ) class TaxonomyItemVersionView(MethodView): """Endpoint for a single version of a taxonomy item.""" def _check_path_params( self, namespace: str, taxonomy: str, taxonomy_item: str, version: str ): if not namespace or not namespace.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested namespace id has the wrong format!"), ) if not taxonomy or not taxonomy.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy id has the wrong format!"), ) if not taxonomy_item or not taxonomy_item.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext("The requested taxonomy item id has the wrong format!"), ) if not version or not version.isdigit(): abort( HTTPStatus.BAD_REQUEST, message=gettext( "The requested taxonomy item version has the wrong format!" ), ) def _get_taxonomy_item_version( self, namespace: str, taxonomy: str, taxonomy_item: str, version: str ) -> TaxonomyItemVersion: namespace_id = int(namespace) taxonomy_id = int(taxonomy) taxonomy_item_id = int(taxonomy_item) version_nr = int(version) found_taxonomy_item_version: Optional[ TaxonomyItemVersion ] = TaxonomyItemVersion.query.filter( TaxonomyItemVersion.version == version_nr, TaxonomyItemVersion.taxonomy_item_id == taxonomy_item_id, ).first() if ( found_taxonomy_item_version is None or found_taxonomy_item_version.taxonomy_item.taxonomy_id != taxonomy_id or found_taxonomy_item_version.taxonomy_item.taxonomy.namespace_id != namespace_id ): abort( HTTPStatus.NOT_FOUND, message=gettext("Taxonomy item version not found.") ) return found_taxonomy_item_version # is not None because abort raises exception @API_V1.response(DynamicApiResponseSchema(TaxonomyItemSchema())) def get( self, namespace: str, taxonomy: str, taxonomy_item: str, version: str, **kwargs: Any ): """Get a single taxonomy item version.""" self._check_path_params( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, version=version, ) found_taxonomy_item_version = self._get_taxonomy_item_version( namespace=namespace, taxonomy=taxonomy, taxonomy_item=taxonomy_item, version=version, ) return ApiResponse( links=[ ApiLink( href=url_for( "api-v1.NamespacesView", _external=True, **{"item-count": 50}, sort="name", ), rel=("first", "page", "collection", "nav"), resource_type="ont-namespace", schema=url_for( "api-v1.ApiSchemaView", schema_id="Namespace", _external=True ), ), *nav_links_for_taxonomy_item_version(found_taxonomy_item_version), *action_links_for_taxonomy_item_version(found_taxonomy_item_version), ], data=taxonomy_item_to_taxonomy_item_data(found_taxonomy_item_version), )
StarcoderdataPython
77009
# Copyright 2014 Cisco Systems, Inc. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); you may # not use this file except in compliance with the License. You may obtain # a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, WITHOUT # WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the # License for the specific language governing permissions and limitations # under the License. import mock from oslo.config import cfg import testtools from neutron.agent.common import config from neutron.common import config as base_config from neutron.common import constants as l3_constants from neutron.openstack.common import log as logging from neutron.openstack.common import uuidutils from neutron.plugins.cisco.cfg_agent import cfg_agent from neutron.tests import base _uuid = uuidutils.generate_uuid HOSTNAME = 'myhost' FAKE_ID = _uuid() LOG = logging.getLogger(__name__) def prepare_router_data(enable_snat=None, num_internal_ports=1): router_id = _uuid() ex_gw_port = {'id': _uuid(), 'network_id': _uuid(), 'fixed_ips': [{'ip_address': '192.168.127.12', 'subnet_id': _uuid()}], 'subnet': {'cidr': '172.16.17.32/24', 'gateway_ip': '172.16.17.32'}} int_ports = [] for i in range(num_internal_ports): int_ports.append({'id': _uuid(), 'network_id': _uuid(), 'admin_state_up': True, 'fixed_ips': [{'ip_address': '35.4.%s.4' % i, 'subnet_id': _uuid()}], 'mac_address': 'ca:fe:de:ad:be:ef', 'subnet': {'cidr': '35.4.%s.0/24' % i, 'gateway_ip': '35.4.%s.1' % i}}) hosting_device = {'id': _uuid(), 'host_type': 'CSR1kv', 'ip_address': '172.16.58.3', 'port': '23'} router = { 'id': router_id, l3_constants.INTERFACE_KEY: int_ports, 'routes': [], 'gw_port': ex_gw_port, 'hosting_device': hosting_device} if enable_snat is not None: router['enable_snat'] = enable_snat return router, int_ports class TestCiscoCfgAgentWIthStateReporting(base.BaseTestCase): def setUp(self): self.conf = cfg.ConfigOpts() config.register_agent_state_opts_helper(cfg.CONF) self.conf.register_opts(base_config.core_opts) self.conf.register_opts(cfg_agent.CiscoCfgAgent.OPTS) cfg.CONF.set_override('report_interval', 0, 'AGENT') super(TestCiscoCfgAgentWIthStateReporting, self).setUp() self.devmgr_plugin_api_cls_p = mock.patch( 'neutron.plugins.cisco.cfg_agent.cfg_agent.' 'CiscoDeviceManagementApi') devmgr_plugin_api_cls = self.devmgr_plugin_api_cls_p.start() self.devmgr_plugin_api = mock.Mock() devmgr_plugin_api_cls.return_value = self.devmgr_plugin_api self.devmgr_plugin_api.register_for_duty.return_value = True self.plugin_reportstate_api_cls_p = mock.patch( 'neutron.agent.rpc.PluginReportStateAPI') plugin_reportstate_api_cls = self.plugin_reportstate_api_cls_p.start() self.plugin_reportstate_api = mock.Mock() plugin_reportstate_api_cls.return_value = self.plugin_reportstate_api self.looping_call_p = mock.patch( 'neutron.openstack.common.loopingcall.FixedIntervalLoopingCall') self.looping_call_p.start() mock.patch('neutron.common.rpc.create_connection').start() def test_agent_registration_success(self): agent = cfg_agent.CiscoCfgAgentWithStateReport(HOSTNAME, self.conf) self.assertTrue(agent.devmgr_rpc.register_for_duty(agent.context)) def test_agent_registration_success_after_2_tries(self): self.devmgr_plugin_api.register_for_duty = mock.Mock( side_effect=[False, False, True]) cfg_agent.REGISTRATION_RETRY_DELAY = 0.01 agent = cfg_agent.CiscoCfgAgentWithStateReport(HOSTNAME, self.conf) self.assertEqual(agent.devmgr_rpc.register_for_duty.call_count, 3) def test_agent_registration_fail_always(self): self.devmgr_plugin_api.register_for_duty = mock.Mock( return_value=False) cfg_agent.REGISTRATION_RETRY_DELAY = 0.01 cfg_agent.MAX_REGISTRATION_ATTEMPTS = 3 with testtools.ExpectedException(SystemExit): cfg_agent.CiscoCfgAgentWithStateReport(HOSTNAME, self.conf) def test_agent_registration_no_device_mgr(self): self.devmgr_plugin_api.register_for_duty = mock.Mock( return_value=None) cfg_agent.REGISTRATION_RETRY_DELAY = 0.01 cfg_agent.MAX_REGISTRATION_ATTEMPTS = 3 with testtools.ExpectedException(SystemExit): cfg_agent.CiscoCfgAgentWithStateReport(HOSTNAME, self.conf) def test_report_state(self): agent = cfg_agent.CiscoCfgAgentWithStateReport(HOSTNAME, self.conf) agent._report_state() self.assertIn('total routers', agent.agent_state['configurations']) self.assertEqual(0, agent.agent_state[ 'configurations']['total routers']) @mock.patch('neutron.plugins.cisco.cfg_agent.' 'cfg_agent.CiscoCfgAgentWithStateReport._agent_registration') def test_report_state_attribute_error(self, agent_registration): cfg.CONF.set_override('report_interval', 1, 'AGENT') self.plugin_reportstate_api.report_state.side_effect = AttributeError agent = cfg_agent.CiscoCfgAgentWithStateReport(HOSTNAME, self.conf) agent.heartbeat = mock.Mock() agent.send_agent_report(None, None) self.assertTrue(agent.heartbeat.stop.called)
StarcoderdataPython
1010
""" Utils for creating xdelta patches. """ import logging from subprocess import check_output, CalledProcessError from shutil import copyfile from os import remove, path class PatchChecksumError(Exception): def __init__(self, message, errors): super(PatchChecksumError, self).__init__(message) class Patch: # TODO: Abstract out the need for "edited" by just copying the original # file. def __init__(self, original, filename, edited=None, xdelta_dir='.'): self.original = original self.edited = edited self.filename = filename # Need to have this absolute path for xdelta3 to be found. self.xdelta_path = path.join(xdelta_dir, 'xdelta3') # self.xdelta_path = 'xdelta3' def create(self): if self.edited is None: raise Exception cmd = [ self.xdelta_path, '-f', '-s', self.original, self.edited, self.filename, ] print(cmd) logging.info(cmd) try: check_output(cmd) except CalledProcessError as e: raise Exception(e.output) def apply(self): if not self.edited: copyfile(self.original, self.original + "_temp") self.edited = self.original self.original = self.original + "_temp" cmd = [ self.xdelta_path, '-f', '-d', '-s', self.original, self.filename, self.edited, ] logging.info(cmd) try: check_output(cmd) except CalledProcessError: raise PatchChecksumError('Target file had incorrect checksum', []) finally: if self.original.endswith('_temp'): remove(self.original)
StarcoderdataPython
3288565
<filename>src/Filter.py import sys from PyQt5 import QtCore, QtGui, QtWidgets from PyQt5.QtCore import * from PyQt5.QtWidgets import * from PyQt5.QtGui import * from scapy.all import * class EmptyDelegate(QItemDelegate): def __init__(self, parent): super(EmptyDelegate, self).__init__(parent) def createEditor(self, QWidget, QStyleOptionViewItem, QModelIndex): return None class Filter(QWidget): filter_emit = pyqtSignal(str) def __init__(self): super().__init__() self.initUI() def sizeHint(self): return QSize(500,500) def initUI(self): self.filter = { 'host': "[src or dst] host <ip>", 'port': "[src or dst] port <port>", 'proto': "[ip or ip6][src or dst] proto <protocol>", 'ether host': "ether [src or dst] host <ip>", 'net': "[src or dst] net <net>", 'gateway': "gateway <ip>", 'mask' : "net <net> mask <mask>", 'vlan': "vlan <ID>" } self.rule = '' #self.setWindowTitle("Filter") self.layout = QVBoxLayout() self.filter_table = QTableWidget(8, 3) self.filter_table.setHorizontalHeaderLabels(["名称", "格式", "过滤器"]) self.filter_table.horizontalHeader().setSectionResizeMode(QHeaderView.Stretch) self.filter_table.verticalHeader().setVisible(False) QTableWidget.resizeColumnsToContents(self.filter_table) QTableWidget.resizeRowsToContents(self.filter_table) self.filter_table.setItemDelegateForColumn(0, EmptyDelegate(self))#第0列不可编辑 self.filter_table.setItemDelegateForColumn(1, EmptyDelegate(self)) # 第1列不可编辑 for i, key in enumerate(self.filter.keys()): self.filter_table.setItem(i, 0, QTableWidgetItem(key)) self.filter_table.setItem(i, 1, QTableWidgetItem(self.filter[key])) self.ok_button = QPushButton("OK") self.cancel_button = QPushButton("Cancel") self.button_layout = QHBoxLayout() self.button_layout.addStretch(1) self.button_layout.addWidget(self.ok_button) self.button_layout.addWidget(self.cancel_button) self.temp_widget = QWidget() self.temp_widget.setLayout(self.button_layout) self.ok_button.clicked.connect(self.ok_action) self.cancel_button.clicked.connect(self.cancel_action) self.layout.addWidget(self.filter_table) self.layout.addWidget(self.temp_widget) self.setLayout(self.layout) self.setGeometry(300, 100, 900, 500) def ok_action(self): for i, key in enumerate(self.filter.keys()): try: temp_text = self.filter_table.item(i, 2).text() except: temp_text = '' if temp_text != '': self.rule += (" and " + temp_text) if self.rule != '': self.rule = self.rule[5:] self.filter_emit.emit(self.rule) #信号,这个和下面那个return_filter可以选一个,也可以都用 def cancel_action(self): self.filter_emit.emit(None) def return_filter(self): return self.rule if __name__ == "__main__": app = QApplication(sys.argv) win = Filter() win.show() sys.exit(app.exec_())
StarcoderdataPython
3398176
<reponame>0xYoan/python_cherrytree<filename>tests/test_python_cherrytree.py #!/usr/bin/env python """Tests for `python_cherrytree` package.""" import unittest from python_cherrytree import python_cherrytree class TestPython_cherrytree(unittest.TestCase): """Tests for `python_cherrytree` package.""" def setUp(self): """Set up test fixtures, if any.""" self.manager = python_cherrytree.SqlManager("./tests/CTF_template.ctb") def tearDown(self): """Tear down test fixtures, if any.""" def test_show_nodes(self): """Test show_nodes.""" self.manager.show_nodes() def test_change_node_name(self): """Test change_node_name""" self.manager.change_node_name("Test", 22) def test_add_txt(self): """Test add_txt""" self.manager.add_txt("Text", 24)
StarcoderdataPython
3260671
<reponame>hartescout/sqlite-dissect<filename>sqlite_dissect/utilities.py from binascii import hexlify from hashlib import md5 from logging import getLogger from re import compile from struct import pack from struct import unpack from sqlite_dissect.constants import ALL_ZEROS_REGEX from sqlite_dissect.constants import LOGGER_NAME from sqlite_dissect.constants import OVERFLOW_HEADER_LENGTH from sqlite_dissect.constants import BLOB_SIGNATURE_IDENTIFIER from sqlite_dissect.constants import STORAGE_CLASS from sqlite_dissect.constants import TEXT_SIGNATURE_IDENTIFIER from sqlite_dissect.exception import InvalidVarIntError """ utilities.py This script holds general utility functions for reference by the sqlite carving library. This script holds the following function(s): calculate_expected_overflow(overflow_byte_size, page_size) decode_varint(byte_array, offset) encode_varint(value) get_class_instance(class_name) get_md5_hash(string) get_record_content(serial_type, record_body, offset=0) get_serial_type_signature(serial_type) get_storage_class(serial_type) has_content(byte_array) """ def calculate_expected_overflow(overflow_byte_size, page_size): overflow_pages = 0 last_overflow_page_content_size = overflow_byte_size if overflow_byte_size > 0: while overflow_byte_size > 0: overflow_pages += 1 last_overflow_page_content_size = overflow_byte_size overflow_byte_size = overflow_byte_size - page_size + OVERFLOW_HEADER_LENGTH return overflow_pages, last_overflow_page_content_size def decode_varint(byte_array, offset=0): unsigned_integer_value = 0 varint_relative_offset = 0 for x in xrange(1, 10): varint_byte = ord(byte_array[offset + varint_relative_offset:offset + varint_relative_offset + 1]) varint_relative_offset += 1 if x == 9: unsigned_integer_value <<= 1 unsigned_integer_value |= varint_byte else: msb_set = varint_byte & 0x80 varint_byte &= 0x7f unsigned_integer_value |= varint_byte if msb_set == 0: break else: unsigned_integer_value <<= 7 signed_integer_value = unsigned_integer_value if signed_integer_value & 0x80000000 << 32: signed_integer_value -= 0x10000000000000000 return signed_integer_value, varint_relative_offset def encode_varint(value): max_allowed = 0x7fffffffffffffff min_allowed = (max_allowed + 1) - 0x10000000000000000 if value > max_allowed or value < min_allowed: log_message = "The value: {} is not able to be cast into a 64 bit signed integer for encoding." log_message = log_message.format(value) getLogger(LOGGER_NAME).error(log_message) raise InvalidVarIntError(log_message) byte_array = bytearray() value += 1 << 64 if value < 0 else 0 if value & 0xff000000 << 32: byte = value & 0xff byte_array.insert(0, pack("B", byte)) value >>= 8 for _ in xrange(8): byte_array.insert(0, pack("B", (value & 0x7f) | 0x80)) value >>= 7 else: while value: byte_array.insert(0, pack("B", (value & 0x7f) | 0x80)) value >>= 7 if len(byte_array) >= 9: log_message = "The value: {} produced a varint with a byte array of length: {} beyond the 9 bytes " \ "allowed for a varint." log_message = log_message.format(value, len(byte_array)) getLogger(LOGGER_NAME).error(log_message) raise InvalidVarIntError(log_message) byte_array[-1] &= 0x7f return byte_array def get_class_instance(class_name): if class_name.find(".") != -1: path_array = class_name.split(".") module = ".".join(path_array[:-1]) instance = __import__(module) for section in path_array[1:]: instance = getattr(instance, section) return instance else: log_message = "Class name: {} did not specify needed modules in order to initialize correctly." log_message = log_message.format(log_message) getLogger(LOGGER_NAME).error(log_message) raise ValueError(log_message) def get_md5_hash(string): md5_hash = md5() md5_hash.update(string) return md5_hash.hexdigest().upper() def get_record_content(serial_type, record_body, offset=0): # NULL if serial_type == 0: content_size = 0 value = None # 8-bit twos-complement integer elif serial_type == 1: content_size = 1 value = unpack(b">b", record_body[offset:offset + content_size])[0] # Big-endian 16-bit twos-complement integer elif serial_type == 2: content_size = 2 value = unpack(b">h", record_body[offset:offset + content_size])[0] # Big-endian 24-bit twos-complement integer elif serial_type == 3: content_size = 3 value_byte_array = '\0' + record_body[offset:offset + content_size] value = unpack(b">I", value_byte_array)[0] if value & 0x800000: value -= 0x1000000 # Big-endian 32-bit twos-complement integer elif serial_type == 4: content_size = 4 value = unpack(b">i", record_body[offset:offset + content_size])[0] # Big-endian 48-bit twos-complement integer elif serial_type == 5: content_size = 6 value_byte_array = '\0' + '\0' + record_body[offset:offset + content_size] value = unpack(b">Q", value_byte_array)[0] if value & 0x800000000000: value -= 0x1000000000000 # Big-endian 64-bit twos-complement integer elif serial_type == 6: content_size = 8 value = unpack(b">q", record_body[offset:offset + content_size])[0] # Big-endian IEEE 754-2008 64-bit floating point number elif serial_type == 7: content_size = 8 value = unpack(b">d", record_body[offset:offset + content_size])[0] # Integer constant 0 (schema format == 4) elif serial_type == 8: content_size = 0 value = 0 # Integer constant 1 (schema format == 4) elif serial_type == 9: content_size = 0 value = 1 # These values are not used/reserved and should not be found in sqlite files elif serial_type == 10 or serial_type == 11: raise Exception() # A BLOB that is (N-12)/2 bytes in length elif serial_type >= 12 and serial_type % 2 == 0: content_size = (serial_type - 12) / 2 value = record_body[offset:offset + content_size] # A string in the database encoding and is (N-13)/2 bytes in length. The nul terminator is omitted elif serial_type >= 13 and serial_type % 2 == 1: content_size = (serial_type - 13) / 2 value = record_body[offset:offset + content_size] else: log_message = "Invalid serial type: {} at offset: {} in record body: {}." log_message = log_message.format(serial_type, offset, hexlify(record_body)) getLogger(LOGGER_NAME).error(log_message) raise ValueError(log_message) return content_size, value def get_serial_type_signature(serial_type): if serial_type >= 12: if serial_type % 2 == 0: return BLOB_SIGNATURE_IDENTIFIER elif serial_type % 2 == 1: return TEXT_SIGNATURE_IDENTIFIER return serial_type def get_storage_class(serial_type): if serial_type == 0: return STORAGE_CLASS.NULL if serial_type in [1, 2, 3, 4, 5, 6, 8, 9]: return STORAGE_CLASS.INTEGER if serial_type == 7: return STORAGE_CLASS.REAL if serial_type >= 12 and serial_type % 2 == 0: return STORAGE_CLASS.BLOB if serial_type >= 13 and serial_type % 2 == 0: return STORAGE_CLASS.TEXT def has_content(byte_array): pattern = compile(ALL_ZEROS_REGEX) if pattern.match(hexlify(byte_array)): return False return True
StarcoderdataPython
1633060
<filename>instance_data/problem_instance_generator.py # MIT License # # Copyright (c) 2021 <NAME> # # Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: from problem_printer import ProblemPrinter # This script generates data for multi capacity dual arm robot assembly application # There built in assumptions are given in the paper XYZ. # In short, if an object is picked with tool it has to be put down using the same tool # Every pick task that requires suction cup, generates a camera task and a place task, and a press task (to be done in that order) # Every pick task that requires gripper, generates a place task, and a press task (to be done in that order) # Press tasks requires empty gripper, since the gripper will be used to "press" # Components are stacked sequentially on fixture 1 and fixture 2, # then the sub-assembly of fixture 1 is picked up and merged with the sub-assembly of fixture 2. # It is then picked up, and moved to output location. # To fully define a problem one needs to give the tasks, which tool they are handled with, # which order they are assembled on the two fixtures. # This is done by providing two lists of numbers. # One list represents the order of assembly of components on one fixture, # the value of each number represents which tool handled that component. # Here, we concatenate these two lists, by intersecting the two lists with a -1. # Given that 0 is gripper (G), and 1 is suction cup (1), the following string: # [G,S,-1,S,G] represents a problem, # where component 1 and 4 are picked by gripper, # and component 2 amd 3 are handled by suckion cup. # component 2 is placed atop component 1 on fixture 1, # and component 4 is placed atop component 3 on fixture 2, # (followed by the picking of sub-assembly of fixture 1, and placing it on fixture 2, as this is always the case) # Running this script will generate the problem instances of the paper XYZ durations = {} durations["template_pick_duration"] = 27 durations["template_camera_duration"] = 30 durations["template_place_duration"] = 51 durations["template_press_duration"] = 6 file_prefix = "p_" G = 0 S = 1 fixture_def = [] #4 components fixture_def.append([G,G,-1,G,G]) fixture_def.append([G,S,-1,S,G]) fixture_def.append([S,G,-1,S,G]) fixture_def.append([S,S,-1,S,S]) #5 components fixture_def.append([G,G,-1,G,G,G]) fixture_def.append([G,S,-1,S,S,G]) fixture_def.append([G,S,S,-1,S,G]) fixture_def.append([S,S,S,-1,S,S]) #6 components fixture_def.append([G,G,G,-1,G,G,G]) fixture_def.append([G,S,S,G,-1,S,G]) fixture_def.append([G,S,G,-1,S,S,G]) fixture_def.append([S,S,S,S,-1,S,S]) #7 components fixture_def.append([G,G,G,-1,G,G,G,G]) fixture_def.append([G,S,G,-1,S,G,S,G]) fixture_def.append([S,G,S,G,-1,G,S,G]) fixture_def.append([S,S,S,S,-1,S,S,S]) #8 components fixture_def.append([G,G,G,G,-1,G,G,G,G]) fixture_def.append([G,S,G,S,G,-1,S,G,S]) fixture_def.append([S,G,S,G,-1,S,G,S,G]) fixture_def.append([S,S,S,S,S,-1,S,S,S]) #9 components fixture_def.append([G,G,G,G,-1,G,G,G,G,G]) fixture_def.append([G,S,G,S,-1,G,S,G,S,G]) fixture_def.append([S,G,S,G,S,-1,G,S,G,S]) fixture_def.append([S,S,S,S,S,-1,S,S,S,S]) #10 components fixture_def.append([G,G,G,G,G,-1,G,G,G,G,G]) fixture_def.append([G,S,G,S,G,S,-1,G,S,G,S]) fixture_def.append([S,G,S,G,S,-1,G,S,G,S,G]) fixture_def.append([S,S,S,S,S,S,-1,S,S,S,S]) # Give template durations ppinstance = ProblemPrinter(fixture_def[0], 0, **durations) ppinstance.FilePrint(file_prefix) for i in range(1,len(fixture_def)): ppinstance = ProblemPrinter(fixture_def[i], i*100) print("Generating model file: ",ppinstance.FilePrint(file_prefix))
StarcoderdataPython
4833775
<gh_stars>1-10 from __future__ import unicode_literals from django.contrib import admin from django.template.defaultfilters import truncatechars from django.utils.translation import ugettext_lazy as _ from reviewboard.reviews.forms import DefaultReviewerForm, GroupForm from reviewboard.reviews.models import (Comment, DefaultReviewer, FileAttachmentComment, GeneralComment, Group, Review, ReviewRequest, ReviewRequestDraft, Screenshot, ScreenshotComment, StatusUpdate) class CommentAdmin(admin.ModelAdmin): list_display = ('truncated_text', 'review_request_id', 'first_line', 'num_lines', 'timestamp') search_fields = ['text'] list_filter = ('timestamp',) raw_id_fields = ('filediff', 'interfilediff', 'reply_to') ordering = ['-timestamp'] def review_request_id(self, obj): return obj.review.get().review_request.display_id review_request_id.short_description = _('Review request ID') def truncated_text(self, obj): return truncatechars(obj.text, 60) truncated_text.short_description = _('Comment Text') class DefaultReviewerAdmin(admin.ModelAdmin): form = DefaultReviewerForm filter_horizontal = ('repository', 'groups', 'people',) list_display = ('name', 'file_regex') raw_id_fields = ('local_site',) fieldsets = ( (_('General Information'), { 'fields': ('name', 'file_regex', 'local_site'), 'classes': ['wide'], }), (_('Reviewers'), { 'fields': ('groups', 'people'), }), (_('Repositories'), { 'description': _('<p>A default reviewer will cover all ' 'repositories, unless assigned one or more ' 'specific repositories below.</p>'), 'fields': ('repository',), }) ) class GroupAdmin(admin.ModelAdmin): form = GroupForm list_display = ('name', 'display_name', 'mailing_list', 'invite_only', 'visible') raw_id_fields = ('local_site',) fieldsets = ( (_('General Information'), { 'fields': ('name', 'display_name', 'mailing_list', 'email_list_only', 'visible'), }), (_('Access Control'), { 'fields': ('invite_only', 'users', 'local_site', 'is_default_group'), }), (_('State'), { 'fields': ('incoming_request_count', 'extra_data'), 'classes': ('collapse',), }), ) class ReviewAdmin(admin.ModelAdmin): list_display = ('review_request', 'user', 'public', 'ship_it', 'is_reply', 'timestamp') list_filter = ('public', 'timestamp') search_fields = ['review_request__summary'] raw_id_fields = ('review_request', 'user', 'base_reply_to', 'body_top_reply_to', 'body_bottom_reply_to', 'comments', 'screenshot_comments', 'file_attachment_comments', 'general_comments', 'reviewed_diffset') fieldsets = ( (_('General Information'), { 'fields': ('user', 'review_request', 'public', 'ship_it', 'body_top_rich_text', 'body_top', 'body_bottom_rich_text', 'body_bottom'), }), (_('Related Objects'), { 'fields': ('base_reply_to', 'body_top_reply_to', 'body_bottom_reply_to', 'comments', 'screenshot_comments', 'file_attachment_comments', 'general_comments'), 'classes': ('collapse',) }), (_('State'), { 'fields': ('email_message_id', 'time_emailed', 'extra_data'), 'classes': ('collapse',) }) ) class ReviewRequestAdmin(admin.ModelAdmin): list_display = ('summary', 'submitter', 'status', 'public', 'last_updated') list_filter = ('public', 'status', 'time_added', 'last_updated', 'repository') search_fields = ['summary'] raw_id_fields = ('submitter', 'diffset_history', 'screenshots', 'inactive_screenshots', 'file_attachments', 'inactive_file_attachments', 'changedescs', 'local_site', 'depends_on', 'repository') filter_horizontal = ('target_people', 'target_groups') fieldsets = ( (_('General Information'), { 'fields': ('submitter', 'public', 'status', 'summary', 'description_rich_text', 'description', 'testing_done_rich_text', 'testing_done', 'bugs_closed', 'repository', 'branch', 'depends_on', 'commit_id', 'time_added') }), (_('Reviewers'), { 'fields': ('target_people', 'target_groups'), }), (_('Related Objects'), { 'fields': ('screenshots', 'inactive_screenshots', 'file_attachments', 'inactive_file_attachments', 'changedescs', 'diffset_history', 'local_site'), 'classes': ['collapse'], }), (_('State'), { 'description': _('<p>This is advanced state that should not be ' 'modified unless something is wrong.</p>'), 'fields': ('email_message_id', 'time_emailed', 'last_review_activity_timestamp', 'shipit_count', 'issue_open_count', 'issue_resolved_count', 'issue_dropped_count', 'local_id', 'extra_data'), 'classes': ['collapse'], }), ) actions = [ 'close_submitted', 'close_discarded', 'reopen', ] def close_submitted(self, request, queryset): rows_updated = queryset.update(status=ReviewRequest.SUBMITTED) if rows_updated == 1: msg = '1 review request was closed as submitted.' else: msg = '%s review requests were closed as submitted.' % \ rows_updated self.message_user(request, msg) close_submitted.short_description = \ _("Close selected review requests as submitted") def close_discarded(self, request, queryset): rows_updated = queryset.update(status=ReviewRequest.DISCARDED) if rows_updated == 1: msg = '1 review request was closed as discarded.' else: msg = '%s review requests were closed as discarded.' % \ rows_updated self.message_user(request, msg) close_discarded.short_description = \ _("Close selected review requests as discarded") def reopen(self, request, queryset): rows_updated = queryset.update(status=ReviewRequest.PENDING_REVIEW) if rows_updated == 1: msg = '1 review request was reopened.' else: msg = '%s review requests were reopened.' % rows_updated self.message_user(request, msg) reopen.short_description = _("Reopen selected review requests") class ReviewRequestDraftAdmin(admin.ModelAdmin): list_display = ('summary', 'submitter', 'last_updated') list_filter = ('last_updated',) search_fields = ['summary'] raw_id_fields = ('review_request', 'diffset', 'screenshots', 'inactive_screenshots', 'changedesc') filter_horizontal = ('target_people', 'target_groups') fieldsets = ( (_('General Information'), { 'fields': ('review_request', 'summary', 'description_rich_text', 'description', 'testing_done_rich_text', 'testing_done', 'depends_on', 'bugs_closed', 'branch', 'commit_id'), }), (_('Reviewers'), { 'fields': ('target_people', 'target_groups'), }), (_('Related Objects'), { 'fields': ('screenshots', 'inactive_screenshots', 'changedesc', 'diffset'), 'classes': ['collapse'], }), (_('State'), { 'fields': ('extra_data',), }), ) class ScreenshotAdmin(admin.ModelAdmin): list_display = ('thumb', 'caption', 'image', 'review_request_id') list_display_links = ('thumb', 'caption') search_fields = ('caption',) def review_request_id(self, obj): return obj.review_request.get().id review_request_id.short_description = _('Review request ID') class ScreenshotCommentAdmin(admin.ModelAdmin): list_display = ('text', 'screenshot', 'review_request_id', 'timestamp') list_filter = ('timestamp',) search_fields = ['text'] raw_id_fields = ('screenshot', 'reply_to') def review_request_id(self, obj): return obj.review.get().review_request.id review_request_id.short_description = _('Review request ID') class FileAttachmentCommentAdmin(admin.ModelAdmin): list_display = ('text', 'file_attachment', 'review_request_id', 'timestamp') list_filter = ('timestamp',) search_fields = ['text'] raw_id_fields = ('file_attachment', 'reply_to') def review_request_id(self, obj): return obj.review.get().review_request.id review_request_id.short_description = _('Review request ID') class GeneralCommentAdmin(admin.ModelAdmin): list_display = ('text', 'review_request_id', 'timestamp') list_filter = ('timestamp',) search_fields = ['text'] raw_id_fields = ('reply_to',) def review_request_id(self, obj): return obj.review.get().review_request.id review_request_id.short_description = _('Review request ID') class StatusUpdateAdmin(admin.ModelAdmin): list_display = ('review_request_id', 'summary', 'description') def review_request_id(self, obj): return obj.review_request.id review_request_id.short_description = _('Review request ID') admin.site.register(Comment, CommentAdmin) admin.site.register(DefaultReviewer, DefaultReviewerAdmin) admin.site.register(FileAttachmentComment, FileAttachmentCommentAdmin) admin.site.register(GeneralComment, GeneralCommentAdmin) admin.site.register(Group, GroupAdmin) admin.site.register(Review, ReviewAdmin) admin.site.register(ReviewRequest, ReviewRequestAdmin) admin.site.register(ReviewRequestDraft, ReviewRequestDraftAdmin) admin.site.register(Screenshot, ScreenshotAdmin) admin.site.register(ScreenshotComment, ScreenshotCommentAdmin) admin.site.register(StatusUpdate, StatusUpdateAdmin)
StarcoderdataPython
1779881
<filename>xml_extractions/common_xml_parser_function.py # Licensed to the Apache Software Foundation (ASF) under one # or more contributor license agreements. See the NOTICE file # distributed with this work for additional information # regarding copyright ownership. The ASF licenses this file # to you under the Apache License, Version 2.0 (the # "License"); you may not use this file except in compliance # with the License. You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, # software distributed under the License is distributed on an # "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY # KIND, either express or implied. See the License for the # specific language governing permissions and limitations # under the License. import os from lxml import etree def read_xml(xml_path: str): """ Parse XML file :param xml_path: path to the XML file :return: root node """ if os.path.exists(xml_path): return etree.parse(xml_path) else: raise IOError("File [" + xml_path + "] doesn't exist!") def replace_none(s: str) -> str: """ Replace NONE by an empty string :param s: original string which may be NONE :return: a stripped string, empty if NONE """ if s is None: return "" return s.strip()
StarcoderdataPython