text
stringlengths
1
1.05M
//***************************************************************************** // Copyright 2017-2019 Intel Corporation // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. // You may obtain a copy of the License at // // http://www.apache.org/licenses/LICENSE-2.0 // // Unless required by applicable law or agreed to in writing, software // distributed under the License is distributed on an "AS IS" BASIS, // WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. // See the License for the specific language governing permissions and // limitations under the License. //***************************************************************************** #pragma once #include <memory> #include "ngraph/axis_vector.hpp" #include "ngraph/node.hpp" #include "ngraph/op/op.hpp" #include "ngraph/op/util/fused_op.hpp" namespace ngraph { namespace op { class Unsqueeze : public ngraph::op::util::FusedOp { public: Unsqueeze(const std::shared_ptr<ngraph::Node>& data, const std::shared_ptr<ngraph::Node>& axes); virtual void pre_validate_and_infer_types() override; virtual NodeVector decompose_op() const override; virtual std::shared_ptr<Node> copy_with_new_args(const NodeVector& new_args) const override; }; } }
// Copyright 2013 The Flutter Authors. All rights reserved. // Use of this source code is governed by a BSD-style license that can be // found in the LICENSE file. #include "flutter/common/task_runners.h" #include "flutter/fml/paths.h" #include "flutter/fml/synchronization/count_down_latch.h" #include "flutter/fml/synchronization/waitable_event.h" #include "flutter/runtime/dart_vm.h" #include "flutter/runtime/dart_vm_lifecycle.h" #include "flutter/runtime/runtime_test.h" namespace flutter { namespace testing { using DartLifecycleTest = RuntimeTest; TEST_F(DartLifecycleTest, CanStartAndShutdownVM) { auto settings = CreateSettingsForFixture(); settings.leak_vm = false; settings.enable_observatory = false; ASSERT_FALSE(DartVMRef::IsInstanceRunning()); { auto vm_ref = DartVMRef::Create(settings); ASSERT_TRUE(DartVMRef::IsInstanceRunning()); } ASSERT_FALSE(DartVMRef::IsInstanceRunning()); } TEST_F(DartLifecycleTest, CanStartAndShutdownVMOverAndOver) { auto settings = CreateSettingsForFixture(); settings.leak_vm = false; settings.enable_observatory = false; ASSERT_FALSE(DartVMRef::IsInstanceRunning()); auto count = DartVM::GetVMLaunchCount(); for (size_t i = 0; i < 10; i++) { auto vm_ref = DartVMRef::Create(settings); ASSERT_TRUE(DartVMRef::IsInstanceRunning()); ASSERT_EQ(DartVM::GetVMLaunchCount(), count + 1); count = DartVM::GetVMLaunchCount(); } ASSERT_FALSE(DartVMRef::IsInstanceRunning()); } static std::shared_ptr<DartIsolate> CreateAndRunRootIsolate( const Settings& settings, const DartVMData& vm, fml::RefPtr<fml::TaskRunner> task_runner, std::string entrypoint) { FML_CHECK(entrypoint.size() > 0); TaskRunners runners("io.flutter.test", task_runner, task_runner, task_runner, task_runner); auto isolate_weak = DartIsolate::CreateRootIsolate( vm.GetSettings(), // settings vm.GetIsolateSnapshot(), // isolate_snapshot runners, // task_runners {}, // window {}, // snapshot_delegate {}, // io_manager {}, // unref_queue {}, // image_decoder "main.dart", // advisory_script_uri entrypoint.c_str(), // advisory_script_entrypoint nullptr, // flags settings.isolate_create_callback, // isolate create callback settings.isolate_shutdown_callback // isolate shutdown callback ); auto isolate = isolate_weak.lock(); if (!isolate) { FML_LOG(ERROR) << "Could not create valid isolate."; return nullptr; } if (DartVM::IsRunningPrecompiledCode()) { if (!isolate->PrepareForRunningFromPrecompiledCode()) { FML_LOG(ERROR) << "Could not prepare to run the isolate from precompiled code."; return nullptr; } } else { if (!isolate->PrepareForRunningFromKernels( settings.application_kernels())) { FML_LOG(ERROR) << "Could not prepare isolate from application kernels."; return nullptr; } } if (isolate->GetPhase() != DartIsolate::Phase::Ready) { FML_LOG(ERROR) << "Isolate was not ready."; return nullptr; } if (!isolate->Run(entrypoint, {}, settings.root_isolate_create_callback)) { FML_LOG(ERROR) << "Could not run entrypoint: " << entrypoint << "."; return nullptr; } if (isolate->GetPhase() != DartIsolate::Phase::Running) { FML_LOG(ERROR) << "Isolate was not Running."; return nullptr; } return isolate; } // TODO(chinmaygarde): This unit-test is flaky and indicates thread un-safety // during shutdown. https://github.com/flutter/flutter/issues/36782 TEST_F(DartLifecycleTest, DISABLED_ShuttingDownTheVMShutsDownAllIsolates) { auto settings = CreateSettingsForFixture(); settings.leak_vm = false; // Make sure the service protocol launches settings.enable_observatory = true; auto thread_task_runner = CreateNewThread(); for (size_t i = 0; i < 3; i++) { ASSERT_FALSE(DartVMRef::IsInstanceRunning()); const auto last_launch_count = DartVM::GetVMLaunchCount(); auto vm_ref = DartVMRef::Create(settings); ASSERT_TRUE(DartVMRef::IsInstanceRunning()); ASSERT_EQ(last_launch_count + 1, DartVM::GetVMLaunchCount()); const size_t isolate_count = 5; fml::CountDownLatch latch(isolate_count); auto vm_data = vm_ref.GetVMData(); for (size_t i = 0; i < isolate_count; ++i) { thread_task_runner->PostTask( [vm_data, &settings, &latch, thread_task_runner]() { ASSERT_TRUE(CreateAndRunRootIsolate(settings, *vm_data.get(), thread_task_runner, "testIsolateShutdown")); latch.CountDown(); }); } latch.Wait(); } ASSERT_FALSE(DartVMRef::IsInstanceRunning()); } } // namespace testing } // namespace flutter
; payload ; exec: ssDNA ; type: virus ; desc: ; Adeno-associated virus, infects humans but doesn't cause any disease. ; Is a perfect for carrying payloads (e.g. vector vaccine) ; Mod: make it produce a toxic protein ; related: ; this is the Adeno-associated virus ; taken from https://www.ncbi.nlm.nih.gov/nuccore/KX583629.1 ; the first thing we have is a repeating region bases gtcatactttctcacaataagcttgtcctcctccccccaataacacgctcgctcgctcgctcgggacaaccgggcgaagcccggttgcaagcgcccttcgggcgcttgtcccgagcgagcgagcgagcgtgttattggggggaggaggacaagcttattgtgagaaagtatga ; padding bases ccaaagtacgtaggccagataccgtaggggttacacaaccaggttgtaacacttgggtgtctgggttcgatttccagtctggccgtgtagggagggcgtgattcttcatcaaagtggtgggtggagaatctgacccttcttttttctcgcgagactttgcgagatttccaaatatcgcgagaccttaacagtataaagtgagcgcgagcgagcgaccgcgccagacgccatcacgccgttgatccctacacaccaag ; this is the reproduction protein bases atgacgacacctacgtactacgagctgattgtggagctgccgagcgacattgacactcaactccccctggtcagcgacagctttgtgcgatgggtgacgagcaagacgtgggaaccccccctggacagcaaatgggacatggaccaagtggaccaagtccagctgactctcggagacaagattcaacgggaaattttaaaacagtggaggaccattaccggagaccctgatccgaaatattacgtccagctggagcaaggagagacgtactttcacctgcacacgttgctgcagtgctgcaacattaagccgttggtcctcggaagatatgtcaaacagattgagaaaaagctggtgagtaccgtctacggggggcacaatcctctgatcgacaattggctccgaattaccaagacaaaatcgatcgggggctccaataaaattcgcgcgcaaagctacattcccgcctatctcattcccaaaaaacaaccggaagttcagtgggcgtggacaaatatcgaggagtatataaaggccgttttaaactctgaattgcgtcatcaaattggagaagcgcatttccaggagcaaggcctcgctctgcgcgacagcaccaacctatcgagaaactctgagggggctcccatcatcgtcagcaagtgcaccaagaaatacatggagctcgtcgagtggctggtcgagaagggcatcacgaccgagaagcaatggctcttggaaaacaaggagagctttcgctccttccaggcctcgagcaactcggctcgccaaatcaaggcggcccttcagggcgccactcaggaaatgctcctcaccaagacggcgtcagactacctgattggcaaagaccccatcggagacatgaccgacaaccgaatctacaaaattttggaaatgaacggctacgaccctctctacgtggccaacctgtttgtaggttggtgtcagatgaagtttggaaaacgaaacacaatctggctgtttggacctgcgaccacgggcaagaccaacattgcggaggctattgcccatgctgtgcccttttatggatgcgtcaactggaccaacgaaaactttcccttcaacgactgcctggaaaagatgatcatttggtgggaagaggggaaaatgacggccaagattgtagagacggctaaagccatcctcgggggatccaaggttcgcgtcgaccaaaagtgcaagtcttcgatgcagctggaacctacgccggtcatcattaccagcaacaccaacatgtgttatgtcgtggatggaaacacgaccacctttgagcacgctcaacccctacaggaccgaatgtttaagctggaactcttgaagcgacttcccgacgactttggaaaagtgaccaaaaaggaagtcagagactttttcgcgtggggggctaaacataccgtagaggtcgattcttgctttttagtaagaaaggcggagtctcgtaaaagacacgccccggaagtggcatcagaggataaaagccctcccgctaaggcggctcgcacagacgagcttcagcatttgagcggcgaggagggaacctctgtctctgccaggtatgttttgaaatgcgctaaacatttggggatggtaaccatgatgtggccatgtagagattgtgaaaaggccaattgtaatataaatcagtgcattttgcataaaagtttgtcttgtaaagagtgttttccagattatgattccgatgtatctgttcaggaaggcgagccttccggcaacccccccttgtcgagctccgacgaggacattccctctcaccaacccccccttgtcaaagattgtaaaccctggactccgtgttcctatcaccacctgaccggggtagccaatagaaattgtagcatgtgcaaattgagaaatgtggatttggatgattgtgacagtgagcaataa ; padding bases aatgacttaaactagac ; this is the capsid protein bases atgtctgctgctgattctgttccagattggttggagaattttgtgcgcaagcacattgtcaatccggttgccgaatttgctcatttggaggctggagccccacaaccaaagcctaaccagcagcatcaagatcgaggcggaaccaaggacgatagccgaggtcttgttttacctggctacaagtatcttggtccttttaacggtcttgacaagggtgaacccgtcaacgctgctgacgctgctgcgctcgagcacgacaaggcgtacgaccagcagctgcaagcgggagacaacccctatctgaaatataaccacgcagacgccgaatttcaagaggccctaaaggacgacacatcctttgggggaaatctcggtaaagcggtattccaggccaaaaagagggttctcgaaccctttggcttggctgaagacggaaagacggctcctaccaacgaacgtcgaaaggagaatatagacgactactatcccaagaggaaaaaagccaaggcgggagaagaaaagcccccttctaccgacgcagtagaaggagctggagacggagaaccaagcacatctaccggaggggaaacccccagcggtactcaatctaatacaatgtctgcagggggcggcgcaccaatgggcgatgaccaacagggtgccgatggagtgggtaattcctcgggaaattggcattgcgattccacatggctggacaatcttgtcatcaccaagtccacccgaacctgggtcctgcccagctacaacaaccacatctacaagcgagtctccaacacgggaggagacaactcgtactttggattcagcaccccgtggggatactttgactttaaccgattccactgccacttttcaccgcgagactggcaacggctcatcaacaacaactggggaatccgacccaaggccctcaagtttaagctcttcaacatccaagtcaaagaggtcacgactcaagactcgaccaagaccgtcgccaataacctcaccagcactattcaagtctttgcggactcggaatatcagctaccgtatgtagtgggcaacgcgtccgagggatgcctgcctccctttcccgcggacgtctttgtgctgccgcagtacggatacctgactttggacaataacggaaactctgtcgacagaagcgccttttactgtctcgagtactttccgagtcagatgctgagaacgggcaacaattttgaatttacctacgaatttgaaaaggtgccgttccacagcatgtttgctcacaaccagtcgctgagtcggctaatgaatccgttggtggaccagtacttgtactactttagcaacgtctcggggcctaacaacgctgcccagattcgttacgacaagggtcgtaaggaagacattgccggccaatgcagaaattggctccccggaccattttggcaaaatcagagcgtgcgtctggacaatgccaacaacaatcccaagtgggattactgggcaaactcgaatcgagtaaggctggacggcaaattgtactccgtcaaccctggaattcctcaagccacagaagctacgcagaatccctacaaccagtatccgacgcagtcgactctggtgtttgaaaagaagcccggaggaaaccccaccggagtagatccaaacaatctcaaccttaccaaggatgaagaaattagaaccaccaatcccgtggcctatgccgtgtcaggaacagtcaccggaacgtcggccatcaatcaaaacaatggagccagtcagactcctacggcttccgacgtggacattttgggagccatgcccggaatggtgtggcaaaatagagacatttatctgcaagggcccatttgggccaagattccctccacagacaatcattttcatccttgtcctctcatgggaggattcggattcaagcatccgcctccgcagattctcatcaaaaacacaccggtgccgtcagaccctgcgggattttcagcgaccaagttcaactcgttcatcactcagtattccaccggacaagtcaccgtggaaatcatgtgggaactacaaaaggaaacgtccaagaggtggaatccagaaattcagtttacgtccaatttcaacgccacccaagaactgcagtttgcacccaacgtgtctggagactacgaagaacccagagccatcggctcgagatatctcaccaaacctctgtaa ; identical padding bases aatgacttaaactagac ; our Ectatomin ; https://www.ncbi.nlm.nih.gov/protein/DAI22846.1?report=fasta compressed MGEPTGFAFAHKRTQTQHKRTHQITVCPTIKSWRTEKRSVHVAERRFPQRGRDWNGSLRAAP* ; padding bases cttgtatttattcattgtttgtatcatttattcaataaaccgtttattcgtttcagtttcaattcgactcgcgtcatactttctcacaataagcttgtcctcctccccccaataacacgctcgctcgctcgctcgggacaagcgcccgaagggcgcttgcaaccgggcttcgcccggttgtcccgagcgagcgagcgagcgtgttattggggggaggaggacaagcttattgtgagaaagtatgac
; A071282: Denominators of Peirce sequence of order 3. ; 2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3,1,3,2,3,2,3 add $0,10 gcd $0,6 mov $1,9 div $1,$0 gcd $1,6 mov $0,$1
; A077008: Legendre symbol (-1,p) where p is the n-th prime. ; Submitted by Jamie Morken(s1) ; -1,1,-1,-1,1,1,-1,-1,1,-1,1,1,-1,-1,1,-1,1,-1,-1,1,-1,-1,1,1,1,-1,-1,1,1,-1,-1,1,-1,1,-1,1,-1,-1,1,-1,1,-1,1,1,-1,-1,-1,-1,1,1,-1,1,-1,1,-1,1,-1,1,1,-1,1,-1,-1,1,1,-1,1,-1,1,1,-1,-1,1,-1,-1,1,1,1,1,-1,1,-1,1,-1,-1,1,1,1,-1,-1,-1,-1,-1,-1,-1,1,1,-1,1,-1 seq $0,5097 ; (Odd primes - 1)/2. mov $2,-1 pow $2,$0 mov $0,$2
; Let us now switch to 32 bit protected mode [org 0x7c00] ; Place where we load kernel from KERNEL_OFFSET equ 0x1000 mov [BOOT_DRIVE], dl ; Set stack mov bp, 0x9000 mov sp, bp ; Print the 16 bit mode declaration mov bx, MSG_REAL_MODE call print_str ; Load kernel call load_kernel ; Switch to 32 bit and never return 😢 call switch_to_pm ; Hang jmp $ ; Include all our previous epic code %include "./print_str.asm" %include "./disk_load.asm" %include "./gdt.asm" %include "./print_str_32.asm" %include "./switch_to_pm.asm" [bits 16] ; Load the kernel into memory load_kernel: ; Print message saying you're loading kernel mov bx, MSG_LOAD_KERNEL call print_str ; Load 15 sectors (why not) mov bx, KERNEL_OFFSET mov dh, 15 mov dl, [BOOT_DRIVE] call disk_load ret ; Now we are in 32 bit mode, so tell assembler to use 32 bit instructions from now on [bits 32] ; Now we are in 32 bit protected mode 😎 begin_pm: ; Print a message using our print thing mov ebx, MSG_PROT_MODE call print_str_32 ; Run the kernel 😎 call KERNEL_OFFSET ; Hang jmp $ ; Define text to print BOOT_DRIVE db 0 MSG_REAL_MODE db "Started in 16-bit Real Mode", 0 MSG_PROT_MODE db "Successfully moved to 32-bit Protected Mode", 0 MSG_LOAD_KERNEL db "Loading kernel...", 0 ; Padding times 510-($-$$) db 0 ; Magic number dw 0xaa55
; A130619: Let M(n) = {{n, 0, 1}, {1, 0, 0}, {0, 1, 0}}, then a(n) is the upper-right term of M(n)*M(n-1)*...*M(1) (empty matrix product yields the identity). ; Submitted by Christian Krause ; 0,1,2,6,25,127,768,5401,43335,390783,3913231,43088876,517457295,6730858066,94275101800,1414643984295,22641034606786,384991863417162,6931268185493211,131716736558977795,2634719723042973062 mov $2,2 mov $3,2 lpb $0 sub $0,1 mul $2,$0 add $4,$3 add $2,$4 mov $4,$1 mov $1,$3 mov $3,$2 lpe mov $0,$1 div $0,2
; A054684: Sum of digits is odd. ; 1,3,5,7,9,10,12,14,16,18,21,23,25,27,29,30,32,34,36,38,41,43,45,47,49,50,52,54,56,58,61,63,65,67,69,70,72,74,76,78,81,83,85,87,89,90,92,94,96,98,100,102,104,106,108,111,113,115,117,119,120,122,124,126,128,131,133,135,137,139,140,142,144,146,148,151,153,155,157,159,160,162,164,166,168,171,173,175,177,179,180,182,184,186,188,191,193,195,197,199,201,203,205,207,209,210,212,214,216,218,221,223,225,227,229,230,232,234,236,238,241,243,245,247,249,250,252,254,256,258,261,263,265,267,269,270,272,274,276,278,281,283,285,287,289,290,292,294,296,298,300,302,304,306,308,311,313,315,317,319,320,322,324,326,328,331,333,335,337,339,340,342,344,346,348,351,353,355,357,359,360,362,364,366,368,371,373,375,377,379,380,382,384,386,388,391,393,395,397,399,401,403,405,407,409,410,412,414,416,418,421,423,425,427,429,430,432,434,436,438,441,443,445,447,449,450,452,454,456,458,461,463,465,467,469,470,472,474,476,478,481,483,485,487,489,490,492,494,496,498 mov $3,$0 mul $0,2 lpb $0,1 add $4,$0 div $0,10 lpe gcd $4,2 mov $1,$4 sub $1,1 mov $2,$3 mul $2,2 add $1,$2
; A028910: Arrange digits of 2^n in descending order. ; Submitted by Jamie Morken(r1) ; 1,2,4,8,61,32,64,821,652,521,4210,8420,9640,9821,86431,87632,66553,732110,644221,885422,8765410,9752210,9444310,8888630,77766211,55443332,88766410,877432211,866554432,987653210,8774432110,8876444321,9997664422,9998855432,99887764111,98876543333,98777666431,987754433321,998777644420,988887555431,9977766521110,9955553222210,9865444311100,9988763222000,98766544421110,88887543332210,87777666444310,888775544333210,987776665442110,999655443322211,9998866544222110,9988876554322211,9997766554433200 mov $1,2 pow $1,$0 seq $1,4186 ; Arrange digits of n in decreasing order. mov $0,$1
; ============================================================================= ; BareMetal -- a 64-bit OS written in Assembly for x86-64 systems ; Copyright (C) 2008-2010 Return Infinity -- see LICENSE.TXT ; ; String Functions ; ============================================================================= align 16 db 'DEBUG: STRING ' align 16 ; ----------------------------------------------------------------------------- ; os_int_to_string -- Convert a binary interger into an string ; IN: RAX = binary integer ; RDI = location to store string ; OUT: RDI = points to end of string ; All other registers preserved ; Min return value is 0 and max return value is 18446744073709551615 so your ; string needs to be able to store at least 21 characters (20 for the digits ; and 1 for the string terminator). ; Adapted from http://www.cs.usfca.edu/~cruse/cs210s09/rax2uint.s os_int_to_string: push rdx push rcx push rbx push rax mov rbx, 10 ; base of the decimal system xor ecx, ecx ; number of digits generated os_int_to_string_next_divide: xor edx, edx ; RAX extended to (RDX,RAX) div rbx ; divide by the number-base push rdx ; save remainder on the stack inc rcx ; and count this remainder cmp rax, 0 ; was the quotient zero? jne os_int_to_string_next_divide ; no, do another division os_int_to_string_next_digit: pop rax ; else pop recent remainder add al, '0' ; and convert to a numeral stosb ; store to memory-buffer loop os_int_to_string_next_digit ; again for other remainders xor al, al stosb ; Store the null terminator at the end of the string pop rax pop rbx pop rcx pop rdx ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_to_int -- Convert a string into a binary interger ; IN: RSI = location of string ; OUT: RAX = integer value ; All other registers preserved ; Adapted from http://www.cs.usfca.edu/~cruse/cs210s09/uint2rax.s os_string_to_int: push rsi push rdx push rcx push rbx xor eax, eax ; initialize accumulator mov rbx, 10 ; decimal-system's radix os_string_to_int_next_digit: mov cl, [rsi] ; fetch next character cmp cl, '0' ; char preceeds '0'? jb os_string_to_int_invalid ; yes, not a numeral cmp cl, '9' ; char follows '9'? ja os_string_to_int_invalid ; yes, not a numeral mul rbx ; ten times prior sum and rcx, 0x0F ; convert char to int add rax, rcx ; add to prior total inc rsi ; advance source index jmp os_string_to_int_next_digit ; and check another char os_string_to_int_invalid: pop rbx pop rcx pop rdx pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_int_to_hex_string -- Convert an integer to a hex string ; IN: RAX = Integer value ; RDI = location to store string ; OUT: All registers preserved os_int_to_hex_string: push rdi push rdx push rcx push rbx push rax mov rcx, 16 ; number of nibbles. 64 bit = 16 nibbles = 8 bytes os_int_to_hex_string_next_nibble: rol rax, 4 ; next nibble into AL mov bl, al ; copy nibble into BL and rbx, 0x0F ; and convert to word mov dl, [hextable + rbx] ; lookup ascii numeral push rax mov al, dl stosb pop rax loop os_int_to_hex_string_next_nibble ; again for next nibble xor eax, eax ; clear RAX to 0 stosb ; Store AL to terminate string pop rax pop rbx pop rcx pop rdx pop rdi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_hex_string_to_int -- Convert up to 8 hexascii to bin ; IN: RSI = Location of hex asciiz string ; OUT: RAX = binary value of hex string ; All other registers preserved os_hex_string_to_int: push rsi push rcx push rbx cld xor ebx, ebx os_hex_string_to_int_loop: lodsb mov cl, 4 cmp al, 'a' jb os_hex_string_to_int_ok sub al, 0x20 ; convert to upper case if alpha os_hex_string_to_int_ok: sub al, '0' ; check if legal jc os_hex_string_to_int_exit ; jmp if out of range cmp al, 9 jle os_hex_string_to_int_got ; jmp if number is 0-9 sub al, 7 ; convert to number from A-F or 10-15 cmp al, 15 ; check if legal ja os_hex_string_to_int_exit ; jmp if illegal hex char os_hex_string_to_int_got: shl rbx, cl or bl, al jmp os_hex_string_to_int_loop os_hex_string_to_int_exit: mov rax, rbx ; int value stored in RBX, move to RAX pop rbx pop rcx pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_length -- Return length of a string ; IN: RSI = string location ; OUT: RCX = length (not including the NULL terminator) ; All other registers preserved os_string_length: push rdi push rax xor ecx, ecx xor eax, eax mov rdi, rsi not rcx cld repne scasb ; compare byte at RDI to value in AL not rcx dec rcx pop rax pop rdi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_find_char -- Find first location of character in a string ; IN: RSI = string location ; AL = character to find ; OUT: RAX = location in string, or 0 if char not present ; All other registers preserved os_string_find_char: push rsi push rcx mov rcx, 1 ; Counter -- start at first char os_string_find_char_more: cmp byte [rsi], al je os_string_find_char_done cmp byte [rsi], 0 je os_string_find_char_not_found inc rsi inc rcx jmp os_string_find_char_more os_string_find_char_done: mov rax, rcx pop rcx pop rsi ret os_string_find_char_not_found: pop rcx pop rsi xor eax, eax ; not found, set RAX to 0 ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_change_char -- Change all instances of a character in a string ; IN: RSI = string location ; AL = character to replace ; BL = replacement character ; OUT: All registers preserved os_string_change_char: push rsi push rcx push rbx push rax mov cl, al os_string_change_char_loop: mov byte al, [rsi] cmp al, 0 je os_string_change_char_done cmp al, cl jne os_string_change_char_no_change mov byte [rsi], bl os_string_change_char_no_change: inc rsi jmp os_string_change_char_loop os_string_change_char_done: pop rax pop rbx pop rcx pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_copy -- Copy the contents of one string into another ; IN: RSI = source ; RDI = destination ; OUT: All registers preserved ; Note: It is up to the programmer to ensure that there is sufficient space in the destination os_string_copy: push rsi push rdi push rax os_string_copy_more: lodsb ; Load a character from the source string stosb cmp al, 0 ; If source string is empty, quit out jne os_string_copy_more pop rax pop rdi pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_truncate -- Chop string down to specified number of characters ; IN: RSI = string location ; RAX = number of characters ; OUT: All registers preserved os_string_truncate: push rsi add rsi, rax mov byte [rsi], 0x00 pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_join -- Join two strings into a third string ; IN: RAX = string one ; RBX = string two ; RDI = destination string ; OUT: All registers preserved ; Note: It is up to the programmer to ensure that there is sufficient space in the destination os_string_join: push rsi push rdi push rcx push rbx push rax mov rsi, rax ; Copy first string to location in RDI call os_string_copy call os_string_length ; Get length of first string add rdi, rcx ; Position at end of first string mov rsi, rbx ; Add second string onto it call os_string_copy pop rax pop rbx pop rcx pop rdi pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_append -- Append a string to an existing string ; IN: RSI = String to be appended ; RDI = Destination string ; OUT: All registers preserved ; Note: It is up to the programmer to ensure that there is sufficient space in the destination os_string_append: push rsi push rdi push rcx xchg rsi, rdi call os_string_length xchg rsi, rdi add rdi, rcx call os_string_copy pop rcx pop rdi pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_chomp -- Strip leading and trailing spaces from a string ; IN: RSI = string location ; OUT: All registers preserved os_string_chomp: push rsi push rdi push rcx push rax call os_string_length ; Quick check to see if there are any characters in the string jrcxz os_string_chomp_done ; No need to work on it if there is no data mov rdi, rsi ; RDI will point to the start of the string... push rdi ; ...while RSI will point to the "actual" start (without the spaces) add rdi, rcx ; os_string_length stored the length in RCX os_string_chomp_findend: ; we start at the end of the string and move backwards until we don't find a space dec rdi cmp rsi, rdi ; Check to make sure we are not reading backward past the string start jg os_string_chomp_fail ; If so then fail (string only contained spaces) cmp byte [rdi], ' ' je os_string_chomp_findend inc rdi ; we found the real end of the string so null terminate it mov byte [rdi], 0x00 pop rdi os_string_chomp_start_count: ; read through string until we find a non-space character cmp byte [rsi], ' ' jne os_string_chomp_copy inc rsi jmp os_string_chomp_start_count os_string_chomp_fail: ; In this situataion the string is all spaces pop rdi ; We are about to bail out so make sure the stack is sane mov al, 0x00 stosb jmp os_string_chomp_done ; At this point RSI points to the actual start of the string (minus the leading spaces, if any) ; And RDI point to the start of the string os_string_chomp_copy: ; Copy a byte from RSI to RDI one byte at a time until we find a NULL lodsb stosb cmp al, 0x00 jne os_string_chomp_copy os_string_chomp_done: pop rax pop rcx pop rdi pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_strip -- Removes specified character from a string ; IN: RSI = string location ; AL = character to remove ; OUT: All registers preserved os_string_strip: push rsi push rdi push rbx push rax mov rdi, rsi mov bl, al ; copy the char into BL since LODSB and STOSB use AL os_string_strip_nextchar: lodsb stosb cmp al, 0x00 ; check if we reached the end of the string je os_string_strip_done ; if so bail out cmp al, bl ; check to see if the character we read is the interesting char jne os_string_strip_nextchar ; if not skip to the next character os_string_strip_skip: ; if so the fall through to here dec rdi ; decrement RDI so we overwrite on the next pass jmp os_string_strip_nextchar os_string_strip_done: pop rax pop rbx pop rdi pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_compare -- See if two strings match ; IN: RSI = string one ; RDI = string two ; OUT: Carry flag set if same os_string_compare: push rsi push rdi push rbx push rax os_string_compare_more: mov al, [rsi] ; Store string contents mov bl, [rdi] cmp al, 0 ; End of first string? je os_string_compare_terminated cmp al, bl jne os_string_compare_not_same inc rsi inc rdi jmp os_string_compare_more os_string_compare_not_same: pop rax pop rbx pop rdi pop rsi clc ret os_string_compare_terminated: cmp bl, 0 ; End of second string? jne os_string_compare_not_same pop rax pop rbx pop rdi pop rsi stc ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_uppercase -- Convert zero-terminated string to uppercase ; IN: RSI = string location ; OUT: All registers preserved os_string_uppercase: push rsi os_string_uppercase_more: cmp byte [rsi], 0x00 ; Zero-termination of string? je os_string_uppercase_done ; If so, quit cmp byte [rsi], 97 ; In the uppercase A to Z range? jl os_string_uppercase_noatoz cmp byte [rsi], 122 jg os_string_uppercase_noatoz sub byte [rsi], 0x20 ; If so, convert input char to lowercase inc rsi jmp os_string_uppercase_more os_string_uppercase_noatoz: inc rsi jmp os_string_uppercase_more os_string_uppercase_done: pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_lowercase -- Convert zero-terminated string to lowercase ; IN: RSI = string location ; OUT: All registers preserved os_string_lowercase: push rsi os_string_lowercase_more: cmp byte [rsi], 0x00 ; Zero-termination of string? je os_string_lowercase_done ; If so, quit cmp byte [rsi], 65 ; In the lowercase A to Z range? jl os_string_lowercase_noatoz cmp byte [rsi], 90 jg os_string_lowercase_noatoz add byte [rsi], 0x20 ; If so, convert input char to uppercase inc rsi jmp os_string_lowercase_more os_string_lowercase_noatoz: inc rsi jmp os_string_lowercase_more os_string_lowercase_done: pop rsi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_get_time_string -- Store the current time in a string in format "HH:MM:SS" ; IN: RDI = location to store string (must be able to fit 9 bytes, 8 data plus null terminator) ; OUT: All registers preserved os_get_time_string: push rdi push rbx push rax os_get_time_string_wait: mov al, 10 out 0x70, al in al, 0x71 test al, 0x80 ; Is there an update in progress? jne os_get_time_string_wait ; If so then try again mov rbx, hextable mov al, 0x04 ; Hours out 0x70, al in al, 0x71 call os_get_time_string_processor mov al, ':' stosb mov al, 0x02 ; Minutes out 0x70, al in al, 0x71 call os_get_time_string_processor mov al, ':' stosb mov al, 0x00 ; Seconds out 0x70, al in al, 0x71 call os_get_time_string_processor mov al, 0x00 ; Terminate the string stosb pop rax pop rbx pop rdi ret os_get_time_string_processor: push rax ; save rax for the next part shr al, 4 ; we want to work on the high part so shift right by 4 bits xlatb stosb pop rax and al, 0x0f ; we want to work on the low part so clear the high part xlatb stosb ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_get_date_string -- Store the current time in a string in format "YYYY/MM/DD" ; IN: RDI = location to store string (must be able to fit 11 bytes, 10 data plus null terminator) ; OUT: All registers preserved ; Note: Uses the os_get_time_string_processor function os_get_date_string: push rdi push rbx push rax os_get_date_string_wait: mov al, 10 out 0x70, al in al, 0x71 test al, 0x80 ; Is there an update in progress? jne os_get_date_string_wait ; If so then try again mov rbx, hextable mov al, 0x32 ; Century out 0x70, al in al, 0x71 call os_get_time_string_processor mov al, 0x09 ; Year out 0x70, al in al, 0x71 call os_get_time_string_processor mov al, '/' stosb mov al, 0x08 ; Month out 0x70, al in al, 0x71 call os_get_time_string_processor mov al, '/' stosb mov al, 0x07 ; Day out 0x70, al in al, 0x71 call os_get_time_string_processor mov al, 0x00 ; Terminate the string stosb pop rax pop rbx pop rdi ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_is_digit -- Check if character is a digit ; IN: AL = ASCII char ; OUT: EQ flag set if numeric ; Note: JE (Jump if Equal) can be used after this function is called os_is_digit: cmp al, '0' jb os_is_digit_not_digit cmp al, '9' ja os_is_digit_not_digit cmp al, al ; To set the equal flag os_is_digit_not_digit: ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_is_alpha -- Check if character is a letter ; IN: AL = ASCII char ; OUT: EQ flag set if alpha ; Note: JE (Jump if Equal) can be used after this function is called os_is_alpha: cmp al, ' ' jb os_is_alpha_not_alpha cmp al, 0x7E ja os_is_alpha_not_alpha cmp al, al ; To set the equal flag os_is_alpha_not_alpha: ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; os_string_parse -- Parse a string into individual words ; IN: RSI = Address of string ; OUT: RCX = word count ; Note: This function will remove "extra" whitespace in the source string ; "This is a test. " will update to "This is a test." os_string_parse: push rsi push rdi push rax xor ecx, ecx ; RCX is our word counter mov rdi, rsi call os_string_chomp ; Remove leading and trailing spaces cmp byte [rsi], 0x00 ; Check the first byte je os_string_parse_done ; If it is a null then bail out inc rcx ; At this point we know we have at least one word os_string_parse_next_char: lodsb stosb cmp al, 0x00 ; Check if we are at the end je os_string_parse_done ; If so then bail out cmp al, ' ' ; Is it a space? je os_string_parse_found_a_space jmp os_string_parse_next_char ; If not then grab the next char os_string_parse_found_a_space: lodsb ; We found a space.. grab the next char cmp al, ' ' ; Is it a space as well? jne os_string_parse_no_more_spaces jmp os_string_parse_found_a_space os_string_parse_no_more_spaces: dec rsi ; Decrement so the next lodsb will read in the non-space inc rcx jmp os_string_parse_next_char os_string_parse_done: pop rax pop rdi pop rsi ret ; ----------------------------------------------------------------------------- ; ============================================================================= ; EOF
BattleCommand_Metronome: ; metronome call ClearLastMove call CheckUserIsCharging jr nz, .asm_3742b ld a, [wKickCounter] push af call BattleCommand_LowerSub pop af ld [wKickCounter], a .asm_3742b call LoadMoveAnim .GetMove: call BattleRandom ; No invalid moves. cp NUM_ATTACKS + 1 jr nc, .GetMove ; None of the moves in MetronomeExcepts. push af ld de, 1 ld hl, MetronomeExcepts call IsInArray pop bc jr c, .GetMove ; No moves the user already has. ld a, b call CheckUserMove jr z, .GetMove ld a, BATTLE_VARS_MOVE call GetBattleVarAddr ld [hl], b call UpdateMoveData jp ResetTurn INCLUDE "data/moves/metronome_exception_moves.asm"
// Copyright 2009 Ryan Dahl <ry@tinyclouds.org> #include <node_signal_handler.h> #include <assert.h> namespace node { using namespace v8; Persistent<FunctionTemplate> SignalHandler::constructor_template; void SignalHandler::Initialize(Handle<Object> target) { HandleScope scope; Local<FunctionTemplate> t = FunctionTemplate::New(SignalHandler::New); constructor_template = Persistent<FunctionTemplate>::New(t); constructor_template->Inherit(EventEmitter::constructor_template); constructor_template->InstanceTemplate()->SetInternalFieldCount(1); constructor_template->SetClassName(String::NewSymbol("SignalHandler")); NODE_SET_PROTOTYPE_METHOD(constructor_template, "stop", SignalHandler::Stop); target->Set(String::NewSymbol("SignalHandler"), constructor_template->GetFunction()); } void SignalHandler::OnSignal(EV_P_ ev_signal *watcher, int revents) { SignalHandler *handler = static_cast<SignalHandler*>(watcher->data); HandleScope scope; assert(revents == EV_SIGNAL); handler->Emit("signal", 0, NULL); } SignalHandler::~SignalHandler() { if (watcher_.active) { ev_ref(EV_DEFAULT_UC); ev_signal_stop(EV_DEFAULT_UC_ &watcher_); } } Handle<Value> SignalHandler::New(const Arguments& args) { HandleScope scope; if (args.Length() != 1 || !args[0]->IsInt32()) { return ThrowException(String::New("Bad arguments")); } int sig = args[0]->Int32Value(); SignalHandler *handler = new SignalHandler(); handler->Wrap(args.Holder()); ev_signal_init(&handler->watcher_, SignalHandler::OnSignal, sig); handler->watcher_.data = handler; ev_signal_start(EV_DEFAULT_UC_ &handler->watcher_); ev_unref(EV_DEFAULT_UC); handler->Attach(); return args.This(); } Handle<Value> SignalHandler::Stop(const Arguments& args) { HandleScope scope; SignalHandler *handler = ObjectWrap::Unwrap<SignalHandler>(args.Holder()); ev_ref(EV_DEFAULT_UC); ev_signal_stop(EV_DEFAULT_UC_ &handler->watcher_); handler->Detach(); return Undefined(); } } // namespace node
.global s_prepare_buffers s_prepare_buffers: ret .global s_faulty_load s_faulty_load: push %r11 push %r12 push %r15 push %rax push %rbx push %rdi push %rsi // Load lea addresses_WT+0xa0fb, %r15 nop sub %rdi, %rdi movups (%r15), %xmm5 vpextrq $0, %xmm5, %rbx nop nop nop nop nop add $61894, %r15 // Load mov $0x70b, %rdi nop nop nop nop sub $31560, %r11 mov (%rdi), %r15d nop nop nop and %r12, %r12 // Load lea addresses_RW+0x19fb, %r12 nop nop cmp $38161, %rax mov (%r12), %bx nop nop nop cmp $44462, %r12 // Faulty Load lea addresses_normal+0xedfb, %r11 nop nop nop xor %r12, %r12 movups (%r11), %xmm4 vpextrq $0, %xmm4, %rsi lea oracles, %r11 and $0xff, %rsi shlq $12, %rsi mov (%r11,%rsi,1), %rsi pop %rsi pop %rdi pop %rbx pop %rax pop %r15 pop %r12 pop %r11 ret /* <gen_faulty_load> [REF] {'OP': 'LOAD', 'src': {'same': True, 'type': 'addresses_normal', 'NT': False, 'AVXalign': False, 'size': 16, 'congruent': 0}} {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_WT', 'NT': False, 'AVXalign': False, 'size': 16, 'congruent': 6}} {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_P', 'NT': False, 'AVXalign': False, 'size': 4, 'congruent': 3}} {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_RW', 'NT': False, 'AVXalign': False, 'size': 2, 'congruent': 9}} [Faulty Load] {'OP': 'LOAD', 'src': {'same': True, 'type': 'addresses_normal', 'NT': False, 'AVXalign': False, 'size': 16, 'congruent': 0}} <gen_prepare_buffer> {'34': 21829} 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 */
;------------------------------------------------------------------------------ ; ; Copyright (c) 2006, Intel Corporation. All rights reserved.<BR> ; This program and the accompanying materials ; are licensed and made available under the terms and conditions of the BSD License ; which accompanies this distribution. The full text of the license may be found at ; http://opensource.org/licenses/bsd-license.php. ; ; THE PROGRAM IS DISTRIBUTED UNDER THE BSD LICENSE ON AN "AS IS" BASIS, ; WITHOUT WARRANTIES OR REPRESENTATIONS OF ANY KIND, EITHER EXPRESS OR IMPLIED. ; ; Module Name: ; ; EnableInterrupts.Asm ; ; Abstract: ; ; EnableInterrupts function ; ; Notes: ; ;------------------------------------------------------------------------------ DEFAULT REL SECTION .text ;------------------------------------------------------------------------------ ; VOID ; EFIAPI ; EnableInterrupts ( ; VOID ; ); ;------------------------------------------------------------------------------ global ASM_PFX(EnableInterrupts) ASM_PFX(EnableInterrupts): sti ret ;------------------------------------------------------------------------------ ; VOID ; EFIAPI ; EnableInterruptsAndSleep ( ; VOID ; ); ;------------------------------------------------------------------------------ global ASM_PFX(EnableInterruptsAndSleep) ASM_PFX(EnableInterruptsAndSleep): sti hlt ret
; A283733: a(n) = a(n-1) + 1 + floor(n*golden ratio), with a(0) = 1. ; 1,3,7,12,19,28,38,50,63,78,95,113,133,155,178,203,229,257,287,318,351,385,421,459,498,539,582,626,672,719,768,819,871,925,981,1038,1097,1157,1219,1283,1348,1415,1483,1553,1625,1698,1773,1850,1928,2008,2089,2172,2257,2343,2431,2520,2611,2704,2798,2894,2992,3091,3192,3294,3398,3504,3611,3720,3831,3943,4057,4172,4289,4408,4528,4650,4773,4898,5025,5153,5283,5415,5548,5683,5819,5957,6097,6238,6381,6526,6672,6820,6969,7120,7273,7427,7583,7740,7899,8060 mov $2,$0 add $2,1 mov $3,$0 lpb $2 mov $0,$3 sub $2,1 sub $0,$2 seq $0,26351 ; Floor(n*phi) + 1, where phi = (1+sqrt(5))/2. add $1,$0 lpe mov $0,$1
#include <catch2/catch.hpp> #include <initializer_list> #include <pltables++/vector.h> #include <stdexcept> #include <string> #include <vector> using namespace plt; TEST_CASE("Vector - construction") { SECTION("Default construct empty vector") { Vector<int> vec; REQUIRE(vec.size() == 0); REQUIRE(vec.capacity() == 0); } SECTION("Default construct N IsTrivial elements") { Vector<int> vec{ 6, 42 }; REQUIRE(vec.size() == 6); REQUIRE(vec.capacity() >= 6); for (int i = 0; i < vec.size(); ++i) { REQUIRE(vec[i] == 42); } const Vector<int>& cvec = vec; for (int i = 0; i < cvec.size(); ++i) { REQUIRE(cvec[i] == 42); } } SECTION("Copy constructor") { Vector<int> v1{ 6, 44 }; Vector<int> v2{ v1 }; REQUIRE(v1.size() == 6); REQUIRE(v2.size() == 6); for (int i = 0; i < v2.size(); ++i) { REQUIRE(v2[i] == 44); REQUIRE(v1[i] == 44); } } SECTION("Move constructor") { Vector<int> v1{ 6, 44 }; Vector<int> v2{ std::move(v1) }; REQUIRE(v1.size() == 0); REQUIRE(v2.size() == 6); for (int i = 0; i < v2.size(); ++i) { REQUIRE(v2[i] == 44); } } SECTION("Copy assignment") { Vector<int> v1{ 5, 41 }; Vector<int> v2{ 10, 1 }; REQUIRE(v1.size() == 5); REQUIRE(v2.size() == 10); REQUIRE(v1[0] == 41); REQUIRE(v2[0] == 1); v2 = v1; REQUIRE(v1.size() == 5); REQUIRE(v2.size() == 5); for (int i = 0; i < v2.size(); ++i) { REQUIRE(v2[i] == 41); REQUIRE(v1[i] == 41); } } SECTION("Move assignment") { Vector<int> v1{ 5, 41 }; Vector<int> v2{ 10, 1 }; REQUIRE(v1.size() == 5); REQUIRE(v2.size() == 10); REQUIRE(v1[0] == 41); REQUIRE(v2[0] == 1); v2 = std::move(v1); REQUIRE(v1.size() == 0); REQUIRE(v2.size() == 5); for (int i = 0; i < v2.size(); ++i) { REQUIRE(v2[i] == 41); } } } TEST_CASE("Vector - append") { Vector<int> vec; constexpr int N = 1024; REQUIRE(vec.is_empty() == true); for (int i = 0; i < N; ++i) { REQUIRE(vec.size() == i); vec.append(i); } REQUIRE(vec.size() == N); for (int i = 0; i < N; ++i) { REQUIRE(vec[i] == i); } for (int i = 0; i < N / 2; ++i) { vec.pop(); } REQUIRE(vec.size() == N / 2); for (int i = 0; i < N / 2; ++i) { vec.append(N / 2 + i + 1); } REQUIRE(vec.size() == N); for (int i = 0; i < N; ++i) { if (i < N / 2) { REQUIRE(vec[i] == i); } else { REQUIRE(vec[i] == i + 1); } } vec.shrink_to_fit(); REQUIRE(vec.size() == vec.capacity()); SECTION("Iterators") { Vector<int>::iterator itr = vec.begin(); REQUIRE(itr != vec.end()); REQUIRE(*itr == 0); itr += 3; REQUIRE(*itr == 3); itr = vec.begin(); Vector<int>::iterator itr2 = itr + 3; REQUIRE(*itr2 == 3); REQUIRE(*itr == 0); } SECTION("ConstIterator") { Vector<int>& cvec = vec; Vector<int>::const_iterator it = cvec.cbegin(); REQUIRE(it == cvec.begin()); REQUIRE(it != cvec.end()); REQUIRE(*it == 0); REQUIRE(*++it == 1); REQUIRE(*it++ == 1); REQUIRE(*++it == 3); } std::vector<int> other; for (auto it : vec) { other.push_back(it); } REQUIRE(vec.size() == (int)other.size()); for (int i = 0; i < vec.size(); ++i) { REQUIRE(vec[i] == other[i]); } } // Not IsTrivial // Not NoThrowMoveConstructible // Not NoThrowMoveAssignable // *IS* NoThrowCopyConstructible // *IS* NoThrowCopyAssignable struct NoThrowCopy { NoThrowCopy(int i) : x{ new int(i) } { } NoThrowCopy(const NoThrowCopy& other) noexcept : x{ new int(*other.x) } {} NoThrowCopy(NoThrowCopy&&) noexcept = delete; ~NoThrowCopy() noexcept { delete x; } NoThrowCopy& operator=(const NoThrowCopy& other) noexcept { x = new int(*other.x); return *this; } NoThrowCopy& operator=(NoThrowCopy&& other) noexcept = delete; int& operator*() { return *x; } int* x = nullptr; }; static_assert(std::is_trivial_v<NoThrowCopy> == false); static_assert(std::is_nothrow_move_constructible_v<NoThrowCopy> == false); static_assert(std::is_nothrow_move_assignable_v<NoThrowCopy> == false); static_assert(std::is_nothrow_copy_constructible_v<NoThrowCopy> == true); static_assert(std::is_nothrow_copy_assignable_v<NoThrowCopy> == true); struct Throwable { Throwable(int i) : x{ new int(i) } { } ~Throwable() noexcept { delete x; } // NOTE: not noexcept Throwable(const Throwable& other) : x{ new int(*other.x) } { } // NOTE: not noexcept Throwable& operator=(const Throwable& other) { x = new int(*other.x); return *this; } Throwable& operator=(Throwable&&) noexcept = delete; int& operator*() { return *x; } int* x = nullptr; }; static_assert(!std::is_trivial_v<Throwable>); static_assert(!std::is_nothrow_move_constructible_v<Throwable>); static_assert(!std::is_nothrow_move_assignable_v<Throwable>); static_assert(!std::is_nothrow_copy_constructible_v<Throwable>); static_assert(!std::is_nothrow_copy_assignable_v<Throwable>); TEST_CASE("Vector non-trivial types") { SECTION("Not trivial, but IsNoThrowMoveConstructible") { static_assert(!std::is_trivial_v<std::string>); static_assert(std::is_nothrow_move_constructible_v<std::string>); Vector<std::string> vec; for (int i = 0; i < 128; ++i) { REQUIRE(vec.size() == i); vec.append(std::to_string(i)); } REQUIRE(vec.size() == 128); for (int i = 0; i < 128; ++i) { REQUIRE(vec[i] == std::to_string(i)); } } SECTION("Not trivial, no nothrow move, but no throw copy") { static_assert(!std::is_trivial_v<NoThrowCopy>); static_assert(!std::is_nothrow_move_constructible_v<NoThrowCopy>); static_assert(std::is_nothrow_copy_constructible_v<NoThrowCopy>); Vector<NoThrowCopy> vec; for (int i = 0; i < 128; ++i) { REQUIRE(vec.size() == i); vec.append(i); REQUIRE(*vec[i] == i); } } SECTION("Throwable Copy") { static_assert(!std::is_trivial_v<Throwable>); static_assert(!std::is_nothrow_move_constructible_v<Throwable>); static_assert(!std::is_nothrow_copy_constructible_v<Throwable>); Vector<Throwable> vec; for (int i = 0; i < 128; ++i) { REQUIRE(vec.size() == i); vec.append(i); REQUIRE(*vec[i] == i); } } SECTION("copy assign std::string larger to smaller") { std::string astr("aaaaaaaaaaaaaaaaaaaaaaaaaaa"); // No SSO std::string bstr("bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"); // No SSO int N1 = 99; int N2 = 42; Vector<std::string> src(N1, astr); Vector<std::string> dst(N2, bstr); REQUIRE(src.size() == N1); REQUIRE(dst.size() == N2); REQUIRE(src[0] == astr); REQUIRE(src[src.size() - 1] == astr); REQUIRE(dst[0] == bstr); REQUIRE(dst[dst.size() - 1] == bstr); dst = src; REQUIRE(src.size() == dst.size()); REQUIRE(dst.size() == N1); for (int i = 0; i < src.size(); ++i) { REQUIRE(dst[i] == src[i]); } } SECTION("copy assign std::string smaller to larger") { std::string astr("aaaaaaaaaaaaaaaaaaaaaaaaaaa"); // No SSO std::string bstr("bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"); // No SSO int N1 = 42; int N2 = 99; Vector<std::string> src(N1, astr); Vector<std::string> dst(N2, bstr); REQUIRE(src.size() == N1); REQUIRE(dst.size() == N2); REQUIRE(src[0] == astr); REQUIRE(src[src.size() - 1] == astr); REQUIRE(dst[0] == bstr); REQUIRE(dst[dst.size() - 1] == bstr); dst = src; REQUIRE(src.size() == dst.size()); REQUIRE(dst.size() == N1); for (int i = 0; i < src.size(); ++i) { REQUIRE(dst[i] == src[i]); } } } TEST_CASE("Erase") { SECTION("Erase single trivial") { Vector<int> vec; for (int i = 0; i < 10; ++i) { vec.push_back(i); } REQUIRE(vec.size() == 10); // remove 5 Vector<int>::iterator iter = vec.erase(vec.begin() + 5); REQUIRE(vec.size() == 9); REQUIRE(*iter == 6); REQUIRE(vec[5] == 6); // remove 9 iter = vec.erase(vec.end() - 1); REQUIRE(vec.size() == 8); REQUIRE(iter == vec.end()); // remove 0 iter = vec.erase(vec.begin()); REQUIRE(vec.size() == 7); REQUIRE(*iter == 1); std::vector<int> expect = { 1, 2, 3, 4, 6, 7, 8 }; REQUIRE(vec.size() == expect.size()); for (int i = 0; i < vec.size(); ++i) { REQUIRE(vec[i] == expect[i]); } } SECTION("Erase single non-trivial") { Vector<std::string> vec; for (int i = 0; i < 10; ++i) { vec.push_back(std::to_string(i)); } REQUIRE(vec.size() == 10); // remove 5 Vector<std::string>::iterator iter = vec.erase(vec.begin() + 5); REQUIRE(vec.size() == 9); REQUIRE(*iter == "6"); REQUIRE(vec[5] == "6"); // remove 9 iter = vec.erase(vec.end() - 1); REQUIRE(vec.size() == 8); REQUIRE(iter == vec.end()); // remove 0 iter = vec.erase(vec.begin()); REQUIRE(vec.size() == 7); REQUIRE(*iter == "1"); std::vector<std::string> expect = { "1", "2", "3", "4", "6", "7", "8" }; REQUIRE(vec.size() == expect.size()); for (int i = 0; i < vec.size(); ++i) { REQUIRE(vec[i] == expect[i]); } } SECTION("std::vector erase range") { std::vector<int> vs = { 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 }; auto iter = vs.erase(vs.begin() + 2, vs.begin() + 7); REQUIRE(vs[0] == 0); REQUIRE(vs[1] == 1); REQUIRE(vs[2] == 7); REQUIRE(vs[3] == 8); REQUIRE(vs[4] == 9); REQUIRE(*iter == 7); } SECTION("erase range trivial") { static_assert(std::is_trivial_v<int>); auto vec = Vector<int>::make({ 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 }); REQUIRE(vec.size() == 10); // expect { 0, 1, 7, 8, 9 } Vector<int>::iterator iter = vec.erase(vec.begin() + 2, vec.begin() + 7); REQUIRE(vec.size() == 5); REQUIRE(vec[0] == 0); REQUIRE(vec[1] == 1); REQUIRE(vec[2] == 7); REQUIRE(vec[3] == 8); REQUIRE(vec[4] == 9); REQUIRE(*iter == 7); } SECTION("erase range is_nothrow_move_assignable") { static_assert(std::is_nothrow_move_assignable_v<std::string> == true); static_assert(std::is_trivial_v<std::string> == false); Vector<std::string> vec; for (int i = 0; i < 10; ++i) { vec.append(std::to_string(i)); } // start { 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 } // expect { 0, 1, 7, 8, 9 } Vector<std::string>::iterator iter = vec.erase(vec.begin() + 2, vec.begin() + 7); REQUIRE(vec.size() == 5); REQUIRE(vec[0] == "0"); REQUIRE(vec[1] == "1"); REQUIRE(vec[2] == "7"); REQUIRE(vec[3] == "8"); REQUIRE(vec[4] == "9"); REQUIRE(*iter == "7"); } }
#include <ATen/core/ivalue.h> #include <ATen/core/jit_type.h> #include <ATen/core/Formatting.h> #include <cmath> namespace c10 { namespace ivalue { CAFFE2_API c10::intrusive_ptr<ConstantString> ConstantString::create( std::string str_) { return c10::make_intrusive<ConstantString>(std::move(str_)); } } // namespace ivalue namespace { template<typename List> std::ostream& printList(std::ostream & out, const List &v, const std::string start, const std::string finish) { out << start; for(size_t i = 0; i < v->elements().size(); ++i) { if(i > 0) out << ", "; // make sure we use ivalue printing, and not default printing for the element type out << IValue(v->elements()[i]); } out << finish; return out; } template<typename Dict> std::ostream& printDict(std::ostream& out, const Dict& v) { out << "{"; bool first = true; for (const auto& pair : v->elements()) { if (!first) { out << ", "; } out << pair.first << ": " << pair.second; first = false; } out << "}"; return out; } } // anonymous namespace std::ostream& operator<<(std::ostream & out, const IValue & v) { switch(v.tag) { case IValue::Tag::None: return out << v.toNone(); case IValue::Tag::Tensor: return out << v.toTensor(); case IValue::Tag::Double: { double d = v.toDouble(); int c = std::fpclassify(d); if (c == FP_NORMAL || c == FP_ZERO) { int64_t i = int64_t(d); if (double(i) == d) { return out << i << "."; } } auto orig_prec = out.precision(); return out << std::setprecision(std::numeric_limits<double>::max_digits10) << v.toDouble() << std::setprecision(orig_prec); } case IValue::Tag::Int: return out << v.toInt(); case IValue::Tag::Bool: return out << (v.toBool() ? "True" : "False"); case IValue::Tag::Tuple: return printList(out, v.toTuple(), "(", ")"); case IValue::Tag::IntList: return printList(out, v.toIntList(), "[", "]"); case IValue::Tag::DoubleList: return printList(out, v.toDoubleList(), "[", "]"); case IValue::Tag::BoolList: return printList(out, v.toBoolList(), "[", "]"); case IValue::Tag::String: return out << v.toStringRef(); case IValue::Tag::TensorList: return printList(out, v.toTensorList(), "[", "]"); case IValue::Tag::Blob: return out << *v.toBlob(); case IValue::Tag::GenericList: return printList(out, v.toGenericList(), "[", "]"); case IValue::Tag::Future: return out << "Future"; case IValue::Tag::Device: return out << v.toDevice(); case IValue::Tag::GenericDict: return printDict(out, v.toGenericDict()); case IValue::Tag::Object: // TODO we should print the object contents return out << "Object<" << v.toObject()->name() << ">"; } AT_ERROR("Tag not found\n"); } #undef TORCH_FORALL_TAGS void IValue::dump() const { std::cout << *this << "\n"; } const std::string& ivalue::Object::name() const { return this->type_->qualname(); } void ivalue::Object::resizeObject(size_t slot) { AT_ASSERT(slot < type()->numAttributes()); slots_.resize(type()->numAttributes()); } static bool CompareIValue(const std::pair<IValue, IValue>& aWrap, const std::pair<IValue, IValue>& bWrap) { const auto a = aWrap.first; const auto b = bWrap.first; if (a.isString() && b.isString()) { return a.toStringRef().compare(b.toStringRef()) < 0; } else if (a.isInt() && b.isInt()) { return a.toInt() < b.toInt(); } else if (a.isDouble() && b.isDouble()) { return a.toDouble() < b.toDouble(); } AT_ERROR("Illegal dict key"); } const ivalue::GenericDict::IterationOrder ivalue::GenericDict::iterationOrder() const { IterationOrder ordered(elements().begin(), elements().end()); std::sort(ordered.begin(), ordered.end(), CompareIValue); return ordered; } } // namespace c10
#include "Platform.inc" #include "FarCalls.inc" #include "Timer0.inc" #include "TestFixture.inc" radix decimal udata global firstTMR0 global secondTMR0 global expectedElapsedTicks firstTMR0 res 1 secondTMR0 res 1 expectedElapsedTicks res 1 startTicks res 1 ElapsedTicksTest code global testArrange testArrange: banksel OPTION_REG bsf OPTION_REG, T0CS testAct: stubTMR0ForFirstValue: banksel firstTMR0 movf firstTMR0, W banksel TMR0 movwf TMR0 storeTimer0 startTicks stubTMR0ForSecondValue: banksel secondTMR0 movf secondTMR0, W banksel TMR0 movwf TMR0 calculateNumberOfElapsedTicks: movlw 0 elapsedSinceTimer0 startTicks testAssert: banksel expectedElapsedTicks .assert "W == expectedElapsedTicks, 'Elapsed number of ticks expectation failure.'" return end
#include "FireworkFactory.h" using namespace std; FireworkFactory::FireworkFactory(){ } // Receive a stack of Firework pointers and add them to the factories inventory. Fireworks must be sold in the order // that they are popped off the stack (The top of the stack is the oldest firework). void FireworkFactory::fireworkShipment(stack<Firework*>& fireworkShipment){ // TODO while(!fireworkShipment.empty()){ Firework *fw=fireworkShipment.top(); if(colorToString(fw->getColor()).compare("Orange")==0){ _op.push(fw); } else if(colorToString(fw->getColor()).compare("Green")==0){ _gp.push(fw); } else if(colorToString(fw->getColor()).compare("Blue")==0){ _bp.push(fw); } else if(colorToString(fw->getColor()).compare("Purple")==0){ _pp.push(fw); } _tinventory.push(fw); fireworkShipment.pop(); } } // Sell quantity fireworks by pushing them onto the customerStack with the oldest fireworks being sold first (FIFO). void FireworkFactory::sellFireworks(stack<Firework*>& customerStack, int quantity){ // TODO int i=0; while(i<quantity && !_tinventory.empty()){ Firework* fw=_tinventory.front(); if(colorToString(fw->getColor()).compare("Orange")==0){ if(fw==_op.front()){ customerStack.push(fw); _op.pop(); i=i+1; } } else if(colorToString(fw->getColor()).compare("Green")==0){ if(fw==_gp.front()){ customerStack.push(fw); _gp.pop(); i=i+1; } } else if(colorToString(fw->getColor()).compare("Blue")==0){ if(fw==_bp.front()){ customerStack.push(fw); _bp.pop(); i=i+1; } } else if(colorToString(fw->getColor()).compare("Purple")==0){ if(fw==_pp.front()){ customerStack.push(fw); _pp.pop(); i=i+1; } } _tinventory.pop(); } } // Before destroying the factory you must properly dispose of all the fireworks in your inventory (On the heap). FireworkFactory::~FireworkFactory(){ // TODO while(!_op.empty()){ Firework* a=_op.front(); delete a; _op.pop(); } while(!_gp.empty()){ Firework* a=_gp.front(); delete a; _gp.pop(); } while(!_bp.empty()){ Firework* a=_bp.front(); delete a; _bp.pop(); } while(!_pp.empty()){ Firework* a=_pp.front(); delete a; _pp.pop(); } } // Receive a shipment of metal which will be used to make new fireworks in the factory. Whenever the factory has 5 of // any type of metal it must immediately make a firework of the corresponding color and add it to the inventory. // To make a firework, you must use the new keyword to create it dynamically on the heap and manage a pointer to // the firework. void FireworkFactory::metalShipment(stack<Metal>& metalShipment){ // TODO while(!metalShipment.empty()){ if(colorToString(metalToColor(metalShipment.top())).compare("Orange")==0){ o=o+1; } else if(colorToString(metalToColor(metalShipment.top())).compare("Green")==0){ g=g+1; } else if(colorToString(metalToColor(metalShipment.top())).compare("Blue")==0){ b=b+1; } else if(colorToString(metalToColor(metalShipment.top())).compare("Purple")==0){ p=p+1; } if(o==5){ Firework* fw=new Firework(metalToColor(metalShipment.top())); _op.push(fw); _tinventory.push(fw); o=0; } else if(g==5){ Firework* fw=new Firework(metalToColor(metalShipment.top())); _gp.push(fw); _tinventory.push(fw); g=0; } else if(b==5){ Firework* fw=new Firework(metalToColor(metalShipment.top())); _bp.push(fw); _tinventory.push(fw); b=0; } else if(p==5){ Firework* fw=new Firework(metalToColor(metalShipment.top())); _pp.push(fw); _tinventory.push(fw); p=0; } metalShipment.pop(); } } // A customer is purchasing quantity fireworks, but they must all be of the color specified by the customer. The order // in which the fireworks are sold must be maintained (FIFO), but fireworks of the specified color can be sold before // other colors if there is no other way to fulfil the order. Be sure not to sell the same firework more than once with // either of the sellFireworks functions. // // For the efficient point of this assignment, this function must run in O(quantity) time. If only 1 firework is being // purchased, the runtime must be O(1) regardless of where the firework to be sold is in the inventory. void FireworkFactory::sellFireworks(stack<Firework*>& customerStack, int quantity, Color color){ // TODO std::string a=colorToString(color); if(a.compare("Orange")==0){ for(int i=0;i<quantity && !_tinventory.empty();i++){ customerStack.push(_op.front()); _op.pop(); } } else if(a.compare("Green")==0){ for(int i=0;i<quantity&&!_tinventory.empty();i++){ customerStack.push(_gp.front()); _gp.pop(); } } else if(a.compare("Blue")==0){ for(int i=0;i<quantity&&!_tinventory.empty();i++){ customerStack.push(_bp.front()); _bp.pop(); } } else if(a.compare("Purple")==0){ for(int i=0;i<quantity&&!_tinventory.empty();i++){ customerStack.push(_pp.front()); _pp.pop(); } } }
; A084382: a(n) = n^3 + 6. ; 6,7,14,33,70,131,222,349,518,735,1006,1337,1734,2203,2750,3381,4102,4919,5838,6865,8006,9267,10654,12173,13830,15631,17582,19689,21958,24395,27006,29797,32774,35943,39310,42881,46662,50659,54878,59325,64006,68927,74094,79513,85190,91131,97342,103829,110598,117655,125006,132657,140614,148883,157470,166381,175622,185199,195118,205385,216006,226987,238334,250053,262150,274631,287502,300769,314438,328515,343006,357917,373254,389023,405230,421881,438982,456539,474558,493045,512006,531447,551374,571793,592710,614131,636062,658509,681478,704975,729006,753577,778694,804363,830590,857381,884742,912679,941198,970305 pow $0,3 add $0,6
; A047673: Row 4 of square array defined in A047671. ; 1,13,61,193,481,1021,1933,3361,5473,8461,12541,17953,24961,33853,44941,58561,75073,94861,118333,145921,178081,215293,258061,306913,362401,425101,495613,574561,662593,760381,868621,988033,1119361 mov $1,$0 pow $0,2 add $0,$1 add $0,2 pow $0,2 sub $0,3
#ifndef HENYEYGREENSTEINPHASEFUNCTION_HPP_ #define HENYEYGREENSTEINPHASEFUNCTION_HPP_ #include "PhaseFunction.hpp" namespace Tungsten { class HenyeyGreensteinPhaseFunction : public PhaseFunction { float _g; inline float henyeyGreenstein(float cosTheta) const; public: HenyeyGreensteinPhaseFunction(); virtual void fromJson(const rapidjson::Value &v, const Scene &scene) override; virtual rapidjson::Value toJson(Allocator &allocator) const override; virtual Vec3f eval(const Vec3f &wi, const Vec3f &wo) const override; virtual bool sample(PathSampleGenerator &sampler, const Vec3f &wi, PhaseSample &sample) const override; virtual float pdf(const Vec3f &wi, const Vec3f &wo) const override; float g() const { return _g; } }; } #endif /* HENYEYGREENSTEINPHASEFUNCTION_HPP_ */
; A077847: Expansion of (1-x)^(-1)/(1-2*x-2*x^2+2*x^3). ; 1,3,9,23,59,147,367,911,2263,5615,13935,34575,85791,212863,528159,1310463,3251519,8067647,20017407,49667071,123233663,305766655,758666495,1882398975,4670597631,11588660223,28753717759,71343560703,177017236479,439214158847 add $0,1 seq $0,52987 ; Expansion of (1-2x^2)/(1-2x-2x^2+2x^3). sub $0,1
; A104638: Number of odd digits in n-th prime. ; 0,1,1,1,2,2,2,2,1,1,2,2,1,1,1,2,2,1,1,2,2,2,1,1,2,2,2,2,2,3,2,3,3,3,2,3,3,2,2,3,3,2,3,3,3,3,2,1,1,1,2,2,1,2,2,1,1,2,2,1,1,2,2,3,3,3,3,3,2,2,3,3,2,3,3,2,2,3,1,1,2,1,2,2,2,1,1,2,1,1,1,2,1,2,2,2,2,2,2,2 seq $0,40 ; The prime numbers. seq $0,196564 ; Number of odd digits in decimal representation of n.
; ; ANSI Video handling for the Epson PX4 ; By Stefano Bodrato - Nov 2014 ; ; Clean a text line ; ; in: A = text row number ; ; ; $Id: f_ansi_dline.asm,v 1.1 2015/11/05 16:08:04 stefano Exp $ ; PUBLIC ansi_del_line EXTERN base_graphics .ansi_del_line ld de,32*8 ld b,a ld hl,$e000 and a jr z,zline .lloop add hl,de djnz lloop .zline ld d,h ld e,l inc de ld (hl),0 ld bc,32*8 ldir ret
.global s_prepare_buffers s_prepare_buffers: push %r12 push %r14 push %r9 push %rax push %rcx push %rdi push %rsi lea addresses_UC_ht+0x29c5, %rsi lea addresses_D_ht+0x4093, %rdi nop nop nop xor $33089, %r9 mov $82, %rcx rep movsb nop nop nop xor $56436, %r14 lea addresses_WC_ht+0x11593, %r12 nop nop nop nop and $7324, %rax mov (%r12), %ecx nop nop inc %rsi lea addresses_D_ht+0x1bf93, %rsi clflush (%rsi) nop nop nop nop nop and $46875, %rcx mov $0x6162636465666768, %rdi movq %rdi, (%rsi) nop nop nop nop add $25877, %rcx pop %rsi pop %rdi pop %rcx pop %rax pop %r9 pop %r14 pop %r12 ret .global s_faulty_load s_faulty_load: push %r10 push %r11 push %r13 push %r14 push %rcx push %rdi push %rdx // Store lea addresses_RW+0x1f7b3, %r10 nop nop nop nop cmp $14271, %rdx mov $0x5152535455565758, %rdi movq %rdi, %xmm1 vmovups %ymm1, (%r10) xor %r13, %r13 // Faulty Load lea addresses_WC+0x1f893, %r11 nop nop xor $399, %r14 mov (%r11), %r10d lea oracles, %rdi and $0xff, %r10 shlq $12, %r10 mov (%rdi,%r10,1), %r10 pop %rdx pop %rdi pop %rcx pop %r14 pop %r13 pop %r11 pop %r10 ret /* <gen_faulty_load> [REF] {'src': {'congruent': 0, 'AVXalign': False, 'same': False, 'size': 32, 'NT': False, 'type': 'addresses_WC'}, 'OP': 'LOAD'} {'OP': 'STOR', 'dst': {'congruent': 3, 'AVXalign': False, 'same': False, 'size': 32, 'NT': False, 'type': 'addresses_RW'}} [Faulty Load] {'src': {'congruent': 0, 'AVXalign': False, 'same': True, 'size': 4, 'NT': False, 'type': 'addresses_WC'}, 'OP': 'LOAD'} <gen_prepare_buffer> {'src': {'congruent': 0, 'same': False, 'type': 'addresses_UC_ht'}, 'OP': 'REPM', 'dst': {'congruent': 11, 'same': False, 'type': 'addresses_D_ht'}} {'src': {'congruent': 8, 'AVXalign': False, 'same': False, 'size': 4, 'NT': False, 'type': 'addresses_WC_ht'}, 'OP': 'LOAD'} {'OP': 'STOR', 'dst': {'congruent': 8, 'AVXalign': False, 'same': False, 'size': 8, 'NT': False, 'type': 'addresses_D_ht'}} {'00': 85} 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 */
dnl AMD64 mpn_gcd_11 optimised for AMD BD2, BD3, BT2. dnl Based on the K7 gcd_1.asm, by Kevin Ryde. Rehacked for AMD64 by Torbjorn dnl Granlund. dnl Copyright 2000-2002, 2005, 2009, 2011, 2012, 2017, 2019 Free Software dnl Foundation, Inc. dnl This file is part of the GNU MP Library. dnl dnl The GNU MP Library is free software; you can redistribute it and/or modify dnl it under the terms of either: dnl dnl * the GNU Lesser General Public License as published by the Free dnl Software Foundation; either version 3 of the License, or (at your dnl option) any later version. dnl dnl or dnl dnl * the GNU General Public License as published by the Free Software dnl Foundation; either version 2 of the License, or (at your option) any dnl later version. dnl dnl or both in parallel, as here. dnl dnl The GNU MP Library is distributed in the hope that it will be useful, but dnl WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY dnl or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License dnl for more details. dnl dnl You should have received copies of the GNU General Public License and the dnl GNU Lesser General Public License along with the GNU MP Library. If not, dnl see https://www.gnu.org/licenses/. include(`../config.m4') C cycles/bit (approx) C AMD K8,K9 ? C AMD K10 ? C AMD bd1 5.4 C AMD bd2 3.72 C AMD bd3 ? C AMD bd4 4.12 C AMD bt1 9.0 C AMD bt2 3.97 C AMD zn1 3.36 C AMD zn2 3.33 C Intel P4 ? C Intel CNR ? C Intel PNR ? C Intel NHM ? C Intel WSM ? C Intel SBR ? C Intel IBR ? C Intel HWL ? C Intel BWL ? C Intel SKL ? C Intel atom ? C Intel SLM ? C Intel GLM ? C Intel GLM+ ? C VIA nano ? define(`u0', `%rdi') define(`v0', `%rsi') ABI_SUPPORT(DOS64) ABI_SUPPORT(STD64) ASM_START() TEXT ALIGN(64) PROLOGUE(mpn_gcd_11) FUNC_ENTRY(2) mov v0, %rdx sub u0, %rdx jz L(end) ALIGN(16) L(top): rep;bsf %rdx, %rcx C tzcnt! mov u0, %rax sub v0, u0 C u - v cmovc %rdx, u0 C u = |u - v| cmovc %rax, v0 C v = min(u,v) shr R8(%rcx), u0 mov v0, %rdx sub u0, %rdx C v - u jnz L(top) L(end): mov v0, %rax C rax = result C rdx = 0 for the benefit of internal gcd_22 call FUNC_EXIT() ret EPILOGUE()
; A101375: a(n) = n*(n+1)*(n^2-2*n+2)/2. ; 0,1,6,30,100,255,546,1036,1800,2925,4510,6666,9516,13195,17850,23640,30736,39321,49590,61750,76020,92631,111826,133860,159000,187525,219726,255906,296380,341475,391530,446896,507936,575025,648550,728910,816516,911791,1015170,1127100,1248040,1378461,1518846,1669690,1831500,2004795,2190106,2387976,2598960,2823625,3062550,3316326,3585556,3870855,4172850,4492180,4829496,5185461,5560750,5956050,6372060,6809491,7269066,7751520,8257600,8788065,9343686,9925246,10533540,11169375,11833570,12526956,13250376,14004685,14790750,15609450,16461676,17348331,18270330,19228600,20224080,21257721,22330486,23443350,24597300,25793335,27032466,28315716,29644120,31018725,32440590,33910786,35430396,37000515,38622250,40296720,42025056,43808401,45647910,47544750 mov $1,$0 bin $1,2 mul $1,$0 add $1,1 mul $0,$1
; ; Camputers Lynx C Library ; ; getk() Read key status ; ; Stefano Bodrato - 2014 ; ; ; $Id: getk.asm,v 1.2 2015/01/21 08:09:27 stefano Exp $ ; PUBLIC getk .getk call $9bd ld l,a ld h,0 ret
; DO NOT MODIFY THIS FILE DIRECTLY! ; author: @TinySecEx ; shadowssdt asm stub for 6.2.9200-sp0-windows-8 amd64 option casemap:none option prologue:none option epilogue:none .code ; ULONG64 __stdcall NtUserYieldTask( ); _6_2_9200_sp0_windows_8_NtUserYieldTask PROC STDCALL mov r10 , rcx mov eax , 4096 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserYieldTask ENDP ; ULONG64 __stdcall NtUserGetThreadState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetThreadState PROC STDCALL mov r10 , rcx mov eax , 4097 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetThreadState ENDP ; ULONG64 __stdcall NtUserPeekMessage( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserPeekMessage PROC STDCALL mov r10 , rcx mov eax , 4098 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPeekMessage ENDP ; ULONG64 __stdcall NtUserCallOneParam( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCallOneParam PROC STDCALL mov r10 , rcx mov eax , 4099 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallOneParam ENDP ; ULONG64 __stdcall NtUserGetKeyState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetKeyState PROC STDCALL mov r10 , rcx mov eax , 4100 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetKeyState ENDP ; ULONG64 __stdcall NtUserInvalidateRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserInvalidateRect PROC STDCALL mov r10 , rcx mov eax , 4101 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInvalidateRect ENDP ; ULONG64 __stdcall NtUserCallNoParam( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserCallNoParam PROC STDCALL mov r10 , rcx mov eax , 4102 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallNoParam ENDP ; ULONG64 __stdcall NtUserGetMessage( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetMessage PROC STDCALL mov r10 , rcx mov eax , 4103 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetMessage ENDP ; ULONG64 __stdcall NtUserMessageCall( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtUserMessageCall PROC STDCALL mov r10 , rcx mov eax , 4104 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMessageCall ENDP ; ULONG64 __stdcall NtGdiBitBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiBitBlt PROC STDCALL mov r10 , rcx mov eax , 4105 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBitBlt ENDP ; ULONG64 __stdcall NtGdiGetCharSet( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiGetCharSet PROC STDCALL mov r10 , rcx mov eax , 4106 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCharSet ENDP ; ULONG64 __stdcall NtUserGetDC( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetDC PROC STDCALL mov r10 , rcx mov eax , 4107 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetDC ENDP ; ULONG64 __stdcall NtGdiSelectBitmap( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSelectBitmap PROC STDCALL mov r10 , rcx mov eax , 4108 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSelectBitmap ENDP ; ULONG64 __stdcall NtUserWaitMessage( ); _6_2_9200_sp0_windows_8_NtUserWaitMessage PROC STDCALL mov r10 , rcx mov eax , 4109 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserWaitMessage ENDP ; ULONG64 __stdcall NtUserTranslateMessage( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserTranslateMessage PROC STDCALL mov r10 , rcx mov eax , 4110 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserTranslateMessage ENDP ; ULONG64 __stdcall NtUserGetProp( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetProp PROC STDCALL mov r10 , rcx mov eax , 4111 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetProp ENDP ; ULONG64 __stdcall NtUserPostMessage( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserPostMessage PROC STDCALL mov r10 , rcx mov eax , 4112 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPostMessage ENDP ; ULONG64 __stdcall NtUserQueryWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserQueryWindow PROC STDCALL mov r10 , rcx mov eax , 4113 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserQueryWindow ENDP ; ULONG64 __stdcall NtUserTranslateAccelerator( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserTranslateAccelerator PROC STDCALL mov r10 , rcx mov eax , 4114 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserTranslateAccelerator ENDP ; ULONG64 __stdcall NtGdiFlush( ); _6_2_9200_sp0_windows_8_NtGdiFlush PROC STDCALL mov r10 , rcx mov eax , 4115 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFlush ENDP ; ULONG64 __stdcall NtUserRedrawWindow( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserRedrawWindow PROC STDCALL mov r10 , rcx mov eax , 4116 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRedrawWindow ENDP ; ULONG64 __stdcall NtUserWindowFromPoint( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserWindowFromPoint PROC STDCALL mov r10 , rcx mov eax , 4117 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserWindowFromPoint ENDP ; ULONG64 __stdcall NtUserCallMsgFilter( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCallMsgFilter PROC STDCALL mov r10 , rcx mov eax , 4118 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallMsgFilter ENDP ; ULONG64 __stdcall NtUserValidateTimerCallback( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserValidateTimerCallback PROC STDCALL mov r10 , rcx mov eax , 4119 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserValidateTimerCallback ENDP ; ULONG64 __stdcall NtUserBeginPaint( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserBeginPaint PROC STDCALL mov r10 , rcx mov eax , 4120 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserBeginPaint ENDP ; ULONG64 __stdcall NtUserSetTimer( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserSetTimer PROC STDCALL mov r10 , rcx mov eax , 4121 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetTimer ENDP ; ULONG64 __stdcall NtUserEndPaint( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserEndPaint PROC STDCALL mov r10 , rcx mov eax , 4122 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEndPaint ENDP ; ULONG64 __stdcall NtUserSetCursor( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetCursor PROC STDCALL mov r10 , rcx mov eax , 4123 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetCursor ENDP ; ULONG64 __stdcall NtUserKillTimer( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserKillTimer PROC STDCALL mov r10 , rcx mov eax , 4124 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserKillTimer ENDP ; ULONG64 __stdcall NtUserBuildHwndList( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtUserBuildHwndList PROC STDCALL mov r10 , rcx mov eax , 4125 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserBuildHwndList ENDP ; ULONG64 __stdcall NtUserSelectPalette( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSelectPalette PROC STDCALL mov r10 , rcx mov eax , 4126 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSelectPalette ENDP ; ULONG64 __stdcall NtUserCallNextHookEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserCallNextHookEx PROC STDCALL mov r10 , rcx mov eax , 4127 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallNextHookEx ENDP ; ULONG64 __stdcall NtUserHideCaret( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserHideCaret PROC STDCALL mov r10 , rcx mov eax , 4128 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHideCaret ENDP ; ULONG64 __stdcall NtGdiIntersectClipRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiIntersectClipRect PROC STDCALL mov r10 , rcx mov eax , 4129 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiIntersectClipRect ENDP ; ULONG64 __stdcall NtUserCallHwndLock( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCallHwndLock PROC STDCALL mov r10 , rcx mov eax , 4130 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallHwndLock ENDP ; ULONG64 __stdcall NtUserGetProcessWindowStation( ); _6_2_9200_sp0_windows_8_NtUserGetProcessWindowStation PROC STDCALL mov r10 , rcx mov eax , 4131 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetProcessWindowStation ENDP ; ULONG64 __stdcall NtGdiDeleteObjectApp( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDeleteObjectApp PROC STDCALL mov r10 , rcx mov eax , 4132 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDeleteObjectApp ENDP ; ULONG64 __stdcall NtUserSetWindowPos( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtUserSetWindowPos PROC STDCALL mov r10 , rcx mov eax , 4133 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowPos ENDP ; ULONG64 __stdcall NtUserShowCaret( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserShowCaret PROC STDCALL mov r10 , rcx mov eax , 4134 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShowCaret ENDP ; ULONG64 __stdcall NtUserEndDeferWindowPosEx( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserEndDeferWindowPosEx PROC STDCALL mov r10 , rcx mov eax , 4135 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEndDeferWindowPosEx ENDP ; ULONG64 __stdcall NtUserCallHwndParamLock( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserCallHwndParamLock PROC STDCALL mov r10 , rcx mov eax , 4136 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallHwndParamLock ENDP ; ULONG64 __stdcall NtUserVkKeyScanEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserVkKeyScanEx PROC STDCALL mov r10 , rcx mov eax , 4137 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserVkKeyScanEx ENDP ; ULONG64 __stdcall NtGdiSetDIBitsToDeviceInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 , ULONG64 arg_13 , ULONG64 arg_14 , ULONG64 arg_15 , ULONG64 arg_16 ); _6_2_9200_sp0_windows_8_NtGdiSetDIBitsToDeviceInternal PROC STDCALL mov r10 , rcx mov eax , 4138 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetDIBitsToDeviceInternal ENDP ; ULONG64 __stdcall NtUserCallTwoParam( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserCallTwoParam PROC STDCALL mov r10 , rcx mov eax , 4139 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallTwoParam ENDP ; ULONG64 __stdcall NtGdiGetRandomRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetRandomRgn PROC STDCALL mov r10 , rcx mov eax , 4140 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetRandomRgn ENDP ; ULONG64 __stdcall NtUserCopyAcceleratorTable( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserCopyAcceleratorTable PROC STDCALL mov r10 , rcx mov eax , 4141 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCopyAcceleratorTable ENDP ; ULONG64 __stdcall NtUserNotifyWinEvent( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserNotifyWinEvent PROC STDCALL mov r10 , rcx mov eax , 4142 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserNotifyWinEvent ENDP ; ULONG64 __stdcall NtGdiExtSelectClipRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiExtSelectClipRgn PROC STDCALL mov r10 , rcx mov eax , 4143 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExtSelectClipRgn ENDP ; ULONG64 __stdcall NtUserIsClipboardFormatAvailable( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserIsClipboardFormatAvailable PROC STDCALL mov r10 , rcx mov eax , 4144 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserIsClipboardFormatAvailable ENDP ; ULONG64 __stdcall NtUserSetScrollInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetScrollInfo PROC STDCALL mov r10 , rcx mov eax , 4145 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetScrollInfo ENDP ; ULONG64 __stdcall GreStretchBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 ); _6_2_9200_sp0_windows_8_GreStretchBlt PROC STDCALL mov r10 , rcx mov eax , 4146 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_GreStretchBlt ENDP ; ULONG64 __stdcall NtUserCreateCaret( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserCreateCaret PROC STDCALL mov r10 , rcx mov eax , 4147 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateCaret ENDP ; ULONG64 __stdcall NtGdiRectVisible( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiRectVisible PROC STDCALL mov r10 , rcx mov eax , 4148 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRectVisible ENDP ; ULONG64 __stdcall NtGdiCombineRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiCombineRgn PROC STDCALL mov r10 , rcx mov eax , 4149 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCombineRgn ENDP ; ULONG64 __stdcall NtGdiGetDCObject( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetDCObject PROC STDCALL mov r10 , rcx mov eax , 4150 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDCObject ENDP ; ULONG64 __stdcall NtUserDispatchMessage( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDispatchMessage PROC STDCALL mov r10 , rcx mov eax , 4151 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDispatchMessage ENDP ; ULONG64 __stdcall NtUserRegisterWindowMessage( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserRegisterWindowMessage PROC STDCALL mov r10 , rcx mov eax , 4152 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterWindowMessage ENDP ; ULONG64 __stdcall NtGdiExtTextOutW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 ); _6_2_9200_sp0_windows_8_NtGdiExtTextOutW PROC STDCALL mov r10 , rcx mov eax , 4153 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExtTextOutW ENDP ; ULONG64 __stdcall NtGdiSelectFont( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSelectFont PROC STDCALL mov r10 , rcx mov eax , 4154 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSelectFont ENDP ; ULONG64 __stdcall NtGdiRestoreDC( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiRestoreDC PROC STDCALL mov r10 , rcx mov eax , 4155 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRestoreDC ENDP ; ULONG64 __stdcall NtGdiSaveDC( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiSaveDC PROC STDCALL mov r10 , rcx mov eax , 4156 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSaveDC ENDP ; ULONG64 __stdcall NtUserGetForegroundWindow( ); _6_2_9200_sp0_windows_8_NtUserGetForegroundWindow PROC STDCALL mov r10 , rcx mov eax , 4157 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetForegroundWindow ENDP ; ULONG64 __stdcall NtUserShowScrollBar( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserShowScrollBar PROC STDCALL mov r10 , rcx mov eax , 4158 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShowScrollBar ENDP ; ULONG64 __stdcall NtUserFindExistingCursorIcon( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserFindExistingCursorIcon PROC STDCALL mov r10 , rcx mov eax , 4159 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserFindExistingCursorIcon ENDP ; ULONG64 __stdcall NtGdiGetDCDword( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetDCDword PROC STDCALL mov r10 , rcx mov eax , 4160 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDCDword ENDP ; ULONG64 __stdcall NtGdiGetRegionData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetRegionData PROC STDCALL mov r10 , rcx mov eax , 4161 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetRegionData ENDP ; ULONG64 __stdcall NtGdiLineTo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiLineTo PROC STDCALL mov r10 , rcx mov eax , 4162 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiLineTo ENDP ; ULONG64 __stdcall NtUserSystemParametersInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSystemParametersInfo PROC STDCALL mov r10 , rcx mov eax , 4163 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSystemParametersInfo ENDP ; ULONG64 __stdcall NtGdiGetAppClipBox( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetAppClipBox PROC STDCALL mov r10 , rcx mov eax , 4164 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetAppClipBox ENDP ; ULONG64 __stdcall NtUserGetAsyncKeyState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetAsyncKeyState PROC STDCALL mov r10 , rcx mov eax , 4165 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetAsyncKeyState ENDP ; ULONG64 __stdcall NtUserGetCPD( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetCPD PROC STDCALL mov r10 , rcx mov eax , 4166 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetCPD ENDP ; ULONG64 __stdcall NtUserRemoveProp( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserRemoveProp PROC STDCALL mov r10 , rcx mov eax , 4167 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRemoveProp ENDP ; ULONG64 __stdcall NtGdiDoPalette( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiDoPalette PROC STDCALL mov r10 , rcx mov eax , 4168 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDoPalette ENDP ; ULONG64 __stdcall NtGdiPolyPolyDraw( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiPolyPolyDraw PROC STDCALL mov r10 , rcx mov eax , 4169 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPolyPolyDraw ENDP ; ULONG64 __stdcall NtUserSetCapture( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetCapture PROC STDCALL mov r10 , rcx mov eax , 4170 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetCapture ENDP ; ULONG64 __stdcall NtUserEnumDisplayMonitors( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserEnumDisplayMonitors PROC STDCALL mov r10 , rcx mov eax , 4171 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnumDisplayMonitors ENDP ; ULONG64 __stdcall NtGdiCreateCompatibleBitmap( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiCreateCompatibleBitmap PROC STDCALL mov r10 , rcx mov eax , 4172 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateCompatibleBitmap ENDP ; ULONG64 __stdcall NtUserSetProp( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetProp PROC STDCALL mov r10 , rcx mov eax , 4173 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetProp ENDP ; ULONG64 __stdcall NtGdiGetTextCharsetInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetTextCharsetInfo PROC STDCALL mov r10 , rcx mov eax , 4174 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetTextCharsetInfo ENDP ; ULONG64 __stdcall NtUserSBGetParms( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSBGetParms PROC STDCALL mov r10 , rcx mov eax , 4175 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSBGetParms ENDP ; ULONG64 __stdcall NtUserGetIconInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserGetIconInfo PROC STDCALL mov r10 , rcx mov eax , 4176 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetIconInfo ENDP ; ULONG64 __stdcall NtUserExcludeUpdateRgn( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserExcludeUpdateRgn PROC STDCALL mov r10 , rcx mov eax , 4177 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserExcludeUpdateRgn ENDP ; ULONG64 __stdcall NtUserSetFocus( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetFocus PROC STDCALL mov r10 , rcx mov eax , 4178 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetFocus ENDP ; ULONG64 __stdcall NtGdiExtGetObjectW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiExtGetObjectW PROC STDCALL mov r10 , rcx mov eax , 4179 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExtGetObjectW ENDP ; ULONG64 __stdcall NtUserGetUpdateRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetUpdateRect PROC STDCALL mov r10 , rcx mov eax , 4180 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetUpdateRect ENDP ; ULONG64 __stdcall NtGdiCreateCompatibleDC( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCreateCompatibleDC PROC STDCALL mov r10 , rcx mov eax , 4181 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateCompatibleDC ENDP ; ULONG64 __stdcall NtUserGetClipboardSequenceNumber( ); _6_2_9200_sp0_windows_8_NtUserGetClipboardSequenceNumber PROC STDCALL mov r10 , rcx mov eax , 4182 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClipboardSequenceNumber ENDP ; ULONG64 __stdcall NtGdiCreatePen( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiCreatePen PROC STDCALL mov r10 , rcx mov eax , 4183 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreatePen ENDP ; ULONG64 __stdcall NtUserShowWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserShowWindow PROC STDCALL mov r10 , rcx mov eax , 4184 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShowWindow ENDP ; ULONG64 __stdcall NtUserGetKeyboardLayoutList( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetKeyboardLayoutList PROC STDCALL mov r10 , rcx mov eax , 4185 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetKeyboardLayoutList ENDP ; ULONG64 __stdcall NtGdiPatBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiPatBlt PROC STDCALL mov r10 , rcx mov eax , 4186 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPatBlt ENDP ; ULONG64 __stdcall NtUserMapVirtualKeyEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserMapVirtualKeyEx PROC STDCALL mov r10 , rcx mov eax , 4187 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMapVirtualKeyEx ENDP ; ULONG64 __stdcall NtUserSetWindowLong( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetWindowLong PROC STDCALL mov r10 , rcx mov eax , 4188 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowLong ENDP ; ULONG64 __stdcall NtGdiHfontCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiHfontCreate PROC STDCALL mov r10 , rcx mov eax , 4189 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiHfontCreate ENDP ; ULONG64 __stdcall NtUserMoveWindow( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserMoveWindow PROC STDCALL mov r10 , rcx mov eax , 4190 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMoveWindow ENDP ; ULONG64 __stdcall NtUserPostThreadMessage( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserPostThreadMessage PROC STDCALL mov r10 , rcx mov eax , 4191 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPostThreadMessage ENDP ; ULONG64 __stdcall NtUserDrawIconEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtUserDrawIconEx PROC STDCALL mov r10 , rcx mov eax , 4192 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDrawIconEx ENDP ; ULONG64 __stdcall NtUserGetSystemMenu( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetSystemMenu PROC STDCALL mov r10 , rcx mov eax , 4193 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetSystemMenu ENDP ; ULONG64 __stdcall NtGdiDrawStream( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiDrawStream PROC STDCALL mov r10 , rcx mov eax , 4194 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDrawStream ENDP ; ULONG64 __stdcall NtUserInternalGetWindowText( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserInternalGetWindowText PROC STDCALL mov r10 , rcx mov eax , 4195 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInternalGetWindowText ENDP ; ULONG64 __stdcall NtUserGetWindowDC( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetWindowDC PROC STDCALL mov r10 , rcx mov eax , 4196 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowDC ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4197 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiInvertRgn( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiInvertRgn PROC STDCALL mov r10 , rcx mov eax , 4198 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiInvertRgn ENDP ; ULONG64 __stdcall NtGdiGetRgnBox( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetRgnBox PROC STDCALL mov r10 , rcx mov eax , 4199 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetRgnBox ENDP ; ULONG64 __stdcall NtGdiGetAndSetDCDword( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiGetAndSetDCDword PROC STDCALL mov r10 , rcx mov eax , 4200 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetAndSetDCDword ENDP ; ULONG64 __stdcall NtGdiMaskBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 , ULONG64 arg_13 ); _6_2_9200_sp0_windows_8_NtGdiMaskBlt PROC STDCALL mov r10 , rcx mov eax , 4201 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMaskBlt ENDP ; ULONG64 __stdcall NtGdiGetWidthTable( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiGetWidthTable PROC STDCALL mov r10 , rcx mov eax , 4202 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetWidthTable ENDP ; ULONG64 __stdcall NtUserScrollDC( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtUserScrollDC PROC STDCALL mov r10 , rcx mov eax , 4203 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserScrollDC ENDP ; ULONG64 __stdcall NtUserGetObjectInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserGetObjectInformation PROC STDCALL mov r10 , rcx mov eax , 4204 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetObjectInformation ENDP ; ULONG64 __stdcall NtGdiCreateBitmap( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiCreateBitmap PROC STDCALL mov r10 , rcx mov eax , 4205 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateBitmap ENDP ; ULONG64 __stdcall NtUserFindWindowEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserFindWindowEx PROC STDCALL mov r10 , rcx mov eax , 4206 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserFindWindowEx ENDP ; ULONG64 __stdcall NtGdiPolyPatBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiPolyPatBlt PROC STDCALL mov r10 , rcx mov eax , 4207 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPolyPatBlt ENDP ; ULONG64 __stdcall NtUserUnhookWindowsHookEx( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserUnhookWindowsHookEx PROC STDCALL mov r10 , rcx mov eax , 4208 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnhookWindowsHookEx ENDP ; ULONG64 __stdcall NtGdiGetNearestColor( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetNearestColor PROC STDCALL mov r10 , rcx mov eax , 4209 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetNearestColor ENDP ; ULONG64 __stdcall NtGdiTransformPoints( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiTransformPoints PROC STDCALL mov r10 , rcx mov eax , 4210 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiTransformPoints ENDP ; ULONG64 __stdcall NtGdiGetDCPoint( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetDCPoint PROC STDCALL mov r10 , rcx mov eax , 4211 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDCPoint ENDP ; ULONG64 __stdcall NtGdiCreateDIBBrush( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiCreateDIBBrush PROC STDCALL mov r10 , rcx mov eax , 4212 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateDIBBrush ENDP ; ULONG64 __stdcall NtGdiGetTextMetricsW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetTextMetricsW PROC STDCALL mov r10 , rcx mov eax , 4213 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetTextMetricsW ENDP ; ULONG64 __stdcall NtUserCreateWindowEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 , ULONG64 arg_13 , ULONG64 arg_14 , ULONG64 arg_15 , ULONG64 arg_16 ); _6_2_9200_sp0_windows_8_NtUserCreateWindowEx PROC STDCALL mov r10 , rcx mov eax , 4214 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateWindowEx ENDP ; ULONG64 __stdcall NtUserSetParent( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetParent PROC STDCALL mov r10 , rcx mov eax , 4215 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetParent ENDP ; ULONG64 __stdcall NtUserGetKeyboardState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetKeyboardState PROC STDCALL mov r10 , rcx mov eax , 4216 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetKeyboardState ENDP ; ULONG64 __stdcall NtUserToUnicodeEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtUserToUnicodeEx PROC STDCALL mov r10 , rcx mov eax , 4217 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserToUnicodeEx ENDP ; ULONG64 __stdcall NtUserGetControlBrush( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetControlBrush PROC STDCALL mov r10 , rcx mov eax , 4218 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetControlBrush ENDP ; ULONG64 __stdcall NtUserGetClassName( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetClassName PROC STDCALL mov r10 , rcx mov eax , 4219 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClassName ENDP ; ULONG64 __stdcall NtGdiAlphaBlend( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 ); _6_2_9200_sp0_windows_8_NtGdiAlphaBlend PROC STDCALL mov r10 , rcx mov eax , 4220 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAlphaBlend ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4221 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiOffsetRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiOffsetRgn PROC STDCALL mov r10 , rcx mov eax , 4222 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiOffsetRgn ENDP ; ULONG64 __stdcall NtUserDefSetText( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserDefSetText PROC STDCALL mov r10 , rcx mov eax , 4223 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDefSetText ENDP ; ULONG64 __stdcall NtGdiGetTextFaceW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiGetTextFaceW PROC STDCALL mov r10 , rcx mov eax , 4224 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetTextFaceW ENDP ; ULONG64 __stdcall NtGdiStretchDIBitsInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 , ULONG64 arg_13 , ULONG64 arg_14 , ULONG64 arg_15 , ULONG64 arg_16 ); _6_2_9200_sp0_windows_8_NtGdiStretchDIBitsInternal PROC STDCALL mov r10 , rcx mov eax , 4225 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiStretchDIBitsInternal ENDP ; ULONG64 __stdcall NtUserSendInput( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSendInput PROC STDCALL mov r10 , rcx mov eax , 4226 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSendInput ENDP ; ULONG64 __stdcall NtUserGetThreadDesktop( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetThreadDesktop PROC STDCALL mov r10 , rcx mov eax , 4227 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetThreadDesktop ENDP ; ULONG64 __stdcall NtGdiCreateRectRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiCreateRectRgn PROC STDCALL mov r10 , rcx mov eax , 4228 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateRectRgn ENDP ; ULONG64 __stdcall NtGdiGetDIBitsInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 ); _6_2_9200_sp0_windows_8_NtGdiGetDIBitsInternal PROC STDCALL mov r10 , rcx mov eax , 4229 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDIBitsInternal ENDP ; ULONG64 __stdcall NtUserGetUpdateRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetUpdateRgn PROC STDCALL mov r10 , rcx mov eax , 4230 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetUpdateRgn ENDP ; ULONG64 __stdcall NtGdiDeleteClientObj( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDeleteClientObj PROC STDCALL mov r10 , rcx mov eax , 4231 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDeleteClientObj ENDP ; ULONG64 __stdcall NtUserGetIconSize( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetIconSize PROC STDCALL mov r10 , rcx mov eax , 4232 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetIconSize ENDP ; ULONG64 __stdcall NtUserFillWindow( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserFillWindow PROC STDCALL mov r10 , rcx mov eax , 4233 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserFillWindow ENDP ; ULONG64 __stdcall NtGdiExtCreateRegion( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiExtCreateRegion PROC STDCALL mov r10 , rcx mov eax , 4234 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExtCreateRegion ENDP ; ULONG64 __stdcall NtGdiComputeXformCoefficients( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiComputeXformCoefficients PROC STDCALL mov r10 , rcx mov eax , 4235 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiComputeXformCoefficients ENDP ; ULONG64 __stdcall NtUserSetWindowsHookEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserSetWindowsHookEx PROC STDCALL mov r10 , rcx mov eax , 4236 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowsHookEx ENDP ; ULONG64 __stdcall NtUserNotifyProcessCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserNotifyProcessCreate PROC STDCALL mov r10 , rcx mov eax , 4237 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserNotifyProcessCreate ENDP ; ULONG64 __stdcall NtGdiUnrealizeObject( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiUnrealizeObject PROC STDCALL mov r10 , rcx mov eax , 4238 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiUnrealizeObject ENDP ; ULONG64 __stdcall NtUserGetTitleBarInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetTitleBarInfo PROC STDCALL mov r10 , rcx mov eax , 4239 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetTitleBarInfo ENDP ; ULONG64 __stdcall NtGdiRectangle( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiRectangle PROC STDCALL mov r10 , rcx mov eax , 4240 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRectangle ENDP ; ULONG64 __stdcall NtUserSetThreadDesktop( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetThreadDesktop PROC STDCALL mov r10 , rcx mov eax , 4241 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetThreadDesktop ENDP ; ULONG64 __stdcall NtUserGetDCEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetDCEx PROC STDCALL mov r10 , rcx mov eax , 4242 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetDCEx ENDP ; ULONG64 __stdcall NtUserGetScrollBarInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetScrollBarInfo PROC STDCALL mov r10 , rcx mov eax , 4243 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetScrollBarInfo ENDP ; ULONG64 __stdcall NtGdiGetTextExtent( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiGetTextExtent PROC STDCALL mov r10 , rcx mov eax , 4244 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetTextExtent ENDP ; ULONG64 __stdcall NtUserSetWindowFNID( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetWindowFNID PROC STDCALL mov r10 , rcx mov eax , 4245 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowFNID ENDP ; ULONG64 __stdcall NtGdiSetLayout( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetLayout PROC STDCALL mov r10 , rcx mov eax , 4246 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetLayout ENDP ; ULONG64 __stdcall NtUserCalcMenuBar( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserCalcMenuBar PROC STDCALL mov r10 , rcx mov eax , 4247 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCalcMenuBar ENDP ; ULONG64 __stdcall NtUserThunkedMenuItemInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserThunkedMenuItemInfo PROC STDCALL mov r10 , rcx mov eax , 4248 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserThunkedMenuItemInfo ENDP ; ULONG64 __stdcall NtGdiExcludeClipRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiExcludeClipRect PROC STDCALL mov r10 , rcx mov eax , 4249 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExcludeClipRect ENDP ; ULONG64 __stdcall NtGdiCreateDIBSection( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 ); _6_2_9200_sp0_windows_8_NtGdiCreateDIBSection PROC STDCALL mov r10 , rcx mov eax , 4250 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateDIBSection ENDP ; ULONG64 __stdcall NtGdiGetDCforBitmap( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiGetDCforBitmap PROC STDCALL mov r10 , rcx mov eax , 4251 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDCforBitmap ENDP ; ULONG64 __stdcall NtUserDestroyCursor( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserDestroyCursor PROC STDCALL mov r10 , rcx mov eax , 4252 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDestroyCursor ENDP ; ULONG64 __stdcall NtUserDestroyWindow( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDestroyWindow PROC STDCALL mov r10 , rcx mov eax , 4253 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDestroyWindow ENDP ; ULONG64 __stdcall NtUserCallHwndParam( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserCallHwndParam PROC STDCALL mov r10 , rcx mov eax , 4254 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallHwndParam ENDP ; ULONG64 __stdcall NtGdiCreateDIBitmapInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiCreateDIBitmapInternal PROC STDCALL mov r10 , rcx mov eax , 4255 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateDIBitmapInternal ENDP ; ULONG64 __stdcall NtUserOpenWindowStation( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserOpenWindowStation PROC STDCALL mov r10 , rcx mov eax , 4256 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserOpenWindowStation ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4257 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4258 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4259 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtUserSetCursorIconData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetCursorIconData PROC STDCALL mov r10 , rcx mov eax , 4260 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetCursorIconData ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4261 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtUserCloseDesktop( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserCloseDesktop PROC STDCALL mov r10 , rcx mov eax , 4262 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCloseDesktop ENDP ; ULONG64 __stdcall NtUserOpenDesktop( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserOpenDesktop PROC STDCALL mov r10 , rcx mov eax , 4263 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserOpenDesktop ENDP ; ULONG64 __stdcall NtUserSetProcessWindowStation( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetProcessWindowStation PROC STDCALL mov r10 , rcx mov eax , 4264 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetProcessWindowStation ENDP ; ULONG64 __stdcall NtUserGetAtomName( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetAtomName PROC STDCALL mov r10 , rcx mov eax , 4265 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetAtomName ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4266 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiExtCreatePen( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiExtCreatePen PROC STDCALL mov r10 , rcx mov eax , 4267 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExtCreatePen ENDP ; ULONG64 __stdcall NtGdiCreatePaletteInternal( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiCreatePaletteInternal PROC STDCALL mov r10 , rcx mov eax , 4268 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreatePaletteInternal ENDP ; ULONG64 __stdcall NtGdiSetBrushOrg( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiSetBrushOrg PROC STDCALL mov r10 , rcx mov eax , 4269 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetBrushOrg ENDP ; ULONG64 __stdcall NtUserBuildNameList( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserBuildNameList PROC STDCALL mov r10 , rcx mov eax , 4270 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserBuildNameList ENDP ; ULONG64 __stdcall NtGdiSetPixel( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiSetPixel PROC STDCALL mov r10 , rcx mov eax , 4271 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetPixel ENDP ; ULONG64 __stdcall NtUserRegisterClassExWOW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtUserRegisterClassExWOW PROC STDCALL mov r10 , rcx mov eax , 4272 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterClassExWOW ENDP ; ULONG64 __stdcall NtGdiCreatePatternBrushInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiCreatePatternBrushInternal PROC STDCALL mov r10 , rcx mov eax , 4273 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreatePatternBrushInternal ENDP ; ULONG64 __stdcall NtUserGetAncestor( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetAncestor PROC STDCALL mov r10 , rcx mov eax , 4274 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetAncestor ENDP ; ULONG64 __stdcall NtGdiGetOutlineTextMetricsInternalW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiGetOutlineTextMetricsInternalW PROC STDCALL mov r10 , rcx mov eax , 4275 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetOutlineTextMetricsInternalW ENDP ; ULONG64 __stdcall NtGdiSetBitmapBits( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetBitmapBits PROC STDCALL mov r10 , rcx mov eax , 4276 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetBitmapBits ENDP ; ULONG64 __stdcall NtUserCloseWindowStation( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserCloseWindowStation PROC STDCALL mov r10 , rcx mov eax , 4277 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCloseWindowStation ENDP ; ULONG64 __stdcall NtUserGetDoubleClickTime( ); _6_2_9200_sp0_windows_8_NtUserGetDoubleClickTime PROC STDCALL mov r10 , rcx mov eax , 4278 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetDoubleClickTime ENDP ; ULONG64 __stdcall NtUserEnableScrollBar( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserEnableScrollBar PROC STDCALL mov r10 , rcx mov eax , 4279 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnableScrollBar ENDP ; ULONG64 __stdcall NtGdiCreateSolidBrush( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiCreateSolidBrush PROC STDCALL mov r10 , rcx mov eax , 4280 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateSolidBrush ENDP ; ULONG64 __stdcall NtUserGetClassInfoEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserGetClassInfoEx PROC STDCALL mov r10 , rcx mov eax , 4281 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClassInfoEx ENDP ; ULONG64 __stdcall NtGdiCreateClientObj( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCreateClientObj PROC STDCALL mov r10 , rcx mov eax , 4282 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateClientObj ENDP ; ULONG64 __stdcall NtUserUnregisterClass( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserUnregisterClass PROC STDCALL mov r10 , rcx mov eax , 4283 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnregisterClass ENDP ; ULONG64 __stdcall NtUserDeleteMenu( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserDeleteMenu PROC STDCALL mov r10 , rcx mov eax , 4284 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDeleteMenu ENDP ; ULONG64 __stdcall NtGdiRectInRegion( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiRectInRegion PROC STDCALL mov r10 , rcx mov eax , 4285 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRectInRegion ENDP ; ULONG64 __stdcall NtUserScrollWindowEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtUserScrollWindowEx PROC STDCALL mov r10 , rcx mov eax , 4286 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserScrollWindowEx ENDP ; ULONG64 __stdcall NtGdiGetPixel( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetPixel PROC STDCALL mov r10 , rcx mov eax , 4287 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetPixel ENDP ; ULONG64 __stdcall NtUserSetClassLong( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetClassLong PROC STDCALL mov r10 , rcx mov eax , 4288 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetClassLong ENDP ; ULONG64 __stdcall NtUserGetMenuBarInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetMenuBarInfo PROC STDCALL mov r10 , rcx mov eax , 4289 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetMenuBarInfo ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4290 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4291 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiGetNearestPaletteIndex( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetNearestPaletteIndex PROC STDCALL mov r10 , rcx mov eax , 4292 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetNearestPaletteIndex ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4293 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4294 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiGetCharWidthW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiGetCharWidthW PROC STDCALL mov r10 , rcx mov eax , 4295 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCharWidthW ENDP ; ULONG64 __stdcall NtUserInvalidateRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserInvalidateRgn PROC STDCALL mov r10 , rcx mov eax , 4296 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInvalidateRgn ENDP ; ULONG64 __stdcall NtUserGetClipboardOwner( ); _6_2_9200_sp0_windows_8_NtUserGetClipboardOwner PROC STDCALL mov r10 , rcx mov eax , 4297 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClipboardOwner ENDP ; ULONG64 __stdcall NtUserSetWindowRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetWindowRgn PROC STDCALL mov r10 , rcx mov eax , 4298 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowRgn ENDP ; ULONG64 __stdcall NtUserBitBltSysBmp( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtUserBitBltSysBmp PROC STDCALL mov r10 , rcx mov eax , 4299 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserBitBltSysBmp ENDP ; ULONG64 __stdcall NtGdiGetCharWidthInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetCharWidthInfo PROC STDCALL mov r10 , rcx mov eax , 4300 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCharWidthInfo ENDP ; ULONG64 __stdcall NtUserValidateRect( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserValidateRect PROC STDCALL mov r10 , rcx mov eax , 4301 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserValidateRect ENDP ; ULONG64 __stdcall NtUserCloseClipboard( ); _6_2_9200_sp0_windows_8_NtUserCloseClipboard PROC STDCALL mov r10 , rcx mov eax , 4302 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCloseClipboard ENDP ; ULONG64 __stdcall NtUserOpenClipboard( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserOpenClipboard PROC STDCALL mov r10 , rcx mov eax , 4303 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserOpenClipboard ENDP ; ULONG64 __stdcall NtGdiGetStockObject( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiGetStockObject PROC STDCALL mov r10 , rcx mov eax , 4304 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetStockObject ENDP ; ULONG64 __stdcall NtUserSetClipboardData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetClipboardData PROC STDCALL mov r10 , rcx mov eax , 4305 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetClipboardData ENDP ; ULONG64 __stdcall NtUserEnableMenuItem( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserEnableMenuItem PROC STDCALL mov r10 , rcx mov eax , 4306 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnableMenuItem ENDP ; ULONG64 __stdcall NtUserAlterWindowStyle( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserAlterWindowStyle PROC STDCALL mov r10 , rcx mov eax , 4307 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserAlterWindowStyle ENDP ; ULONG64 __stdcall NtGdiFillRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiFillRgn PROC STDCALL mov r10 , rcx mov eax , 4308 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFillRgn ENDP ; ULONG64 __stdcall NtUserGetWindowPlacement( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetWindowPlacement PROC STDCALL mov r10 , rcx mov eax , 4309 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowPlacement ENDP ; ULONG64 __stdcall NtGdiModifyWorldTransform( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiModifyWorldTransform PROC STDCALL mov r10 , rcx mov eax , 4310 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiModifyWorldTransform ENDP ; ULONG64 __stdcall NtGdiGetFontData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiGetFontData PROC STDCALL mov r10 , rcx mov eax , 4311 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetFontData ENDP ; ULONG64 __stdcall NtUserGetOpenClipboardWindow( ); _6_2_9200_sp0_windows_8_NtUserGetOpenClipboardWindow PROC STDCALL mov r10 , rcx mov eax , 4312 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetOpenClipboardWindow ENDP ; ULONG64 __stdcall NtUserSetThreadState( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetThreadState PROC STDCALL mov r10 , rcx mov eax , 4313 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetThreadState ENDP ; ULONG64 __stdcall NtGdiOpenDCW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 ); _6_2_9200_sp0_windows_8_NtGdiOpenDCW PROC STDCALL mov r10 , rcx mov eax , 4314 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiOpenDCW ENDP ; ULONG64 __stdcall NtUserTrackMouseEvent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserTrackMouseEvent PROC STDCALL mov r10 , rcx mov eax , 4315 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserTrackMouseEvent ENDP ; ULONG64 __stdcall NtGdiGetTransform( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetTransform PROC STDCALL mov r10 , rcx mov eax , 4316 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetTransform ENDP ; ULONG64 __stdcall NtUserDestroyMenu( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDestroyMenu PROC STDCALL mov r10 , rcx mov eax , 4317 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDestroyMenu ENDP ; ULONG64 __stdcall NtGdiGetBitmapBits( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetBitmapBits PROC STDCALL mov r10 , rcx mov eax , 4318 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetBitmapBits ENDP ; ULONG64 __stdcall NtUserConsoleControl( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserConsoleControl PROC STDCALL mov r10 , rcx mov eax , 4319 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserConsoleControl ENDP ; ULONG64 __stdcall NtUserSetActiveWindow( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetActiveWindow PROC STDCALL mov r10 , rcx mov eax , 4320 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetActiveWindow ENDP ; ULONG64 __stdcall NtUserSetInformationThread( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetInformationThread PROC STDCALL mov r10 , rcx mov eax , 4321 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetInformationThread ENDP ; ULONG64 __stdcall NtUserSetWindowPlacement( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetWindowPlacement PROC STDCALL mov r10 , rcx mov eax , 4322 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowPlacement ENDP ; ULONG64 __stdcall NtUserGetControlColor( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetControlColor PROC STDCALL mov r10 , rcx mov eax , 4323 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetControlColor ENDP ; ULONG64 __stdcall NtGdiSetMetaRgn( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiSetMetaRgn PROC STDCALL mov r10 , rcx mov eax , 4324 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetMetaRgn ENDP ; ULONG64 __stdcall NtGdiSetMiterLimit( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetMiterLimit PROC STDCALL mov r10 , rcx mov eax , 4325 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetMiterLimit ENDP ; ULONG64 __stdcall NtGdiSetVirtualResolution( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiSetVirtualResolution PROC STDCALL mov r10 , rcx mov eax , 4326 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetVirtualResolution ENDP ; ULONG64 __stdcall NtGdiGetRasterizerCaps( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetRasterizerCaps PROC STDCALL mov r10 , rcx mov eax , 4327 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetRasterizerCaps ENDP ; ULONG64 __stdcall NtUserSetWindowWord( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetWindowWord PROC STDCALL mov r10 , rcx mov eax , 4328 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowWord ENDP ; ULONG64 __stdcall NtUserGetClipboardFormatName( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetClipboardFormatName PROC STDCALL mov r10 , rcx mov eax , 4329 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClipboardFormatName ENDP ; ULONG64 __stdcall NtUserRealInternalGetMessage( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserRealInternalGetMessage PROC STDCALL mov r10 , rcx mov eax , 4330 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRealInternalGetMessage ENDP ; ULONG64 __stdcall NtUserCreateLocalMemHandle( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserCreateLocalMemHandle PROC STDCALL mov r10 , rcx mov eax , 4331 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateLocalMemHandle ENDP ; ULONG64 __stdcall NtUserAttachThreadInput( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserAttachThreadInput PROC STDCALL mov r10 , rcx mov eax , 4332 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserAttachThreadInput ENDP ; ULONG64 __stdcall NtGdiCreateHalftonePalette( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCreateHalftonePalette PROC STDCALL mov r10 , rcx mov eax , 4333 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateHalftonePalette ENDP ; ULONG64 __stdcall NtUserPaintMenuBar( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserPaintMenuBar PROC STDCALL mov r10 , rcx mov eax , 4334 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPaintMenuBar ENDP ; ULONG64 __stdcall NtUserSetKeyboardState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetKeyboardState PROC STDCALL mov r10 , rcx mov eax , 4335 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetKeyboardState ENDP ; ULONG64 __stdcall NtGdiCombineTransform( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiCombineTransform PROC STDCALL mov r10 , rcx mov eax , 4336 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCombineTransform ENDP ; ULONG64 __stdcall NtUserCreateAcceleratorTable( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCreateAcceleratorTable PROC STDCALL mov r10 , rcx mov eax , 4337 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateAcceleratorTable ENDP ; ULONG64 __stdcall NtUserGetCursorFrameInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetCursorFrameInfo PROC STDCALL mov r10 , rcx mov eax , 4338 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetCursorFrameInfo ENDP ; ULONG64 __stdcall NtUserGetAltTabInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserGetAltTabInfo PROC STDCALL mov r10 , rcx mov eax , 4339 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetAltTabInfo ENDP ; ULONG64 __stdcall NtUserGetCaretBlinkTime( ); _6_2_9200_sp0_windows_8_NtUserGetCaretBlinkTime PROC STDCALL mov r10 , rcx mov eax , 4340 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetCaretBlinkTime ENDP ; ULONG64 __stdcall NtGdiQueryFontAssocInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiQueryFontAssocInfo PROC STDCALL mov r10 , rcx mov eax , 4341 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiQueryFontAssocInfo ENDP ; ULONG64 __stdcall NtUserProcessConnect( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserProcessConnect PROC STDCALL mov r10 , rcx mov eax , 4342 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserProcessConnect ENDP ; ULONG64 __stdcall NtUserEnumDisplayDevices( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserEnumDisplayDevices PROC STDCALL mov r10 , rcx mov eax , 4343 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnumDisplayDevices ENDP ; ULONG64 __stdcall NtUserEmptyClipboard( ); _6_2_9200_sp0_windows_8_NtUserEmptyClipboard PROC STDCALL mov r10 , rcx mov eax , 4344 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEmptyClipboard ENDP ; ULONG64 __stdcall NtUserGetClipboardData( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetClipboardData PROC STDCALL mov r10 , rcx mov eax , 4345 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClipboardData ENDP ; ULONG64 __stdcall NtUserRemoveMenu( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserRemoveMenu PROC STDCALL mov r10 , rcx mov eax , 4346 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRemoveMenu ENDP ; ULONG64 __stdcall NtGdiSetBoundsRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetBoundsRect PROC STDCALL mov r10 , rcx mov eax , 4347 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetBoundsRect ENDP ; ULONG64 __stdcall NtGdiGetBitmapDimension( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetBitmapDimension PROC STDCALL mov r10 , rcx mov eax , 4348 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetBitmapDimension ENDP ; ULONG64 __stdcall NtUserConvertMemHandle( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserConvertMemHandle PROC STDCALL mov r10 , rcx mov eax , 4349 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserConvertMemHandle ENDP ; ULONG64 __stdcall NtUserDestroyAcceleratorTable( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDestroyAcceleratorTable PROC STDCALL mov r10 , rcx mov eax , 4350 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDestroyAcceleratorTable ENDP ; ULONG64 __stdcall NtUserGetGUIThreadInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetGUIThreadInfo PROC STDCALL mov r10 , rcx mov eax , 4351 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetGUIThreadInfo ENDP ; ULONG64 __stdcall NtGdiCloseFigure( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCloseFigure PROC STDCALL mov r10 , rcx mov eax , 4352 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCloseFigure ENDP ; ULONG64 __stdcall NtUserSetWindowsHookAW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetWindowsHookAW PROC STDCALL mov r10 , rcx mov eax , 4353 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowsHookAW ENDP ; ULONG64 __stdcall NtUserSetMenuDefaultItem( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetMenuDefaultItem PROC STDCALL mov r10 , rcx mov eax , 4354 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetMenuDefaultItem ENDP ; ULONG64 __stdcall NtUserCheckMenuItem( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserCheckMenuItem PROC STDCALL mov r10 , rcx mov eax , 4355 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCheckMenuItem ENDP ; ULONG64 __stdcall NtUserSetWinEventHook( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtUserSetWinEventHook PROC STDCALL mov r10 , rcx mov eax , 4356 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWinEventHook ENDP ; ULONG64 __stdcall NtUserUnhookWinEvent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserUnhookWinEvent PROC STDCALL mov r10 , rcx mov eax , 4357 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnhookWinEvent ENDP ; ULONG64 __stdcall NtUserLockWindowUpdate( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserLockWindowUpdate PROC STDCALL mov r10 , rcx mov eax , 4358 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserLockWindowUpdate ENDP ; ULONG64 __stdcall NtUserSetSystemMenu( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetSystemMenu PROC STDCALL mov r10 , rcx mov eax , 4359 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetSystemMenu ENDP ; ULONG64 __stdcall NtUserThunkedMenuInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserThunkedMenuInfo PROC STDCALL mov r10 , rcx mov eax , 4360 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserThunkedMenuInfo ENDP ; ULONG64 __stdcall NtGdiBeginPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiBeginPath PROC STDCALL mov r10 , rcx mov eax , 4361 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBeginPath ENDP ; ULONG64 __stdcall NtGdiEndPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEndPath PROC STDCALL mov r10 , rcx mov eax , 4362 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEndPath ENDP ; ULONG64 __stdcall NtGdiFillPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiFillPath PROC STDCALL mov r10 , rcx mov eax , 4363 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFillPath ENDP ; ULONG64 __stdcall NtUserCallHwnd( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCallHwnd PROC STDCALL mov r10 , rcx mov eax , 4364 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallHwnd ENDP ; ULONG64 __stdcall NtUserDdeInitialize( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserDdeInitialize PROC STDCALL mov r10 , rcx mov eax , 4365 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDdeInitialize ENDP ; ULONG64 __stdcall NtUserModifyUserStartupInfoFlags( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserModifyUserStartupInfoFlags PROC STDCALL mov r10 , rcx mov eax , 4366 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserModifyUserStartupInfoFlags ENDP ; ULONG64 __stdcall NtUserCountClipboardFormats( ); _6_2_9200_sp0_windows_8_NtUserCountClipboardFormats PROC STDCALL mov r10 , rcx mov eax , 4367 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCountClipboardFormats ENDP ; ULONG64 __stdcall NtGdiAddFontMemResourceEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiAddFontMemResourceEx PROC STDCALL mov r10 , rcx mov eax , 4368 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAddFontMemResourceEx ENDP ; ULONG64 __stdcall NtGdiEqualRgn( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiEqualRgn PROC STDCALL mov r10 , rcx mov eax , 4369 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEqualRgn ENDP ; ULONG64 __stdcall NtGdiGetSystemPaletteUse( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiGetSystemPaletteUse PROC STDCALL mov r10 , rcx mov eax , 4370 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetSystemPaletteUse ENDP ; ULONG64 __stdcall NtGdiRemoveFontMemResourceEx( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiRemoveFontMemResourceEx PROC STDCALL mov r10 , rcx mov eax , 4371 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRemoveFontMemResourceEx ENDP ; ULONG64 __stdcall NtUserEnumDisplaySettings( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserEnumDisplaySettings PROC STDCALL mov r10 , rcx mov eax , 4372 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnumDisplaySettings ENDP ; ULONG64 __stdcall NtUserPaintDesktop( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserPaintDesktop PROC STDCALL mov r10 , rcx mov eax , 4373 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPaintDesktop ENDP ; ULONG64 __stdcall NtGdiExtEscape( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiExtEscape PROC STDCALL mov r10 , rcx mov eax , 4374 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExtEscape ENDP ; ULONG64 __stdcall NtGdiSetBitmapDimension( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiSetBitmapDimension PROC STDCALL mov r10 , rcx mov eax , 4375 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetBitmapDimension ENDP ; ULONG64 __stdcall NtGdiSetFontEnumeration( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiSetFontEnumeration PROC STDCALL mov r10 , rcx mov eax , 4376 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetFontEnumeration ENDP ; ULONG64 __stdcall NtUserChangeClipboardChain( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserChangeClipboardChain PROC STDCALL mov r10 , rcx mov eax , 4377 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserChangeClipboardChain ENDP ; ULONG64 __stdcall NtUserSetClipboardViewer( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetClipboardViewer PROC STDCALL mov r10 , rcx mov eax , 4378 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetClipboardViewer ENDP ; ULONG64 __stdcall NtUserShowWindowAsync( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserShowWindowAsync PROC STDCALL mov r10 , rcx mov eax , 4379 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShowWindowAsync ENDP ; ULONG64 __stdcall NtGdiCreateColorSpace( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCreateColorSpace PROC STDCALL mov r10 , rcx mov eax , 4380 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateColorSpace ENDP ; ULONG64 __stdcall NtGdiDeleteColorSpace( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDeleteColorSpace PROC STDCALL mov r10 , rcx mov eax , 4381 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDeleteColorSpace ENDP ; ULONG64 __stdcall NtUserActivateKeyboardLayout( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserActivateKeyboardLayout PROC STDCALL mov r10 , rcx mov eax , 4382 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserActivateKeyboardLayout ENDP ; ULONG64 __stdcall NtBindCompositionSurface( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtBindCompositionSurface PROC STDCALL mov r10 , rcx mov eax , 4383 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtBindCompositionSurface ENDP ; ULONG64 __stdcall NtCreateCompositionSurfaceHandle( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtCreateCompositionSurfaceHandle PROC STDCALL mov r10 , rcx mov eax , 4384 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtCreateCompositionSurfaceHandle ENDP ; ULONG64 __stdcall NtDCompositionAddCrossDeviceVisualChild( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtDCompositionAddCrossDeviceVisualChild PROC STDCALL mov r10 , rcx mov eax , 4385 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionAddCrossDeviceVisualChild ENDP ; ULONG64 __stdcall NtDCompositionAddVisualChild( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtDCompositionAddVisualChild PROC STDCALL mov r10 , rcx mov eax , 4386 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionAddVisualChild ENDP ; ULONG64 __stdcall NtDCompositionBeginFrame( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionBeginFrame PROC STDCALL mov r10 , rcx mov eax , 4387 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionBeginFrame ENDP ; ULONG64 __stdcall NtDCompositionCommitChannel( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionCommitChannel PROC STDCALL mov r10 , rcx mov eax , 4388 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionCommitChannel ENDP ; ULONG64 __stdcall NtDCompositionConfirmFrame( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionConfirmFrame PROC STDCALL mov r10 , rcx mov eax , 4389 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionConfirmFrame ENDP ; ULONG64 __stdcall NtDCompositionGetChannels( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionGetChannels PROC STDCALL mov r10 , rcx mov eax , 4390 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionGetChannels ENDP ; ULONG64 __stdcall NtDCompositionCreateChannel( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtDCompositionCreateChannel PROC STDCALL mov r10 , rcx mov eax , 4391 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionCreateChannel ENDP ; ULONG64 __stdcall NtDCompositionCreateConnectionContext( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionCreateConnectionContext PROC STDCALL mov r10 , rcx mov eax , 4392 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionCreateConnectionContext ENDP ; ULONG64 __stdcall NtDCompositionCreateDwmChannel( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtDCompositionCreateDwmChannel PROC STDCALL mov r10 , rcx mov eax , 4393 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionCreateDwmChannel ENDP ; ULONG64 __stdcall NtDCompositionCreateResource( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionCreateResource PROC STDCALL mov r10 , rcx mov eax , 4394 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionCreateResource ENDP ; ULONG64 __stdcall NtDCompositionCurrentBatchId( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionCurrentBatchId PROC STDCALL mov r10 , rcx mov eax , 4395 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionCurrentBatchId ENDP ; ULONG64 __stdcall NtDCompositionDestroyChannel( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtDCompositionDestroyChannel PROC STDCALL mov r10 , rcx mov eax , 4396 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionDestroyChannel ENDP ; ULONG64 __stdcall NtDCompositionDestroyConnectionContext( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtDCompositionDestroyConnectionContext PROC STDCALL mov r10 , rcx mov eax , 4397 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionDestroyConnectionContext ENDP ; ULONG64 __stdcall NtDCompositionDiscardFrame( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionDiscardFrame PROC STDCALL mov r10 , rcx mov eax , 4398 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionDiscardFrame ENDP ; ULONG64 __stdcall NtDCompositionDwmSyncFlush( ); _6_2_9200_sp0_windows_8_NtDCompositionDwmSyncFlush PROC STDCALL mov r10 , rcx mov eax , 4399 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionDwmSyncFlush ENDP ; ULONG64 __stdcall NtDCompositionGetChannels( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionGetChannels PROC STDCALL mov r10 , rcx mov eax , 4400 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionGetChannels ENDP ; ULONG64 __stdcall NtDCompositionGetConnectionContextBatch( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtDCompositionGetConnectionContextBatch PROC STDCALL mov r10 , rcx mov eax , 4401 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionGetConnectionContextBatch ENDP ; ULONG64 __stdcall NtDCompositionGetDeletedResources( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionGetDeletedResources PROC STDCALL mov r10 , rcx mov eax , 4402 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionGetDeletedResources ENDP ; ULONG64 __stdcall NtDCompositionGetFrameLegacyTokens( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtDCompositionGetFrameLegacyTokens PROC STDCALL mov r10 , rcx mov eax , 4403 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionGetFrameLegacyTokens ENDP ; ULONG64 __stdcall NtDCompositionGetFrameStatistics( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtDCompositionGetFrameStatistics PROC STDCALL mov r10 , rcx mov eax , 4404 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionGetFrameStatistics ENDP ; ULONG64 __stdcall NtDCompositionGetFrameSurfaceUpdates( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtDCompositionGetFrameSurfaceUpdates PROC STDCALL mov r10 , rcx mov eax , 4405 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionGetFrameSurfaceUpdates ENDP ; ULONG64 __stdcall NtDCompositionReleaseAllResources( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionReleaseAllResources PROC STDCALL mov r10 , rcx mov eax , 4406 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionReleaseAllResources ENDP ; ULONG64 __stdcall NtDCompositionReleaseResource( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionReleaseResource PROC STDCALL mov r10 , rcx mov eax , 4407 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionReleaseResource ENDP ; ULONG64 __stdcall NtDCompositionRemoveCrossDeviceVisualChild( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionRemoveCrossDeviceVisualChild PROC STDCALL mov r10 , rcx mov eax , 4408 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionRemoveCrossDeviceVisualChild ENDP ; ULONG64 __stdcall NtDCompositionRemoveVisualChild( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionRemoveVisualChild PROC STDCALL mov r10 , rcx mov eax , 4409 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionRemoveVisualChild ENDP ; ULONG64 __stdcall NtDCompositionReplaceVisualChildren( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionReplaceVisualChildren PROC STDCALL mov r10 , rcx mov eax , 4410 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionReplaceVisualChildren ENDP ; ULONG64 __stdcall NtDCompositionRetireFrame( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionRetireFrame PROC STDCALL mov r10 , rcx mov eax , 4411 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionRetireFrame ENDP ; ULONG64 __stdcall NtDCompositionSetChannelCommitCompletionEvent( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionSetChannelCommitCompletionEvent PROC STDCALL mov r10 , rcx mov eax , 4412 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetChannelCommitCompletionEvent ENDP ; ULONG64 __stdcall NtDCompositionSetResourceAnimationProperty( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionSetResourceAnimationProperty PROC STDCALL mov r10 , rcx mov eax , 4413 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetResourceAnimationProperty ENDP ; ULONG64 __stdcall NtDCompositionSetResourceBufferProperty( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtDCompositionSetResourceBufferProperty PROC STDCALL mov r10 , rcx mov eax , 4414 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetResourceBufferProperty ENDP ; ULONG64 __stdcall NtDCompositionSetResourceDeletedNotificationTag( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtDCompositionSetResourceDeletedNotificationTag PROC STDCALL mov r10 , rcx mov eax , 4415 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetResourceDeletedNotificationTag ENDP ; ULONG64 __stdcall NtDCompositionSetResourceFloatProperty( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionSetResourceFloatProperty PROC STDCALL mov r10 , rcx mov eax , 4416 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetResourceFloatProperty ENDP ; ULONG64 __stdcall NtDCompositionSetResourceIntegerProperty( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionSetResourceIntegerProperty PROC STDCALL mov r10 , rcx mov eax , 4417 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetResourceIntegerProperty ENDP ; ULONG64 __stdcall NtDCompositionSetResourceReferenceArrayProperty( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtDCompositionSetResourceReferenceArrayProperty PROC STDCALL mov r10 , rcx mov eax , 4418 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetResourceReferenceArrayProperty ENDP ; ULONG64 __stdcall NtDCompositionSetResourceReferenceProperty( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtDCompositionSetResourceReferenceProperty PROC STDCALL mov r10 , rcx mov eax , 4419 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSetResourceReferenceProperty ENDP ; ULONG64 __stdcall NtDCompositionSignalGpuFence( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionSignalGpuFence PROC STDCALL mov r10 , rcx mov eax , 4420 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSignalGpuFence ENDP ; ULONG64 __stdcall NtDCompositionSubmitDWMBatch( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionSubmitDWMBatch PROC STDCALL mov r10 , rcx mov eax , 4421 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSubmitDWMBatch ENDP ; ULONG64 __stdcall NtDCompositionSynchronize( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionSynchronize PROC STDCALL mov r10 , rcx mov eax , 4422 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionSynchronize ENDP ; ULONG64 __stdcall NtDCompositionTelemetryTouchInteractionBegin( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtDCompositionTelemetryTouchInteractionBegin PROC STDCALL mov r10 , rcx mov eax , 4423 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionTelemetryTouchInteractionBegin ENDP ; ULONG64 __stdcall NtDCompositionTelemetryTouchInteractionEnd( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtDCompositionTelemetryTouchInteractionEnd PROC STDCALL mov r10 , rcx mov eax , 4424 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionTelemetryTouchInteractionEnd ENDP ; ULONG64 __stdcall NtDCompositionTelemetryTouchInteractionUpdate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionTelemetryTouchInteractionUpdate PROC STDCALL mov r10 , rcx mov eax , 4425 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionTelemetryTouchInteractionUpdate ENDP ; ULONG64 __stdcall NtDCompositionValidateAndReferenceSystemVisualForHwndTarget( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtDCompositionValidateAndReferenceSystemVisualForHwndTarget PROC STDCALL mov r10 , rcx mov eax , 4426 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionValidateAndReferenceSystemVisualForHwndTarget ENDP ; ULONG64 __stdcall NtDCompositionWaitForChannel( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtDCompositionWaitForChannel PROC STDCALL mov r10 , rcx mov eax , 4427 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtDCompositionWaitForChannel ENDP ; ULONG64 __stdcall NtGdiAbortDoc( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiAbortDoc PROC STDCALL mov r10 , rcx mov eax , 4428 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAbortDoc ENDP ; ULONG64 __stdcall NtGdiAbortPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiAbortPath PROC STDCALL mov r10 , rcx mov eax , 4429 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAbortPath ENDP ; ULONG64 __stdcall NtGdiAddEmbFontToDC( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiAddEmbFontToDC PROC STDCALL mov r10 , rcx mov eax , 4430 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAddEmbFontToDC ENDP ; ULONG64 __stdcall NtGdiAddFontResourceW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiAddFontResourceW PROC STDCALL mov r10 , rcx mov eax , 4431 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAddFontResourceW ENDP ; ULONG64 __stdcall NtGdiAddRemoteFontToDC( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiAddRemoteFontToDC PROC STDCALL mov r10 , rcx mov eax , 4432 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAddRemoteFontToDC ENDP ; ULONG64 __stdcall NtGdiAddRemoteMMInstanceToDC( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiAddRemoteMMInstanceToDC PROC STDCALL mov r10 , rcx mov eax , 4433 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAddRemoteMMInstanceToDC ENDP ; ULONG64 __stdcall NtGdiAngleArc( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiAngleArc PROC STDCALL mov r10 , rcx mov eax , 4434 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAngleArc ENDP ; ULONG64 __stdcall NtGdiAnyLinkedFonts( ); _6_2_9200_sp0_windows_8_NtGdiAnyLinkedFonts PROC STDCALL mov r10 , rcx mov eax , 4435 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiAnyLinkedFonts ENDP ; ULONG64 __stdcall NtGdiArcInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 ); _6_2_9200_sp0_windows_8_NtGdiArcInternal PROC STDCALL mov r10 , rcx mov eax , 4436 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiArcInternal ENDP ; ULONG64 __stdcall NtGdiBRUSHOBJ_DeleteRbrush( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_DeleteRbrush PROC STDCALL mov r10 , rcx mov eax , 4437 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_DeleteRbrush ENDP ; ULONG64 __stdcall NtGdiBRUSHOBJ_hGetColorTransform( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_hGetColorTransform PROC STDCALL mov r10 , rcx mov eax , 4438 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_hGetColorTransform ENDP ; ULONG64 __stdcall NtGdiBRUSHOBJ_pvAllocRbrush( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_pvAllocRbrush PROC STDCALL mov r10 , rcx mov eax , 4439 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_pvAllocRbrush ENDP ; ULONG64 __stdcall NtGdiBRUSHOBJ_pvGetRbrush( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_pvGetRbrush PROC STDCALL mov r10 , rcx mov eax , 4440 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_pvGetRbrush ENDP ; ULONG64 __stdcall NtGdiBRUSHOBJ_ulGetBrushColor( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_ulGetBrushColor PROC STDCALL mov r10 , rcx mov eax , 4441 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBRUSHOBJ_ulGetBrushColor ENDP ; ULONG64 __stdcall NtGdiBeginGdiRendering( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiBeginGdiRendering PROC STDCALL mov r10 , rcx mov eax , 4442 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiBeginGdiRendering ENDP ; ULONG64 __stdcall NtGdiCLIPOBJ_bEnum( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiCLIPOBJ_bEnum PROC STDCALL mov r10 , rcx mov eax , 4443 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCLIPOBJ_bEnum ENDP ; ULONG64 __stdcall NtGdiCLIPOBJ_cEnumStart( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiCLIPOBJ_cEnumStart PROC STDCALL mov r10 , rcx mov eax , 4444 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCLIPOBJ_cEnumStart ENDP ; ULONG64 __stdcall NtGdiCLIPOBJ_ppoGetPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCLIPOBJ_ppoGetPath PROC STDCALL mov r10 , rcx mov eax , 4445 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCLIPOBJ_ppoGetPath ENDP ; ULONG64 __stdcall NtGdiCancelDC( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCancelDC PROC STDCALL mov r10 , rcx mov eax , 4446 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCancelDC ENDP ; ULONG64 __stdcall NtGdiChangeGhostFont( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiChangeGhostFont PROC STDCALL mov r10 , rcx mov eax , 4447 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiChangeGhostFont ENDP ; ULONG64 __stdcall NtGdiCheckBitmapBits( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiCheckBitmapBits PROC STDCALL mov r10 , rcx mov eax , 4448 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCheckBitmapBits ENDP ; ULONG64 __stdcall NtGdiClearBitmapAttributes( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiClearBitmapAttributes PROC STDCALL mov r10 , rcx mov eax , 4449 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiClearBitmapAttributes ENDP ; ULONG64 __stdcall NtGdiClearBrushAttributes( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiClearBrushAttributes PROC STDCALL mov r10 , rcx mov eax , 4450 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiClearBrushAttributes ENDP ; ULONG64 __stdcall NtGdiColorCorrectPalette( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiColorCorrectPalette PROC STDCALL mov r10 , rcx mov eax , 4451 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiColorCorrectPalette ENDP ; ULONG64 __stdcall NtGdiConfigureOPMProtectedOutput( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiConfigureOPMProtectedOutput PROC STDCALL mov r10 , rcx mov eax , 4452 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiConfigureOPMProtectedOutput ENDP ; ULONG64 __stdcall NtGdiConvertMetafileRect( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiConvertMetafileRect PROC STDCALL mov r10 , rcx mov eax , 4453 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiConvertMetafileRect ENDP ; ULONG64 __stdcall NtGdiCreateBitmapFromDxSurface( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiCreateBitmapFromDxSurface PROC STDCALL mov r10 , rcx mov eax , 4454 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateBitmapFromDxSurface ENDP ; ULONG64 __stdcall NtGdiCreateBitmapFromDxSurface2( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiCreateBitmapFromDxSurface2 PROC STDCALL mov r10 , rcx mov eax , 4455 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateBitmapFromDxSurface2 ENDP ; ULONG64 __stdcall NtGdiCreateColorTransform( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiCreateColorTransform PROC STDCALL mov r10 , rcx mov eax , 4456 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateColorTransform ENDP ; ULONG64 __stdcall NtGdiCreateEllipticRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiCreateEllipticRgn PROC STDCALL mov r10 , rcx mov eax , 4457 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateEllipticRgn ENDP ; ULONG64 __stdcall NtGdiCreateHatchBrushInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiCreateHatchBrushInternal PROC STDCALL mov r10 , rcx mov eax , 4458 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateHatchBrushInternal ENDP ; ULONG64 __stdcall NtGdiCreateMetafileDC( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiCreateMetafileDC PROC STDCALL mov r10 , rcx mov eax , 4459 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateMetafileDC ENDP ; ULONG64 __stdcall NtGdiCreateOPMProtectedOutputs( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiCreateOPMProtectedOutputs PROC STDCALL mov r10 , rcx mov eax , 4460 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateOPMProtectedOutputs ENDP ; ULONG64 __stdcall NtGdiCreateRoundRectRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiCreateRoundRectRgn PROC STDCALL mov r10 , rcx mov eax , 4461 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateRoundRectRgn ENDP ; ULONG64 __stdcall NtGdiCreateServerMetaFile( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiCreateServerMetaFile PROC STDCALL mov r10 , rcx mov eax , 4462 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateServerMetaFile ENDP ; ULONG64 __stdcall NtGdiCreateSessionMappedDIBSection( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiCreateSessionMappedDIBSection PROC STDCALL mov r10 , rcx mov eax , 4463 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiCreateSessionMappedDIBSection ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4464 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4465 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4466 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4467 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDDCCIGetCapabilitiesString( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiDDCCIGetCapabilitiesString PROC STDCALL mov r10 , rcx mov eax , 4468 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDDCCIGetCapabilitiesString ENDP ; ULONG64 __stdcall NtGdiDDCCIGetCapabilitiesStringLength( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDDCCIGetCapabilitiesStringLength PROC STDCALL mov r10 , rcx mov eax , 4469 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDDCCIGetCapabilitiesStringLength ENDP ; ULONG64 __stdcall NtGdiDDCCIGetTimingReport( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDDCCIGetTimingReport PROC STDCALL mov r10 , rcx mov eax , 4470 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDDCCIGetTimingReport ENDP ; ULONG64 __stdcall NtGdiDDCCIGetVCPFeature( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiDDCCIGetVCPFeature PROC STDCALL mov r10 , rcx mov eax , 4471 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDDCCIGetVCPFeature ENDP ; ULONG64 __stdcall NtGdiDDCCISaveCurrentSettings( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDDCCISaveCurrentSettings PROC STDCALL mov r10 , rcx mov eax , 4472 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDDCCISaveCurrentSettings ENDP ; ULONG64 __stdcall NtGdiDDCCISetVCPFeature( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiDDCCISetVCPFeature PROC STDCALL mov r10 , rcx mov eax , 4473 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDDCCISetVCPFeature ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4474 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4475 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4476 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4477 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4478 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4479 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4480 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4481 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDdCreateFullscreenSprite( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiDdCreateFullscreenSprite PROC STDCALL mov r10 , rcx mov eax , 4482 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdCreateFullscreenSprite ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4483 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDdDDIAcquireKeyedMutex( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIAcquireKeyedMutex PROC STDCALL mov r10 , rcx mov eax , 4484 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIAcquireKeyedMutex ENDP ; ULONG64 __stdcall NtGdiDdDDIAcquireKeyedMutex2( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIAcquireKeyedMutex2 PROC STDCALL mov r10 , rcx mov eax , 4485 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIAcquireKeyedMutex2 ENDP ; ULONG64 __stdcall NtGdiDdDDICheckExclusiveOwnership( ); _6_2_9200_sp0_windows_8_NtGdiDdDDICheckExclusiveOwnership PROC STDCALL mov r10 , rcx mov eax , 4486 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICheckExclusiveOwnership ENDP ; ULONG64 __stdcall NtGdiDdDDICheckMonitorPowerState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICheckMonitorPowerState PROC STDCALL mov r10 , rcx mov eax , 4487 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICheckMonitorPowerState ENDP ; ULONG64 __stdcall NtGdiDdDDICheckOcclusion( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICheckOcclusion PROC STDCALL mov r10 , rcx mov eax , 4488 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICheckOcclusion ENDP ; ULONG64 __stdcall NtGdiDdDDICheckSharedResourceAccess( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICheckSharedResourceAccess PROC STDCALL mov r10 , rcx mov eax , 4489 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICheckSharedResourceAccess ENDP ; ULONG64 __stdcall NtGdiDdDDICheckVidPnExclusiveOwnership( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICheckVidPnExclusiveOwnership PROC STDCALL mov r10 , rcx mov eax , 4490 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICheckVidPnExclusiveOwnership ENDP ; ULONG64 __stdcall NtGdiDdDDICloseAdapter( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICloseAdapter PROC STDCALL mov r10 , rcx mov eax , 4491 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICloseAdapter ENDP ; ULONG64 __stdcall NtGdiDdDDIConfigureSharedResource( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIConfigureSharedResource PROC STDCALL mov r10 , rcx mov eax , 4492 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIConfigureSharedResource ENDP ; ULONG64 __stdcall NtGdiDdDDICreateAllocation( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateAllocation PROC STDCALL mov r10 , rcx mov eax , 4493 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateAllocation ENDP ; ULONG64 __stdcall NtGdiDdDDICreateContext( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateContext PROC STDCALL mov r10 , rcx mov eax , 4494 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateContext ENDP ; ULONG64 __stdcall NtGdiDdDDICreateDCFromMemory( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateDCFromMemory PROC STDCALL mov r10 , rcx mov eax , 4495 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateDCFromMemory ENDP ; ULONG64 __stdcall NtGdiDdDDICreateDevice( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateDevice PROC STDCALL mov r10 , rcx mov eax , 4496 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateDevice ENDP ; ULONG64 __stdcall NtGdiDdDDICreateKeyedMutex( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateKeyedMutex PROC STDCALL mov r10 , rcx mov eax , 4497 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateKeyedMutex ENDP ; ULONG64 __stdcall NtGdiDdDDICreateKeyedMutex2( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateKeyedMutex2 PROC STDCALL mov r10 , rcx mov eax , 4498 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateKeyedMutex2 ENDP ; ULONG64 __stdcall NtGdiDdDDICreateOutputDupl( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateOutputDupl PROC STDCALL mov r10 , rcx mov eax , 4499 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateOutputDupl ENDP ; ULONG64 __stdcall NtGdiDdDDICreateOverlay( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateOverlay PROC STDCALL mov r10 , rcx mov eax , 4500 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateOverlay ENDP ; ULONG64 __stdcall NtGdiDdDDICreateSynchronizationObject( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDICreateSynchronizationObject PROC STDCALL mov r10 , rcx mov eax , 4501 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDICreateSynchronizationObject ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroyAllocation( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyAllocation PROC STDCALL mov r10 , rcx mov eax , 4502 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyAllocation ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroyContext( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyContext PROC STDCALL mov r10 , rcx mov eax , 4503 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyContext ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroyDCFromMemory( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyDCFromMemory PROC STDCALL mov r10 , rcx mov eax , 4504 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyDCFromMemory ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroyDevice( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyDevice PROC STDCALL mov r10 , rcx mov eax , 4505 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyDevice ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroyKeyedMutex( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyKeyedMutex PROC STDCALL mov r10 , rcx mov eax , 4506 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyKeyedMutex ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroyOutputDupl( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyOutputDupl PROC STDCALL mov r10 , rcx mov eax , 4507 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyOutputDupl ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroyOverlay( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyOverlay PROC STDCALL mov r10 , rcx mov eax , 4508 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroyOverlay ENDP ; ULONG64 __stdcall NtGdiDdDDIDestroySynchronizationObject( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroySynchronizationObject PROC STDCALL mov r10 , rcx mov eax , 4509 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIDestroySynchronizationObject ENDP ; ULONG64 __stdcall NtGdiDdDDIEnumAdapters( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIEnumAdapters PROC STDCALL mov r10 , rcx mov eax , 4510 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIEnumAdapters ENDP ; ULONG64 __stdcall NtGdiDdDDIEscape( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIEscape PROC STDCALL mov r10 , rcx mov eax , 4511 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIEscape ENDP ; ULONG64 __stdcall NtGdiDdDDIFlipOverlay( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIFlipOverlay PROC STDCALL mov r10 , rcx mov eax , 4512 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIFlipOverlay ENDP ; ULONG64 __stdcall NtGdiDdDDIGetContextInProcessSchedulingPriority( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetContextInProcessSchedulingPriority PROC STDCALL mov r10 , rcx mov eax , 4513 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetContextInProcessSchedulingPriority ENDP ; ULONG64 __stdcall NtGdiDdDDIGetContextSchedulingPriority( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetContextSchedulingPriority PROC STDCALL mov r10 , rcx mov eax , 4514 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetContextSchedulingPriority ENDP ; ULONG64 __stdcall NtGdiDdDDIGetDeviceState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetDeviceState PROC STDCALL mov r10 , rcx mov eax , 4515 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetDeviceState ENDP ; ULONG64 __stdcall NtGdiDdDDIGetDisplayModeList( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetDisplayModeList PROC STDCALL mov r10 , rcx mov eax , 4516 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetDisplayModeList ENDP ; ULONG64 __stdcall NtGdiDdDDIGetMultisampleMethodList( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetMultisampleMethodList PROC STDCALL mov r10 , rcx mov eax , 4517 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetMultisampleMethodList ENDP ; ULONG64 __stdcall NtGdiDdDDIGetOverlayState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetOverlayState PROC STDCALL mov r10 , rcx mov eax , 4518 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetOverlayState ENDP ; ULONG64 __stdcall NtGdiDdDDIGetPresentHistory( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetPresentHistory PROC STDCALL mov r10 , rcx mov eax , 4519 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetPresentHistory ENDP ; ULONG64 __stdcall NtGdiDdDDIGetPresentQueueEvent( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetPresentQueueEvent PROC STDCALL mov r10 , rcx mov eax , 4520 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetPresentQueueEvent ENDP ; ULONG64 __stdcall NtGdiDdDDIGetProcessSchedulingPriorityClass( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetProcessSchedulingPriorityClass PROC STDCALL mov r10 , rcx mov eax , 4521 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetProcessSchedulingPriorityClass ENDP ; ULONG64 __stdcall NtGdiDdDDIGetRuntimeData( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetRuntimeData PROC STDCALL mov r10 , rcx mov eax , 4522 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetRuntimeData ENDP ; ULONG64 __stdcall NtGdiDdDDIGetScanLine( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetScanLine PROC STDCALL mov r10 , rcx mov eax , 4523 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetScanLine ENDP ; ULONG64 __stdcall NtGdiDdDDIGetSharedPrimaryHandle( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetSharedPrimaryHandle PROC STDCALL mov r10 , rcx mov eax , 4524 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetSharedPrimaryHandle ENDP ; ULONG64 __stdcall NtGdiDdDDIGetSharedResourceAdapterLuid( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIGetSharedResourceAdapterLuid PROC STDCALL mov r10 , rcx mov eax , 4525 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIGetSharedResourceAdapterLuid ENDP ; ULONG64 __stdcall NtGdiDdDDIInvalidateActiveVidPn( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIInvalidateActiveVidPn PROC STDCALL mov r10 , rcx mov eax , 4526 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIInvalidateActiveVidPn ENDP ; ULONG64 __stdcall NtGdiDdDDILock( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDILock PROC STDCALL mov r10 , rcx mov eax , 4527 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDILock ENDP ; ULONG64 __stdcall NtGdiDdDDIOfferAllocations( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOfferAllocations PROC STDCALL mov r10 , rcx mov eax , 4528 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOfferAllocations ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenAdapterFromDeviceName( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenAdapterFromDeviceName PROC STDCALL mov r10 , rcx mov eax , 4529 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenAdapterFromDeviceName ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenAdapterFromHdc( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenAdapterFromHdc PROC STDCALL mov r10 , rcx mov eax , 4530 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenAdapterFromHdc ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenAdapterFromLuid( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenAdapterFromLuid PROC STDCALL mov r10 , rcx mov eax , 4531 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenAdapterFromLuid ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenKeyedMutex( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenKeyedMutex PROC STDCALL mov r10 , rcx mov eax , 4532 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenKeyedMutex ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenKeyedMutex2( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenKeyedMutex2 PROC STDCALL mov r10 , rcx mov eax , 4533 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenKeyedMutex2 ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenNtHandleFromName( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenNtHandleFromName PROC STDCALL mov r10 , rcx mov eax , 4534 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenNtHandleFromName ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenResource( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenResource PROC STDCALL mov r10 , rcx mov eax , 4535 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenResource ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenResourceFromNtHandle( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenResourceFromNtHandle PROC STDCALL mov r10 , rcx mov eax , 4536 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenResourceFromNtHandle ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenSyncObjectFromNtHandle( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenSyncObjectFromNtHandle PROC STDCALL mov r10 , rcx mov eax , 4537 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenSyncObjectFromNtHandle ENDP ; ULONG64 __stdcall NtGdiDdDDIOpenSynchronizationObject( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenSynchronizationObject PROC STDCALL mov r10 , rcx mov eax , 4538 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOpenSynchronizationObject ENDP ; ULONG64 __stdcall NtGdiDdDDIOutputDuplGetFrameInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplGetFrameInfo PROC STDCALL mov r10 , rcx mov eax , 4539 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplGetFrameInfo ENDP ; ULONG64 __stdcall NtGdiDdDDIOutputDuplGetMetaData( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplGetMetaData PROC STDCALL mov r10 , rcx mov eax , 4540 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplGetMetaData ENDP ; ULONG64 __stdcall NtGdiDdDDIOutputDuplGetPointerShapeData( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplGetPointerShapeData PROC STDCALL mov r10 , rcx mov eax , 4541 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplGetPointerShapeData ENDP ; ULONG64 __stdcall NtGdiDdDDIOutputDuplPresent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplPresent PROC STDCALL mov r10 , rcx mov eax , 4542 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplPresent ENDP ; ULONG64 __stdcall NtGdiDdDDIOutputDuplReleaseFrame( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplReleaseFrame PROC STDCALL mov r10 , rcx mov eax , 4543 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIOutputDuplReleaseFrame ENDP ; ULONG64 __stdcall NtGdiDdDDIPinDirectFlipResources( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIPinDirectFlipResources PROC STDCALL mov r10 , rcx mov eax , 4544 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIPinDirectFlipResources ENDP ; ULONG64 __stdcall NtGdiDdDDIPollDisplayChildren( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIPollDisplayChildren PROC STDCALL mov r10 , rcx mov eax , 4545 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIPollDisplayChildren ENDP ; ULONG64 __stdcall NtGdiDdDDIPresent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIPresent PROC STDCALL mov r10 , rcx mov eax , 4546 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIPresent ENDP ; ULONG64 __stdcall NtGdiDdDDIQueryAdapterInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryAdapterInfo PROC STDCALL mov r10 , rcx mov eax , 4547 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryAdapterInfo ENDP ; ULONG64 __stdcall NtGdiDdDDIQueryAllocationResidency( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryAllocationResidency PROC STDCALL mov r10 , rcx mov eax , 4548 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryAllocationResidency ENDP ; ULONG64 __stdcall NtGdiDdDDIQueryRemoteVidPnSourceFromGdiDisplayName( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryRemoteVidPnSourceFromGdiDisplayName PROC STDCALL mov r10 , rcx mov eax , 4549 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryRemoteVidPnSourceFromGdiDisplayName ENDP ; ULONG64 __stdcall NtGdiDdDDIQueryResourceInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryResourceInfo PROC STDCALL mov r10 , rcx mov eax , 4550 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryResourceInfo ENDP ; ULONG64 __stdcall NtGdiDdDDIQueryResourceInfoFromNtHandle( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryResourceInfoFromNtHandle PROC STDCALL mov r10 , rcx mov eax , 4551 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryResourceInfoFromNtHandle ENDP ; ULONG64 __stdcall NtGdiDdDDIQueryStatistics( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryStatistics PROC STDCALL mov r10 , rcx mov eax , 4552 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIQueryStatistics ENDP ; ULONG64 __stdcall NtGdiDdDDIReclaimAllocations( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIReclaimAllocations PROC STDCALL mov r10 , rcx mov eax , 4553 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIReclaimAllocations ENDP ; ULONG64 __stdcall NtGdiDdDDIReleaseKeyedMutex( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIReleaseKeyedMutex PROC STDCALL mov r10 , rcx mov eax , 4554 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIReleaseKeyedMutex ENDP ; ULONG64 __stdcall NtGdiDdDDIReleaseKeyedMutex2( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIReleaseKeyedMutex2 PROC STDCALL mov r10 , rcx mov eax , 4555 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIReleaseKeyedMutex2 ENDP ; ULONG64 __stdcall NtGdiDdDDIReleaseProcessVidPnSourceOwners( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIReleaseProcessVidPnSourceOwners PROC STDCALL mov r10 , rcx mov eax , 4556 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIReleaseProcessVidPnSourceOwners ENDP ; ULONG64 __stdcall NtGdiDdDDIRender( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIRender PROC STDCALL mov r10 , rcx mov eax , 4557 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIRender ENDP ; ULONG64 __stdcall NtGdiDdDDISetAllocationPriority( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetAllocationPriority PROC STDCALL mov r10 , rcx mov eax , 4558 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetAllocationPriority ENDP ; ULONG64 __stdcall NtGdiDdDDISetContextInProcessSchedulingPriority( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetContextInProcessSchedulingPriority PROC STDCALL mov r10 , rcx mov eax , 4559 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetContextInProcessSchedulingPriority ENDP ; ULONG64 __stdcall NtGdiDdDDISetContextSchedulingPriority( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetContextSchedulingPriority PROC STDCALL mov r10 , rcx mov eax , 4560 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetContextSchedulingPriority ENDP ; ULONG64 __stdcall NtGdiDdDDISetDisplayMode( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetDisplayMode PROC STDCALL mov r10 , rcx mov eax , 4561 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetDisplayMode ENDP ; ULONG64 __stdcall NtGdiDdDDISetDisplayPrivateDriverFormat( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetDisplayPrivateDriverFormat PROC STDCALL mov r10 , rcx mov eax , 4562 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetDisplayPrivateDriverFormat ENDP ; ULONG64 __stdcall NtGdiDdDDISetGammaRamp( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetGammaRamp PROC STDCALL mov r10 , rcx mov eax , 4563 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetGammaRamp ENDP ; ULONG64 __stdcall NtGdiDdDDISetProcessSchedulingPriorityClass( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetProcessSchedulingPriorityClass PROC STDCALL mov r10 , rcx mov eax , 4564 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetProcessSchedulingPriorityClass ENDP ; ULONG64 __stdcall NtGdiDdDDISetQueuedLimit( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetQueuedLimit PROC STDCALL mov r10 , rcx mov eax , 4565 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetQueuedLimit ENDP ; ULONG64 __stdcall NtGdiDdDDISetStereoEnabled( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetStereoEnabled PROC STDCALL mov r10 , rcx mov eax , 4566 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetStereoEnabled ENDP ; ULONG64 __stdcall NtGdiDdDDISetVidPnSourceOwner( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetVidPnSourceOwner PROC STDCALL mov r10 , rcx mov eax , 4567 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetVidPnSourceOwner ENDP ; ULONG64 __stdcall NtGdiDdDDISetVidPnSourceOwner1( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISetVidPnSourceOwner1 PROC STDCALL mov r10 , rcx mov eax , 4568 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISetVidPnSourceOwner1 ENDP ; ULONG64 __stdcall NtGdiDdDDIShareObjects( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIShareObjects PROC STDCALL mov r10 , rcx mov eax , 4569 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIShareObjects ENDP ; ULONG64 __stdcall NtGdiDdDDISharedPrimaryLockNotification( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISharedPrimaryLockNotification PROC STDCALL mov r10 , rcx mov eax , 4570 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISharedPrimaryLockNotification ENDP ; ULONG64 __stdcall NtGdiDdDDISharedPrimaryUnLockNotification( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISharedPrimaryUnLockNotification PROC STDCALL mov r10 , rcx mov eax , 4571 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISharedPrimaryUnLockNotification ENDP ; ULONG64 __stdcall NtGdiDdDDISignalSynchronizationObject( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDISignalSynchronizationObject PROC STDCALL mov r10 , rcx mov eax , 4572 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDISignalSynchronizationObject ENDP ; ULONG64 __stdcall NtGdiDdDDIUnlock( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIUnlock PROC STDCALL mov r10 , rcx mov eax , 4573 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIUnlock ENDP ; ULONG64 __stdcall NtGdiDdDDIUnpinDirectFlipResources( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIUnpinDirectFlipResources PROC STDCALL mov r10 , rcx mov eax , 4574 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIUnpinDirectFlipResources ENDP ; ULONG64 __stdcall NtGdiDdDDIUpdateOverlay( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIUpdateOverlay PROC STDCALL mov r10 , rcx mov eax , 4575 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIUpdateOverlay ENDP ; ULONG64 __stdcall NtGdiDdDDIWaitForIdle( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForIdle PROC STDCALL mov r10 , rcx mov eax , 4576 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForIdle ENDP ; ULONG64 __stdcall NtGdiDdDDIWaitForSynchronizationObject( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForSynchronizationObject PROC STDCALL mov r10 , rcx mov eax , 4577 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForSynchronizationObject ENDP ; ULONG64 __stdcall NtGdiDdDDIWaitForVerticalBlankEvent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForVerticalBlankEvent PROC STDCALL mov r10 , rcx mov eax , 4578 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForVerticalBlankEvent ENDP ; ULONG64 __stdcall NtGdiDdDDIWaitForVerticalBlankEvent2( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForVerticalBlankEvent2 PROC STDCALL mov r10 , rcx mov eax , 4579 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDDIWaitForVerticalBlankEvent2 ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4580 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4581 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDdDestroyFullscreenSprite( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDdDestroyFullscreenSprite PROC STDCALL mov r10 , rcx mov eax , 4582 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdDestroyFullscreenSprite ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4583 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4584 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4585 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4586 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4587 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4588 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4589 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4590 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4591 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4592 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4593 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4594 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4595 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4596 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4597 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4598 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4599 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDdNotifyFullscreenSpriteUpdate( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDdNotifyFullscreenSpriteUpdate PROC STDCALL mov r10 , rcx mov eax , 4600 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdNotifyFullscreenSpriteUpdate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4601 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4602 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDdQueryVisRgnUniqueness( ); _6_2_9200_sp0_windows_8_NtGdiDdQueryVisRgnUniqueness PROC STDCALL mov r10 , rcx mov eax , 4603 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdQueryVisRgnUniqueness ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4604 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4605 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4606 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4607 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4608 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4609 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4610 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDdUnattachSurface( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDdUnattachSurface PROC STDCALL mov r10 , rcx mov eax , 4611 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDdUnattachSurface ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4612 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4613 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4614 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDeleteColorTransform( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiDeleteColorTransform PROC STDCALL mov r10 , rcx mov eax , 4615 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDeleteColorTransform ENDP ; ULONG64 __stdcall NtGdiDescribePixelFormat( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiDescribePixelFormat PROC STDCALL mov r10 , rcx mov eax , 4616 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDescribePixelFormat ENDP ; ULONG64 __stdcall NtGdiDestroyOPMProtectedOutput( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiDestroyOPMProtectedOutput PROC STDCALL mov r10 , rcx mov eax , 4617 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDestroyOPMProtectedOutput ENDP ; ULONG64 __stdcall _DestroyPhysicalMonitor_CMonitorAPI__QEAAJPEAX_Z( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8__DestroyPhysicalMonitor_CMonitorAPI__QEAAJPEAX_Z PROC STDCALL mov r10 , rcx mov eax , 4618 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8__DestroyPhysicalMonitor_CMonitorAPI__QEAAJPEAX_Z ENDP ; ULONG64 __stdcall NtGdiDoBanding( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiDoBanding PROC STDCALL mov r10 , rcx mov eax , 4619 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDoBanding ENDP ; ULONG64 __stdcall NtGdiDrawEscape( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiDrawEscape PROC STDCALL mov r10 , rcx mov eax , 4620 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDrawEscape ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4621 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4622 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4623 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4624 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4625 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4626 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4627 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4628 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4629 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4630 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4631 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4632 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4633 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4634 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4635 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4636 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4637 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiDwmCreatedBitmapRemotingOutput( ); _6_2_9200_sp0_windows_8_NtGdiDwmCreatedBitmapRemotingOutput PROC STDCALL mov r10 , rcx mov eax , 4638 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiDwmCreatedBitmapRemotingOutput ENDP ; ULONG64 __stdcall NtGdiD3dContextCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate PROC STDCALL mov r10 , rcx mov eax , 4639 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiD3dContextCreate ENDP ; ULONG64 __stdcall NtGdiEllipse( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiEllipse PROC STDCALL mov r10 , rcx mov eax , 4640 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEllipse ENDP ; ULONG64 __stdcall NtGdiEnableEudc( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEnableEudc PROC STDCALL mov r10 , rcx mov eax , 4641 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEnableEudc ENDP ; ULONG64 __stdcall NtGdiEndDoc( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEndDoc PROC STDCALL mov r10 , rcx mov eax , 4642 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEndDoc ENDP ; ULONG64 __stdcall NtGdiEndGdiRendering( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiEndGdiRendering PROC STDCALL mov r10 , rcx mov eax , 4643 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEndGdiRendering ENDP ; ULONG64 __stdcall NtGdiEndPage( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEndPage PROC STDCALL mov r10 , rcx mov eax , 4644 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEndPage ENDP ; ULONG64 __stdcall NtGdiEngAlphaBlend( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiEngAlphaBlend PROC STDCALL mov r10 , rcx mov eax , 4645 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngAlphaBlend ENDP ; ULONG64 __stdcall NtGdiEngAssociateSurface( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiEngAssociateSurface PROC STDCALL mov r10 , rcx mov eax , 4646 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngAssociateSurface ENDP ; ULONG64 __stdcall NtGdiEngBitBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiEngBitBlt PROC STDCALL mov r10 , rcx mov eax , 4647 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngBitBlt ENDP ; ULONG64 __stdcall NtGdiEngCheckAbort( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngCheckAbort PROC STDCALL mov r10 , rcx mov eax , 4648 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngCheckAbort ENDP ; ULONG64 __stdcall NtGdiEngComputeGlyphSet( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiEngComputeGlyphSet PROC STDCALL mov r10 , rcx mov eax , 4649 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngComputeGlyphSet ENDP ; ULONG64 __stdcall NtGdiEngCopyBits( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiEngCopyBits PROC STDCALL mov r10 , rcx mov eax , 4650 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngCopyBits ENDP ; ULONG64 __stdcall NtGdiEngCreateBitmap( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiEngCreateBitmap PROC STDCALL mov r10 , rcx mov eax , 4651 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngCreateBitmap ENDP ; ULONG64 __stdcall NtGdiEngCreateClip( ); _6_2_9200_sp0_windows_8_NtGdiEngCreateClip PROC STDCALL mov r10 , rcx mov eax , 4652 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngCreateClip ENDP ; ULONG64 __stdcall NtGdiEngCreateDeviceBitmap( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiEngCreateDeviceBitmap PROC STDCALL mov r10 , rcx mov eax , 4653 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngCreateDeviceBitmap ENDP ; ULONG64 __stdcall NtGdiEngCreateDeviceSurface( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiEngCreateDeviceSurface PROC STDCALL mov r10 , rcx mov eax , 4654 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngCreateDeviceSurface ENDP ; ULONG64 __stdcall NtGdiEngCreatePalette( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiEngCreatePalette PROC STDCALL mov r10 , rcx mov eax , 4655 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngCreatePalette ENDP ; ULONG64 __stdcall NtGdiEngDeleteClip( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngDeleteClip PROC STDCALL mov r10 , rcx mov eax , 4656 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngDeleteClip ENDP ; ULONG64 __stdcall NtGdiEngDeletePalette( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngDeletePalette PROC STDCALL mov r10 , rcx mov eax , 4657 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngDeletePalette ENDP ; ULONG64 __stdcall NtGdiEngDeletePath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngDeletePath PROC STDCALL mov r10 , rcx mov eax , 4658 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngDeletePath ENDP ; ULONG64 __stdcall NtGdiEngDeleteSurface( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngDeleteSurface PROC STDCALL mov r10 , rcx mov eax , 4659 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngDeleteSurface ENDP ; ULONG64 __stdcall NtGdiEngEraseSurface( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiEngEraseSurface PROC STDCALL mov r10 , rcx mov eax , 4660 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngEraseSurface ENDP ; ULONG64 __stdcall NtGdiEngFillPath( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiEngFillPath PROC STDCALL mov r10 , rcx mov eax , 4661 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngFillPath ENDP ; ULONG64 __stdcall NtGdiEngGradientFill( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 ); _6_2_9200_sp0_windows_8_NtGdiEngGradientFill PROC STDCALL mov r10 , rcx mov eax , 4662 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngGradientFill ENDP ; ULONG64 __stdcall NtGdiEngLineTo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 ); _6_2_9200_sp0_windows_8_NtGdiEngLineTo PROC STDCALL mov r10 , rcx mov eax , 4663 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngLineTo ENDP ; ULONG64 __stdcall NtGdiEngLockSurface( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngLockSurface PROC STDCALL mov r10 , rcx mov eax , 4664 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngLockSurface ENDP ; ULONG64 __stdcall NtGdiEngMarkBandingSurface( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngMarkBandingSurface PROC STDCALL mov r10 , rcx mov eax , 4665 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngMarkBandingSurface ENDP ; ULONG64 __stdcall NtGdiEngPaint( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiEngPaint PROC STDCALL mov r10 , rcx mov eax , 4666 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngPaint ENDP ; ULONG64 __stdcall NtGdiEngPlgBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiEngPlgBlt PROC STDCALL mov r10 , rcx mov eax , 4667 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngPlgBlt ENDP ; ULONG64 __stdcall NtGdiEngStretchBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiEngStretchBlt PROC STDCALL mov r10 , rcx mov eax , 4668 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngStretchBlt ENDP ; ULONG64 __stdcall NtGdiEngStretchBltROP( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 , ULONG64 arg_13 ); _6_2_9200_sp0_windows_8_NtGdiEngStretchBltROP PROC STDCALL mov r10 , rcx mov eax , 4669 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngStretchBltROP ENDP ; ULONG64 __stdcall NtGdiEngStrokeAndFillPath( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 ); _6_2_9200_sp0_windows_8_NtGdiEngStrokeAndFillPath PROC STDCALL mov r10 , rcx mov eax , 4670 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngStrokeAndFillPath ENDP ; ULONG64 __stdcall NtGdiEngStrokePath( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiEngStrokePath PROC STDCALL mov r10 , rcx mov eax , 4671 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngStrokePath ENDP ; ULONG64 __stdcall NtGdiEngTextOut( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 ); _6_2_9200_sp0_windows_8_NtGdiEngTextOut PROC STDCALL mov r10 , rcx mov eax , 4672 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngTextOut ENDP ; ULONG64 __stdcall NtGdiEngTransparentBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiEngTransparentBlt PROC STDCALL mov r10 , rcx mov eax , 4673 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngTransparentBlt ENDP ; ULONG64 __stdcall NtGdiEngUnlockSurface( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiEngUnlockSurface PROC STDCALL mov r10 , rcx mov eax , 4674 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEngUnlockSurface ENDP ; ULONG64 __stdcall NtGdiEnumFonts( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiEnumFonts PROC STDCALL mov r10 , rcx mov eax , 4675 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEnumFonts ENDP ; ULONG64 __stdcall NtGdiEnumObjects( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiEnumObjects PROC STDCALL mov r10 , rcx mov eax , 4676 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEnumObjects ENDP ; ULONG64 __stdcall NtGdiEudcLoadUnloadLink( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiEudcLoadUnloadLink PROC STDCALL mov r10 , rcx mov eax , 4677 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiEudcLoadUnloadLink ENDP ; ULONG64 __stdcall NtGdiExtFloodFill( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiExtFloodFill PROC STDCALL mov r10 , rcx mov eax , 4678 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiExtFloodFill ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_cGetAllGlyphHandles( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_cGetAllGlyphHandles PROC STDCALL mov r10 , rcx mov eax , 4679 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_cGetAllGlyphHandles ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_cGetGlyphs( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_cGetGlyphs PROC STDCALL mov r10 , rcx mov eax , 4680 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_cGetGlyphs ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_pQueryGlyphAttrs( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pQueryGlyphAttrs PROC STDCALL mov r10 , rcx mov eax , 4681 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pQueryGlyphAttrs ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_pfdg( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pfdg PROC STDCALL mov r10 , rcx mov eax , 4682 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pfdg ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_pifi( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pifi PROC STDCALL mov r10 , rcx mov eax , 4683 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pifi ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_pvTrueTypeFontFile( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pvTrueTypeFontFile PROC STDCALL mov r10 , rcx mov eax , 4684 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pvTrueTypeFontFile ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_pxoGetXform( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pxoGetXform PROC STDCALL mov r10 , rcx mov eax , 4685 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_pxoGetXform ENDP ; ULONG64 __stdcall NtGdiFONTOBJ_vGetInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_vGetInfo PROC STDCALL mov r10 , rcx mov eax , 4686 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFONTOBJ_vGetInfo ENDP ; ULONG64 __stdcall NtGdiFlattenPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiFlattenPath PROC STDCALL mov r10 , rcx mov eax , 4687 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFlattenPath ENDP ; ULONG64 __stdcall NtGdiFontIsLinked( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiFontIsLinked PROC STDCALL mov r10 , rcx mov eax , 4688 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFontIsLinked ENDP ; ULONG64 __stdcall NtGdiForceUFIMapping( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiForceUFIMapping PROC STDCALL mov r10 , rcx mov eax , 4689 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiForceUFIMapping ENDP ; ULONG64 __stdcall NtGdiFrameRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiFrameRgn PROC STDCALL mov r10 , rcx mov eax , 4690 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFrameRgn ENDP ; ULONG64 __stdcall NtGdiFullscreenControl( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiFullscreenControl PROC STDCALL mov r10 , rcx mov eax , 4691 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiFullscreenControl ENDP ; ULONG64 __stdcall NtGdiGetBoundsRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetBoundsRect PROC STDCALL mov r10 , rcx mov eax , 4692 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetBoundsRect ENDP ; ULONG64 __stdcall NtGdiGetCOPPCompatibleOPMInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetCOPPCompatibleOPMInformation PROC STDCALL mov r10 , rcx mov eax , 4693 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCOPPCompatibleOPMInformation ENDP ; ULONG64 __stdcall NtGdiGetCertificate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiGetCertificate PROC STDCALL mov r10 , rcx mov eax , 4694 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCertificate ENDP ; ULONG64 __stdcall NtGdiGetCertificateSize( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetCertificateSize PROC STDCALL mov r10 , rcx mov eax , 4695 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCertificateSize ENDP ; ULONG64 __stdcall NtGdiGetCharABCWidthsW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiGetCharABCWidthsW PROC STDCALL mov r10 , rcx mov eax , 4696 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCharABCWidthsW ENDP ; ULONG64 __stdcall NtGdiGetCharacterPlacementW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiGetCharacterPlacementW PROC STDCALL mov r10 , rcx mov eax , 4697 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetCharacterPlacementW ENDP ; ULONG64 __stdcall NtGdiGetColorAdjustment( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetColorAdjustment PROC STDCALL mov r10 , rcx mov eax , 4698 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetColorAdjustment ENDP ; ULONG64 __stdcall NtGdiGetColorSpaceforBitmap( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiGetColorSpaceforBitmap PROC STDCALL mov r10 , rcx mov eax , 4699 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetColorSpaceforBitmap ENDP ; ULONG64 __stdcall NtGdiGetDeviceCaps( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetDeviceCaps PROC STDCALL mov r10 , rcx mov eax , 4700 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDeviceCaps ENDP ; ULONG64 __stdcall NtGdiGetDeviceCapsAll( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetDeviceCapsAll PROC STDCALL mov r10 , rcx mov eax , 4701 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDeviceCapsAll ENDP ; ULONG64 __stdcall NtGdiGetDeviceGammaRamp( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetDeviceGammaRamp PROC STDCALL mov r10 , rcx mov eax , 4702 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDeviceGammaRamp ENDP ; ULONG64 __stdcall NtGdiGetDeviceWidth( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiGetDeviceWidth PROC STDCALL mov r10 , rcx mov eax , 4703 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDeviceWidth ENDP ; ULONG64 __stdcall NtGdiGetDhpdev( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiGetDhpdev PROC STDCALL mov r10 , rcx mov eax , 4704 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetDhpdev ENDP ; ULONG64 __stdcall NtGdiGetETM( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetETM PROC STDCALL mov r10 , rcx mov eax , 4705 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetETM ENDP ; ULONG64 __stdcall NtGdiGetEmbUFI( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiGetEmbUFI PROC STDCALL mov r10 , rcx mov eax , 4706 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetEmbUFI ENDP ; ULONG64 __stdcall NtGdiGetEmbedFonts( ); _6_2_9200_sp0_windows_8_NtGdiGetEmbedFonts PROC STDCALL mov r10 , rcx mov eax , 4707 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetEmbedFonts ENDP ; ULONG64 __stdcall NtGdiGetEudcTimeStampEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetEudcTimeStampEx PROC STDCALL mov r10 , rcx mov eax , 4708 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetEudcTimeStampEx ENDP ; ULONG64 __stdcall NtGdiGetFontFileData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiGetFontFileData PROC STDCALL mov r10 , rcx mov eax , 4709 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetFontFileData ENDP ; ULONG64 __stdcall NtGdiGetFontFileInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiGetFontFileInfo PROC STDCALL mov r10 , rcx mov eax , 4710 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetFontFileInfo ENDP ; ULONG64 __stdcall NtGdiGetFontResourceInfoInternalW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiGetFontResourceInfoInternalW PROC STDCALL mov r10 , rcx mov eax , 4711 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetFontResourceInfoInternalW ENDP ; ULONG64 __stdcall NtGdiGetFontUnicodeRanges( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetFontUnicodeRanges PROC STDCALL mov r10 , rcx mov eax , 4712 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetFontUnicodeRanges ENDP ; ULONG64 __stdcall NtGdiGetGlyphIndicesW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiGetGlyphIndicesW PROC STDCALL mov r10 , rcx mov eax , 4713 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetGlyphIndicesW ENDP ; ULONG64 __stdcall NtGdiGetGlyphIndicesWInternal( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiGetGlyphIndicesWInternal PROC STDCALL mov r10 , rcx mov eax , 4714 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetGlyphIndicesWInternal ENDP ; ULONG64 __stdcall NtGdiGetGlyphOutline( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiGetGlyphOutline PROC STDCALL mov r10 , rcx mov eax , 4715 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetGlyphOutline ENDP ; ULONG64 __stdcall NtGdiGetKerningPairs( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetKerningPairs PROC STDCALL mov r10 , rcx mov eax , 4716 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetKerningPairs ENDP ; ULONG64 __stdcall NtGdiGetLinkedUFIs( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetLinkedUFIs PROC STDCALL mov r10 , rcx mov eax , 4717 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetLinkedUFIs ENDP ; ULONG64 __stdcall NtGdiGetMiterLimit( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetMiterLimit PROC STDCALL mov r10 , rcx mov eax , 4718 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetMiterLimit ENDP ; ULONG64 __stdcall NtGdiGetMonitorID( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetMonitorID PROC STDCALL mov r10 , rcx mov eax , 4719 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetMonitorID ENDP ; ULONG64 __stdcall NtGdiGetNumberOfPhysicalMonitors( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetNumberOfPhysicalMonitors PROC STDCALL mov r10 , rcx mov eax , 4720 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetNumberOfPhysicalMonitors ENDP ; ULONG64 __stdcall NtGdiGetOPMInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetOPMInformation PROC STDCALL mov r10 , rcx mov eax , 4721 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetOPMInformation ENDP ; ULONG64 __stdcall NtGdiGetOPMRandomNumber( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetOPMRandomNumber PROC STDCALL mov r10 , rcx mov eax , 4722 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetOPMRandomNumber ENDP ; ULONG64 __stdcall NtGdiGetObjectBitmapHandle( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetObjectBitmapHandle PROC STDCALL mov r10 , rcx mov eax , 4723 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetObjectBitmapHandle ENDP ; ULONG64 __stdcall NtGdiGetPath( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiGetPath PROC STDCALL mov r10 , rcx mov eax , 4724 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetPath ENDP ; ULONG64 __stdcall NtGdiGetPerBandInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetPerBandInfo PROC STDCALL mov r10 , rcx mov eax , 4725 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetPerBandInfo ENDP ; ULONG64 __stdcall NtGdiGetPhysicalMonitorDescription( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiGetPhysicalMonitorDescription PROC STDCALL mov r10 , rcx mov eax , 4726 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetPhysicalMonitorDescription ENDP ; ULONG64 __stdcall NtGdiGetPhysicalMonitors( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiGetPhysicalMonitors PROC STDCALL mov r10 , rcx mov eax , 4727 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetPhysicalMonitors ENDP ; ULONG64 __stdcall NtGdiGetRealizationInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetRealizationInfo PROC STDCALL mov r10 , rcx mov eax , 4728 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetRealizationInfo ENDP ; ULONG64 __stdcall NtGdiGetServerMetaFileBits( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiGetServerMetaFileBits PROC STDCALL mov r10 , rcx mov eax , 4729 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetServerMetaFileBits ENDP ; ULONG64 __stdcall UMPDDrvQuerySpoolType( ); _6_2_9200_sp0_windows_8_UMPDDrvQuerySpoolType PROC STDCALL mov r10 , rcx mov eax , 4730 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_UMPDDrvQuerySpoolType ENDP ; ULONG64 __stdcall NtGdiGetStats( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiGetStats PROC STDCALL mov r10 , rcx mov eax , 4731 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetStats ENDP ; ULONG64 __stdcall NtGdiGetStringBitmapW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiGetStringBitmapW PROC STDCALL mov r10 , rcx mov eax , 4732 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetStringBitmapW ENDP ; ULONG64 __stdcall NtGdiGetSuggestedOPMProtectedOutputArraySize( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiGetSuggestedOPMProtectedOutputArraySize PROC STDCALL mov r10 , rcx mov eax , 4733 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetSuggestedOPMProtectedOutputArraySize ENDP ; ULONG64 __stdcall NtGdiGetTextExtentExW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiGetTextExtentExW PROC STDCALL mov r10 , rcx mov eax , 4734 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetTextExtentExW ENDP ; ULONG64 __stdcall NtGdiGetUFI( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiGetUFI PROC STDCALL mov r10 , rcx mov eax , 4735 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetUFI ENDP ; ULONG64 __stdcall NtGdiGetUFIPathname( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 ); _6_2_9200_sp0_windows_8_NtGdiGetUFIPathname PROC STDCALL mov r10 , rcx mov eax , 4736 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGetUFIPathname ENDP ; ULONG64 __stdcall NtGdiGradientFill( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiGradientFill PROC STDCALL mov r10 , rcx mov eax , 4737 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiGradientFill ENDP ; ULONG64 __stdcall NtGdiHLSurfGetInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiHLSurfGetInformation PROC STDCALL mov r10 , rcx mov eax , 4738 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiHLSurfGetInformation ENDP ; ULONG64 __stdcall NtGdiHLSurfSetInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiHLSurfSetInformation PROC STDCALL mov r10 , rcx mov eax , 4739 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiHLSurfSetInformation ENDP ; ULONG64 __stdcall NtGdiHT_Get8BPPFormatPalette( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiHT_Get8BPPFormatPalette PROC STDCALL mov r10 , rcx mov eax , 4740 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiHT_Get8BPPFormatPalette ENDP ; ULONG64 __stdcall NtGdiHT_Get8BPPMaskPalette( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiHT_Get8BPPMaskPalette PROC STDCALL mov r10 , rcx mov eax , 4741 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiHT_Get8BPPMaskPalette ENDP ; ULONG64 __stdcall NtGdiIcmBrushInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtGdiIcmBrushInfo PROC STDCALL mov r10 , rcx mov eax , 4742 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiIcmBrushInfo ENDP ; for CDiscardInputQueue::GetType ; ULONG64 __stdcall CDiscardInputQueue__GetType( ); _6_2_9200_sp0_windows_8_CDiscardInputQueue__GetType PROC STDCALL mov r10 , rcx mov eax , 4743 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_CDiscardInputQueue__GetType ENDP ; ULONG64 __stdcall NtGdiInitSpool( ); _6_2_9200_sp0_windows_8_NtGdiInitSpool PROC STDCALL mov r10 , rcx mov eax , 4744 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiInitSpool ENDP ; ULONG64 __stdcall NtGdiMakeFontDir( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiMakeFontDir PROC STDCALL mov r10 , rcx mov eax , 4745 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMakeFontDir ENDP ; ULONG64 __stdcall NtGdiMakeInfoDC( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiMakeInfoDC PROC STDCALL mov r10 , rcx mov eax , 4746 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMakeInfoDC ENDP ; ULONG64 __stdcall NtGdiMakeObjectUnXferable( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiMakeObjectUnXferable PROC STDCALL mov r10 , rcx mov eax , 4747 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMakeObjectUnXferable ENDP ; ULONG64 __stdcall NtGdiMakeObjectXferable( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiMakeObjectXferable PROC STDCALL mov r10 , rcx mov eax , 4748 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMakeObjectXferable ENDP ; ULONG64 __stdcall NtGdiMirrorWindowOrg( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiMirrorWindowOrg PROC STDCALL mov r10 , rcx mov eax , 4749 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMirrorWindowOrg ENDP ; ULONG64 __stdcall NtGdiMonoBitmap( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiMonoBitmap PROC STDCALL mov r10 , rcx mov eax , 4750 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMonoBitmap ENDP ; ULONG64 __stdcall NtGdiMoveTo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiMoveTo PROC STDCALL mov r10 , rcx mov eax , 4751 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiMoveTo ENDP ; ULONG64 __stdcall NtGdiOffsetClipRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiOffsetClipRgn PROC STDCALL mov r10 , rcx mov eax , 4752 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiOffsetClipRgn ENDP ; ULONG64 __stdcall NtGdiPATHOBJ_bEnum( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_bEnum PROC STDCALL mov r10 , rcx mov eax , 4753 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_bEnum ENDP ; ULONG64 __stdcall NtGdiPATHOBJ_bEnumClipLines( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_bEnumClipLines PROC STDCALL mov r10 , rcx mov eax , 4754 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_bEnumClipLines ENDP ; ULONG64 __stdcall NtGdiPATHOBJ_vEnumStart( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_vEnumStart PROC STDCALL mov r10 , rcx mov eax , 4755 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_vEnumStart ENDP ; ULONG64 __stdcall NtGdiPATHOBJ_vEnumStartClipLines( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_vEnumStartClipLines PROC STDCALL mov r10 , rcx mov eax , 4756 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_vEnumStartClipLines ENDP ; ULONG64 __stdcall NtGdiPATHOBJ_vGetBounds( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_vGetBounds PROC STDCALL mov r10 , rcx mov eax , 4757 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPATHOBJ_vGetBounds ENDP ; ULONG64 __stdcall NtGdiPathToRegion( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiPathToRegion PROC STDCALL mov r10 , rcx mov eax , 4758 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPathToRegion ENDP ; ULONG64 __stdcall NtGdiPlgBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiPlgBlt PROC STDCALL mov r10 , rcx mov eax , 4759 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPlgBlt ENDP ; ULONG64 __stdcall NtGdiPolyDraw( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiPolyDraw PROC STDCALL mov r10 , rcx mov eax , 4760 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPolyDraw ENDP ; ULONG64 __stdcall NtGdiPolyTextOutW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiPolyTextOutW PROC STDCALL mov r10 , rcx mov eax , 4761 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPolyTextOutW ENDP ; ULONG64 __stdcall NtGdiPtInRegion( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiPtInRegion PROC STDCALL mov r10 , rcx mov eax , 4762 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPtInRegion ENDP ; ULONG64 __stdcall NtGdiPtVisible( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiPtVisible PROC STDCALL mov r10 , rcx mov eax , 4763 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiPtVisible ENDP ; ULONG64 __stdcall NtGdiQueryFonts( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiQueryFonts PROC STDCALL mov r10 , rcx mov eax , 4764 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiQueryFonts ENDP ; ULONG64 __stdcall NtGdiRemoveFontResourceW( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiRemoveFontResourceW PROC STDCALL mov r10 , rcx mov eax , 4765 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRemoveFontResourceW ENDP ; ULONG64 __stdcall NtGdiRemoveMergeFont( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiRemoveMergeFont PROC STDCALL mov r10 , rcx mov eax , 4766 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRemoveMergeFont ENDP ; ULONG64 __stdcall NtGdiResetDC( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiResetDC PROC STDCALL mov r10 , rcx mov eax , 4767 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiResetDC ENDP ; ULONG64 __stdcall NtGdiResizePalette( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiResizePalette PROC STDCALL mov r10 , rcx mov eax , 4768 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiResizePalette ENDP ; ULONG64 __stdcall NtGdiRoundRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtGdiRoundRect PROC STDCALL mov r10 , rcx mov eax , 4769 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiRoundRect ENDP ; ULONG64 __stdcall NtGdiSTROBJ_bEnum( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSTROBJ_bEnum PROC STDCALL mov r10 , rcx mov eax , 4770 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSTROBJ_bEnum ENDP ; ULONG64 __stdcall NtGdiSTROBJ_bEnumPositionsOnly( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSTROBJ_bEnumPositionsOnly PROC STDCALL mov r10 , rcx mov eax , 4771 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSTROBJ_bEnumPositionsOnly ENDP ; ULONG64 __stdcall NtGdiSTROBJ_bGetAdvanceWidths( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiSTROBJ_bGetAdvanceWidths PROC STDCALL mov r10 , rcx mov eax , 4772 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSTROBJ_bGetAdvanceWidths ENDP ; ULONG64 __stdcall NtGdiSTROBJ_dwGetCodePage( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiSTROBJ_dwGetCodePage PROC STDCALL mov r10 , rcx mov eax , 4773 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSTROBJ_dwGetCodePage ENDP ; ULONG64 __stdcall NtGdiSTROBJ_vEnumStart( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiSTROBJ_vEnumStart PROC STDCALL mov r10 , rcx mov eax , 4774 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSTROBJ_vEnumStart ENDP ; ULONG64 __stdcall NtGdiScaleViewportExtEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiScaleViewportExtEx PROC STDCALL mov r10 , rcx mov eax , 4775 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiScaleViewportExtEx ENDP ; ULONG64 __stdcall NtGdiScaleWindowExtEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtGdiScaleWindowExtEx PROC STDCALL mov r10 , rcx mov eax , 4776 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiScaleWindowExtEx ENDP ; ULONG64 __stdcall NtGdiSelectBrush( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSelectBrush PROC STDCALL mov r10 , rcx mov eax , 4777 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSelectBrush ENDP ; ULONG64 __stdcall NtGdiSelectClipPath( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSelectClipPath PROC STDCALL mov r10 , rcx mov eax , 4778 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSelectClipPath ENDP ; ULONG64 __stdcall NtGdiSelectPen( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSelectPen PROC STDCALL mov r10 , rcx mov eax , 4779 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSelectPen ENDP ; ULONG64 __stdcall NtGdiSetBitmapAttributes( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetBitmapAttributes PROC STDCALL mov r10 , rcx mov eax , 4780 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetBitmapAttributes ENDP ; ULONG64 __stdcall NtGdiSetBrushAttributes( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetBrushAttributes PROC STDCALL mov r10 , rcx mov eax , 4781 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetBrushAttributes ENDP ; ULONG64 __stdcall NtGdiSetColorAdjustment( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetColorAdjustment PROC STDCALL mov r10 , rcx mov eax , 4782 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetColorAdjustment ENDP ; ULONG64 __stdcall NtGdiSetColorSpace( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetColorSpace PROC STDCALL mov r10 , rcx mov eax , 4783 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetColorSpace ENDP ; ULONG64 __stdcall NtGdiSetDeviceGammaRamp( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetDeviceGammaRamp PROC STDCALL mov r10 , rcx mov eax , 4784 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetDeviceGammaRamp ENDP ; ULONG64 __stdcall NtGdiSetFontXform( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetFontXform PROC STDCALL mov r10 , rcx mov eax , 4785 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetFontXform ENDP ; ULONG64 __stdcall NtGdiSetIcmMode( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetIcmMode PROC STDCALL mov r10 , rcx mov eax , 4786 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetIcmMode ENDP ; ULONG64 __stdcall NtGdiSetLinkedUFIs( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetLinkedUFIs PROC STDCALL mov r10 , rcx mov eax , 4787 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetLinkedUFIs ENDP ; ULONG64 __stdcall NtGdiSetMagicColors( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetMagicColors PROC STDCALL mov r10 , rcx mov eax , 4788 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetMagicColors ENDP ; ULONG64 __stdcall NtGdiSetOPMSigningKeyAndSequenceNumbers( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetOPMSigningKeyAndSequenceNumbers PROC STDCALL mov r10 , rcx mov eax , 4789 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetOPMSigningKeyAndSequenceNumbers ENDP ; ULONG64 __stdcall NtGdiSetPUMPDOBJ( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiSetPUMPDOBJ PROC STDCALL mov r10 , rcx mov eax , 4790 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetPUMPDOBJ ENDP ; ULONG64 __stdcall NtGdiSetPixelFormat( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetPixelFormat PROC STDCALL mov r10 , rcx mov eax , 4791 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetPixelFormat ENDP ; ULONG64 __stdcall NtGdiSetRectRgn( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiSetRectRgn PROC STDCALL mov r10 , rcx mov eax , 4792 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetRectRgn ENDP ; ULONG64 __stdcall NtGdiSetSizeDevice( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetSizeDevice PROC STDCALL mov r10 , rcx mov eax , 4793 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetSizeDevice ENDP ; ULONG64 __stdcall NtGdiSetSystemPaletteUse( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiSetSystemPaletteUse PROC STDCALL mov r10 , rcx mov eax , 4794 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetSystemPaletteUse ENDP ; ULONG64 __stdcall NtGdiSetTextJustification( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtGdiSetTextJustification PROC STDCALL mov r10 , rcx mov eax , 4795 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetTextJustification ENDP ; ULONG64 __stdcall NtGdiSetUMPDSandboxState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiSetUMPDSandboxState PROC STDCALL mov r10 , rcx mov eax , 4796 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSetUMPDSandboxState ENDP ; ULONG64 __stdcall NtGdiStartDoc( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiStartDoc PROC STDCALL mov r10 , rcx mov eax , 4797 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiStartDoc ENDP ; ULONG64 __stdcall NtGdiStartPage( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiStartPage PROC STDCALL mov r10 , rcx mov eax , 4798 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiStartPage ENDP ; ULONG64 __stdcall NtGdiStrokeAndFillPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiStrokeAndFillPath PROC STDCALL mov r10 , rcx mov eax , 4799 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiStrokeAndFillPath ENDP ; ULONG64 __stdcall NtGdiStrokePath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiStrokePath PROC STDCALL mov r10 , rcx mov eax , 4800 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiStrokePath ENDP ; ULONG64 __stdcall NtGdiSwapBuffers( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiSwapBuffers PROC STDCALL mov r10 , rcx mov eax , 4801 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiSwapBuffers ENDP ; ULONG64 __stdcall NtGdiTransparentBlt( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 ); _6_2_9200_sp0_windows_8_NtGdiTransparentBlt PROC STDCALL mov r10 , rcx mov eax , 4802 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiTransparentBlt ENDP ; ULONG64 __stdcall NtGdiUMPDEngFreeUserMem( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiUMPDEngFreeUserMem PROC STDCALL mov r10 , rcx mov eax , 4803 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiUMPDEngFreeUserMem ENDP ; for CCompositionBuffer::GetIndependentFlipState ; ULONG64 __stdcall CCompositionBuffer__GetIndependentFlipState( ); _6_2_9200_sp0_windows_8_CCompositionBuffer__GetIndependentFlipState PROC STDCALL mov r10 , rcx mov eax , 4804 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_CCompositionBuffer__GetIndependentFlipState ENDP ; for CDiscardInputQueue::GetType ; ULONG64 __stdcall CDiscardInputQueue__GetType( ); _6_2_9200_sp0_windows_8_CDiscardInputQueue__GetType PROC STDCALL mov r10 , rcx mov eax , 4805 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_CDiscardInputQueue__GetType ENDP ; ULONG64 __stdcall NtGdiUpdateColors( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiUpdateColors PROC STDCALL mov r10 , rcx mov eax , 4806 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiUpdateColors ENDP ; ULONG64 __stdcall NtGdiUpdateTransform( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiUpdateTransform PROC STDCALL mov r10 , rcx mov eax , 4807 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiUpdateTransform ENDP ; ULONG64 __stdcall NtGdiWidenPath( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiWidenPath PROC STDCALL mov r10 , rcx mov eax , 4808 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiWidenPath ENDP ; ULONG64 __stdcall NtGdiXFORMOBJ_bApplyXform( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtGdiXFORMOBJ_bApplyXform PROC STDCALL mov r10 , rcx mov eax , 4809 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiXFORMOBJ_bApplyXform ENDP ; ULONG64 __stdcall NtGdiXFORMOBJ_iGetXform( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiXFORMOBJ_iGetXform PROC STDCALL mov r10 , rcx mov eax , 4810 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiXFORMOBJ_iGetXform ENDP ; ULONG64 __stdcall NtGdiXLATEOBJ_cGetPalette( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtGdiXLATEOBJ_cGetPalette PROC STDCALL mov r10 , rcx mov eax , 4811 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiXLATEOBJ_cGetPalette ENDP ; ULONG64 __stdcall NtGdiXLATEOBJ_hGetColorTransform( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtGdiXLATEOBJ_hGetColorTransform PROC STDCALL mov r10 , rcx mov eax , 4812 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiXLATEOBJ_hGetColorTransform ENDP ; ULONG64 __stdcall NtGdiXLATEOBJ_iXlate( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtGdiXLATEOBJ_iXlate PROC STDCALL mov r10 , rcx mov eax , 4813 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtGdiXLATEOBJ_iXlate ENDP ; ULONG64 __stdcall NtNotifyPresentToCompositionSurface( ); _6_2_9200_sp0_windows_8_NtNotifyPresentToCompositionSurface PROC STDCALL mov r10 , rcx mov eax , 4814 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtNotifyPresentToCompositionSurface ENDP ; ULONG64 __stdcall NtOpenCompositionSurfaceDirtyRegion( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtOpenCompositionSurfaceDirtyRegion PROC STDCALL mov r10 , rcx mov eax , 4815 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtOpenCompositionSurfaceDirtyRegion ENDP ; ULONG64 __stdcall NtOpenCompositionSurfaceSectionInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtOpenCompositionSurfaceSectionInfo PROC STDCALL mov r10 , rcx mov eax , 4816 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtOpenCompositionSurfaceSectionInfo ENDP ; ULONG64 __stdcall NtOpenCompositionSurfaceSwapChainHandleInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtOpenCompositionSurfaceSwapChainHandleInfo PROC STDCALL mov r10 , rcx mov eax , 4817 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtOpenCompositionSurfaceSwapChainHandleInfo ENDP ; ULONG64 __stdcall NtQueryCompositionSurfaceBinding( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtQueryCompositionSurfaceBinding PROC STDCALL mov r10 , rcx mov eax , 4818 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtQueryCompositionSurfaceBinding ENDP ; ULONG64 __stdcall NtQueryCompositionSurfaceRenderingRealization( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtQueryCompositionSurfaceRenderingRealization PROC STDCALL mov r10 , rcx mov eax , 4819 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtQueryCompositionSurfaceRenderingRealization ENDP ; ULONG64 __stdcall NtQueryCompositionSurfaceStatistics( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtQueryCompositionSurfaceStatistics PROC STDCALL mov r10 , rcx mov eax , 4820 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtQueryCompositionSurfaceStatistics ENDP ; ULONG64 __stdcall NtSetCompositionSurfaceOutOfFrameDirectFlipNotification( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtSetCompositionSurfaceOutOfFrameDirectFlipNotification PROC STDCALL mov r10 , rcx mov eax , 4821 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtSetCompositionSurfaceOutOfFrameDirectFlipNotification ENDP ; ULONG64 __stdcall NtSetCompositionSurfaceStatistics( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtSetCompositionSurfaceStatistics PROC STDCALL mov r10 , rcx mov eax , 4822 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtSetCompositionSurfaceStatistics ENDP ; ULONG64 __stdcall NtTokenManagerGetOutOfFrameDirectFlipSurfaceUpdates( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtTokenManagerGetOutOfFrameDirectFlipSurfaceUpdates PROC STDCALL mov r10 , rcx mov eax , 4823 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtTokenManagerGetOutOfFrameDirectFlipSurfaceUpdates ENDP ; ULONG64 __stdcall NtTokenManagerOpenEvent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtTokenManagerOpenEvent PROC STDCALL mov r10 , rcx mov eax , 4824 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtTokenManagerOpenEvent ENDP ; ULONG64 __stdcall NtTokenManagerThread( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtTokenManagerThread PROC STDCALL mov r10 , rcx mov eax , 4825 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtTokenManagerThread ENDP ; ULONG64 __stdcall NtUnBindCompositionSurface( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUnBindCompositionSurface PROC STDCALL mov r10 , rcx mov eax , 4826 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUnBindCompositionSurface ENDP ; ULONG64 __stdcall NtUserAcquireIAMKey( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserAcquireIAMKey PROC STDCALL mov r10 , rcx mov eax , 4827 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserAcquireIAMKey ENDP ; ULONG64 __stdcall NtUserAddClipboardFormatListener( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserAddClipboardFormatListener PROC STDCALL mov r10 , rcx mov eax , 4828 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserAddClipboardFormatListener ENDP ; ULONG64 __stdcall NtUserAssociateInputContext( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserAssociateInputContext PROC STDCALL mov r10 , rcx mov eax , 4829 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserAssociateInputContext ENDP ; ULONG64 __stdcall NtUserAutoPromoteMouseInPointer( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserAutoPromoteMouseInPointer PROC STDCALL mov r10 , rcx mov eax , 4830 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserAutoPromoteMouseInPointer ENDP ; ULONG64 __stdcall NtUserAutoRotateScreen( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserAutoRotateScreen PROC STDCALL mov r10 , rcx mov eax , 4831 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserAutoRotateScreen ENDP ; ULONG64 __stdcall NtUserBlockInput( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserBlockInput PROC STDCALL mov r10 , rcx mov eax , 4832 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserBlockInput ENDP ; ULONG64 __stdcall NtUserBuildHimcList( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserBuildHimcList PROC STDCALL mov r10 , rcx mov eax , 4833 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserBuildHimcList ENDP ; ULONG64 __stdcall NtUserBuildPropList( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserBuildPropList PROC STDCALL mov r10 , rcx mov eax , 4834 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserBuildPropList ENDP ; ULONG64 __stdcall NtUserCalculatePopupWindowPosition( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserCalculatePopupWindowPosition PROC STDCALL mov r10 , rcx mov eax , 4835 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCalculatePopupWindowPosition ENDP ; ULONG64 __stdcall NtUserCallHwndOpt( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCallHwndOpt PROC STDCALL mov r10 , rcx mov eax , 4836 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCallHwndOpt ENDP ; ULONG64 __stdcall NtUserCanBrokerForceForeground( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserCanBrokerForceForeground PROC STDCALL mov r10 , rcx mov eax , 4837 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCanBrokerForceForeground ENDP ; ULONG64 __stdcall NtUserChangeDisplaySettings( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserChangeDisplaySettings PROC STDCALL mov r10 , rcx mov eax , 4838 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserChangeDisplaySettings ENDP ; ULONG64 __stdcall NtUserChangeWindowMessageFilterEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserChangeWindowMessageFilterEx PROC STDCALL mov r10 , rcx mov eax , 4839 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserChangeWindowMessageFilterEx ENDP ; ULONG64 __stdcall NtUserCheckAccessForIntegrityLevel( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserCheckAccessForIntegrityLevel PROC STDCALL mov r10 , rcx mov eax , 4840 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCheckAccessForIntegrityLevel ENDP ; ULONG64 __stdcall NtUserCheckProcessForClipboardAccess( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCheckProcessForClipboardAccess PROC STDCALL mov r10 , rcx mov eax , 4841 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCheckProcessForClipboardAccess ENDP ; ULONG64 __stdcall NtUserCheckProcessSession( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserCheckProcessSession PROC STDCALL mov r10 , rcx mov eax , 4842 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCheckProcessSession ENDP ; ULONG64 __stdcall NtUserCheckWindowThreadDesktop( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserCheckWindowThreadDesktop PROC STDCALL mov r10 , rcx mov eax , 4843 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCheckWindowThreadDesktop ENDP ; ULONG64 __stdcall NtUserChildWindowFromPointEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserChildWindowFromPointEx PROC STDCALL mov r10 , rcx mov eax , 4844 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserChildWindowFromPointEx ENDP ; ULONG64 __stdcall NtUserClipCursor( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserClipCursor PROC STDCALL mov r10 , rcx mov eax , 4845 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserClipCursor ENDP ; ULONG64 __stdcall NtUserCreateDCompositionHwndTarget( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserCreateDCompositionHwndTarget PROC STDCALL mov r10 , rcx mov eax , 4846 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateDCompositionHwndTarget ENDP ; ULONG64 __stdcall NtUserCreateDesktopEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserCreateDesktopEx PROC STDCALL mov r10 , rcx mov eax , 4847 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateDesktopEx ENDP ; ULONG64 __stdcall NtUserCreateInputContext( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserCreateInputContext PROC STDCALL mov r10 , rcx mov eax , 4848 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateInputContext ENDP ; ULONG64 __stdcall NtUserCreateWindowStation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtUserCreateWindowStation PROC STDCALL mov r10 , rcx mov eax , 4849 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCreateWindowStation ENDP ; ULONG64 __stdcall NtUserCtxDisplayIOCtl( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserCtxDisplayIOCtl PROC STDCALL mov r10 , rcx mov eax , 4850 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserCtxDisplayIOCtl ENDP ; ULONG64 __stdcall NtUserDeferWindowPosAndBand( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 ); _6_2_9200_sp0_windows_8_NtUserDeferWindowPosAndBand PROC STDCALL mov r10 , rcx mov eax , 4851 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDeferWindowPosAndBand ENDP ; ULONG64 __stdcall NtUserDelegateCapturePointers( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserDelegateCapturePointers PROC STDCALL mov r10 , rcx mov eax , 4852 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDelegateCapturePointers ENDP ; ULONG64 __stdcall NtUserDelegateInput( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserDelegateInput PROC STDCALL mov r10 , rcx mov eax , 4853 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDelegateInput ENDP ; ULONG64 __stdcall NtUserDestroyDCompositionHwndTarget( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserDestroyDCompositionHwndTarget PROC STDCALL mov r10 , rcx mov eax , 4854 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDestroyDCompositionHwndTarget ENDP ; ULONG64 __stdcall NtUserDestroyInputContext( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDestroyInputContext PROC STDCALL mov r10 , rcx mov eax , 4855 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDestroyInputContext ENDP ; ULONG64 __stdcall NtUserDisableImmersiveOwner( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDisableImmersiveOwner PROC STDCALL mov r10 , rcx mov eax , 4856 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDisableImmersiveOwner ENDP ; ULONG64 __stdcall NtUserDisableProcessWindowFiltering( ); _6_2_9200_sp0_windows_8_NtUserDisableProcessWindowFiltering PROC STDCALL mov r10 , rcx mov eax , 4857 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDisableProcessWindowFiltering ENDP ; ULONG64 __stdcall NtUserDisableThreadIme( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDisableThreadIme PROC STDCALL mov r10 , rcx mov eax , 4858 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDisableThreadIme ENDP ; ULONG64 __stdcall NtUserDiscardPointerFrameMessages( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDiscardPointerFrameMessages PROC STDCALL mov r10 , rcx mov eax , 4859 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDiscardPointerFrameMessages ENDP ; ULONG64 __stdcall NtUserDisplayConfigGetDeviceInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDisplayConfigGetDeviceInfo PROC STDCALL mov r10 , rcx mov eax , 4860 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDisplayConfigGetDeviceInfo ENDP ; ULONG64 __stdcall NtUserDisplayConfigSetDeviceInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserDisplayConfigSetDeviceInfo PROC STDCALL mov r10 , rcx mov eax , 4861 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDisplayConfigSetDeviceInfo ENDP ; ULONG64 __stdcall NtUserDoSoundConnect( ); _6_2_9200_sp0_windows_8_NtUserDoSoundConnect PROC STDCALL mov r10 , rcx mov eax , 4862 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDoSoundConnect ENDP ; ULONG64 __stdcall NtUserDoSoundDisconnect( ); _6_2_9200_sp0_windows_8_NtUserDoSoundDisconnect PROC STDCALL mov r10 , rcx mov eax , 4863 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDoSoundDisconnect ENDP ; ULONG64 __stdcall NtUserDragDetect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserDragDetect PROC STDCALL mov r10 , rcx mov eax , 4864 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDragDetect ENDP ; ULONG64 __stdcall NtUserDragObject( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserDragObject PROC STDCALL mov r10 , rcx mov eax , 4865 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDragObject ENDP ; ULONG64 __stdcall NtUserDrawAnimatedRects( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserDrawAnimatedRects PROC STDCALL mov r10 , rcx mov eax , 4866 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDrawAnimatedRects ENDP ; ULONG64 __stdcall NtUserDrawCaption( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserDrawCaption PROC STDCALL mov r10 , rcx mov eax , 4867 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDrawCaption ENDP ; ULONG64 __stdcall NtUserDrawCaptionTemp( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 ); _6_2_9200_sp0_windows_8_NtUserDrawCaptionTemp PROC STDCALL mov r10 , rcx mov eax , 4868 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDrawCaptionTemp ENDP ; ULONG64 __stdcall NtUserDrawMenuBarTemp( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserDrawMenuBarTemp PROC STDCALL mov r10 , rcx mov eax , 4869 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDrawMenuBarTemp ENDP ; ULONG64 __stdcall NtUserDwmGetRemoteSessionOcclusionEvent( ); _6_2_9200_sp0_windows_8_NtUserDwmGetRemoteSessionOcclusionEvent PROC STDCALL mov r10 , rcx mov eax , 4870 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDwmGetRemoteSessionOcclusionEvent ENDP ; ULONG64 __stdcall NtUserDwmGetRemoteSessionOcclusionState( ); _6_2_9200_sp0_windows_8_NtUserDwmGetRemoteSessionOcclusionState PROC STDCALL mov r10 , rcx mov eax , 4871 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDwmGetRemoteSessionOcclusionState ENDP ; ULONG64 __stdcall NtUserDwmStartRedirection( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserDwmStartRedirection PROC STDCALL mov r10 , rcx mov eax , 4872 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDwmStartRedirection ENDP ; ULONG64 __stdcall NtUserDwmStopRedirection( ); _6_2_9200_sp0_windows_8_NtUserDwmStopRedirection PROC STDCALL mov r10 , rcx mov eax , 4873 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDwmStopRedirection ENDP ; ULONG64 __stdcall NtUserDwmValidateWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserDwmValidateWindow PROC STDCALL mov r10 , rcx mov eax , 4874 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserDwmValidateWindow ENDP ; ULONG64 __stdcall NtUserEnableIAMAccess( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserEnableIAMAccess PROC STDCALL mov r10 , rcx mov eax , 4875 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnableIAMAccess ENDP ; ULONG64 __stdcall NtUserEnableMouseInPointer( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserEnableMouseInPointer PROC STDCALL mov r10 , rcx mov eax , 4876 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnableMouseInPointer ENDP ; ULONG64 __stdcall NtUserEnableMouseInputForCursorSuppression( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserEnableMouseInputForCursorSuppression PROC STDCALL mov r10 , rcx mov eax , 4877 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEnableMouseInputForCursorSuppression ENDP ; ULONG64 __stdcall NtUserEndMenu( ); _6_2_9200_sp0_windows_8_NtUserEndMenu PROC STDCALL mov r10 , rcx mov eax , 4878 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEndMenu ENDP ; ULONG64 __stdcall NtUserEvent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserEvent PROC STDCALL mov r10 , rcx mov eax , 4879 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserEvent ENDP ; ULONG64 __stdcall NtUserFlashWindowEx( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserFlashWindowEx PROC STDCALL mov r10 , rcx mov eax , 4880 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserFlashWindowEx ENDP ; ULONG64 __stdcall NtUserFrostCrashedWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserFrostCrashedWindow PROC STDCALL mov r10 , rcx mov eax , 4881 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserFrostCrashedWindow ENDP ; ULONG64 __stdcall NtUserGetAppImeLevel( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetAppImeLevel PROC STDCALL mov r10 , rcx mov eax , 4882 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetAppImeLevel ENDP ; ULONG64 __stdcall NtUserGetAutoRotationState( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetAutoRotationState PROC STDCALL mov r10 , rcx mov eax , 4883 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetAutoRotationState ENDP ; ULONG64 __stdcall NtUserGetCIMSSM( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetCIMSSM PROC STDCALL mov r10 , rcx mov eax , 4884 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetCIMSSM ENDP ; ULONG64 __stdcall NtUserGetCaretPos( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetCaretPos PROC STDCALL mov r10 , rcx mov eax , 4885 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetCaretPos ENDP ; ULONG64 __stdcall NtUserGetClipCursor( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetClipCursor PROC STDCALL mov r10 , rcx mov eax , 4886 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClipCursor ENDP ; ULONG64 __stdcall NtUserGetClipboardAccessToken( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetClipboardAccessToken PROC STDCALL mov r10 , rcx mov eax , 4887 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClipboardAccessToken ENDP ; ULONG64 __stdcall NtUserGetClipboardViewer( ); _6_2_9200_sp0_windows_8_NtUserGetClipboardViewer PROC STDCALL mov r10 , rcx mov eax , 4888 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetClipboardViewer ENDP ; ULONG64 __stdcall NtUserGetComboBoxInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetComboBoxInfo PROC STDCALL mov r10 , rcx mov eax , 4889 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetComboBoxInfo ENDP ; ULONG64 __stdcall NtUserGetCurrentInputMessageSource( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetCurrentInputMessageSource PROC STDCALL mov r10 , rcx mov eax , 4890 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetCurrentInputMessageSource ENDP ; ULONG64 __stdcall NtUserGetCursorInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetCursorInfo PROC STDCALL mov r10 , rcx mov eax , 4891 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetCursorInfo ENDP ; ULONG64 __stdcall NtUserGetDesktopID( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetDesktopID PROC STDCALL mov r10 , rcx mov eax , 4892 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetDesktopID ENDP ; ULONG64 __stdcall NtUserGetDisplayAutoRotationPreferences( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetDisplayAutoRotationPreferences PROC STDCALL mov r10 , rcx mov eax , 4893 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetDisplayAutoRotationPreferences ENDP ; ULONG64 __stdcall NtUserGetDisplayAutoRotationPreferencesByProcessId( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetDisplayAutoRotationPreferencesByProcessId PROC STDCALL mov r10 , rcx mov eax , 4894 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetDisplayAutoRotationPreferencesByProcessId ENDP ; ULONG64 __stdcall NtUserGetDisplayConfigBufferSizes( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetDisplayConfigBufferSizes PROC STDCALL mov r10 , rcx mov eax , 4895 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetDisplayConfigBufferSizes ENDP ; ULONG64 __stdcall NtUserGetGestureConfig( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserGetGestureConfig PROC STDCALL mov r10 , rcx mov eax , 4896 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetGestureConfig ENDP ; ULONG64 __stdcall NtUserGetGestureExtArgs( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetGestureExtArgs PROC STDCALL mov r10 , rcx mov eax , 4897 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetGestureExtArgs ENDP ; ULONG64 __stdcall NtUserGetGestureInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetGestureInfo PROC STDCALL mov r10 , rcx mov eax , 4898 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetGestureInfo ENDP ; ULONG64 __stdcall NtUserGetGlobalIMEStatus( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetGlobalIMEStatus PROC STDCALL mov r10 , rcx mov eax , 4899 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetGlobalIMEStatus ENDP ; ULONG64 __stdcall NtUserGetGuiResources( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetGuiResources PROC STDCALL mov r10 , rcx mov eax , 4900 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetGuiResources ENDP ; ULONG64 __stdcall NtUserGetImeHotKey( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetImeHotKey PROC STDCALL mov r10 , rcx mov eax , 4901 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetImeHotKey ENDP ; ULONG64 __stdcall NtUserGetImeInfoEx( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetImeInfoEx PROC STDCALL mov r10 , rcx mov eax , 4902 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetImeInfoEx ENDP ; ULONG64 __stdcall NtUserGetInputLocaleInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetInputLocaleInfo PROC STDCALL mov r10 , rcx mov eax , 4903 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetInputLocaleInfo ENDP ; ULONG64 __stdcall NtUserGetInternalWindowPos( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetInternalWindowPos PROC STDCALL mov r10 , rcx mov eax , 4904 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetInternalWindowPos ENDP ; ULONG64 __stdcall NtUserGetKeyNameText( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetKeyNameText PROC STDCALL mov r10 , rcx mov eax , 4905 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetKeyNameText ENDP ; ULONG64 __stdcall NtUserGetKeyboardLayoutName( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetKeyboardLayoutName PROC STDCALL mov r10 , rcx mov eax , 4906 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetKeyboardLayoutName ENDP ; ULONG64 __stdcall NtUserGetLayeredWindowAttributes( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetLayeredWindowAttributes PROC STDCALL mov r10 , rcx mov eax , 4907 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetLayeredWindowAttributes ENDP ; ULONG64 __stdcall NtUserGetListBoxInfo( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetListBoxInfo PROC STDCALL mov r10 , rcx mov eax , 4908 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetListBoxInfo ENDP ; ULONG64 __stdcall NtUserGetMenuIndex( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetMenuIndex PROC STDCALL mov r10 , rcx mov eax , 4909 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetMenuIndex ENDP ; ULONG64 __stdcall NtUserGetMenuItemRect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetMenuItemRect PROC STDCALL mov r10 , rcx mov eax , 4910 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetMenuItemRect ENDP ; ULONG64 __stdcall NtUserGetMouseMovePointsEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserGetMouseMovePointsEx PROC STDCALL mov r10 , rcx mov eax , 4911 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetMouseMovePointsEx ENDP ; ULONG64 __stdcall NtUserGetPointerCursorId( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetPointerCursorId PROC STDCALL mov r10 , rcx mov eax , 4912 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerCursorId ENDP ; ULONG64 __stdcall NtUserGetPointerDevice( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetPointerDevice PROC STDCALL mov r10 , rcx mov eax , 4913 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerDevice ENDP ; ULONG64 __stdcall NtUserGetPointerDeviceCursors( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetPointerDeviceCursors PROC STDCALL mov r10 , rcx mov eax , 4914 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerDeviceCursors ENDP ; ULONG64 __stdcall NtUserGetPointerDeviceProperties( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetPointerDeviceProperties PROC STDCALL mov r10 , rcx mov eax , 4915 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerDeviceProperties ENDP ; ULONG64 __stdcall NtUserGetPointerDeviceRects( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetPointerDeviceRects PROC STDCALL mov r10 , rcx mov eax , 4916 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerDeviceRects ENDP ; ULONG64 __stdcall NtUserGetPointerDevices( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetPointerDevices PROC STDCALL mov r10 , rcx mov eax , 4917 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerDevices ENDP ; ULONG64 __stdcall NtUserGetPointerInfoList( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtUserGetPointerInfoList PROC STDCALL mov r10 , rcx mov eax , 4918 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerInfoList ENDP ; ULONG64 __stdcall NtUserGetPointerType( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetPointerType PROC STDCALL mov r10 , rcx mov eax , 4919 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPointerType ENDP ; ULONG64 __stdcall NtUserGetPriorityClipboardFormat( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetPriorityClipboardFormat PROC STDCALL mov r10 , rcx mov eax , 4920 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetPriorityClipboardFormat ENDP ; ULONG64 __stdcall NtUserGetProcessUIContextInformation( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetProcessUIContextInformation PROC STDCALL mov r10 , rcx mov eax , 4921 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetProcessUIContextInformation ENDP ; ULONG64 __stdcall NtUserGetQueueEventStatus( ); _6_2_9200_sp0_windows_8_NtUserGetQueueEventStatus PROC STDCALL mov r10 , rcx mov eax , 4922 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetQueueEventStatus ENDP ; ULONG64 __stdcall NtUserGetRawInputBuffer( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetRawInputBuffer PROC STDCALL mov r10 , rcx mov eax , 4923 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetRawInputBuffer ENDP ; ULONG64 __stdcall NtUserGetRawInputData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserGetRawInputData PROC STDCALL mov r10 , rcx mov eax , 4924 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetRawInputData ENDP ; ULONG64 __stdcall NtUserGetRawInputDeviceInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetRawInputDeviceInfo PROC STDCALL mov r10 , rcx mov eax , 4925 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetRawInputDeviceInfo ENDP ; ULONG64 __stdcall NtUserGetRawInputDeviceList( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetRawInputDeviceList PROC STDCALL mov r10 , rcx mov eax , 4926 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetRawInputDeviceList ENDP ; ULONG64 __stdcall NtUserGetRawPointerDeviceData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserGetRawPointerDeviceData PROC STDCALL mov r10 , rcx mov eax , 4927 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetRawPointerDeviceData ENDP ; ULONG64 __stdcall NtUserGetRegisteredRawInputDevices( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetRegisteredRawInputDevices PROC STDCALL mov r10 , rcx mov eax , 4928 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetRegisteredRawInputDevices ENDP ; ULONG64 __stdcall NtUserGetTopLevelWindow( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetTopLevelWindow PROC STDCALL mov r10 , rcx mov eax , 4929 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetTopLevelWindow ENDP ; ULONG64 __stdcall NtUserGetTouchInputInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserGetTouchInputInfo PROC STDCALL mov r10 , rcx mov eax , 4930 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetTouchInputInfo ENDP ; ULONG64 __stdcall NtUserGetTouchValidationStatus( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGetTouchValidationStatus PROC STDCALL mov r10 , rcx mov eax , 4931 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetTouchValidationStatus ENDP ; ULONG64 __stdcall NtUserGetUpdatedClipboardFormats( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetUpdatedClipboardFormats PROC STDCALL mov r10 , rcx mov eax , 4932 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetUpdatedClipboardFormats ENDP ; ULONG64 __stdcall NtUserGetWOWClass( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetWOWClass PROC STDCALL mov r10 , rcx mov eax , 4933 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWOWClass ENDP ; ULONG64 __stdcall NtUserGetWindowBand( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetWindowBand PROC STDCALL mov r10 , rcx mov eax , 4934 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowBand ENDP ; ULONG64 __stdcall NtUserGetWindowCompositionAttribute( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetWindowCompositionAttribute PROC STDCALL mov r10 , rcx mov eax , 4935 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowCompositionAttribute ENDP ; ULONG64 __stdcall NtUserGetWindowCompositionInfo( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetWindowCompositionInfo PROC STDCALL mov r10 , rcx mov eax , 4936 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowCompositionInfo ENDP ; ULONG64 __stdcall NtUserGetWindowDisplayAffinity( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetWindowDisplayAffinity PROC STDCALL mov r10 , rcx mov eax , 4937 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowDisplayAffinity ENDP ; ULONG64 __stdcall NtUserGetWindowFeedbackSetting( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserGetWindowFeedbackSetting PROC STDCALL mov r10 , rcx mov eax , 4938 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowFeedbackSetting ENDP ; ULONG64 __stdcall NtUserGetWindowMinimizeRect( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserGetWindowMinimizeRect PROC STDCALL mov r10 , rcx mov eax , 4939 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowMinimizeRect ENDP ; ULONG64 __stdcall NtUserGetWindowRgnEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserGetWindowRgnEx PROC STDCALL mov r10 , rcx mov eax , 4940 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGetWindowRgnEx ENDP ; ULONG64 __stdcall NtUserGhostWindowFromHungWindow( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserGhostWindowFromHungWindow PROC STDCALL mov r10 , rcx mov eax , 4941 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserGhostWindowFromHungWindow ENDP ; ULONG64 __stdcall NtUserHandleDelegatedInput( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserHandleDelegatedInput PROC STDCALL mov r10 , rcx mov eax , 4942 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHandleDelegatedInput ENDP ; ULONG64 __stdcall NtUserHardErrorControl( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserHardErrorControl PROC STDCALL mov r10 , rcx mov eax , 4943 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHardErrorControl ENDP ; ULONG64 __stdcall NtUserHidePointerContactVisualization( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserHidePointerContactVisualization PROC STDCALL mov r10 , rcx mov eax , 4944 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHidePointerContactVisualization ENDP ; ULONG64 __stdcall NtUserHiliteMenuItem( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserHiliteMenuItem PROC STDCALL mov r10 , rcx mov eax , 4945 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHiliteMenuItem ENDP ; ULONG64 __stdcall NtUserHungWindowFromGhostWindow( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserHungWindowFromGhostWindow PROC STDCALL mov r10 , rcx mov eax , 4946 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHungWindowFromGhostWindow ENDP ; ULONG64 __stdcall NtUserHwndQueryRedirectionInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserHwndQueryRedirectionInfo PROC STDCALL mov r10 , rcx mov eax , 4947 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHwndQueryRedirectionInfo ENDP ; ULONG64 __stdcall NtUserHwndSetRedirectionInfo( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserHwndSetRedirectionInfo PROC STDCALL mov r10 , rcx mov eax , 4948 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserHwndSetRedirectionInfo ENDP ; ULONG64 __stdcall NtUserImpersonateDdeClientWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserImpersonateDdeClientWindow PROC STDCALL mov r10 , rcx mov eax , 4949 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserImpersonateDdeClientWindow ENDP ; ULONG64 __stdcall NtUserInitTask( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 , ULONG64 arg_11 , ULONG64 arg_12 ); _6_2_9200_sp0_windows_8_NtUserInitTask PROC STDCALL mov r10 , rcx mov eax , 4950 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInitTask ENDP ; ULONG64 __stdcall NtUserInitialize( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserInitialize PROC STDCALL mov r10 , rcx mov eax , 4951 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInitialize ENDP ; ULONG64 __stdcall NtUserInitializeClientPfnArrays( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserInitializeClientPfnArrays PROC STDCALL mov r10 , rcx mov eax , 4952 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInitializeClientPfnArrays ENDP ; ULONG64 __stdcall NtUserInitializeTouchInjection( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserInitializeTouchInjection PROC STDCALL mov r10 , rcx mov eax , 4953 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInitializeTouchInjection ENDP ; ULONG64 __stdcall NtUserInjectGesture( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserInjectGesture PROC STDCALL mov r10 , rcx mov eax , 4954 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInjectGesture ENDP ; ULONG64 __stdcall NtUserInjectTouchInput( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserInjectTouchInput PROC STDCALL mov r10 , rcx mov eax , 4955 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInjectTouchInput ENDP ; ULONG64 __stdcall NtUserInternalClipCursor( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserInternalClipCursor PROC STDCALL mov r10 , rcx mov eax , 4956 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInternalClipCursor ENDP ; ULONG64 __stdcall NtUserInternalGetWindowIcon( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserInternalGetWindowIcon PROC STDCALL mov r10 , rcx mov eax , 4957 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserInternalGetWindowIcon ENDP ; ULONG64 __stdcall NtUserIsMouseInPointerEnabled( ); _6_2_9200_sp0_windows_8_NtUserIsMouseInPointerEnabled PROC STDCALL mov r10 , rcx mov eax , 4958 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserIsMouseInPointerEnabled ENDP ; ULONG64 __stdcall NtUserIsMouseInputEnabled( ); _6_2_9200_sp0_windows_8_NtUserIsMouseInputEnabled PROC STDCALL mov r10 , rcx mov eax , 4959 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserIsMouseInputEnabled ENDP ; ULONG64 __stdcall NtUserIsTopLevelWindow( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserIsTopLevelWindow PROC STDCALL mov r10 , rcx mov eax , 4960 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserIsTopLevelWindow ENDP ; ULONG64 __stdcall NtUserIsTouchWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserIsTouchWindow PROC STDCALL mov r10 , rcx mov eax , 4961 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserIsTouchWindow ENDP ; ULONG64 __stdcall NtUserLayoutCompleted( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserLayoutCompleted PROC STDCALL mov r10 , rcx mov eax , 4962 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserLayoutCompleted ENDP ; ULONG64 __stdcall NtUserLoadKeyboardLayoutEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 ); _6_2_9200_sp0_windows_8_NtUserLoadKeyboardLayoutEx PROC STDCALL mov r10 , rcx mov eax , 4963 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserLoadKeyboardLayoutEx ENDP ; ULONG64 __stdcall NtUserLockWindowStation( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserLockWindowStation PROC STDCALL mov r10 , rcx mov eax , 4964 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserLockWindowStation ENDP ; ULONG64 __stdcall NtUserLockWorkStation( ); _6_2_9200_sp0_windows_8_NtUserLockWorkStation PROC STDCALL mov r10 , rcx mov eax , 4965 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserLockWorkStation ENDP ; ULONG64 __stdcall NtUserLogicalToPhysicalPoint( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserLogicalToPhysicalPoint PROC STDCALL mov r10 , rcx mov eax , 4966 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserLogicalToPhysicalPoint ENDP ; ULONG64 __stdcall NtUserMNDragLeave( ); _6_2_9200_sp0_windows_8_NtUserMNDragLeave PROC STDCALL mov r10 , rcx mov eax , 4967 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMNDragLeave ENDP ; ULONG64 __stdcall NtUserMNDragOver( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserMNDragOver PROC STDCALL mov r10 , rcx mov eax , 4968 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMNDragOver ENDP ; ULONG64 __stdcall NtUserMagControl( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserMagControl PROC STDCALL mov r10 , rcx mov eax , 4969 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMagControl ENDP ; ULONG64 __stdcall NtUserMagGetContextInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserMagGetContextInformation PROC STDCALL mov r10 , rcx mov eax , 4970 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMagGetContextInformation ENDP ; ULONG64 __stdcall NtUserMagSetContextInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserMagSetContextInformation PROC STDCALL mov r10 , rcx mov eax , 4971 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMagSetContextInformation ENDP ; ULONG64 __stdcall NtUserMenuItemFromPoint( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserMenuItemFromPoint PROC STDCALL mov r10 , rcx mov eax , 4972 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMenuItemFromPoint ENDP ; ULONG64 __stdcall NtUserMinMaximize( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserMinMaximize PROC STDCALL mov r10 , rcx mov eax , 4973 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserMinMaximize ENDP ; ULONG64 __stdcall NtUserModifyWindowTouchCapability( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserModifyWindowTouchCapability PROC STDCALL mov r10 , rcx mov eax , 4974 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserModifyWindowTouchCapability ENDP ; ULONG64 __stdcall NtUserNotifyIMEStatus( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserNotifyIMEStatus PROC STDCALL mov r10 , rcx mov eax , 4975 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserNotifyIMEStatus ENDP ; ULONG64 __stdcall NtUserOpenInputDesktop( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserOpenInputDesktop PROC STDCALL mov r10 , rcx mov eax , 4976 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserOpenInputDesktop ENDP ; ULONG64 __stdcall NtUserOpenThreadDesktop( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserOpenThreadDesktop PROC STDCALL mov r10 , rcx mov eax , 4977 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserOpenThreadDesktop ENDP ; ULONG64 __stdcall NtUserPaintMonitor( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserPaintMonitor PROC STDCALL mov r10 , rcx mov eax , 4978 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPaintMonitor ENDP ; ULONG64 __stdcall NtUserPhysicalToLogicalPoint( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserPhysicalToLogicalPoint PROC STDCALL mov r10 , rcx mov eax , 4979 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPhysicalToLogicalPoint ENDP ; ULONG64 __stdcall NtUserPrintWindow( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserPrintWindow PROC STDCALL mov r10 , rcx mov eax , 4980 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPrintWindow ENDP ; ULONG64 __stdcall NtUserPromoteMouseInPointer( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserPromoteMouseInPointer PROC STDCALL mov r10 , rcx mov eax , 4981 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPromoteMouseInPointer ENDP ; ULONG64 __stdcall NtUserPromotePointer( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserPromotePointer PROC STDCALL mov r10 , rcx mov eax , 4982 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserPromotePointer ENDP ; ULONG64 __stdcall NtUserQueryBSDRWindow( ); _6_2_9200_sp0_windows_8_NtUserQueryBSDRWindow PROC STDCALL mov r10 , rcx mov eax , 4983 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserQueryBSDRWindow ENDP ; ULONG64 __stdcall NtUserQueryDisplayConfig( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserQueryDisplayConfig PROC STDCALL mov r10 , rcx mov eax , 4984 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserQueryDisplayConfig ENDP ; ULONG64 __stdcall NtUserQueryInformationThread( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserQueryInformationThread PROC STDCALL mov r10 , rcx mov eax , 4985 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserQueryInformationThread ENDP ; ULONG64 __stdcall NtUserQueryInputContext( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserQueryInputContext PROC STDCALL mov r10 , rcx mov eax , 4986 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserQueryInputContext ENDP ; ULONG64 __stdcall NtUserQuerySendMessage( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserQuerySendMessage PROC STDCALL mov r10 , rcx mov eax , 4987 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserQuerySendMessage ENDP ; ULONG64 __stdcall NtUserRealChildWindowFromPoint( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserRealChildWindowFromPoint PROC STDCALL mov r10 , rcx mov eax , 4988 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRealChildWindowFromPoint ENDP ; ULONG64 __stdcall NtUserRealWaitMessageEx( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserRealWaitMessageEx PROC STDCALL mov r10 , rcx mov eax , 4989 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRealWaitMessageEx ENDP ; ULONG64 __stdcall NtUserRegisterBSDRWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserRegisterBSDRWindow PROC STDCALL mov r10 , rcx mov eax , 4990 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterBSDRWindow ENDP ; ULONG64 __stdcall NtUserRegisterEdgy( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserRegisterEdgy PROC STDCALL mov r10 , rcx mov eax , 4991 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterEdgy ENDP ; ULONG64 __stdcall NtUserRegisterErrorReportingDialog( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserRegisterErrorReportingDialog PROC STDCALL mov r10 , rcx mov eax , 4992 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterErrorReportingDialog ENDP ; ULONG64 __stdcall NtUserRegisterHotKey( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserRegisterHotKey PROC STDCALL mov r10 , rcx mov eax , 4993 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterHotKey ENDP ; ULONG64 __stdcall NtUserRegisterPointerDeviceNotifications( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserRegisterPointerDeviceNotifications PROC STDCALL mov r10 , rcx mov eax , 4994 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterPointerDeviceNotifications ENDP ; ULONG64 __stdcall NtUserRegisterPointerInputTarget( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserRegisterPointerInputTarget PROC STDCALL mov r10 , rcx mov eax , 4995 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterPointerInputTarget ENDP ; ULONG64 __stdcall NtUserRegisterRawInputDevices( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserRegisterRawInputDevices PROC STDCALL mov r10 , rcx mov eax , 4996 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterRawInputDevices ENDP ; ULONG64 __stdcall NtUserRegisterServicesProcess( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserRegisterServicesProcess PROC STDCALL mov r10 , rcx mov eax , 4997 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterServicesProcess ENDP ; ULONG64 __stdcall NtUserRegisterSessionPort( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserRegisterSessionPort PROC STDCALL mov r10 , rcx mov eax , 4998 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterSessionPort ENDP ; ULONG64 __stdcall NtUserRegisterTasklist( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserRegisterTasklist PROC STDCALL mov r10 , rcx mov eax , 4999 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterTasklist ENDP ; ULONG64 __stdcall NtUserRegisterTouchHitTestingWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserRegisterTouchHitTestingWindow PROC STDCALL mov r10 , rcx mov eax , 5000 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterTouchHitTestingWindow ENDP ; ULONG64 __stdcall NtUserRegisterUserApiHook( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserRegisterUserApiHook PROC STDCALL mov r10 , rcx mov eax , 5001 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRegisterUserApiHook ENDP ; ULONG64 __stdcall NtUserRemoteConnect( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserRemoteConnect PROC STDCALL mov r10 , rcx mov eax , 5002 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRemoteConnect ENDP ; ULONG64 __stdcall NtUserRemoteRedrawRectangle( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserRemoteRedrawRectangle PROC STDCALL mov r10 , rcx mov eax , 5003 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRemoteRedrawRectangle ENDP ; ULONG64 __stdcall NtUserRemoteRedrawScreen( ); _6_2_9200_sp0_windows_8_NtUserRemoteRedrawScreen PROC STDCALL mov r10 , rcx mov eax , 5004 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRemoteRedrawScreen ENDP ; ULONG64 __stdcall NtUserRemoteStopScreenUpdates( ); _6_2_9200_sp0_windows_8_NtUserRemoteStopScreenUpdates PROC STDCALL mov r10 , rcx mov eax , 5005 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRemoteStopScreenUpdates ENDP ; ULONG64 __stdcall NtUserRemoveClipboardFormatListener( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserRemoveClipboardFormatListener PROC STDCALL mov r10 , rcx mov eax , 5006 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserRemoveClipboardFormatListener ENDP ; ULONG64 __stdcall NtUserResolveDesktopForWOW( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserResolveDesktopForWOW PROC STDCALL mov r10 , rcx mov eax , 5007 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserResolveDesktopForWOW ENDP ; ULONG64 __stdcall NtUserSendEventMessage( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSendEventMessage PROC STDCALL mov r10 , rcx mov eax , 5008 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSendEventMessage ENDP ; ULONG64 __stdcall NtUserSetActiveProcess( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetActiveProcess PROC STDCALL mov r10 , rcx mov eax , 5009 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetActiveProcess ENDP ; ULONG64 __stdcall NtUserSetAppImeLevel( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetAppImeLevel PROC STDCALL mov r10 , rcx mov eax , 5010 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetAppImeLevel ENDP ; ULONG64 __stdcall NtUserSetAutoRotation( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetAutoRotation PROC STDCALL mov r10 , rcx mov eax , 5011 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetAutoRotation ENDP ; ULONG64 __stdcall NtUserSetBrokeredForeground( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetBrokeredForeground PROC STDCALL mov r10 , rcx mov eax , 5012 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetBrokeredForeground ENDP ; ULONG64 __stdcall NtUserSetCalibrationData( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetCalibrationData PROC STDCALL mov r10 , rcx mov eax , 5013 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetCalibrationData ENDP ; ULONG64 __stdcall NtUserSetChildWindowNoActivate( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetChildWindowNoActivate PROC STDCALL mov r10 , rcx mov eax , 5014 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetChildWindowNoActivate ENDP ; ULONG64 __stdcall NtUserSetClassWord( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetClassWord PROC STDCALL mov r10 , rcx mov eax , 5015 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetClassWord ENDP ; ULONG64 __stdcall NtUserSetCursorContents( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetCursorContents PROC STDCALL mov r10 , rcx mov eax , 5016 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetCursorContents ENDP ; ULONG64 __stdcall NtUserSetDisplayAutoRotationPreferences( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetDisplayAutoRotationPreferences PROC STDCALL mov r10 , rcx mov eax , 5017 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetDisplayAutoRotationPreferences ENDP ; ULONG64 __stdcall NtUserSetDisplayConfig( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserSetDisplayConfig PROC STDCALL mov r10 , rcx mov eax , 5018 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetDisplayConfig ENDP ; ULONG64 __stdcall NtUserSetDisplayMapping( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetDisplayMapping PROC STDCALL mov r10 , rcx mov eax , 5019 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetDisplayMapping ENDP ; ULONG64 __stdcall NtUserSetFallbackForeground( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetFallbackForeground PROC STDCALL mov r10 , rcx mov eax , 5020 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetFallbackForeground ENDP ; ULONG64 __stdcall NtUserSetGestureConfig( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserSetGestureConfig PROC STDCALL mov r10 , rcx mov eax , 5021 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetGestureConfig ENDP ; ULONG64 __stdcall NtUserSetImeHotKey( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserSetImeHotKey PROC STDCALL mov r10 , rcx mov eax , 5022 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetImeHotKey ENDP ; ULONG64 __stdcall NtUserSetImeInfoEx( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetImeInfoEx PROC STDCALL mov r10 , rcx mov eax , 5023 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetImeInfoEx ENDP ; ULONG64 __stdcall NtUserSetImeOwnerWindow( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetImeOwnerWindow PROC STDCALL mov r10 , rcx mov eax , 5024 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetImeOwnerWindow ENDP ; ULONG64 __stdcall NtUserSetImmersiveBackgroundWindow( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetImmersiveBackgroundWindow PROC STDCALL mov r10 , rcx mov eax , 5025 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetImmersiveBackgroundWindow ENDP ; ULONG64 __stdcall NtUserSetInternalWindowPos( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetInternalWindowPos PROC STDCALL mov r10 , rcx mov eax , 5026 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetInternalWindowPos ENDP ; ULONG64 __stdcall NtUserSetLayeredWindowAttributes( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetLayeredWindowAttributes PROC STDCALL mov r10 , rcx mov eax , 5027 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetLayeredWindowAttributes ENDP ; ULONG64 __stdcall NtUserSetMenu( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetMenu PROC STDCALL mov r10 , rcx mov eax , 5028 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetMenu ENDP ; ULONG64 __stdcall NtUserSetMenuContextHelpId( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetMenuContextHelpId PROC STDCALL mov r10 , rcx mov eax , 5029 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetMenuContextHelpId ENDP ; ULONG64 __stdcall NtUserSetMenuFlagRtoL( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetMenuFlagRtoL PROC STDCALL mov r10 , rcx mov eax , 5030 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetMenuFlagRtoL ENDP ; ULONG64 __stdcall NtUserSetMirrorRendering( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetMirrorRendering PROC STDCALL mov r10 , rcx mov eax , 5031 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetMirrorRendering ENDP ; ULONG64 __stdcall NtUserSetObjectInformation( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetObjectInformation PROC STDCALL mov r10 , rcx mov eax , 5032 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetObjectInformation ENDP ; ULONG64 __stdcall NtUserSetProcessDPIAware( ); _6_2_9200_sp0_windows_8_NtUserSetProcessDPIAware PROC STDCALL mov r10 , rcx mov eax , 5033 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetProcessDPIAware ENDP ; ULONG64 __stdcall NtUserSetProcessRestrictionExemption( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetProcessRestrictionExemption PROC STDCALL mov r10 , rcx mov eax , 5034 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetProcessRestrictionExemption ENDP ; ULONG64 __stdcall NtUserSetProcessUIAccessZorder( ); _6_2_9200_sp0_windows_8_NtUserSetProcessUIAccessZorder PROC STDCALL mov r10 , rcx mov eax , 5035 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetProcessUIAccessZorder ENDP ; ULONG64 __stdcall NtUserSetSensorPresence( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserSetSensorPresence PROC STDCALL mov r10 , rcx mov eax , 5036 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetSensorPresence ENDP ; ULONG64 __stdcall NtUserSetShellWindowEx( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetShellWindowEx PROC STDCALL mov r10 , rcx mov eax , 5037 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetShellWindowEx ENDP ; ULONG64 __stdcall NtUserSetSysColors( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetSysColors PROC STDCALL mov r10 , rcx mov eax , 5038 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetSysColors ENDP ; ULONG64 __stdcall NtUserSetSystemCursor( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetSystemCursor PROC STDCALL mov r10 , rcx mov eax , 5039 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetSystemCursor ENDP ; ULONG64 __stdcall NtUserSetSystemTimer( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetSystemTimer PROC STDCALL mov r10 , rcx mov eax , 5040 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetSystemTimer ENDP ; ULONG64 __stdcall NtUserSetThreadInputBlocked( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetThreadInputBlocked PROC STDCALL mov r10 , rcx mov eax , 5041 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetThreadInputBlocked ENDP ; ULONG64 __stdcall NtUserSetThreadLayoutHandles( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetThreadLayoutHandles PROC STDCALL mov r10 , rcx mov eax , 5042 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetThreadLayoutHandles ENDP ; ULONG64 __stdcall NtUserSetWindowBand( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetWindowBand PROC STDCALL mov r10 , rcx mov eax , 5043 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowBand ENDP ; ULONG64 __stdcall NtUserSetWindowCompositionAttribute( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetWindowCompositionAttribute PROC STDCALL mov r10 , rcx mov eax , 5044 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowCompositionAttribute ENDP ; ULONG64 __stdcall NtUserSetWindowCompositionTransition( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserSetWindowCompositionTransition PROC STDCALL mov r10 , rcx mov eax , 5045 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowCompositionTransition ENDP ; ULONG64 __stdcall NtUserSetWindowDisplayAffinity( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserSetWindowDisplayAffinity PROC STDCALL mov r10 , rcx mov eax , 5046 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowDisplayAffinity ENDP ; ULONG64 __stdcall NtUserSetWindowFeedbackSetting( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserSetWindowFeedbackSetting PROC STDCALL mov r10 , rcx mov eax , 5047 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowFeedbackSetting ENDP ; ULONG64 __stdcall NtUserSetWindowRgnEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSetWindowRgnEx PROC STDCALL mov r10 , rcx mov eax , 5048 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowRgnEx ENDP ; ULONG64 __stdcall NtUserSetWindowStationUser( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetWindowStationUser PROC STDCALL mov r10 , rcx mov eax , 5049 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowStationUser ENDP ; ULONG64 __stdcall NtUserShowSystemCursor( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserShowSystemCursor PROC STDCALL mov r10 , rcx mov eax , 5050 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShowSystemCursor ENDP ; ULONG64 __stdcall NtUserShutdownBlockReasonCreate( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserShutdownBlockReasonCreate PROC STDCALL mov r10 , rcx mov eax , 5051 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShutdownBlockReasonCreate ENDP ; ULONG64 __stdcall NtUserShutdownBlockReasonQuery( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserShutdownBlockReasonQuery PROC STDCALL mov r10 , rcx mov eax , 5052 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShutdownBlockReasonQuery ENDP ; ULONG64 __stdcall NtUserShutdownReasonDestroy( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserShutdownReasonDestroy PROC STDCALL mov r10 , rcx mov eax , 5053 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserShutdownReasonDestroy ENDP ; ULONG64 __stdcall NtUserSignalRedirectionStartComplete( ); _6_2_9200_sp0_windows_8_NtUserSignalRedirectionStartComplete PROC STDCALL mov r10 , rcx mov eax , 5054 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSignalRedirectionStartComplete ENDP ; ULONG64 __stdcall NtUserSlicerControl( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSlicerControl PROC STDCALL mov r10 , rcx mov eax , 5055 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSlicerControl ENDP ; ULONG64 __stdcall NtUserSoundSentry( ); _6_2_9200_sp0_windows_8_NtUserSoundSentry PROC STDCALL mov r10 , rcx mov eax , 5056 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSoundSentry ENDP ; ULONG64 __stdcall NtUserSwitchDesktop( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserSwitchDesktop PROC STDCALL mov r10 , rcx mov eax , 5057 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSwitchDesktop ENDP ; ULONG64 __stdcall NtUserTestForInteractiveUser( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserTestForInteractiveUser PROC STDCALL mov r10 , rcx mov eax , 5058 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserTestForInteractiveUser ENDP ; ULONG64 __stdcall NtUserTrackPopupMenuEx( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 ); _6_2_9200_sp0_windows_8_NtUserTrackPopupMenuEx PROC STDCALL mov r10 , rcx mov eax , 5059 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserTrackPopupMenuEx ENDP ; ULONG64 __stdcall NtUserUndelegateInput( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserUndelegateInput PROC STDCALL mov r10 , rcx mov eax , 5060 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUndelegateInput ENDP ; ULONG64 __stdcall NtUserUnloadKeyboardLayout( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserUnloadKeyboardLayout PROC STDCALL mov r10 , rcx mov eax , 5061 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnloadKeyboardLayout ENDP ; ULONG64 __stdcall NtUserUnlockWindowStation( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserUnlockWindowStation PROC STDCALL mov r10 , rcx mov eax , 5062 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnlockWindowStation ENDP ; ULONG64 __stdcall NtUserUnregisterHotKey( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserUnregisterHotKey PROC STDCALL mov r10 , rcx mov eax , 5063 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnregisterHotKey ENDP ; ULONG64 __stdcall NtUserUnregisterSessionPort( ); _6_2_9200_sp0_windows_8_NtUserUnregisterSessionPort PROC STDCALL mov r10 , rcx mov eax , 5064 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnregisterSessionPort ENDP ; ULONG64 __stdcall NtUserUnregisterUserApiHook( ); _6_2_9200_sp0_windows_8_NtUserUnregisterUserApiHook PROC STDCALL mov r10 , rcx mov eax , 5065 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUnregisterUserApiHook ENDP ; ULONG64 __stdcall NtUserUpdateDefaultDesktopThumbnail( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 ); _6_2_9200_sp0_windows_8_NtUserUpdateDefaultDesktopThumbnail PROC STDCALL mov r10 , rcx mov eax , 5066 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUpdateDefaultDesktopThumbnail ENDP ; ULONG64 __stdcall NtUserUpdateInputContext( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserUpdateInputContext PROC STDCALL mov r10 , rcx mov eax , 5067 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUpdateInputContext ENDP ; ULONG64 __stdcall NtUserUpdateInstance( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserUpdateInstance PROC STDCALL mov r10 , rcx mov eax , 5068 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUpdateInstance ENDP ; ULONG64 __stdcall NtUserUpdateLayeredWindow( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 , ULONG64 arg_05 , ULONG64 arg_06 , ULONG64 arg_07 , ULONG64 arg_08 , ULONG64 arg_09 , ULONG64 arg_10 ); _6_2_9200_sp0_windows_8_NtUserUpdateLayeredWindow PROC STDCALL mov r10 , rcx mov eax , 5069 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUpdateLayeredWindow ENDP ; ULONG64 __stdcall NtUserUpdatePerUserSystemParameters( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserUpdatePerUserSystemParameters PROC STDCALL mov r10 , rcx mov eax , 5070 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUpdatePerUserSystemParameters ENDP ; ULONG64 __stdcall NtUserUpdateWindowTransform( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserUpdateWindowTransform PROC STDCALL mov r10 , rcx mov eax , 5071 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUpdateWindowTransform ENDP ; ULONG64 __stdcall NtUserUserHandleGrantAccess( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserUserHandleGrantAccess PROC STDCALL mov r10 , rcx mov eax , 5072 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserUserHandleGrantAccess ENDP ; ULONG64 __stdcall NtUserValidateHandleSecure( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserValidateHandleSecure PROC STDCALL mov r10 , rcx mov eax , 5073 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserValidateHandleSecure ENDP ; ULONG64 __stdcall NtUserWaitAvailableMessageEx( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserWaitAvailableMessageEx PROC STDCALL mov r10 , rcx mov eax , 5074 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserWaitAvailableMessageEx ENDP ; ULONG64 __stdcall NtUserWaitForInputIdle( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 ); _6_2_9200_sp0_windows_8_NtUserWaitForInputIdle PROC STDCALL mov r10 , rcx mov eax , 5075 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserWaitForInputIdle ENDP ; ULONG64 __stdcall NtUserWaitForMsgAndEvent( ULONG64 arg_01 ); _6_2_9200_sp0_windows_8_NtUserWaitForMsgAndEvent PROC STDCALL mov r10 , rcx mov eax , 5076 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserWaitForMsgAndEvent ENDP ; ULONG64 __stdcall NtUserWaitForRedirectionStartComplete( ); _6_2_9200_sp0_windows_8_NtUserWaitForRedirectionStartComplete PROC STDCALL mov r10 , rcx mov eax , 5077 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserWaitForRedirectionStartComplete ENDP ; ULONG64 __stdcall NtUserWindowFromPhysicalPoint( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtUserWindowFromPhysicalPoint PROC STDCALL mov r10 , rcx mov eax , 5078 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserWindowFromPhysicalPoint ENDP ; ULONG64 __stdcall NtValidateCompositionSurfaceHandle( ULONG64 arg_01 , ULONG64 arg_02 ); _6_2_9200_sp0_windows_8_NtValidateCompositionSurfaceHandle PROC STDCALL mov r10 , rcx mov eax , 5079 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtValidateCompositionSurfaceHandle ENDP ; ULONG64 __stdcall NtUserSetClassLongPtr( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetClassLongPtr PROC STDCALL mov r10 , rcx mov eax , 5080 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetClassLongPtr ENDP ; ULONG64 __stdcall NtUserSetWindowLongPtr( ULONG64 arg_01 , ULONG64 arg_02 , ULONG64 arg_03 , ULONG64 arg_04 ); _6_2_9200_sp0_windows_8_NtUserSetWindowLongPtr PROC STDCALL mov r10 , rcx mov eax , 5081 ;syscall db 0Fh , 05h ret _6_2_9200_sp0_windows_8_NtUserSetWindowLongPtr ENDP
.global s_prepare_buffers s_prepare_buffers: push %r12 push %r15 push %r8 push %r9 push %rcx push %rdi push %rdx push %rsi lea addresses_D_ht+0xa5c1, %r8 nop nop inc %rcx movb $0x61, (%r8) nop inc %r15 lea addresses_D_ht+0x11d1, %rsi lea addresses_normal_ht+0x102c1, %rdi nop dec %rdx mov $29, %rcx rep movsl xor $17999, %rdi lea addresses_D_ht+0x5cb9, %rsi lea addresses_UC_ht+0xb4c1, %rdi nop nop sub %r9, %r9 mov $13, %rcx rep movsq nop nop nop nop xor %r12, %r12 lea addresses_WT_ht+0x17539, %rsi xor $35012, %r12 movl $0x61626364, (%rsi) nop nop nop nop add $1004, %r12 lea addresses_A_ht+0x9311, %rsi lea addresses_WC_ht+0x11c41, %rdi and %r12, %r12 mov $102, %rcx rep movsb nop nop cmp %r8, %r8 lea addresses_normal_ht+0x14c1, %rcx nop nop cmp $35663, %r9 mov $0x6162636465666768, %rdx movq %rdx, (%rcx) nop cmp %r15, %r15 lea addresses_WC_ht+0x9911, %rdx nop nop nop nop nop add %r12, %r12 mov $0x6162636465666768, %rcx movq %rcx, %xmm6 vmovups %ymm6, (%rdx) nop xor %rsi, %rsi pop %rsi pop %rdx pop %rdi pop %rcx pop %r9 pop %r8 pop %r15 pop %r12 ret .global s_faulty_load s_faulty_load: push %r15 push %r8 push %rax push %rbx push %rcx push %rdx push %rsi // Store lea addresses_WT+0x19ac1, %rbx nop nop nop nop add %r15, %r15 movb $0x51, (%rbx) nop nop nop nop nop add %r8, %r8 // Store lea addresses_A+0x19ec1, %rbx clflush (%rbx) nop nop nop nop add $7140, %rdx movb $0x51, (%rbx) nop nop nop nop nop xor $55248, %rax // Store lea addresses_WT+0x1f9c5, %rbx nop nop nop nop lfence mov $0x5152535455565758, %r15 movq %r15, (%rbx) nop nop nop nop nop sub %rdx, %rdx // Store mov $0xdc1, %rdx nop nop nop nop nop dec %r8 mov $0x5152535455565758, %rcx movq %rcx, (%rdx) nop nop cmp %rbx, %rbx // Store lea addresses_normal+0x19921, %rsi clflush (%rsi) nop nop nop nop nop and $25385, %rax mov $0x5152535455565758, %rbx movq %rbx, %xmm2 movups %xmm2, (%rsi) nop xor $45117, %rbx // Load lea addresses_RW+0xc6c1, %rcx nop sub %rax, %rax mov (%rcx), %si nop nop add $37756, %rdx // Faulty Load lea addresses_WT+0x19ac1, %rbx nop xor $50965, %rcx movaps (%rbx), %xmm1 vpextrq $1, %xmm1, %rsi lea oracles, %rbx and $0xff, %rsi shlq $12, %rsi mov (%rbx,%rsi,1), %rsi pop %rsi pop %rdx pop %rcx pop %rbx pop %rax pop %r8 pop %r15 ret /* <gen_faulty_load> [REF] {'src': {'type': 'addresses_WT', 'AVXalign': False, 'size': 8, 'NT': False, 'same': False, 'congruent': 0}, 'OP': 'LOAD'} {'OP': 'STOR', 'dst': {'type': 'addresses_WT', 'AVXalign': False, 'size': 1, 'NT': False, 'same': True, 'congruent': 0}} {'OP': 'STOR', 'dst': {'type': 'addresses_A', 'AVXalign': False, 'size': 1, 'NT': False, 'same': False, 'congruent': 10}} {'OP': 'STOR', 'dst': {'type': 'addresses_WT', 'AVXalign': False, 'size': 8, 'NT': False, 'same': False, 'congruent': 2}} {'OP': 'STOR', 'dst': {'type': 'addresses_P', 'AVXalign': False, 'size': 8, 'NT': False, 'same': False, 'congruent': 7}} {'OP': 'STOR', 'dst': {'type': 'addresses_normal', 'AVXalign': False, 'size': 16, 'NT': False, 'same': False, 'congruent': 5}} {'src': {'type': 'addresses_RW', 'AVXalign': False, 'size': 2, 'NT': False, 'same': False, 'congruent': 10}, 'OP': 'LOAD'} [Faulty Load] {'src': {'type': 'addresses_WT', 'AVXalign': True, 'size': 16, 'NT': False, 'same': True, 'congruent': 0}, 'OP': 'LOAD'} <gen_prepare_buffer> {'OP': 'STOR', 'dst': {'type': 'addresses_D_ht', 'AVXalign': False, 'size': 1, 'NT': False, 'same': False, 'congruent': 6}} {'src': {'type': 'addresses_D_ht', 'congruent': 3, 'same': False}, 'OP': 'REPM', 'dst': {'type': 'addresses_normal_ht', 'congruent': 11, 'same': False}} {'src': {'type': 'addresses_D_ht', 'congruent': 3, 'same': False}, 'OP': 'REPM', 'dst': {'type': 'addresses_UC_ht', 'congruent': 8, 'same': False}} {'OP': 'STOR', 'dst': {'type': 'addresses_WT_ht', 'AVXalign': False, 'size': 4, 'NT': False, 'same': False, 'congruent': 3}} {'src': {'type': 'addresses_A_ht', 'congruent': 3, 'same': False}, 'OP': 'REPM', 'dst': {'type': 'addresses_WC_ht', 'congruent': 7, 'same': True}} {'OP': 'STOR', 'dst': {'type': 'addresses_normal_ht', 'AVXalign': False, 'size': 8, 'NT': True, 'same': False, 'congruent': 9}} {'OP': 'STOR', 'dst': {'type': 'addresses_WC_ht', 'AVXalign': False, 'size': 32, 'NT': False, 'same': False, 'congruent': 4}} {'bd': 5, '85': 3, '40': 14, '8e': 1, '7f': 1, 'd1': 1, '35': 1, '5c': 1, '42': 8, '46': 2365, '7a': 1, '00': 16638, '15': 3, '45': 2769, '43': 1, 'ff': 13, '23': 1, '84': 3} 45 45 00 00 00 46 00 45 00 00 00 00 00 00 45 00 45 45 00 00 00 00 00 00 45 00 45 00 00 46 00 45 00 45 00 00 00 00 00 00 00 00 46 40 00 00 00 00 00 00 00 45 00 45 00 00 00 00 00 45 00 45 00 45 00 00 00 00 00 45 45 00 00 45 00 00 00 46 45 00 45 00 00 00 00 00 00 00 00 00 00 00 00 00 00 45 00 45 45 00 00 00 00 46 00 00 00 00 00 45 45 00 00 00 00 00 00 00 00 00 00 00 46 00 46 00 45 00 45 46 00 00 00 45 00 00 45 00 00 00 00 00 00 00 00 00 45 00 45 00 00 00 45 00 46 00 45 00 00 00 00 46 00 00 00 00 00 46 00 00 00 00 00 00 46 00 00 45 00 45 00 00 46 45 00 00 45 45 00 46 00 46 00 00 00 45 00 45 00 00 00 46 00 46 00 46 00 00 46 00 00 45 00 45 00 46 00 46 00 00 00 00 00 00 46 46 00 45 00 46 00 00 45 46 00 00 45 00 00 00 00 00 00 45 00 00 00 00 00 45 00 00 00 00 46 00 45 00 00 00 00 00 00 00 00 00 46 00 00 00 00 45 00 00 00 00 45 00 00 46 00 45 00 45 00 00 46 46 00 00 45 45 00 46 00 45 00 46 00 00 45 00 45 00 45 00 00 00 45 00 46 00 00 46 00 46 00 45 00 00 00 00 00 00 45 00 46 00 00 00 00 00 00 00 00 00 00 00 00 00 00 45 00 00 00 00 00 00 45 00 00 00 00 00 46 00 00 00 00 00 46 00 00 00 00 00 00 45 00 00 00 45 00 00 00 00 00 00 00 00 00 00 45 45 00 00 00 45 00 00 00 00 00 00 00 46 45 00 46 00 00 46 00 00 46 00 46 00 45 00 46 00 00 00 00 00 00 00 46 00 45 45 00 45 00 46 00 45 45 00 00 00 00 45 00 00 46 00 46 00 00 00 45 00 00 00 00 00 00 00 00 00 00 45 00 00 00 46 00 00 45 00 00 00 00 00 45 00 45 00 46 00 00 00 00 00 00 00 00 00 00 00 00 00 45 00 45 46 00 46 00 00 00 00 00 46 00 00 00 00 46 00 46 00 45 00 00 45 00 45 00 00 00 00 45 00 46 46 00 00 00 00 45 00 00 00 00 00 45 45 00 00 45 00 45 00 00 00 00 46 00 00 00 46 00 00 00 00 45 00 00 00 00 45 00 46 00 45 00 45 00 00 00 00 00 00 00 00 00 00 46 00 00 00 00 45 46 00 00 00 00 45 00 00 00 00 46 00 46 00 00 45 00 00 00 00 00 00 00 00 00 00 00 46 00 46 00 00 46 00 00 00 45 00 00 00 00 00 46 00 00 46 00 46 00 45 00 00 00 00 00 00 46 00 45 00 00 45 00 46 00 00 00 00 46 00 45 00 00 45 00 46 00 00 00 00 00 46 00 00 45 00 00 00 00 00 00 00 45 00 46 00 45 00 45 00 00 00 00 00 00 00 45 00 00 00 00 00 00 46 00 46 00 00 00 00 00 00 45 45 00 00 45 00 00 46 00 00 00 00 00 00 45 00 00 00 00 00 00 00 00 46 00 00 45 00 45 00 00 00 00 00 46 00 00 45 00 46 45 00 00 45 00 45 00 00 00 00 45 00 00 40 45 00 00 00 45 45 00 00 00 00 00 45 00 00 45 00 00 46 00 46 00 00 00 00 00 00 46 45 00 00 00 00 00 46 00 46 00 46 00 00 00 00 45 00 00 00 45 00 00 00 00 00 45 00 45 00 46 00 00 00 00 45 00 00 46 00 00 00 00 00 00 00 46 00 45 00 45 00 00 45 00 00 00 45 00 00 00 45 00 00 00 00 00 00 45 00 46 00 00 00 00 00 00 00 00 00 00 00 00 00 46 00 45 00 00 00 45 00 45 00 45 00 00 00 00 00 00 45 00 00 00 00 00 00 46 00 46 00 45 00 00 00 45 00 00 00 00 00 00 00 00 00 00 45 45 00 45 00 00 00 00 00 00 00 46 00 00 00 45 00 00 00 46 00 00 45 00 45 00 00 45 00 00 00 00 00 46 00 00 00 00 00 00 00 00 46 46 00 00 00 45 00 46 00 46 00 45 00 00 46 00 00 46 00 46 00 46 00 00 00 45 45 00 00 00 00 45 00 00 45 00 00 00 00 00 00 00 00 45 00 00 00 00 00 00 00 00 45 */
/* FreeRTOS V8.2.3 - Copyright (C) 2015 Real Time Engineers Ltd. All rights reserved VISIT http://www.FreeRTOS.org TO ENSURE YOU ARE USING THE LATEST VERSION. This file is part of the FreeRTOS distribution. FreeRTOS is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License (version 2) as published by the Free Software Foundation >>>> AND MODIFIED BY <<<< the FreeRTOS exception. *************************************************************************** >>! NOTE: The modification to the GPL is included to allow you to !<< >>! distribute a combined work that includes FreeRTOS without being !<< >>! obliged to provide the source code for proprietary components !<< >>! outside of the FreeRTOS kernel. !<< *************************************************************************** FreeRTOS is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. Full license text is available on the following link: http://www.freertos.org/a00114.html *************************************************************************** * * * FreeRTOS provides completely free yet professionally developed, * * robust, strictly quality controlled, supported, and cross * * platform software that is more than just the market leader, it * * is the industry's de facto standard. * * * * Help yourself get started quickly while simultaneously helping * * to support the FreeRTOS project by purchasing a FreeRTOS * * tutorial book, reference manual, or both: * * http://www.FreeRTOS.org/Documentation * * * *************************************************************************** http://www.FreeRTOS.org/FAQHelp.html - Having a problem? Start by reading the FAQ page "My application does not run, what could be wrong?". Have you defined configASSERT()? http://www.FreeRTOS.org/support - In return for receiving this top quality embedded software for free we request you assist our global community by participating in the support forum. http://www.FreeRTOS.org/training - Investing in training allows your team to be as productive as possible as early as possible. Now you can receive FreeRTOS training directly from Richard Barry, CEO of Real Time Engineers Ltd, and the world's leading authority on the world's leading RTOS. http://www.FreeRTOS.org/plus - A selection of FreeRTOS ecosystem products, including FreeRTOS+Trace - an indispensable productivity tool, a DOS compatible FAT file system, and our tiny thread aware UDP/IP stack. http://www.FreeRTOS.org/labs - Where new FreeRTOS products go to incubate. Come and try FreeRTOS+TCP, our new open source TCP/IP stack for FreeRTOS. http://www.OpenRTOS.com - Real Time Engineers ltd. license FreeRTOS to High Integrity Systems ltd. to sell under the OpenRTOS brand. Low cost OpenRTOS licenses offer ticketed support, indemnification and commercial middleware. http://www.SafeRTOS.com - High Integrity Systems also provide a safety engineered and independently SIL3 certified version for use in safety and mission critical applications that require provable dependability. 1 tab == 4 spaces! */ #include "FreeRTOSConfig.h" #include "portasm.h" .CODE /* * The RTOS tick ISR. * * If the cooperative scheduler is in use this simply increments the tick * count. * * If the preemptive scheduler is in use a context switch can also occur. */ _vTickISR: portSAVE_CONTEXT call #_xTaskIncrementTick cmp.w #0x00, r15 jeq _SkipContextSwitch call #_vTaskSwitchContext _SkipContextSwitch: portRESTORE_CONTEXT /*-----------------------------------------------------------*/ /* * Manual context switch called by the portYIELD() macro. */ _vPortYield:: /* Mimic an interrupt by pushing the SR. */ push SR /* Now the SR is stacked we can disable interrupts. */ dint /* Save the context of the current task. */ portSAVE_CONTEXT /* Switch to the highest priority task that is ready to run. */ call #_vTaskSwitchContext /* Restore the context of the new task. */ portRESTORE_CONTEXT /*-----------------------------------------------------------*/ /* * Start off the scheduler by initialising the RTOS tick timer, then restoring * the context of the first task. */ _xPortStartScheduler:: /* Setup the hardware to generate the tick. Interrupts are disabled when this function is called. */ call #_prvSetupTimerInterrupt /* Restore the context of the first task that is going to run. */ portRESTORE_CONTEXT /*-----------------------------------------------------------*/ /* Place the tick ISR in the correct vector. */ .VECTORS .KEEP ORG TIMERA0_VECTOR DW _vTickISR END
// Copyright (c) 2011-2015 The Bitcoin Core developers // Distributed under the MIT software license, see the accompanying // file COPYING or http://www.opensource.org/licenses/mit-license.php. #define BOOST_TEST_MODULE DCU Test Suite #include "test_dcu.h" #include "chainparams.h" #include "consensus/consensus.h" #include "consensus/validation.h" #include "key.h" #include "validation.h" #include "miner.h" #include "net_processing.h" #include "pubkey.h" #include "random.h" #include "txdb.h" #include "txmempool.h" #include "ui_interface.h" #include "util.h" #ifdef ENABLE_WALLET #include "wallet/db.h" #include "wallet/wallet.h" #endif #include <boost/filesystem.hpp> #include <boost/test/unit_test.hpp> #include <boost/thread.hpp> CClientUIInterface uiInterface; // Declared but not defined in ui_interface.h CWallet* pwalletMain; std::unique_ptr<CConnman> g_connman; extern bool fPrintToConsole; extern void noui_connect(); BasicTestingSetup::BasicTestingSetup(const std::string& chainName) { ECC_Start(); SetupEnvironment(); SetupNetworking(); fPrintToDebugLog = false; // don't want to write to debug.log file fCheckBlockIndex = true; SelectParams(chainName); noui_connect(); } BasicTestingSetup::~BasicTestingSetup() { ECC_Stop(); g_connman.reset(); } TestingSetup::TestingSetup(const std::string& chainName) : BasicTestingSetup(chainName) { const CChainParams& chainparams = Params(); #ifdef ENABLE_WALLET bitdb.MakeMock(); #endif ClearDatadirCache(); pathTemp = GetTempPath() / strprintf("test_dcu_%lu_%i", (unsigned long)GetTime(), (int)(GetRand(100000))); boost::filesystem::create_directories(pathTemp); mapArgs["-datadir"] = pathTemp.string(); pblocktree = new CBlockTreeDB(1 << 20, true); pcoinsdbview = new CCoinsViewDB(1 << 23, true); pcoinsTip = new CCoinsViewCache(pcoinsdbview); InitBlockIndex(chainparams); #ifdef ENABLE_WALLET bool fFirstRun; pwalletMain = new CWallet("wallet.dat"); pwalletMain->LoadWallet(fFirstRun); RegisterValidationInterface(pwalletMain); #endif nScriptCheckThreads = 3; for (int i=0; i < nScriptCheckThreads-1; i++) threadGroup.create_thread(&ThreadScriptCheck); g_connman = std::unique_ptr<CConnman>(new CConnman()); connman = g_connman.get(); RegisterNodeSignals(GetNodeSignals()); } TestingSetup::~TestingSetup() { UnregisterNodeSignals(GetNodeSignals()); threadGroup.interrupt_all(); threadGroup.join_all(); #ifdef ENABLE_WALLET UnregisterValidationInterface(pwalletMain); delete pwalletMain; pwalletMain = NULL; #endif UnloadBlockIndex(); delete pcoinsTip; delete pcoinsdbview; delete pblocktree; #ifdef ENABLE_WALLET bitdb.Flush(true); bitdb.Reset(); #endif boost::filesystem::remove_all(pathTemp); } TestChain100Setup::TestChain100Setup() : TestingSetup(CBaseChainParams::REGTEST) { // Generate a 100-block chain: coinbaseKey.MakeNewKey(true); CScript scriptPubKey = CScript() << ToByteVector(coinbaseKey.GetPubKey()) << OP_CHECKSIG; for (int i = 0; i < COINBASE_MATURITY; i++) { std::vector<CMutableTransaction> noTxns; CBlock b = CreateAndProcessBlock(noTxns, scriptPubKey); coinbaseTxns.push_back(b.vtx[0]); } } // // Create a new block with just given transactions, coinbase paying to // scriptPubKey, and try to add it to the current chain. // CBlock TestChain100Setup::CreateAndProcessBlock(const std::vector<CMutableTransaction>& txns, const CScript& scriptPubKey) { const CChainParams& chainparams = Params(); CBlockTemplate *pblocktemplate = CreateNewBlock(chainparams, scriptPubKey); CBlock& block = pblocktemplate->block; // Replace mempool-selected txns with just coinbase plus passed-in txns: block.vtx.resize(1); BOOST_FOREACH(const CMutableTransaction& tx, txns) block.vtx.push_back(tx); // IncrementExtraNonce creates a valid coinbase and merkleRoot unsigned int extraNonce = 0; IncrementExtraNonce(&block, chainActive.Tip(), extraNonce); while (!CheckProofOfWork(block.GetHash(), block.nBits, chainparams.GetConsensus())) ++block.nNonce; ProcessNewBlock(chainparams, &block, true, NULL, NULL); CBlock result = block; delete pblocktemplate; return result; } TestChain100Setup::~TestChain100Setup() { } CTxMemPoolEntry TestMemPoolEntryHelper::FromTx(CMutableTransaction &tx, CTxMemPool *pool) { CTransaction txn(tx); bool hasNoDependencies = pool ? pool->HasNoInputsOf(tx) : hadNoDependencies; // Hack to assume either its completely dependent on other mempool txs or not at all CAmount inChainValue = hasNoDependencies ? txn.GetValueOut() : 0; return CTxMemPoolEntry(txn, nFee, nTime, dPriority, nHeight, hasNoDependencies, inChainValue, spendsCoinbase, sigOpCount, lp); } void Shutdown(void* parg) { exit(0); } void StartShutdown() { exit(0); } bool ShutdownRequested() { return false; }
#include <iostream> #include "type_name_rt.hpp" #include "type_name_pt.hpp" // std::array<char> output operator, for type_name_pt output template <size_t N> std::ostream& operator<<(std::ostream& o, std::array<char,N> const& a) { for (char c : a) o.put(c); return o; } constexpr char static_var{}; int main() { std::cout << "AUTO_NAME &static_var : " << auto_name_pt<&static_var> << '\n'; std::cout << "AUTO_NAME char{} : " << auto_name_pt<char{}> << '\n'; std::cout << '\n'; std::cout << "TYPE_NAME char _PT : " << type_name_pt<char> << '\n'; std::cout << " _RT : " << type_name_rt<char> << '\n'; std::cout << "TYPE_NAME int& _PT : " << type_name_pt<int&> << '\n'; std::cout << " _RT : " << type_name_rt<int&> << '\n'; std::cout << "TYPE_NAME bool&& _PT : " << type_name_pt<bool&&> << '\n'; std::cout << " _RT : " << type_name_rt<bool&&> << '\n'; std::cout << "TYPE_NAME int const& _PT : " << type_name_pt<int const&> << '\n'; std::cout << " _RT : " << type_name_rt<int const&> << '\n'; std::cout << '\n'; const volatile char abc[1][2][3]{}; using ABC = decltype(abc); std::cout << "TYPE_NAME const volatile char[1][2][3] _PT: " << type_name_pt<ABC> << '\n'; std::cout << " _RT: " << type_name_rt<ABC> << '\n'; std::cout << '\n'; std::cout << "TYPE_NAME std::string : _PT " << type_name_pt<std::string> << '\n'; std::cout << " : _RT " << type_name_str<std::string>() << '\n'; }
data1 dw 0x0001 data3 db 0x12 mov ax, [data1] div word [data1] add word [data1], 0x1234 xor word [data1], 0x1234 div byte [0xf0] xor al,[data3] div byte [data1] jmp near start start: mov ax,0 mov byte [data],0 data db 0x55,0xaa jmp 0x2000:0x5000 mov ax, 21015 mov bl, 10 div bl and cl,0xf0
engine_flag: MACRO ; location, bit ; (all locations are in WRAM bank 1) dwb \1 + (\2 / 8), 1 << (\2 % 8) ENDM EngineFlags: ; entries correspond to ENGINE_* constants ; pokegear engine_flag wPokegearFlags, POKEGEAR_RADIO_CARD_F ; $0 engine_flag wPokegearFlags, POKEGEAR_MAP_CARD_F engine_flag wPokegearFlags, POKEGEAR_PHONE_CARD_F engine_flag wPokegearFlags, POKEGEAR_EXPN_CARD_F engine_flag wPokegearFlags, POKEGEAR_OBTAINED_F ; day-care engine_flag wDayCareMan, DAYCAREMAN_HAS_EGG_F engine_flag wDayCareMan, DAYCAREMAN_HAS_MON_F engine_flag wDayCareLady, DAYCARELADY_HAS_MON_F engine_flag wMomSavingMoney, MOM_SAVING_SOME_MONEY_F ; $8 engine_flag wMomSavingMoney, MOM_ACTIVE_F engine_flag wUnusedTwoDayTimerOn, 0 ; unused, possibly related to a 2-day timer engine_flag wStatusFlags, STATUSFLAGS_POKEDEX_F engine_flag wStatusFlags, STATUSFLAGS_UNOWN_DEX_F engine_flag wStatusFlags, STATUSFLAGS_CAUGHT_POKERUS_F engine_flag wStatusFlags, STATUSFLAGS_ROCKET_SIGNAL_F engine_flag wStatusFlags, STATUSFLAGS_HALL_OF_FAME_F engine_flag wStatusFlags, STATUSFLAGS_MAIN_MENU_MOBILE_CHOICES_F engine_flag wStatusFlags2, STATUSFLAGS2_BUG_CONTEST_TIMER_F engine_flag wStatusFlags2, STATUSFLAGS2_SAFARI_GAME_F engine_flag wStatusFlags2, STATUSFLAGS2_ROCKETS_IN_RADIO_TOWER_F engine_flag wStatusFlags2, STATUSFLAGS2_BIKE_SHOP_CALL_F engine_flag wStatusFlags2, STATUSFLAGS2_UNUSED_5_F engine_flag wStatusFlags2, STATUSFLAGS2_REACHED_GOLDENROD_F engine_flag wStatusFlags2, STATUSFLAGS2_ROCKETS_IN_MAHOGANY_F engine_flag wBikeFlags, BIKEFLAGS_STRENGTH_ACTIVE_F ; $18 engine_flag wBikeFlags, BIKEFLAGS_ALWAYS_ON_BIKE_F engine_flag wBikeFlags, BIKEFLAGS_DOWNHILL_F engine_flag wJohtoBadges, ZEPHYRBADGE engine_flag wJohtoBadges, HIVEBADGE engine_flag wJohtoBadges, PLAINBADGE engine_flag wJohtoBadges, FOGBADGE engine_flag wJohtoBadges, MINERALBADGE engine_flag wJohtoBadges, STORMBADGE ; $20 engine_flag wJohtoBadges, GLACIERBADGE engine_flag wJohtoBadges, RISINGBADGE engine_flag wKantoBadges, BOULDERBADGE engine_flag wKantoBadges, CASCADEBADGE engine_flag wKantoBadges, THUNDERBADGE engine_flag wKantoBadges, RAINBOWBADGE engine_flag wKantoBadges, SOULBADGE engine_flag wKantoBadges, MARSHBADGE ; $28 engine_flag wKantoBadges, VOLCANOBADGE engine_flag wKantoBadges, EARTHBADGE ; unown sets (see data/wild/unlocked_unowns.asm) engine_flag wUnlockedUnowns, 0 ; A-K engine_flag wUnlockedUnowns, 1 ; L-R engine_flag wUnlockedUnowns, 2 ; S-W engine_flag wUnlockedUnowns, 3 ; X-Z engine_flag wUnlockedUnowns, 4 ; unused engine_flag wUnlockedUnowns, 5 ; unused ; $30 engine_flag wUnlockedUnowns, 6 ; unused engine_flag wUnlockedUnowns, 7 ; unused ; fly engine_flag wVisitedSpawns, SPAWN_HOME engine_flag wVisitedSpawns, SPAWN_DEBUG engine_flag wVisitedSpawns, SPAWN_PALLET engine_flag wVisitedSpawns, SPAWN_VIRIDIAN engine_flag wVisitedSpawns, SPAWN_PEWTER engine_flag wVisitedSpawns, SPAWN_CERULEAN ; $38 engine_flag wVisitedSpawns, SPAWN_ROCK_TUNNEL engine_flag wVisitedSpawns, SPAWN_VERMILION engine_flag wVisitedSpawns, SPAWN_LAVENDER engine_flag wVisitedSpawns, SPAWN_SAFFRON engine_flag wVisitedSpawns, SPAWN_CELADON engine_flag wVisitedSpawns, SPAWN_FUCHSIA engine_flag wVisitedSpawns, SPAWN_CINNABAR engine_flag wVisitedSpawns, SPAWN_INDIGO ; $40 engine_flag wVisitedSpawns, SPAWN_NEW_BARK engine_flag wVisitedSpawns, SPAWN_CHERRYGROVE engine_flag wVisitedSpawns, SPAWN_VIOLET engine_flag wVisitedSpawns, SPAWN_AZALEA engine_flag wVisitedSpawns, SPAWN_CIANWOOD engine_flag wVisitedSpawns, SPAWN_GOLDENROD engine_flag wVisitedSpawns, SPAWN_OLIVINE engine_flag wVisitedSpawns, SPAWN_ECRUTEAK ; $48 engine_flag wVisitedSpawns, SPAWN_MAHOGANY engine_flag wVisitedSpawns, SPAWN_LAKE_OF_RAGE engine_flag wVisitedSpawns, SPAWN_BLACKTHORN engine_flag wVisitedSpawns, SPAWN_MT_SILVER engine_flag wVisitedSpawns, NUM_SPAWNS ; unused engine_flag wLuckyNumberShowFlag, LUCKYNUMBERSHOW_GAME_OVER_F engine_flag wStatusFlags2, STATUSFLAGS2_UNUSED_3_F engine_flag wDailyFlags1, DAILYFLAGS1_KURT_MAKING_BALLS_F ; $50 engine_flag wDailyFlags1, DAILYFLAGS1_BUG_CONTEST_F engine_flag wDailyFlags1, DAILYFLAGS1_FISH_SWARM_F engine_flag wDailyFlags1, DAILYFLAGS1_TIME_CAPSULE_F engine_flag wDailyFlags1, DAILYFLAGS1_ALL_FRUIT_TREES_F engine_flag wDailyFlags1, DAILYFLAGS1_GOT_SHUCKIE_TODAY_F engine_flag wDailyFlags1, DAILYFLAGS1_GOLDENROD_UNDERGROUND_BARGAIN_F engine_flag wDailyFlags1, DAILYFLAGS1_TRAINER_HOUSE_F engine_flag wDailyFlags2, DAILYFLAGS2_MT_MOON_SQUARE_CLEFAIRY_F ; $58 engine_flag wDailyFlags2, DAILYFLAGS2_UNION_CAVE_LAPRAS_F engine_flag wDailyFlags2, DAILYFLAGS2_GOLDENROD_UNDERGROUND_GOT_HAIRCUT_F engine_flag wDailyFlags2, DAILYFLAGS2_GOLDENROD_DEPT_STORE_TM27_RETURN_F engine_flag wDailyFlags2, DAILYFLAGS2_DAISYS_GROOMING_F engine_flag wDailyFlags2, DAILYFLAGS2_INDIGO_PLATEAU_RIVAL_FIGHT_F engine_flag wDailyFlags2, DAILYFLAGS2_MOVE_TUTOR_F engine_flag wDailyFlags2, DAILYFLAGS2_BUENAS_PASSWORD_F engine_flag wSwarmFlags, SWARMFLAGS_BUENAS_PASSWORD_F ; $60 engine_flag wSwarmFlags, SWARMFLAGS_GOLDENROD_DEPT_STORE_SALE_F engine_flag wGameTimerPause, GAMETIMERPAUSE_MOBILE_7_F engine_flag wPlayerGender, PLAYERGENDER_FEMALE_F engine_flag wCelebiEvent, CELEBIEVENT_FOREST_IS_RESTLESS_F ; rematches engine_flag wDailyRematchFlags, 0 ; jack engine_flag wDailyRematchFlags, 1 ; huey engine_flag wDailyRematchFlags, 2 ; gaven engine_flag wDailyRematchFlags, 3 ; beth ; $68 engine_flag wDailyRematchFlags, 4 ; jose engine_flag wDailyRematchFlags, 5 ; reena engine_flag wDailyRematchFlags, 6 ; joey engine_flag wDailyRematchFlags, 7 ; wade engine_flag wDailyRematchFlags, 8 ; ralph engine_flag wDailyRematchFlags, 9 ; liz engine_flag wDailyRematchFlags, 10 ; anthony engine_flag wDailyRematchFlags, 11 ; todd ; $70 engine_flag wDailyRematchFlags, 12 ; gina engine_flag wDailyRematchFlags, 13 ; arnie engine_flag wDailyRematchFlags, 14 ; alan engine_flag wDailyRematchFlags, 15 ; dana engine_flag wDailyRematchFlags, 16 ; chad engine_flag wDailyRematchFlags, 17 ; tully engine_flag wDailyRematchFlags, 18 ; brent engine_flag wDailyRematchFlags, 19 ; tiffany ; $78 engine_flag wDailyRematchFlags, 20 ; vance engine_flag wDailyRematchFlags, 21 ; wilton engine_flag wDailyRematchFlags, 22 ; parry engine_flag wDailyRematchFlags, 23 ; erin engine_flag wDailyPhoneItemFlags, 0 ; beverly has nugget engine_flag wDailyPhoneItemFlags, 1 ; jose has star piece engine_flag wDailyPhoneItemFlags, 2 ; wade has item (see EVENT_WADE_HAS_*** in constants/event_flags.asm) engine_flag wDailyPhoneItemFlags, 3 ; gina has leaf stone ; $80 engine_flag wDailyPhoneItemFlags, 4 ; alan has fire stone engine_flag wDailyPhoneItemFlags, 5 ; liz has thunderstone engine_flag wDailyPhoneItemFlags, 6 ; derek has nugget engine_flag wDailyPhoneItemFlags, 7 ; tully has water stone engine_flag wDailyPhoneItemFlags, 8 ; tiffany has pink bow engine_flag wDailyPhoneItemFlags, 9 ; wilton has item (see EVENT_WILTON_HAS_*** in constants/event_flags.asm) engine_flag wDailyPhoneTimeOfDayFlags, 0 ; jack engine_flag wDailyPhoneTimeOfDayFlags, 1 ; huey ; $88 engine_flag wDailyPhoneTimeOfDayFlags, 2 ; gaven engine_flag wDailyPhoneTimeOfDayFlags, 3 ; beth engine_flag wDailyPhoneTimeOfDayFlags, 4 ; jose engine_flag wDailyPhoneTimeOfDayFlags, 5 ; reena engine_flag wDailyPhoneTimeOfDayFlags, 6 ; joey engine_flag wDailyPhoneTimeOfDayFlags, 7 ; wade engine_flag wDailyPhoneTimeOfDayFlags, 8 ; ralph engine_flag wDailyPhoneTimeOfDayFlags, 9 ; liz ; $90 engine_flag wDailyPhoneTimeOfDayFlags, 10 ; anthony engine_flag wDailyPhoneTimeOfDayFlags, 11 ; todd engine_flag wDailyPhoneTimeOfDayFlags, 12 ; gina engine_flag wDailyPhoneTimeOfDayFlags, 13 ; arnie engine_flag wDailyPhoneTimeOfDayFlags, 14 ; alan engine_flag wDailyPhoneTimeOfDayFlags, 15 ; dana engine_flag wDailyPhoneTimeOfDayFlags, 16 ; chad engine_flag wDailyPhoneTimeOfDayFlags, 17 ; tully ; $98 engine_flag wDailyPhoneTimeOfDayFlags, 18 ; brent engine_flag wDailyPhoneTimeOfDayFlags, 19 ; tiffany engine_flag wDailyPhoneTimeOfDayFlags, 20 ; vance engine_flag wDailyPhoneTimeOfDayFlags, 21 ; wilton engine_flag wDailyPhoneTimeOfDayFlags, 22 ; parry engine_flag wDailyPhoneTimeOfDayFlags, 23 ; erin engine_flag wPlayerSpriteSetupFlags, PLAYERSPRITESETUP_FEMALE_TO_MALE_F engine_flag wSwarmFlags, SWARMFLAGS_DUNSPARCE_SWARM_F ; $a0 engine_flag wSwarmFlags, SWARMFLAGS_YANMA_SWARM_F
.global s_prepare_buffers s_prepare_buffers: push %r11 push %r13 push %r8 push %r9 push %rbp push %rcx push %rdi push %rsi lea addresses_normal_ht+0xed75, %rsi lea addresses_WT_ht+0x1aa, %rdi clflush (%rsi) nop dec %r9 mov $51, %rcx rep movsb nop nop nop add %r9, %r9 lea addresses_D_ht+0xee9d, %rbp nop nop nop sub $53178, %r13 mov $0x6162636465666768, %r9 movq %r9, (%rbp) nop nop nop nop nop dec %rcx lea addresses_WT_ht+0x19675, %rsi nop nop nop nop sub %rdi, %rdi mov (%rsi), %rbp nop nop xor %rsi, %rsi lea addresses_A_ht+0xe087, %rbp nop dec %rdi movl $0x61626364, (%rbp) xor $32499, %rdi lea addresses_normal_ht+0x4735, %r9 nop nop cmp %rcx, %rcx mov (%r9), %rsi nop nop nop nop cmp $8753, %r9 lea addresses_D_ht+0xc675, %rcx nop nop nop nop nop add $37138, %r8 mov $0x6162636465666768, %r13 movq %r13, (%rcx) nop nop nop nop sub %rbp, %rbp lea addresses_D_ht+0xe6c5, %rsi lea addresses_WC_ht+0x1de75, %rdi nop nop nop xor %r11, %r11 mov $101, %rcx rep movsw nop nop nop nop nop add $28441, %rdi lea addresses_WT_ht+0x479d, %rcx nop nop nop nop sub $42413, %rsi mov (%rcx), %rdi nop nop nop nop cmp %r11, %r11 lea addresses_A_ht+0x1da75, %r13 nop nop nop nop and %rcx, %rcx movw $0x6162, (%r13) nop nop nop xor %r9, %r9 lea addresses_WC_ht+0x11b6a, %r11 nop nop nop sub %r9, %r9 mov $0x6162636465666768, %r13 movq %r13, %xmm0 vmovups %ymm0, (%r11) cmp %rbp, %rbp lea addresses_UC_ht+0x55a1, %r11 nop nop and $46217, %rbp mov (%r11), %rdi nop nop nop nop cmp %r9, %r9 pop %rsi pop %rdi pop %rcx pop %rbp pop %r9 pop %r8 pop %r13 pop %r11 ret .global s_faulty_load s_faulty_load: push %r12 push %r14 push %r9 push %rax push %rdx push %rsi // Faulty Load lea addresses_RW+0x1f675, %r14 clflush (%r14) sub %r9, %r9 mov (%r14), %eax lea oracles, %rdx and $0xff, %rax shlq $12, %rax mov (%rdx,%rax,1), %rax pop %rsi pop %rdx pop %rax pop %r9 pop %r14 pop %r12 ret /* <gen_faulty_load> [REF] {'src': {'type': 'addresses_RW', 'AVXalign': False, 'size': 1, 'NT': False, 'same': False, 'congruent': 0}, 'OP': 'LOAD'} [Faulty Load] {'src': {'type': 'addresses_RW', 'AVXalign': False, 'size': 4, 'NT': False, 'same': True, 'congruent': 0}, 'OP': 'LOAD'} <gen_prepare_buffer> {'src': {'type': 'addresses_normal_ht', 'congruent': 8, 'same': False}, 'OP': 'REPM', 'dst': {'type': 'addresses_WT_ht', 'congruent': 0, 'same': False}} {'OP': 'STOR', 'dst': {'type': 'addresses_D_ht', 'AVXalign': False, 'size': 8, 'NT': False, 'same': False, 'congruent': 2}} {'src': {'type': 'addresses_WT_ht', 'AVXalign': True, 'size': 8, 'NT': False, 'same': False, 'congruent': 9}, 'OP': 'LOAD'} {'OP': 'STOR', 'dst': {'type': 'addresses_A_ht', 'AVXalign': False, 'size': 4, 'NT': False, 'same': False, 'congruent': 1}} {'src': {'type': 'addresses_normal_ht', 'AVXalign': False, 'size': 8, 'NT': False, 'same': False, 'congruent': 6}, 'OP': 'LOAD'} {'OP': 'STOR', 'dst': {'type': 'addresses_D_ht', 'AVXalign': False, 'size': 8, 'NT': False, 'same': False, 'congruent': 11}} {'src': {'type': 'addresses_D_ht', 'congruent': 4, 'same': False}, 'OP': 'REPM', 'dst': {'type': 'addresses_WC_ht', 'congruent': 10, 'same': False}} {'src': {'type': 'addresses_WT_ht', 'AVXalign': False, 'size': 8, 'NT': False, 'same': False, 'congruent': 1}, 'OP': 'LOAD'} {'OP': 'STOR', 'dst': {'type': 'addresses_A_ht', 'AVXalign': False, 'size': 2, 'NT': False, 'same': False, 'congruent': 10}} {'OP': 'STOR', 'dst': {'type': 'addresses_WC_ht', 'AVXalign': False, 'size': 32, 'NT': False, 'same': False, 'congruent': 0}} {'src': {'type': 'addresses_UC_ht', 'AVXalign': False, 'size': 8, 'NT': False, 'same': True, 'congruent': 2}, 'OP': 'LOAD'} {'32': 21829} 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 */
// Copyright 2017-2018 Chabloom LC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. // You may obtain a copy of the License at // // http://www.apache.org/licenses/LICENSE-2.0 // // Unless required by applicable law or agreed to in writing, software // distributed under the License is distributed on an "AS IS" BASIS, // WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. // See the License for the specific language governing permissions and // limitations under the License. #include "_vulkan.h" VKAPI_ATTR void VKAPI_CALL vkDestroySemaphore( VkDevice device, VkSemaphore semaphore, const VkAllocationCallbacks* pAllocator) { if (pAllocator) { pAllocator->pfnFree(nullptr, semaphore); } else { delete semaphore; } semaphore = nullptr; }
; A130103: Expansion of e.g.f. e^(2x)-(1+x)*e^x+x. ; 0,1,1,4,11,26,57,120,247,502,1013,2036,4083,8178,16369,32752,65519,131054,262125,524268,1048555,2097130,4194281,8388584,16777191,33554406,67108837,134217700,268435427,536870882,1073741793,2147483616,4294967263,8589934558,17179869149,34359738332,68719476699,137438953434,274877906905,549755813848,1099511627735,2199023255510,4398046511061,8796093022164,17592186044371,35184372088786,70368744177617,140737488355280,281474976710607,562949953421262,1125899906842573,2251799813685196,4503599627370443 mov $1,$0 cmp $1,1 add $1,2 pow $1,$0 sub $1,$0 mov $0,$1 sub $0,1
; cpu_m68k.asm - 6502 CPU emulation for Atari Falcon port ; ; Copyright (C) 2001 Karel Rous (empty head) ; Copyright (C) 2001-2003 Atari800 development team (see DOC/CREDITS) ; ; This file is part of the Atari800 emulator project which emulates ; the Atari 400, 800, 800XL, 130XE, and 5200 8-bit computers. ; ; Atari800 is free software; you can redistribute it and/or modify ; it under the terms of the GNU General Public License as published by ; the Free Software Foundation; either version 2 of the License, or ; (at your option) any later version. ; ; Atari800 is distributed in the hope that it will be useful, ; but WITHOUT ANY WARRANTY; without even the implied warranty of ; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ; GNU General Public License for more details. ; ; You should have received a copy of the GNU General Public License ; along with Atari800; if not, write to the Free Software ; Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA ; ; Last changes : 30th March 2003, gerhard.janka ; P65C02 ; we emulate this version of processor (6502 has a bug in jump code, ; you can emulate this bug by commenting out this line :) ; PROFILE ; fills the 'instruction_count' array for instruction profiling ; MONITOR_BREAK ; jump to monitor at break ; CRASH_MENU ; enable crash menu output ; CYCLE_EXACT ; !NO_CYCLE_EXACT :) ; NEW_CYCLE_EXACT ; !NO_NEW_CYCLE_EXACT :) OPT P=68040,L1,O+,W- output cpu_m68k.o xref _CART_BountyBob2 xref _CART_BountyBob1 xref _GTIA_GetByte xref _POKEY_GetByte xref _PIA_GetByte xref _ANTIC_GetByte xref _CART_GetByte xref _GTIA_PutByte xref _POKEY_PutByte xref _PIA_PutByte xref _ANTIC_PutByte xref _CART_PutByte xref _Atari800_RunEsc xref _Atari800_Exit xref _exit xref _wsync_halt ;CPU is stopped ifd NEW_CYCLE_EXACT xref _delayed_wsync xref _antic2cpu_ptr xref _cur_screen_pos endc xref _xpos xref _xpos_limit xdef _regPC xdef _regA xdef _regP ;/* Processor Status Byte (Partial) */ xdef _regS xdef _regX xdef _regY xref _memory xref _attrib ifd PROFILE xref _instruction_count endc ifd MONITOR_BREAK xdef _remember_PC xdef _remember_PC_curpos ifd NEW_CYCLE_EXACT xdef _remember_xpos xdef _remember_xpos_curpos endc xdef _remember_JMP xdef _remember_jmp_curpos xref _ypos_break_addr xref _ypos xref _break_addr xref _break_step xref _break_ret xref _break_cim xref _break_here xref _brkhere xref _ret_nesting endc ifd CRASH_MENU xref _crash_code xref _crash_address xref _crash_afterCIM endc xdef _IRQ xdef _NMI xdef _RTI xdef _GO xdef _CPUGET xdef _CPUPUT xdef _CPU_INIT xdef _cycles ;temporarily needed outside :) xdef _cim_encountered xdef _rts_handler ifd MONITOR_BREAK rem_pc_steps equ 64 ; has to be equal to REMEMBER_PC_STEPS rem_jmp_steps equ 16 ; has to be equal to REMEMBER_JMP_STEPS remember_PC _remember_PC ds.w rem_pc_steps ;REMEMBER_PC_STEPS remember_PC_curpos _remember_PC_curpos ds.l 1 remember_xpos _remember_xpos ds.l rem_pc_steps ;REMEMBER_PC_STEPS remember_xpos_curpos _remember_xpos_curpos ds.l 1 remember_JMP _remember_JMP ds.w rem_jmp_steps ;REMEMBER_JMP_STEPS remember_jmp_curpos _remember_jmp_curpos ds.l 1 endc even cnop 0,4 ; doubleword alignment regP ds.b 1 ; _regP ds.b 1 ; CCR regA ds.b 1 _regA ds.b 1 ; A regX ds.b 1 _regX ds.b 1 ; X regY ds.b 1 _regY ds.b 1 ; Y regPC _regPC ds.w 1 ; PC regS ds.b 1 _regS ds.b 1 ; stack IRQ _IRQ ds.b 1 ds.b 1 ; dummy _cim_encountered ds.b 1 _rts_handler ds.l 1 even memory_pointer equr a5 attrib_pointer equr a4 PC6502 equr a2 CD equr a6 ; cycles counter up ZFLAG equr d1 ; Bit 0..7 NFLAG equr d1 ; Bit 8..15 VFLAG equr d6 ; Bit 7 DFLAG equr d6 ; Bit 15 CFLAG equr d5 ; Bit 0..7, ( 1 = ff ) A equr d2 X equr d3 Y equr d4 ;d0 contains usually adress where we are working or temporary value ;d7 contains is a working register or adress LoHi macro ;change order of lo and hi byte (address) ror.w #8,\1 endm ; ========================================================== ; Emulated Registers and Flags are kept local to this module ; ========================================================== ; regP=processor flags; regPC=PC; regA=A; regX=X; regY=Y UPDATE_GLOBAL_REGS macro sub.l memory_pointer,PC6502 movem.w d0/d2-d4/a2,regP ; d0->regP, d2-d4 (A,X,Y) a2 (regPC) endm ; PC=regPC; A=regA; X=regX; Y=regY UPDATE_LOCAL_REGS macro moveq #0,d7 move.w regP,d0 move.w regA,d2 move.w regX,d3 move.w regY,d4 move.w regPC,d7 move.l memory_pointer,PC6502 add.l d7,PC6502 lea OPMODE_TABLE,a3 btst #D_FLAGB,_regP beq.s .upd_end lea OPMODE_TABLE_D,a3 .upd_end: endm _Local_GetByte: move.l d7,d1 moveq #0,d0 move.b d1,d0 lsr.w #8,d1 move.b (HIxTable,d1.l),d1 ; jmp ([GetTable,PC,d1.l*4]) move.w (GetTable,PC,d1.l*2),d1 jmp (GetTable,d1.w) GetTable: dc.w GetNone-GetTable,GetGTIA-GetTable dc.w GetPOKEY-GetTable,GetPIA-GetTable dc.w GetANTIC-GetTable,GetCART-GetTable dc.w ItsBob1-GetTable,ItsBob2-GetTable GetNone: st d0 ; higher bytes are 0 from before rts GetGTIA: move.l d0,-(a7) jsr _GTIA_GetByte addq.l #4,a7 rts GetPOKEY: move.l d0,-(a7) jsr _POKEY_GetByte addq.l #4,a7 rts GetPIA: move.l d0,-(a7) jsr _PIA_GetByte addq.l #4,a7 rts GetANTIC: move.l d0,-(a7) jsr _ANTIC_GetByte addq.l #4,a7 rts GetCART: move.l d0,-(a7) jsr _CART_GetByte addq.l #4,a7 rts ItsBob2: move.w d7,-(a7) clr.w -(a7) jsr _CART_BountyBob2 addq.l #4,a7 moveq #0,d0 rts ItsBob1: move.w d7,-(a7) clr.w -(a7) jsr _CART_BountyBob1 addq.l #4,a7 moveq #0,d0 rts _Local_PutByte: moveq #0,d1 move.w d7,d1 lsr.w #8,d1 move.b (HIxTable,d1.l),d1 jmp ([PutTable,PC,d1.l*4]) PutTable: dc.l PutNone,PutGTIA,PutPOKEY,PutPIA dc.l PutANTIC,PutCART,ItsBob1,ItsBob2 PutNone: moveq #0,d0 rts PutGTIA: move.b d0,d1 move.l d1,-(a7) move.b d7,d1 move.l d1,-(a7) ifd CYCLE_EXACT move.l CD,_xpos endc jsr _GTIA_PutByte addq.l #8,a7 rts PutPOKEY: move.b d0,d1 move.l d1,-(a7) move.b d7,d1 move.l d1,-(a7) ifd CYCLE_EXACT move.l CD,_xpos endc jsr _POKEY_PutByte addq.l #8,a7 rts PutPIA: move.b d0,d1 move.l d1,-(a7) move.b d7,d1 move.l d1,-(a7) jsr _PIA_PutByte addq.l #8,a7 rts PutANTIC: move.b d0,d1 move.l d1,-(a7) move.b d7,d1 move.l d1,-(a7) move.l CD,_xpos jsr _ANTIC_PutByte move.l _xpos,CD addq.l #8,a7 rts PutCART: move.b d0,d1 move.l d1,-(a7) move.b d7,d1 move.l d1,-(a7) jsr _CART_PutByte addq.l #8,a7 rts HIxNone equ 0 HIxGTIA8 equ 1 HIxGTIA5 equ 1 HIxPOKEY8 equ 2 HIxPOKEY5 equ 2 HIxPIA8 equ 3 HIxANTIC8 equ 4 HIxCART equ 5 HIxBob1 equ 6 HIxBob2 equ 7 HIxTable: dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 00..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 04..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 08..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 0c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 10..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 14..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 18..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 1c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 20..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 24..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 28..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 2c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 30..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 34..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 38..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 3c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 40..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 44..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 48..b dc.b HIxNone,HIxNone,HIxNone,HIxBob1 ; 4c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 50..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 54..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 58..b dc.b HIxNone,HIxNone,HIxNone,HIxBob2 ; 5c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 60..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 64..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 68..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 6c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 70..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 74..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 78..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 7c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 80..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 84..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 88..b dc.b HIxNone,HIxNone,HIxNone,HIxBob1 ; 8c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 90..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 94..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; 98..b dc.b HIxNone,HIxNone,HIxNone,HIxBob2 ; 9c..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; a0..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; a4..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; a8..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; ac..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; b0..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; b4..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; b8..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; bc..f dc.b HIxGTIA5,HIxNone,HIxNone,HIxNone ; c0..3 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; c4..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; c8..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; cc..f dc.b HIxGTIA8,HIxNone,HIxPOKEY8,HIxPIA8 ; d0..3 dc.b HIxANTIC8,HIxCART,HIxNone,HIxNone ; d4..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; d8..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; dc..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; e0..3 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; e4..7 dc.b HIxPOKEY5,HIxNone,HIxNone,HIxPOKEY5 ; e8..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; ec..f dc.b HIxNone,HIxNone,HIxNone,HIxNone ; f0..3 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; f4..7 dc.b HIxNone,HIxNone,HIxNone,HIxNone ; f8..b dc.b HIxNone,HIxNone,HIxNone,HIxNone ; fc..f EXE_GETBYTE macro ; move.l d7,-(a7) jsr _Local_GetByte ; addq.l #4,a7 ;put stack onto right place endm EXE_PUTBYTE macro ; clr.l -(a7) ; move.b \1,3(a7) ;byte jsr _Local_PutByte ; addq.l #8,a7 endm RMW_GETBYTE macro ifd CYCLE_EXACT move.w d7,d0 and.w #$ef1f,d0 cmp.w #$c01a,d0 bne.s .normal_get EXE_GETBYTE subq.l #1,CD move.l d0,-(a7) EXE_PUTBYTE d0 move.l (a7)+,d0 addq.l #1,CD bra.s .end_rmw_get .normal_get: EXE_GETBYTE .end_rmw_get: elseif EXE_GETBYTE endc endm _CPU_INIT: ifd MONITOR_BREAK moveq #0,d0 move.l d0,_remember_PC_curpos move.l d0,_remember_xpos_curpos move.l d0,_remember_jmp_curpos endc moveq #1,d0 ; set regS to page 1 move.b d0,regS rts ;these are bit in MC68000 CCR register NB68 equ 3 EB68 equ 4 ;X ZB68 equ 2 OB68 equ 1 CB68 equ 0 WSYNC_C equ 106 N_FLAG equ $80 N_FLAGN equ $7f N_FLAGB equ 7 V_FLAG equ $40 V_FLAGN equ $bf V_FLAGB equ 6 G_FLAG equ $20 G_FLAGB equ 5 B_FLAG equ $10 B_FLAGN equ $ef B_FLAGB equ 4 D_FLAG equ $08 D_FLAGN equ $f7 D_FLAGB equ 3 I_FLAG equ $04 I_FLAGN equ $fb I_FLAGB equ 2 Z_FLAG equ $02 Z_FLAGN equ $fd Z_FLAGB equ 1 C_FLAG equ $01 C_FLAGN equ $fe C_FLAGB equ 0 VCZN_FLAGS equ $c3 VCZN_FLAGSN equ $3c SetI macro ori.b #I_FLAG,_regP endm ClrI macro andi.b #I_FLAGN,_regP endm SetB macro ori.b #B_FLAG,_regP endm SetD macro ori.b #D_FLAG,_regP lea OPMODE_TABLE_D,a3 endm ClrD macro andi.b #D_FLAGN,_regP lea OPMODE_TABLE,a3 endm ;static UBYTE N; /* bit7 zero (0) or bit 7 non-zero (1) */ ;static UBYTE Z; /* zero (0) or non-zero (1) */ ;static UBYTE V; ;static UBYTE C; /* zero (0) or one(1) */ isRAM equ 0 isROM equ 1 isHARDWARE equ 2 ;/* ; * The following array is used for 6502 instruction profiling ; */ ;int instruction_count[256]; ;UBYTE memory[65536]; ;UBYTE attrib[65536]; ;/* ; =============================================================== ; Z flag: This actually contains the result of an operation which ; would modify the Z flag. The value is tested for ; equality by the BEQ and BNE instruction. ; =============================================================== ;*/ ; Bit : 76543210 ; 68000 : ***XNZVC ; _RegP : NV*BDIZC ConvertSTATUS_RegP macro move.b _regP,\1 ;put flag BDI into d0 andi.b #VCZN_FLAGSN,\1 ; clear overflow, carry, zero & negative flag tst.b CFLAG beq.s .SETC\@ addq.b #1,\1 .SETC\@ tst.w NFLAG bpl.s .SETN\@ ; ori.b #N_FLAG,\1 tas \1 .SETN\@ tst.b ZFLAG bne.s .SETZ\@ ; beware! reverse compare is ok addq.b #2,\1 .SETZ\@ tst.b VFLAG bpl.s .SETV\@ ; !!! ori.b #V_FLAG,\1 .SETV\@ endm ConvertSTATUS_RegP_destroy macro move.b _regP,\1 ;put flag BDI into d0 andi.b #VCZN_FLAGSN,\1 ; clear overflow, carry, zero & negative flag lsr.b #7,CFLAG or.b CFLAG,\1 tst.w NFLAG bpl.s .SETN\@ ; ori.b #N_FLAG,\1 tas \1 .SETN\@ tst.b ZFLAG bne.s .SETZ\@ ; beware! reverse compare is ok addq.b #2,\1 .SETZ\@ tst.b VFLAG bpl.s .SETV\@ ; !!! ori.b #V_FLAG,\1 .SETV\@ endm ConvertRegP_STATUS macro btst #V_FLAGB,\1 sne VFLAG btst #C_FLAGB,\1 sne CFLAG move.b \1,NFLAG lsl.w #8,NFLAG ; sets NFLAG and clears ZFLAG btst #Z_FLAGB,\1 seq ZFLAG endm Call_Atari800_RunEsc macro ; move.l d7,-(a7) !!!TEST!!! clr.l -(a7) ;!!!TEST!!! move.b d7,(3,a7) ;!!!TEST!!! ConvertSTATUS_RegP_destroy d0 UPDATE_GLOBAL_REGS jsr _Atari800_RunEsc addq.l #4,a7 UPDATE_LOCAL_REGS ConvertRegP_STATUS d0 endm Call_Atari800_Exit_true macro pea $1.W jsr _Atari800_Exit addq.l #4,a7 tst.l d0 bne.s .GOON\@ clr.l -(a7) jsr _exit .GOON\@ endm PLW macro moveq #0,\2 move.w regS,\2 addq.b #2,\2 ; wrong way around move.b (memory_pointer,\2.l),\1 asl.w #8,\1 subq.b #1,\2 or.b (memory_pointer,\2.l),\1 addq.b #1,\2 move.b \2,_regS endm SetVFLAG macro st VFLAG endm ClrVFLAG macro clr.b VFLAG endm SetCFLAG macro st CFLAG endm ClrCFLAG macro clr.b CFLAG endm CPUGET: _CPUGET: ConvertSTATUS_RegP d0 move.b d0,_regP rts CPUPUT: _CPUPUT: move.b _regP,d0 ConvertRegP_STATUS d0 rts NMI: _NMI: lea _memory,a0 moveq #0,d1 move.w regS,d1 move.b _regPC,(a0,d1.l) subq.b #1,d1 move.b _regPC+1,(a0,d1.l) subq.b #1,d1 ; move.b _regP,(a0,d1.l) ;put P onto stack move.b _regP,d0 ; Test andi.b #B_FLAGN,d0 ; Test move.b d0,(a0,d1.l) ; Test subq.b #1,d1 move.b d1,_regS SetI ;put regPC & Stack pointer adress on its place move.w (a0,$fffa.l),d1 LoHi d1 move.w d1,_regPC addq.l #7,_xpos ifd MONITOR_BREAK addq.l #1,_ret_nesting endc rts _GO: ;cycles (d0) ; UWORD PC; ; UBYTE S; ; UBYTE A; ; UBYTE X; ; UBYTE Y; ; ; UWORD addr; ; UBYTE data; ;/* ; This used to be in the main loop but has been removed to improve ; execution speed. It does not seem to have any adverse effect on ; the emulation for two reasons:- ; ; 1. NMI's can only be raised in atari_custom.c - there is ; no way an NMI can be generated whilst in this routine. ; ; 2. The timing of the IRQs are not that critical. ;*/ move.l 4(a7),d0 ifd NEW_CYCLE_EXACT tst.b _wsync_halt beq.s NO_WS_HALT moveq.l #WSYNC_C-1,d1 ; TEST : no -1 if bpl.s cmp.l #-999,_cur_screen_pos beq.s .now_cmp move.l _antic2cpu_ptr,a0 move.l (a0,d1*4),d1 .now_cmp: add.l _delayed_wsync,d1 cmp.l d0,d1 ; bpl.s TERM_GO ; TEST bge TERM_GO ; TEST addq.l #1,d1 ; TEST : not necessary if bpl.s move.l d1,_xpos clr.b _wsync_halt clr.l _delayed_wsync elseif tst.b _wsync_halt beq.s NO_WS_HALT moveq.l #WSYNC_C-1,d1 ; TEST : no -1 if bpl.s cmp.l d0,d1 ; bpl.s TERM_GO ; TEST bge TERM_GO ; TEST addq.l #1,d1 ; TEST : not necessary if bpl.s move.l d1,_xpos clr.b _wsync_halt endc NO_WS_HALT: move.l d0,_xpos_limit ; needed for WSYNC store inside ANTIC movem.l d2-d7/a2-a6,-(a7) move.l _xpos,CD lea _memory,memory_pointer UPDATE_LOCAL_REGS ConvertRegP_STATUS d0 lea _attrib,attrib_pointer tst.b _IRQ ; CPUCHECKIRQ beq NEXTCHANGE_WITHOUT move.b d0,d7 ; and.b #I_FLAG,d0 ;is interrupt active btst #I_FLAG,d0 bne NEXTCHANGE_WITHOUT ;yes, no other interrupt moveq #0,d0 move.w regS,d0 ; push PC and P to stack ( PHW + PHB ) start move.b _regPC,(memory_pointer,d0.l) subq.b #1,d0 move.b _regPC+1,(memory_pointer,d0.l) subq.b #1,d0 ; move.b d7,(memory_pointer,d0.l) ;put P onto stack andi.b #B_FLAGN,d7 ; TEST move.b d7,(memory_pointer,d0.l) ; TEST subq.b #1,d0 move.b d0,_regS ; push PC and P to stack ( PHW + PHB ) end SetI move.w (memory_pointer,$fffe.l),d0 ; d0 already cleared from before LoHi d0 move.l d0,PC6502 add.l memory_pointer,PC6502 addq.l #7,CD clr.b _IRQ ;clear interrupt..... ifd MONITOR_BREAK addq.l #1,_ret_nesting endc bra NEXTCHANGE_WITHOUT ;/* ; ===================================== ; Extract Address if Required by Opcode ; ===================================== ;*/ ;d0 contains final value for use in program ; addressing macros NCYCLES_XY macro cmp.b \1,d7 ; if ( (UBYTE) addr < X,Y ) ncycles++; ; bpl.s .NCY_XY_NC\@ bcc.s .NCY_XY_NC\@ ; !!! addq.l #1,CD .NCY_XY_NC\@: endm ABSOLUTE macro move.w (PC6502)+,d7 LoHi d7 ;d7 contains reversed value endm ABSOLUTE_X macro ABSOLUTE add.w X,d7 endm ABSOLUTE_X_NCY macro ABSOLUTE_X \1 NCYCLES_XY X endm ABSOLUTE_Y macro ABSOLUTE add.w Y,d7 endm ABSOLUTE_Y_NCY macro ABSOLUTE_Y \1 NCYCLES_XY Y endm IMMEDIATE macro move.b (PC6502)+,\1 endm INDIRECT_X macro move.b (PC6502)+,d7 add.b X,d7 move.w (memory_pointer,d7.l),d7 LoHi d7 endm INDIRECT_Y macro move.b (PC6502)+,d7 move.w (memory_pointer,d7.l),d7 LoHi d7 ;swap bytes add.w Y,d7 endm INDIRECT_Y_NCY macro INDIRECT_Y NCYCLES_XY Y endm ZPAGE macro move.b (PC6502)+,d7 endm ZPAGE_X macro move.b (PC6502)+,d7 add.b X,d7 endm ZPAGE_Y macro move.b (PC6502)+,d7 add.b Y,d7 endm ; miscellaneous macros NEXTCHANGE_REG macro move.b \1,ZFLAG bra.w NEXTCHANGE_N endm ; command macros ROL_C macro add.b CFLAG,CFLAG addx.b \1,\1 ;left scs CFLAG endm ROR_C macro add.b CFLAG,CFLAG roxr.b #1,\1 scs CFLAG endm ASL_C macro add.b \1,\1 ;left scs CFLAG endm LSR_C macro lsr.b #1,\1 scs CFLAG endm ; opcodes ; inofficial opcodes ; unstable inofficial opcodes opcode_93: ;/* SHA (ab),y [unofficial, UNSTABLE - Store A AND X AND (H+1) ?] */ ; /* It seems previous memory value is important - also in 9f */; addq.l #cy_IndY2,CD move.b (PC6502)+,d7 addq.b #1,d7 move.b (memory_pointer,d7.l),d0 addq.b #1,d0 and.b A,d0 and.b X,d0 move.w (memory_pointer,d7.l),d7 LoHi d7 ;swap bytes add.w Y,d7 tst.b (attrib_pointer,d7.l) ; PUTANYBYTE bne.w A800PUTB move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_9f: ;/* SHA abcd,y [unofficial, UNSTABLE - Store A AND X AND (H+1) ?] */ addq.l #cy_IndY2,CD move.w (PC6502)+,d7 move.b d7,d0 LoHi d7 ;d7 contains reversed value addq.b #1,d0 and.b A,d0 and.b X,d0 add.w Y,d7 tst.b (attrib_pointer,d7.l) ; PUTANYBYTE bne.w A800PUTB move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_9e: ;/* SHX abcd,y [unofficial - Store X and (H+1)] (Fox) */ ; /* Seems to be stable */ addq.l #cy_IndY2,CD move.w (PC6502)+,d7 move.b d7,d0 LoHi d7 ;d7 contains reversed value addq.b #1,d0 and.b X,d0 add.w Y,d7 tst.b (attrib_pointer,d7.l) ; PUTANYBYTE bne.w A800PUTB move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_9c: ;/* SHY abcd,x [unofficial - Store Y and (H+1)] (Fox) */ ; /* Seems to be stable */ addq.l #cy_AbsX2,CD move.w (PC6502)+,d7 move.b d7,d0 LoHi d7 ;d7 contains reversed value addq.b #1,d0 and.b A,d0 and.b Y,d0 add.w X,d7 tst.b (attrib_pointer,d7.l) ; PUTANYBYTE bne.w A800PUTB move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_9b: ;/* SHS abcd,y [unofficial, UNSTABLE] (Fox) */ ; /* Transfer A AND X to S, then store S AND (H+1)] */ ; /* S seems to be stable, only memory values vary */ addq.l #cy_IndY2,CD move.w (PC6502)+,d7 move.b d7,d0 LoHi d7 ;d7 contains reversed value move.b A,_regS and.b X,_regS addq.b #1,d0 and.b _regS,d0 add.w Y,d7 tst.b (attrib_pointer,d7.l) ; PUTANYBYTE bne.w A800PUTB move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT ; stable inofficial opcodes opcode_6b: ;/* ARR #ab [unofficial - Acc AND Data, ROR result] */ ; not optimized because I think it will never be executed anyway addq.l #cy_Imm,CD IMMEDIATE ZFLAG and.b A,ZFLAG btst #D_FLAGB,_regP beq.s .6b_noBCD ; 'BCD fixup' move.b ZFLAG,d7 ROR_C ZFLAG move.b ZFLAG,A move.b d7,VFLAG ;VFLAG eor.b ZFLAG,VFLAG and.b #$40,VFLAG sne VFLAG move.b A,d7 move.b A,d7 move.b d7,d0 andi.b #15,d0 move.b d7,CFLAG andi.b #1,CFLAG add.b CFLAG,d0 cmpi.b #6,d0 ; check for >5 bmi.s .6b_bcd1 ; <=5 move.b A,CFLAG and.b #240,CFLAG move.b A,d0 addq.b #6,d0 and.b #15,d0 move.b CFLAG,A or.b d0,A .6b_bcd1: move.b d7,d0 andi.b #$f0,d0 move.b d7,CFLAG andi.b #16,CFLAG cmpi.b #$51,d0 ; check for >$50 bmi.s .6b_bcd2 ; <=$50 move.b A,CFLAG and.b #15,CFLAG move.b A,d0 add.b #$60,d0 and.b #$f0,d0 move.b CFLAG,A or.w d0,A SetCFLAG bra.w NEXTCHANGE_N .6b_bcd2: ClrCFLAG bra.w NEXTCHANGE_N ; Binary .6b_noBCD: ROR_C ZFLAG move.b ZFLAG,A move.b A,VFLAG ;VFLAG lsr.b #6,VFLAG move.b A,CFLAG lsr.b #5,CFLAG eor.b CFLAG,VFLAG and.b #1,VFLAG sne VFLAG move.b A,CFLAG ;CFLAG and.b #$40,CFLAG sne CFLAG bra.w NEXTCHANGE_N opcode_02: ;/* CIM [unofficial - crash immediate] */ opcode_12: opcode_22: opcode_32: opcode_42: opcode_52: opcode_62: opcode_72: opcode_92: opcode_b2: addq.l #cy_CIM,CD subq.w #1,PC6502 ConvertSTATUS_RegP_destroy d0 UPDATE_GLOBAL_REGS ifd CRASH_MENU move.w PC6502,_crash_address addq.w #1,PC6502 move.w PC6502,crash_afterCIM move.l d7,_crash_code move.l _atari_screen,-(sp) jsr _ui elseif ifd MONITOR_BREAK moveq #1,d0 move.l d0,_break_cim elseif Call_Atari800_Exit_true endc UPDATE_LOCAL_REGS ConvertRegP_STATUS d0 endc bra.w NEXTCHANGE_WITHOUT opcode_07: ;/* ASO ab [unofficial - ASL then ORA with Acc] */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE ASL_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE or.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_17: ;/* ASO ab,x [unofficial - ASL then ORA with Acc] */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE ASL_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE or.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N ASO_C_CONT macro ;/* [unofficial - ASL Mem, then ORA with A] */ move.b (attrib_pointer,d7.l),d0 bne.s ASO_Getbyte_ROMHW move.b (memory_pointer,d7.l),d0 ;get byte ASL_C d0 bra ASO_STORE_MEM endm opcode_03: ;/* ASO (ab,x) [unofficial - ASL then ORA with Acc] */ addq.l #cy_IndX_RW,CD INDIRECT_X ASO_C_CONT opcode_13: ;/* ASO (ab),y [unofficial - ASL then ORA with Acc] */ addq.l #cy_IndY_RW,CD INDIRECT_Y ASO_C_CONT opcode_0f: ;/* ASO abcd [unofficial - ASL then ORA with Acc] */ addq.l #cy_Abs_RW,CD ABSOLUTE ASO_C_CONT opcode_1b: ;/* ASO abcd,y [unofficial - ASL then ORA with Acc] */ addq.l #cy_AbsY_RW,CD ABSOLUTE_Y ASO_C_CONT opcode_1f: ;/* ASO abcd,x [unofficial - ASL then ORA with Acc] */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X ASO_C_CONT ASO_Getbyte_ROMHW: cmp.b #isHARDWARE,d0 beq.s .Getbyte_HW move.b (memory_pointer,d7.l),d0 ;get byte ASL_C d0 bra.s ASO_NOW_ORA .Getbyte_HW: RMW_GETBYTE ASL_C d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,d0 bra.s ASO_NOW_ORA ASO_STORE_MEM: move.b d0,(memory_pointer,d7.l) ASO_NOW_ORA: or.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_27: ;/* RLA ab [unofficial - ROL Mem, then AND with A] */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE ROL_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE and.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_37: ;/* RLA ab,x [unofficial - ROL Mem, then AND with A] */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE ROL_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE and.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N RLA_C_CONT macro ;/* [unofficial - ROL Mem, then AND with A] */ move.b (attrib_pointer,d7.l),d0 bne.w RLA_Getbyte_ROMHW move.b (memory_pointer,d7.l),d0 ;get byte ROL_C d0 bra.w RLA_STORE_MEM endm opcode_23: ;/* RLA (ab,x) [unofficial - ROL Mem, then AND with A] */ addq.l #cy_IndX_RW,CD INDIRECT_X RLA_C_CONT opcode_33: ;/* RLA (ab),y [unofficial - ROL Mem, then AND with A] */ addq.l #cy_IndY_RW,CD INDIRECT_Y RLA_C_CONT opcode_2f: ;/* RLA abcd [unofficial - ROL Mem, then AND with A] */ addq.l #cy_Abs_RW,CD ABSOLUTE RLA_C_CONT opcode_3b: ;/* RLA abcd,y [unofficial - ROL Mem, then AND with A] */ addq.l #cy_AbsY_RW,CD ABSOLUTE_Y RLA_C_CONT opcode_3f: ;/* RLA abcd,x [unofficial - ROL Mem, then AND with A] */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X RLA_C_CONT RLA_Getbyte_ROMHW: cmp.b #isHARDWARE,d0 beq.s .Getbyte_HW move.b (memory_pointer,d7.l),d0 ;get byte ROL_C d0 bra.s RLA_NOW_AND .Getbyte_HW: RMW_GETBYTE ROL_C d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,d0 bra.s RLA_NOW_AND RLA_STORE_MEM: move.b d0,(memory_pointer,d7.l) RLA_NOW_AND: and.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_47: ;/* LSE ab [unofficial - LSR then EOR result with A] */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE LSR_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE eor.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_57: ;/* LSE ab,x [unofficial - LSR then EOR result with A] */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE LSR_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE eor.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N LSE_C_CONT macro ;/* [unofficial - LSR Mem then EOR with A] */ move.b (attrib_pointer,d7.l),d0 bne.s LSE_Getbyte_ROMHW move.b (memory_pointer,d7.l),d0 ;get byte LSR_C d0 bra LSE_STORE_MEM endm opcode_43: ;/* LSE (ab,x) [unofficial] */ addq.l #cy_IndX_RW,CD INDIRECT_X LSE_C_CONT opcode_53: ;/* LSE (ab),y [unofficial] */ addq.l #cy_IndY_RW,CD INDIRECT_Y LSE_C_CONT opcode_4f: ;/* LSE abcd [unofficial] */ addq.l #cy_Abs_RW,CD ABSOLUTE LSE_C_CONT opcode_5b: ;/* LSE abcd,y [unofficial] */ addq.l #cy_AbsY_RW,CD ABSOLUTE_Y LSE_C_CONT opcode_5f: ;/* LSE abcd,x [unofficial] */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X LSE_C_CONT LSE_Getbyte_ROMHW: cmp.b #isHARDWARE,d0 beq.s .Getbyte_HW move.b (memory_pointer,d7.l),d0 ;get byte LSR_C d0 bra.s LSE_NOW_EOR .Getbyte_HW: RMW_GETBYTE LSR_C d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,d0 bra.s LSE_NOW_EOR LSE_STORE_MEM: move.b d0,(memory_pointer,d7.l) LSE_NOW_EOR: eor.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_4b: ;/* ALR #ab [unofficial - Acc AND Data, LSR result] */ addq.l #cy_Imm,CD IMMEDIATE ZFLAG and.b A,ZFLAG LSR_C ZFLAG bra.w NEXTCHANGE_N opcode_67: ;/* RRA ab [unofficial - ROR Mem, then ADC to Acc] */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE ROR_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE bra.w adc opcode_77: ;/* RRA ab,x [unofficial - ROR Mem, then ADC to Acc] */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE ROR_C d0 move.b d0,(memory_pointer,d7.l) ; PUTZPBYTE bra.w adc GETANYBYTE_RRA macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) bne RRA_RAMROM RMW_GETBYTE bra RRA_C_CONT endm opcode_63: ;/* RRA (ab,x) [unofficial - ROR Mem, then ADC to Acc] */ addq.l #cy_IndX_RW,CD INDIRECT_X GETANYBYTE_RRA opcode_73: ;/* RRA (ab),y [unofficial - ROR Mem, then ADC to Acc] */ addq.l #cy_IndY_RW,CD INDIRECT_Y GETANYBYTE_RRA opcode_6f: ;/* RRA abcd [unofficial - ROR Mem, then ADC to Acc] */ addq.l #cy_Abs_RW,CD ABSOLUTE GETANYBYTE_RRA opcode_7b: ;/* RRA abcd,y [unofficial - ROR Mem, then ADC to Acc] */ addq.l #cy_AbsY_RW,CD ABSOLUTE_Y GETANYBYTE_RRA opcode_7f: ;/* RRA abcd,x [unofficial - ROR Mem, then ADC to Acc] */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X GETANYBYTE_RRA RRA_RAMROM: move.b (memory_pointer,d7.l),d0 ;get byte RRA_C_CONT: ;/* [unofficial - ROR Mem, then ADC to Acc] */ ROR_C d0 tst.b (attrib_pointer,d7.l) bne.s .ROM_OR_HW move.b d0,(memory_pointer,d7.l) bra.w adc .ROM_OR_HW: cmp.b #isROM,(attrib_pointer,d7.l) beq.w adc ;ROM ? move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,d0 bra.w adc opcode_87: ;/* SAX ab [unofficial - Store result A AND X] */ addq.l #cy_ZP,CD ZPAGE move.b A,d0 and.b X,d0 move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_97: ;/* SAX ab,y [unofficial - Store result A AND X] */ addq.l #cy_ZPY,CD ZPAGE_Y move.b A,d0 and.b X,d0 move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_83: ;/* SAX (ab,x) [unofficial - Store result A AND X] */ addq.l #cy_IndX,CD INDIRECT_X move.b A,d0 and.b X,d0 tst.b (attrib_pointer,d7.l) ; PUTANYBYTE bne.w A800PUTB move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_8f: ;/* SAX abcd [unofficial - Store result A AND X] */ addq.l #cy_Abs,CD ABSOLUTE move.b A,d0 and.b X,d0 tst.b (attrib_pointer,d7.l) ; PUTANYBYTE bne.w A800PUTB move.b d0,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT opcode_a7: ;/* LAX ab [unofficial] - LDA + LDX */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),A ; GETZPBYTE move.b A,X NEXTCHANGE_REG A opcode_b7: ;/* LAX ab,y [unofficial] - LDA + LDX */ addq.l #cy_ZPY,CD ZPAGE_Y move.b (memory_pointer,d7.l),A ; GETZPBYTE move.b A,X NEXTCHANGE_REG A GETANYBYTE_LAX macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s LAX_HW move.b (memory_pointer,d7.l),A ;get byte move.b A,X NEXTCHANGE_REG A endm opcode_a3: ;/* LAX (ind,x) [unofficial] - LDA + LDX */ addq.l #cy_IndX,CD INDIRECT_X GETANYBYTE_LAX opcode_b3: ;/* LAX (ind),y [unofficial] - LDA + LDX */ addq.l #cy_IndY,CD INDIRECT_Y_NCY GETANYBYTE_LAX opcode_af: ;/* LAX abcd [unofficial] - LDA + LDX */ addq.l #cy_Abs,CD ABSOLUTE GETANYBYTE_LAX opcode_bf: ;/* LAX abcd,y [unofficial] - LDA + LDX */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY GETANYBYTE_LAX LAX_HW: EXE_GETBYTE move.b d0,A move.b A,X NEXTCHANGE_REG A opcode_bb: ;/* LAS abcd,y [unofficial - AND S with Mem, transfer to A and X */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY cmp.b #isHARDWARE,(attrib_pointer,d7.l) bne.s .Getbyte_RAMROM EXE_GETBYTE bra.s .AFTER_READ .Getbyte_RAMROM move.b (memory_pointer,d7.l),d0 ;get byte .AFTER_READ and.b _regS,d0 move.b d0,A move.b d0,X move.b d0,ZFLAG bra.w NEXTCHANGE_N opcode_c7: ;/* DCM ab [unofficial - DEC Mem then CMP with Acc] */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE subq.b #1,d0 move.b d0,(memory_pointer,d7.l) bra.w COMPARE_A opcode_d7: ;/* DCM ab,x [unofficial - DEC Mem then CMP with Acc] */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE subq.b #1,d0 move.b d0,(memory_pointer,d7.l) bra.w COMPARE_A DCM_C_CONT macro ;/* [unofficial - DEC Mem then CMP with Acc] */ tst.b (attrib_pointer,d7.l) bne.s DCM_ROM_HW move.b (memory_pointer,d7.l),d0 ;get byte subq.b #1,d0 move.b d0,(memory_pointer,d7.l) bra.w COMPARE_A endm opcode_c3: ;/* DCM (ab,x) [unofficial - DEC Mem then CMP with Acc] */ addq.l #cy_IndX_RW,CD INDIRECT_X DCM_C_CONT opcode_d3: ;/* DCM (ab),y [unofficial - DEC Mem then CMP with Acc] */ addq.l #cy_IndY_RW,CD INDIRECT_Y DCM_C_CONT opcode_cf: ;/* DCM abcd [unofficial] - DEC Mem then CMP with Acc] */ addq.l #cy_Abs_RW,CD ABSOLUTE DCM_C_CONT opcode_db: ;/* DCM abcd,y [unofficial - DEC Mem then CMP with Acc] */ addq.l #cy_AbsY_RW,CD ABSOLUTE_Y DCM_C_CONT DCM_ROM_HW: cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s .Getbyte_HW move.b (memory_pointer,d7.l),d0 ;get byte subq.b #1,d0 bra.w COMPARE_A .Getbyte_HW RMW_GETBYTE subq.b #1,d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,d0 bra.w COMPARE_A opcode_df: ;/* DCM abcd,x [unofficial - DEC Mem then CMP with Acc] */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X DCM_C_CONT opcode_cb: ;/* SBX #ab [unofficial - store (A AND X - Mem) in X] */ addq.l #cy_Imm,CD IMMEDIATE d0 and.b A,X subq.b #1,CFLAG subx.b d0,X scc CFLAG NEXTCHANGE_REG X opcode_e7: ;/* INS ab [unofficial] - INC Mem then SBC with Acc] */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE addq.b #1,d0 move.b d0,(memory_pointer,d7.l) bra sbc opcode_f7: ;/* INS ab,x [unofficial] - INC Mem then SBC with Acc] */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE addq.b #1,d0 move.b d0,(memory_pointer,d7.l) bra sbc INS_C_CONT macro ;/* [unofficial - INC Mem then SBC with Acc] */ tst.b (attrib_pointer,d7.l) bne.s INS_ROM_HW move.b (memory_pointer,d7.l),d0 ;get byte addq.b #1,d0 move.b d0,(memory_pointer,d7.l) bra.w sbc endm opcode_e3: ;/* INS (ab,x) [unofficial] - INC Mem then SBC with Acc] */ addq.l #cy_IndX_RW,CD INDIRECT_X INS_C_CONT opcode_f3: ;/* INS (ab),y [unofficial] - INC Mem then SBC with Acc] */ addq.l #cy_IndY_RW,CD INDIRECT_Y INS_C_CONT opcode_ef: ;/* INS abcd [unofficial] - INC Mem then SBC with Acc] */ addq.l #cy_Abs_RW,CD ABSOLUTE INS_C_CONT opcode_fb: ;/* INS abcd,y [unofficial] - INC Mem then SBC with Acc] */ addq.l #cy_AbsY_RW,CD ABSOLUTE_Y INS_C_CONT INS_ROM_HW: cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s .Getbyte_HW move.b (memory_pointer,d7.l),d0 ;get byte addq.b #1,d0 bra.w sbc .Getbyte_HW RMW_GETBYTE addq.b #1,d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,d0 bra.w sbc opcode_ff: ;/* INS abcd,x [unofficial] - INC Mem then SBC with Acc] */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X INS_C_CONT opcode_80: ;/* NOP #ab [unofficial - skip byte] */ opcode_82: opcode_89: opcode_c2: opcode_e2: addq.l #cy_NOP2,CD addq.l #1,PC6502 bra.w NEXTCHANGE_WITHOUT opcode_04: ;/* NOP ab [unofficial - skip byte] */ opcode_44: opcode_64: addq.l #cy_NOP3,CD addq.l #1,PC6502 bra.w NEXTCHANGE_WITHOUT opcode_14: ;/* NOP ab,x [unofficial - skip byte] */ opcode_34: opcode_54: opcode_74: opcode_d4: opcode_f4: addq.l #cy_NOP4,CD addq.l #1,PC6502 bra.w NEXTCHANGE_WITHOUT opcode_0b: ;/* ANC #ab [unofficial - AND then copy N to C */ opcode_2b: addq.l #cy_Imm,CD and.b (PC6502)+,A move.b A,ZFLAG smi CFLAG bra.w NEXTCHANGE_N opcode_ab: ;/* ANX #ab [unofficial - AND #ab, then TAX] */ addq.l #cy_Imm,CD IMMEDIATE d0 and.b d0,A move.b A,X NEXTCHANGE_REG A opcode_8b: ;/* ANE #ab [unofficial - A AND X AND (Mem OR $EF) to Acc] */ addq.l #cy_Imm,CD move.b (PC6502)+,d0 and.b X,A move.b A,ZFLAG and.b d0,ZFLAG or.b #$ef,d0 and.b d0,A bra.w NEXTCHANGE_N opcode_0c: ;/* NOP abcd [unofficial - skip word] */ addq.l #cy_SKW,CD addq.l #2,PC6502 bra.w NEXTCHANGE_WITHOUT opcode_1c: ;/* NOP abcd,x [unofficial - skip word] */ opcode_3c: opcode_5c: opcode_7c: opcode_dc: opcode_fc: addq.l #cy_SKW,CD move.b (PC6502),d7 add.l X,d7 bcs.s .SOLVE_PB addq.l #cy_Bcc1,CD addq.l #2,PC6502 bra.w NEXTCHANGE_WITHOUT .SOLVE_PB: addq.l #cy_Bcc2,CD addq.l #2,PC6502 bra.w NEXTCHANGE_WITHOUT opcode_1a: ;/* NOP [unofficial] */ opcode_3a: opcode_5a: opcode_7a: opcode_da: opcode_fa: addq.l #cy_NOP,CD bra.w NEXTCHANGE_WITHOUT ; official opcodes opcode_00: ;/* BRK */ ifd MONITOR_BREAK tst.l _brkhere beq.s .oc_00_norm move.b #1,_break_here jsr go_monitor bra.w NEXTCHANGE_WITHOUT .oc_00_norm: endc addq.l #cy_BRK,CD ; btst #I_FLAGB,_regP ; bne.w NEXTCHANGE_WITHOUT SetB move.l PC6502,d7 sub.l memory_pointer,d7 addq.w #1,d7 moveq #0,d0 ; PHW + PHP move.w regS,d0 subq.b #1,d0 ; wrong way around move.b d7,(memory_pointer,d0.l) addq.b #1,d0 LoHi d7 move.b d7,(memory_pointer,d0.l) subq.b #2,d0 ConvertSTATUS_RegP d7 ; move.b d7,_regP ;put result to _regP ! TEST !!! move.b d7,(memory_pointer,d0.l) subq.b #1,d0 move.b d0,_regS SetI move.w (memory_pointer,$fffe.l),d7 LoHi d7 move.l d7,PC6502 add.l memory_pointer,PC6502 ifd MONITOR_BREAK addq.l #1,_ret_nesting endc bra.w NEXTCHANGE_WITHOUT opcode_08: ;/* PHP */ addq.l #cy_RegPH,CD move.w regS,d7 ConvertSTATUS_RegP d0 move.b d0,(memory_pointer,d7.l) subq.b #1,d7 move.b d7,_regS bra.w NEXTCHANGE_WITHOUT opcode_28: ;/* PLP */ addq.l #cy_RegPL,CD moveq #0,d0 ; PLP move.w regS,d0 addq.b #1,d0 ; move.b (memory_pointer,d0.l),_regP move.b (memory_pointer,d0.l),d7 ; TEST ori.b #$30,d7 ; TEST move.b d7,_regP ; TEST ConvertRegP_STATUS d7 move.b d0,_regS tst.b _IRQ ; CPUCHECKIRQ beq.w NEXTCHANGE_WITHOUT btst #I_FLAGB,d7 bne.w NEXTCHANGE_WITHOUT ; moveq #0,d0 ; move.w regS,d0 ; push PC and P to stack ( PHW + PHB ) start subq.b #2,d0 ; but do it the wrong way around for optim. andi.b #B_FLAGN,d7 ; move.b d7,(memory_pointer,d0.l) ; Push P move.l PC6502,d7 sub.l memory_pointer,d7 addq.b #1,d0 ; wrong way around move.b d7,(memory_pointer,d0.l) ; Push High addq.b #1,d0 LoHi d7 move.b d7,(memory_pointer,d0.l) ; Push Low subq.b #3,d0 move.b d0,_regS ; push PC and P to stack ( PHW + PHB ) end SetI move.w (memory_pointer,$fffe.l),d7 LoHi d7 move.l d7,PC6502 add.l memory_pointer,PC6502 addq.l #7,CD ifd MONITOR_BREAK addq.l #1,_ret_nesting endc bra.w NEXTCHANGE_WITHOUT opcode_48: ;/* PHA */ addq.l #cy_RegPH,CD move.w regS,d7 move.b A,(memory_pointer,d7.l) subq.b #1,d7 move.b d7,_regS bra.w NEXTCHANGE_WITHOUT opcode_68: ;/* PLA */ addq.l #cy_RegPL,CD move.w regS,d7 addq.b #1,d7 move.b (memory_pointer,d7.l),A move.b d7,_regS NEXTCHANGE_REG A OR_ANYBYTE macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s OR_HW or.b (memory_pointer,d7.l),A move.b A,ZFLAG bra.w NEXTCHANGE_N endm opcode_01: ;/* ORA (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X OR_ANYBYTE opcode_11: ;/* ORA (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY OR_ANYBYTE OR_HW: EXE_GETBYTE or.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_0d: ;/* ORA abcd */ addq.l #cy_Abs,CD ABSOLUTE OR_ANYBYTE opcode_19: ;/* ORA abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY OR_ANYBYTE opcode_1d: ;/* ORA abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY OR_ANYBYTE opcode_05: ;/* ORA ab */ addq.l #cy_ZP,CD ZPAGE or.b (memory_pointer,d7.l),A ; OR ZPBYTE move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_15: ;/* ORA ab,x */ addq.l #cy_ZPX,CD ZPAGE_X or.b (memory_pointer,d7.l),A ; OR ZPBYTE move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_09: ;/* ORA #ab */ addq.l #cy_Imm,CD or.b (PC6502)+,A move.b A,ZFLAG bra.w NEXTCHANGE_N AND_ANYBYTE macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s AND_HW and.b (memory_pointer,d7.l),A move.b A,ZFLAG bra.w NEXTCHANGE_N endm opcode_21: ;/* AND (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X AND_ANYBYTE opcode_31: ;/* AND (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY AND_ANYBYTE AND_HW: EXE_GETBYTE and.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_2d: ;/* AND abcd */ addq.l #cy_Abs,CD ABSOLUTE AND_ANYBYTE opcode_39: ;/* AND abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY AND_ANYBYTE opcode_3d: ;/* AND abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY AND_ANYBYTE opcode_25: ;/* AND ab */ addq.l #cy_ZP,CD ZPAGE and.b (memory_pointer,d7.l),A ; AND ZPBYTE move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_35: ;/* AND ab,x */ addq.l #cy_ZPX,CD ZPAGE_X and.b (memory_pointer,d7.l),A ; AND ZPBYTE move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_29: ;/* AND #ab */ addq.l #cy_Imm,CD and.b (PC6502)+,A move.b A,ZFLAG bra.w NEXTCHANGE_N EOR_C_CONT macro eor.b d0,A move.b A,ZFLAG bra.w NEXTCHANGE_N endm GETANYBYTE_EOR macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s EOR_HW move.b (memory_pointer,d7.l),d0 ;get byte EOR_C_CONT endm opcode_41: ;/* EOR (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X GETANYBYTE_EOR opcode_51: ;/* EOR (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY GETANYBYTE_EOR EOR_HW: EXE_GETBYTE EOR_C_CONT opcode_4d: ;/* EOR abcd */ addq.l #cy_Abs,CD ABSOLUTE GETANYBYTE_EOR opcode_59: ;/* EOR abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY GETANYBYTE_EOR opcode_5d: ;/* EOR abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY GETANYBYTE_EOR opcode_45: ;/* EOR ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 EOR_C_CONT opcode_55: ;/* EOR ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 EOR_C_CONT opcode_49: ;/* EOR #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 ; because eor only works with registers ! EOR_C_CONT opcode_0a: ;/* ASLA */ addq.l #cy_RegChg,CD ASL_C A NEXTCHANGE_REG A opcode_06: ;/* ASL ab */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),ZFLAG ASL_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_N opcode_16: ;/* ASL ab,x */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),ZFLAG ASL_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_N RPW_ASL_C macro move.b (attrib_pointer,d7.l),d0 bne.s RPW_HW_ASL move.b (memory_pointer,d7.l),ZFLAG ;get byte ASL_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) bra.w NEXTCHANGE_N endm opcode_0e: ;/* ASL abcd */ addq.l #cy_Abs_RW,CD ABSOLUTE RPW_ASL_C opcode_1e: ;/* ASL abcd,x */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X RPW_ASL_C RPW_HW_ASL: cmp.b #isROM,d0 beq.s RPW_ROM_ASL RMW_GETBYTE ASL_C d0 ext.w d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,ZFLAG bra.w NEXTCHANGE_WITHOUT RPW_ROM_ASL: move.b (memory_pointer,d7.l),ZFLAG ; get byte ASL_C ZFLAG bra.w NEXTCHANGE_N opcode_2a: ;/* ROLA */ addq.l #cy_RegChg,CD ROL_C A NEXTCHANGE_REG A opcode_26: ;/* ROL ab */ addq.l #cy_ZP_RW,CD ZPAGE move.b (memory_pointer,d7.l),ZFLAG ; GETZPBYTE ROL_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_N opcode_36: ;/* ROL ab,x */ addq.l #cy_ZPX_RW,CD ZPAGE_X move.b (memory_pointer,d7.l),ZFLAG ; GETZPBYTE ROL_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_N RPW_ROL_C macro move.b (attrib_pointer,d7.l),d0 bne.s RPW_HW_ROL move.b (memory_pointer,d7.l),ZFLAG ;get byte ROL_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) bra.w NEXTCHANGE_N endm opcode_2e: ;/* ROL abcd */ addq.l #cy_Abs_RW,CD ABSOLUTE RPW_ROL_C opcode_3e: ;/* ROL abcd,x */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X RPW_ROL_C RPW_HW_ROL: cmp.b #isROM,d0 beq.s RPW_ROM_ROL RMW_GETBYTE ROL_C d0 ext.w d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,ZFLAG bra.w NEXTCHANGE_WITHOUT RPW_ROM_ROL: move.b (memory_pointer,d7.l),ZFLAG ;get byte ROL_C ZFLAG bra.w NEXTCHANGE_N opcode_4a: ;/* LSRA */ addq.l #cy_RegChg,CD clr.w NFLAG lsr.b #1,A scs CFLAG move.b A,ZFLAG bra.w NEXTCHANGE_WITHOUT opcode_46: ;/* LSR ab */ addq.l #cy_ZP_RW,CD ZPAGE clr.w NFLAG move.b (memory_pointer,d7.l),ZFLAG ; GETZPBYTE lsr.b #1,ZFLAG scs CFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT opcode_56: ;/* LSR ab,x */ addq.l #cy_ZPX_RW,CD ZPAGE_X clr.w NFLAG move.b (memory_pointer,d7.l),ZFLAG ; GETZPBYTE lsr.b #1,ZFLAG scs CFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT RPW_LSR_C macro clr.w NFLAG move.b (attrib_pointer,d7.l),d0 bne.s RPW_HW_LSR move.b (memory_pointer,d7.l),ZFLAG ;get byte LSR_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT endm opcode_4e: ;/* LSR abcd */ addq.l #cy_Abs_RW,CD ABSOLUTE RPW_LSR_C opcode_5e: ;/* LSR abcd,x */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X RPW_LSR_C RPW_HW_LSR: cmp.b #isROM,d0 beq.s RPW_ROM_LSR RMW_GETBYTE LSR_C d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,ZFLAG bra.w NEXTCHANGE_WITHOUT RPW_ROM_LSR: move.b (memory_pointer,d7.l),ZFLAG ;get byte LSR_C ZFLAG bra.w NEXTCHANGE_WITHOUT opcode_6a: ;/* RORA */ addq.l #cy_RegChg,CD ROR_C A NEXTCHANGE_REG A opcode_66: ;/* ROR ab */ addq.l #cy_ZP_RW,CD ZPAGE add.b CFLAG,CFLAG move.b (memory_pointer,d7.l),ZFLAG ; GETZPBYTE roxr.b #1,ZFLAG scs CFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_N opcode_76: ;/* ROR ab,x */ addq.l #cy_ZPX_RW,CD ZPAGE_X add.b CFLAG,CFLAG move.b (memory_pointer,d7.l),ZFLAG ; GETZPBYTE roxr.b #1,ZFLAG scs CFLAG move.b ZFLAG,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_N RPW_ROR_C macro move.b (attrib_pointer,d7.l),d0 bne.s RPW_HW_ROR move.b (memory_pointer,d7.l),ZFLAG ;get byte ROR_C ZFLAG move.b ZFLAG,(memory_pointer,d7.l) bra.w NEXTCHANGE_N endm opcode_6e: ;/* ROR abcd */ addq.l #cy_Abs_RW,CD ABSOLUTE RPW_ROR_C opcode_7e: ;/* ROR abcd,x */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X RPW_ROR_C RPW_HW_ROR: cmp.b #isROM,d0 beq.s RPW_ROM_ROR RMW_GETBYTE ROR_C d0 ext.w d0 move.l d0,-(a7) EXE_PUTBYTE d7 move.l (a7)+,ZFLAG bra.w NEXTCHANGE_WITHOUT RPW_ROM_ROR: move.b (memory_pointer,d7.l),ZFLAG ;get byte ROR_C ZFLAG bra.w NEXTCHANGE_N opcode_18: ;/* CLC */ addq.l #cy_FlagCS,CD ClrCFLAG bra.w NEXTCHANGE_WITHOUT opcode_38: ;/* SEC */ addq.l #cy_FlagCS,CD SetCFLAG bra.w NEXTCHANGE_WITHOUT opcode_58: ;/* CLI */ addq.l #cy_FlagCS,CD ClrI tst.b _IRQ ; ~ CPUCHECKIRQ beq.w NEXTCHANGE_WITHOUT move.l PC6502,d7 sub.l memory_pointer,d7 moveq #0,d0 ; PHW + PHP (B0) move.w regS,d0 subq.b #1,d0 ; wrong way around move.b d7,(memory_pointer,d0.l) addq.b #1,d0 LoHi d7 move.b d7,(memory_pointer,d0.l) subq.b #2,d0 ConvertSTATUS_RegP d7 ; move.b d7,_regP ;put result to _regP ! TEST !!! andi.b #B_FLAGN,d7 ; TEST move.b d7,(memory_pointer,d0.l) subq.b #1,d0 move.b d0,_regS SetI move.w (memory_pointer,$fffe.l),d7 LoHi d7 move.l d7,PC6502 add.l memory_pointer,PC6502 clr.b _IRQ addq.l #7,CD ifd MONITOR_BREAK addq.l #1,_ret_nesting endc bra.w NEXTCHANGE_WITHOUT opcode_78: ;/* SEI */ addq.l #cy_FlagCS,CD SetI bra.w NEXTCHANGE_WITHOUT opcode_b8: ;/* CLV */ addq.l #cy_FlagCS,CD ClrVFLAG bra.w NEXTCHANGE_WITHOUT opcode_d8: ;/* CLD */ addq.l #cy_FlagCS,CD ClrD bra.w NEXTCHANGE_WITHOUT opcode_f8: ;/* SED */ addq.l #cy_FlagCS,CD SetD bra.w NEXTCHANGE_WITHOUT JMP_C macro move.w (PC6502)+,d7 LoHi d7 ;(in d7 adress where we want to jump) lea (memory_pointer,d7.l),PC6502 bra.w NEXTCHANGE_WITHOUT endm opcode_4c: ;/* JMP abcd */ ifd MONITOR_BREAK move.l PC6502,d7 ;current pointer sub.l memory_pointer,d7 subq.l #1,d7 lea _remember_JMP,a0 move.l _remember_jmp_curpos,d0 move.w d7,(a0,d0*2) addq.l #1,d0 cmp.l #rem_jmp_steps,d0 bmi.s .point_rem_jmp moveq #0,d0 .point_rem_jmp: move.l d0,_remember_jmp_curpos endc addq.l #cy_JmpAbs,CD JMP_C opcode_6c: ;/* JMP (abcd) */ ifd MONITOR_BREAK move.l PC6502,d7 ;current pointer sub.l memory_pointer,d7 subq.l #1,d7 lea _remember_JMP,a0 move.l _remember_jmp_curpos,d0 move.w d7,(a0,d0*2) addq.l #1,d0 cmp.l #rem_jmp_steps,d0 bmi.s .point_rem_jmp moveq #0,d0 .point_rem_jmp: move.l d0,_remember_jmp_curpos endc move.w (PC6502)+,d7 LoHi d7 ifd P65C02 move.w (memory_pointer,d7.l),d7 LoHi d7 lea (memory_pointer,d7.l),PC6502 else ;/* original 6502 had a bug in jmp (addr) when addr crossed page boundary */ cmp.b #$ff,d7 beq.s .PROBLEM_FOUND ;when problematic jump is found move.w (memory_pointer,d7.l),d7 LoHi d7 lea (memory_pointer,d7.l),PC6502 addq.l #cy_JmpInd,CD bra.w NEXTCHANGE_WITHOUT .PROBLEM_FOUND: move.l d7,d0 ;we have to use both of them clr.b d7 ;instead of reading right this adress, ;we read adress at this start of page move.b (memory_pointer,d7.l),d7 LoHi d7 move.b (memory_pointer,d0.l),d7 lea (memory_pointer,d7.l),PC6502 endc addq.l #cy_JmpInd,CD bra.w NEXTCHANGE_WITHOUT opcode_20: ;/* JSR abcd */ addq.l #cy_Sub,CD move.l PC6502,d7 ;current pointer sub.l memory_pointer,d7 ifd MONITOR_BREAK subq.l #1,d7 lea _remember_JMP,a0 move.l _remember_jmp_curpos,d0 move.w d7,(a0,d0*2) addq.l #1,d7 ; restore to PC addq.l #1,d0 cmp.l #rem_jmp_steps,d0 bmi.s .point_rem_jmp moveq #0,d0 .point_rem_jmp: move.l d0,_remember_jmp_curpos addq.l #1,_ret_nesting endc addq.l #1,d7 ; return address moveq #0,d0 ; PHW move.w regS,d0 subq.b #1,d0 ; wrong way around move.b d7,(memory_pointer,d0.l) addq.b #1,d0 LoHi d7 move.b d7,(memory_pointer,d0.l) subq.b #2,d0 move.b d0,_regS JMP_C opcode_60: ;/* RTS */ addq.l #cy_Sub,CD PLW d7,d0 lea 1(memory_pointer,d7.l),PC6502 ifd MONITOR_BREAK tst.b _break_ret beq.s .mb_end tst.l _ret_nesting bmi.s .mb_end move.b #1,_break_step .mb_end: subq.l #1,_ret_nesting endc bra.w NEXTCHANGE_WITHOUT opcode_40: ;/* RTI */ _RTI: addq.l #cy_Sub,CD moveq #0,d0 ; PLP + PLW move.w regS,d0 addq.b #1,d0 ; move.b (memory_pointer,d0.l),_regP move.b (memory_pointer,d0.l),d7 ; TEST ori.b #$30,d7 ; TEST move.b d7,_regP ; TEST ConvertRegP_STATUS d7 addq.b #2,d0 ; wrong way around move.b (memory_pointer,d0.l),d7 asl.w #8,d7 subq.b #1,d0 or.b (memory_pointer,d0.l),d7 addq.b #1,d0 move.b d0,_regS lea (memory_pointer,d7.l),PC6502 ifd MONITOR_BREAK tst.b _break_ret beq.s .mb_end tst.l _ret_nesting bmi.s .mb_end move.b #1,_break_step .mb_end: subq.l #1,_ret_nesting endc tst.b _IRQ ; CPUCHECKIRQ beq.w NEXTCHANGE_WITHOUT move.b _regP,d7 ; andi.b #I_FLAG,d7 btst #I_FLAGB,d7 bne.w NEXTCHANGE_WITHOUT moveq #0,d0 move.w regS,d0 ; push PC and P to stack ( PHW + PHB ) start subq.b #2,d0 andi.b #B_FLAGN,d7 ; TEST move.b d7,(memory_pointer,d0.l) ; Push P move.l PC6502,d7 sub.l memory_pointer,d7 addq.b #1,d0 ; wrong way around move.b d7,(memory_pointer,d0.l) addq.b #1,d0 LoHi d7 move.b d7,(memory_pointer,d0.l) subq.b #3,d0 move.b d0,_regS ; push PC and P to stack ( PHW + PHB ) end SetI move.w (memory_pointer,$fffe.l),d7 LoHi d7 move.l d7,PC6502 add.l memory_pointer,PC6502 addq.l #7,CD ifd MONITOR_BREAK addq.l #1,_ret_nesting endc bra.w NEXTCHANGE_WITHOUT BIT_C_CONT macro ext.w NFLAG btst #V_FLAGB,ZFLAG sne VFLAG and.b A,ZFLAG bra.w NEXTCHANGE_WITHOUT endm opcode_24: ;/* BIT ab */ addq.l #cy_ZP,CD ZPAGE BIT_RAMROM: move.b (memory_pointer,d7.l),ZFLAG ; GETZPBYTE BIT_C_CONT opcode_2c: ;/* BIT abcd */ addq.l #cy_Abs,CD ABSOLUTE cmp.b #isHARDWARE,(attrib_pointer,d7.l) bne.s BIT_RAMROM EXE_GETBYTE move.b d0,ZFLAG BIT_C_CONT STOREANYBYTE_A macro tst.b (attrib_pointer,d7.l) bne.s STA_HW move.b A,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT endm opcode_81: ;/* STA (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X STOREANYBYTE_A opcode_91: ;/* STA (ab),y */ addq.l #cy_IndY2,CD INDIRECT_Y STOREANYBYTE_A opcode_8d: ;/* STA abcd */ addq.l #cy_Abs,CD ABSOLUTE STOREANYBYTE_A opcode_99: ;/* STA abcd,y */ addq.l #cy_IndY2,CD ABSOLUTE_Y STOREANYBYTE_A opcode_9d: ;/* STA abcd,x */ addq.l #cy_AbsX2,CD ABSOLUTE_X STOREANYBYTE_A STA_HW: move.b A,d0 bra.w A800PUTB opcode_85: ;/* STA ab */ addq.l #cy_ZP,CD ZPAGE move.b A,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT opcode_95: ;/* STA ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b A,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT STOREANYBYTE macro tst.b (attrib_pointer,d7.l) bne.s .GO_PUTBYTE\@ move.b \1,(memory_pointer,d7.l) bra.w NEXTCHANGE_WITHOUT .GO_PUTBYTE\@: move.b \1,d0 bra.w A800PUTB endm opcode_8e: ;/* STX abcd */ addq.l #cy_Abs,CD ABSOLUTE STOREANYBYTE X opcode_86: ;/* STX ab */ addq.l #cy_ZP,CD ZPAGE move.b X,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT opcode_96: ;/* STX ab,y */ addq.l #cy_ZPY,CD ZPAGE_Y move.b X,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT opcode_8c: ;/* STY abcd */ addq.l #cy_Abs,CD ABSOLUTE STOREANYBYTE Y opcode_84: ;/* STY ab */ addq.l #cy_ZP,CD ZPAGE move.b Y,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT opcode_94: ;/* STY ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b Y,(memory_pointer,d7.l) ; PUTZPBYTE bra.w NEXTCHANGE_WITHOUT LOADANYBYTE_A macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s LDA_HW move.b (memory_pointer,d7.l),A ;get byte NEXTCHANGE_REG A endm opcode_a1: ;/* LDA (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X LOADANYBYTE_A opcode_b1: ;/* LDA (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY LOADANYBYTE_A LDA_HW: EXE_GETBYTE move.b d0,A NEXTCHANGE_REG A opcode_ad: ;/* LDA abcd */ addq.l #cy_Abs,CD ABSOLUTE LOADANYBYTE_A opcode_b9: ;/* LDA abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY LOADANYBYTE_A opcode_bd: ;/* LDA abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY LOADANYBYTE_A opcode_a5: ;/* LDA ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),A ; GETZPBYTE move.b A,ZFLAG bra.w NEXTCHANGE_N opcode_b5: ;/* LDA ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),A ; GETZPBYTE NEXTCHANGE_REG A opcode_a9: ;/* LDA #ab */ addq.l #cy_Imm,CD IMMEDIATE A move.b A,ZFLAG bra.w NEXTCHANGE_N LOADANYBYTE_X macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s LDX_HW move.b (memory_pointer,d7.l),X ;get byte NEXTCHANGE_REG X endm opcode_ae: ;/* LDX abcd */ addq.l #cy_Abs,CD ABSOLUTE LOADANYBYTE_X opcode_be: ;/* LDX abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY LOADANYBYTE_X LDX_HW: EXE_GETBYTE move.b d0,X NEXTCHANGE_REG X opcode_a6: ;/* LDX ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),X ; GETZPBYTE move.b X,ZFLAG bra.w NEXTCHANGE_N opcode_b6: ;/* LDX ab,y */ addq.l #cy_ZPY,CD ZPAGE_Y move.b (memory_pointer,d7.l),X ; GETZPBYTE NEXTCHANGE_REG X opcode_a2: ;/* LDX #ab */ addq.l #cy_Imm,CD IMMEDIATE X move.b X,ZFLAG bra.w NEXTCHANGE_N LOADANYBYTE_Y macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s LDY_HW move.b (memory_pointer,d7.l),Y ;get byte NEXTCHANGE_REG Y endm opcode_ac: ;/* LDY abcd */ addq.l #cy_Abs,CD ABSOLUTE LOADANYBYTE_Y opcode_bc: ;/* LDY abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY LOADANYBYTE_Y LDY_HW: EXE_GETBYTE move.b d0,Y NEXTCHANGE_REG Y opcode_a4: ;/* LDY ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),Y ; GETZPBYTE move.b Y,ZFLAG bra.w NEXTCHANGE_N opcode_b4: ;/* LDY ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),Y ; GETZPBYTE NEXTCHANGE_REG Y opcode_a0: ;/* LDY #ab */ addq.l #cy_Imm,CD IMMEDIATE Y move.b Y,ZFLAG bra.w NEXTCHANGE_N opcode_8a: ;/* TXA */ addq.l #cy_RegChg,CD move.b X,A NEXTCHANGE_REG A opcode_aa: ;/* TAX */ addq.l #cy_RegChg,CD move.b A,X NEXTCHANGE_REG A opcode_98: ;/* TYA */ addq.l #cy_RegChg,CD move.b Y,A NEXTCHANGE_REG A opcode_a8: ;/* TAY */ addq.l #cy_RegChg,CD move.b A,Y NEXTCHANGE_REG A opcode_9a: ;/* TXS */ addq.l #cy_RegChg,CD move.b X,_regS bra.w NEXTCHANGE_WITHOUT opcode_ba: ;/* TSX */ addq.l #cy_RegChg,CD move.b _regS,X NEXTCHANGE_REG X opcode_d2: ;/* ESCRTS #ab (JAM) - on Atari is here instruction CIM ;[unofficial] !RS! */ addq.l #cy_CIM,CD move.b (PC6502)+,d7 Call_Atari800_RunEsc PLW d7,d0 lea (memory_pointer,d7.l),PC6502 addq.l #1,PC6502 ifd MONITOR_BREAK tst.b _break_ret beq.s .mb_end tst.l _ret_nesting bmi.s .mb_end move.b #1,_break_step .mb_end: subq.l #1,_ret_nesting endc bra.w NEXTCHANGE_WITHOUT opcode_f2: ;/* ESC #ab (JAM) - on Atari is here instruction CIM ;[unofficial] !RS! */ addq.l #cy_CIM,CD move.b (PC6502)+,d7 Call_Atari800_RunEsc bra.w NEXTCHANGE_WITHOUT opcode_ea: ;/* NOP */ ;official addq.l #cy_NOP,CD bra.w NEXTCHANGE_WITHOUT opcode_c6: ;/* DEC ab */ addq.l #cy_ZP_RW,CD ZPAGE subq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N opcode_d6: ;/* DEC ab,x */ addq.l #cy_ZPX_RW,CD ZPAGE_X subq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N opcode_ce: ;/* DEC abcd */ addq.l #cy_Abs_RW,CD ABSOLUTE move.b (attrib_pointer,d7.l),d0 bne.s DEC_Byte_ROMHW subq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N DEC_Byte_ROMHW: cmp.b #isHARDWARE,d0 beq.s .Getbyte_HW move.b (memory_pointer,d7.l),ZFLAG ;get byte subq.b #1,ZFLAG bra.w NEXTCHANGE_N .Getbyte_HW: RMW_GETBYTE move.b d0,ZFLAG subq.b #1,ZFLAG ; bra.w A800PUTB_Ld0_N A800PUTB_Ld0_N: ext.w NFLAG A800PUTB_Ld0: move.b ZFLAG,d0 A800PUTB: cmp.b #isROM,(attrib_pointer,d7.l) beq.s A800PUTBE move.l ZFLAG,-(a7) EXE_PUTBYTE d7 move.l (a7)+,ZFLAG A800PUTBE: bra.w NEXTCHANGE_WITHOUT opcode_de: ;/* DEC abcd,x */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X move.b (attrib_pointer,d7.l),d0 bne.s DEC_Byte_ROMHW subq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N opcode_ca: ;/* DEX */ addq.l #cy_RegChg,CD subq.b #1,X NEXTCHANGE_REG X opcode_88: ;/* DEY */ addq.l #cy_RegChg,CD subq.b #1,Y NEXTCHANGE_REG Y opcode_e6: ;/* INC ab */ addq.l #cy_ZP_RW,CD ZPAGE addq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N opcode_f6: ;/* INC ab,x */ addq.l #cy_ZPX_RW,CD ZPAGE_X addq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N opcode_ee: ;/* INC abcd */ addq.l #cy_Abs_RW,CD ABSOLUTE move.b (attrib_pointer,d7.l),d0 bne.s INC_Byte_ROMHW addq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N INC_Byte_ROMHW: cmp.b #isHARDWARE,d0 beq.s .Getbyte_HW move.b (memory_pointer,d7.l),ZFLAG ;get byte addq.b #1,ZFLAG bra.w NEXTCHANGE_N .Getbyte_HW: RMW_GETBYTE move.b d0,ZFLAG addq.b #1,ZFLAG bra.w A800PUTB_Ld0_N opcode_fe: ;/* INC abcd,x */ addq.l #cy_AbsX_RW,CD ABSOLUTE_X move.b (attrib_pointer,d7.l),d0 bne.s INC_Byte_ROMHW addq.b #1,(memory_pointer,d7.l) move.b (memory_pointer,d7.l),ZFLAG bra.w NEXTCHANGE_N opcode_e8: ;/* INX */ addq.l #cy_RegChg,CD addq.b #1,X NEXTCHANGE_REG X opcode_c8: ;/* INY */ addq.l #cy_RegChg,CD addq.b #1,Y NEXTCHANGE_REG Y DONT_BRA macro addq.l #cy_Bcc,CD addq.l #1,PC6502 bra.w NEXTCHANGE_WITHOUT endm opcode_10: ;/* BPL */ tst.w NFLAG bpl.s SOLVE DONT_BRA opcode_30: ;/* BMI */ tst.w NFLAG bmi.s SOLVE DONT_BRA opcode_d0: ;/* BNE */ tst.b ZFLAG bne.s SOLVE DONT_BRA opcode_f0: ;/* BEQ */ tst.b ZFLAG beq.s SOLVE DONT_BRA SOLVE: move.b (PC6502)+,d7 extb.l d7 move.l PC6502,d0 add.l d7,PC6502 sub.l memory_pointer,d0 and.w #255,d0 ; !!! add.w d7,d0 and.w #$ff00,d0 bne.s SOLVE_PB addq.l #cy_Bcc1,CD bra.w NEXTCHANGE_WITHOUT SOLVE_PB: addq.l #cy_Bcc2,CD bra.w NEXTCHANGE_WITHOUT opcode_90: ;/* BCC */ tst.b CFLAG beq.s SOLVE DONT_BRA opcode_b0: ;/* BCS */ tst.b CFLAG bne.s SOLVE DONT_BRA opcode_50: ;/* BVC */ tst.b VFLAG beq.s SOLVE DONT_BRA opcode_70: ;/* BVS */ tst.b VFLAG bne.s SOLVE DONT_BRA GETANYBYTE_ADC macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s ADC_HW move.b (memory_pointer,d7.l),d0 ;get byte bra.s adcb endm adc: ; !!! put it where it's needed !!! btst #D_FLAGB,_regP bne.w BCD_ADC bra.w adcb opcode_61: ;/* ADC (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X GETANYBYTE_ADC opcode_71: ;/* ADC (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY GETANYBYTE_ADC ADC_HW: EXE_GETBYTE bra.s adcb opcode_6d: ;/* ADC abcd */ addq.l #cy_Abs,CD ABSOLUTE GETANYBYTE_ADC opcode_79: ;/* ADC abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY GETANYBYTE_ADC opcode_7d: ;/* ADC abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY GETANYBYTE_ADC adcb: add.b CFLAG,CFLAG addx.b d0,A svs VFLAG scs CFLAG NEXTCHANGE_REG A opcode_65: ;/* ADC ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s adcb opcode_75: ;/* ADC ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s adcb opcode_69: ;/* ADC #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 bra.s adcb GETANYBYTE_ADC_D macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s ADC_HW_D move.b (memory_pointer,d7.l),d0 ;get byte bra.s BCD_ADC endm opcode_61_D: ;/* ADC (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X GETANYBYTE_ADC_D opcode_6d_D: ;/* ADC abcd */ addq.l #cy_Abs,CD ABSOLUTE GETANYBYTE_ADC_D opcode_71_D: ;/* ADC (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY GETANYBYTE_ADC_D ADC_HW_D: EXE_GETBYTE bra.s BCD_ADC opcode_79_D: ;/* ADC abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY GETANYBYTE_ADC_D opcode_7d_D: ;/* ADC abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY GETANYBYTE_ADC_D ; Version 1 : exact like Thor ; Z from binary calc. ; N + V after lower nibble decimal correction ; C from decimal calc. ; a lot of code necessary to replicate a 6502 bug BCD_ADC: move.w d0,a0 ; needed first moveq #15,d7 and.b d7,d0 ; low nibble Add move.b A,ZFLAG and.b d7,ZFLAG ; low nibble A add.b CFLAG,CFLAG abcd d0,ZFLAG ; low nibble BCD add move.b A,d0 moveq #$f0,d7 and.b d7,d0 ; high nibble Add add.b d0,ZFLAG move.w a0,d0 and.b d7,d0 ; high nibble Add add.b d0,ZFLAG ext.w NFLAG ; NFLAG finished eor.b A,d0 ; A eor data eor.b A,ZFLAG ; A eor temp not.b ZFLAG or.b d0,ZFLAG smi VFLAG ; VFLAG finished move.w a0,d0 ; restore data add.b CFLAG,CFLAG move.b A,ZFLAG addx.b d0,ZFLAG ; ZFLAG finished add.b CFLAG,CFLAG abcd d0,A ; A finished scs CFLAG bra.w NEXTCHANGE_WITHOUT opcode_65_D: ;/* ADC ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s BCD_ADC opcode_75_D: ;/* ADC ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s BCD_ADC opcode_69_D: ;/* ADC #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 bra.s BCD_ADC GETANYBYTE_SBC macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s SBC_HW move.b (memory_pointer,d7.l),d0 ;get byte bra.s sbcb endm sbc: ; !!! put it where it's needed !!! btst #D_FLAGB,_regP bne.w BCD_SBC bra.w sbcb opcode_e1: ;/* SBC (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X GETANYBYTE_SBC opcode_f1: ;/* SBC (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY GETANYBYTE_SBC SBC_HW: EXE_GETBYTE bra.s sbcb opcode_ed: ;/* SBC abcd */ addq.l #cy_Abs,CD ABSOLUTE GETANYBYTE_SBC opcode_f9: ;/* SBC abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY GETANYBYTE_SBC opcode_fd: ;/* SBC abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY GETANYBYTE_SBC sbcb: subq.b #1,CFLAG subx.b d0,A svs VFLAG scc CFLAG NEXTCHANGE_REG A opcode_e5: ;/* SBC ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s sbcb opcode_f5: ;/* SBC ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s sbcb opcode_eb: ;/* SBC #ab [unofficial] */ opcode_e9: ;/* SBC #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 bra.s sbcb GETANYBYTE_SBC_D macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s SBC_HW_D move.b (memory_pointer,d7.l),d0 ;get byte bra.s BCD_SBC endm opcode_e1_D: ;/* SBC (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X GETANYBYTE_SBC_D opcode_ed_D: ;/* SBC abcd */ addq.l #cy_Abs,CD ABSOLUTE GETANYBYTE_SBC_D opcode_f1_D: ;/* SBC (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY GETANYBYTE_SBC_D SBC_HW_D: EXE_GETBYTE bra.s BCD_SBC opcode_f9_D: ;/* SBC abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY GETANYBYTE_SBC_D opcode_fd_D: ;/* SBC abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY GETANYBYTE_SBC_D ; Version exact like Thor ; C, Z, N, V from binary calc. ; A from decimal calc. BCD_SBC: move.b A,ZFLAG not.b CFLAG add.b CFLAG,CFLAG sbcd d0,A add.b CFLAG,CFLAG subx.b d0,ZFLAG svs VFLAG scc CFLAG bra.w NEXTCHANGE_N opcode_e5_D: ;/* SBC ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s BCD_SBC opcode_f5_D: ;/* SBC ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s BCD_SBC opcode_eb_D: ;/* SBC #ab [unofficial] */ opcode_e9_D: ;/* SBC #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 bra.s BCD_SBC opcode_cc: ;/* CPY abcd */ addq.l #cy_Abs,CD ABSOLUTE cmp.b #isHARDWARE,(attrib_pointer,d7.l) ; GETANYBYTE beq.s .Getbyte_HW move.b (memory_pointer,d7.l),d0 ;get byte move.b Y,ZFLAG bra COMPARE .Getbyte_HW: EXE_GETBYTE move.b Y,ZFLAG bra COMPARE opcode_c4: ;/* CPY ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE move.b Y,ZFLAG bra COMPARE opcode_c0: ;/* CPY #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 move.b Y,ZFLAG bra COMPARE opcode_ec: ;/* CPX abcd */ addq.l #cy_Abs,CD ABSOLUTE cmp.b #isHARDWARE,(attrib_pointer,d7.l) ; GETANYBYTE beq.s .Getbyte_HW move.b (memory_pointer,d7.l),d0 ;get byte move.b X,ZFLAG bra COMPARE .Getbyte_HW: EXE_GETBYTE move.b X,ZFLAG bra COMPARE opcode_e4: ;/* CPX ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE move.b X,ZFLAG bra COMPARE opcode_e0: ;/* CPX #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 move.b X,ZFLAG bra COMPARE GETANYBYTE_CMP macro cmp.b #isHARDWARE,(attrib_pointer,d7.l) beq.s CMP_HW move.b (memory_pointer,d7.l),d0 ;get byte bra COMPARE_A endm opcode_c1: ;/* CMP (ab,x) */ addq.l #cy_IndX,CD INDIRECT_X GETANYBYTE_CMP opcode_d1: ;/* CMP (ab),y */ addq.l #cy_IndY,CD INDIRECT_Y_NCY GETANYBYTE_CMP CMP_HW: EXE_GETBYTE bra.w COMPARE_A opcode_cd: ;/* CMP abcd */ addq.l #cy_Abs,CD ABSOLUTE GETANYBYTE_CMP opcode_d9: ;/* CMP abcd,y */ addq.l #cy_AbsY,CD ABSOLUTE_Y_NCY GETANYBYTE_CMP opcode_dd: ;/* CMP abcd,x */ addq.l #cy_AbsX,CD ABSOLUTE_X_NCY GETANYBYTE_CMP opcode_d5: ;/* CMP ab,x */ addq.l #cy_ZPX,CD ZPAGE_X move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s COMPARE_A opcode_c5: ;/* CMP ab */ addq.l #cy_ZP,CD ZPAGE move.b (memory_pointer,d7.l),d0 ; GETZPBYTE bra.s COMPARE_A opcode_c9: ;/* CMP #ab */ addq.l #cy_Imm,CD IMMEDIATE d0 ; bra.s COMPARE_A COMPARE_A: move.b A,ZFLAG COMPARE: sub.b d0,ZFLAG scc CFLAG ; bra.w NEXTCHANGE_N ;MAIN LOOP , where we are counting cycles and working with other STUFF NEXTCHANGE_N: ext.w NFLAG NEXTCHANGE_WITHOUT: cmp.l _xpos_limit,CD bge.s END_OF_CYCLE **************************************** ifd MONITOR_BREAK ;following block of code allows you to enter ;a break address move.l _remember_PC_curpos,d0 lea _remember_PC,a0 move.l PC6502,d7 sub.l memory_pointer,d7 move.w d7,(a0,d0*2) ; remember program counter addq.l #1,d0 cmp.l #rem_pc_steps,d0 bmi.s .point_rem_pc moveq #0,d0 .point_rem_pc: move.l d0,_remember_PC_curpos ifd NEW_CYCLE_EXACT moveq #0,d0 move.b _ypos,d0 asl.w #8,d0 move.l d0,a1 move.l CD,d0 cmp.l #-999,_cur_screen_pos beq.s .calc_all move.l _cpu2antic_ptr,a0 move.l (a0,d0*4),d0 bra.s .calc_all .calc_all: add.l a1,d0 move.l d0,a1 move.l _remember_xpos,a0 move.l _remember_xpos_curpos,d0 move.l a1,(a0,d0*4) addq.l #1,d0 cmp.l #rem_pc_steps,d0 bmi.s .point_rem_xpos moveq #0,d0 .point_rem_xpos: move.l d0,_remember_xpos_curpos endc cmp.w _break_addr,d7 ; break address reached ? beq.s .go_monitor move.l _ypos,d0 ; !!! or .w ? cmp.l _ypos_break_addr,d0 ; break address reached ? beq.s .go_monitor tst.b _break_step ; step mode active ? beq.s .get_first .go_monitor: bsr go_monitor ;on break monitor is invoked .get_first endc **************************************** moveq #0,d7 move.b (PC6502)+,d7 ifd PROFILE lea _instruction_count,a0 addq.l #1,(a0,d7.l*4) endc ; move.w (OPMODE_TABLE,PC,d7.l*2),d0 ; jmp (OPMODE_TABLE,d0.w) move.w (a3,d7.l*2),d0 jmp (a3,d0.w) END_OF_CYCLE: ConvertSTATUS_RegP_destroy d0 UPDATE_GLOBAL_REGS move.l CD,_xpos ;returned value movem.l (a7)+,d2-d7/a2-a6 TERM_GO: rts go_monitor: ConvertSTATUS_RegP_destroy d0 UPDATE_GLOBAL_REGS Call_Atari800_Exit_true UPDATE_LOCAL_REGS ConvertRegP_STATUS d0 rts cnop 0,4 ; doubleword alignment OPMODE_TABLE: OP_T: dc.w opcode_00-OP_T dc.w opcode_01-OP_T dc.w opcode_02-OP_T dc.w opcode_03-OP_T dc.w opcode_04-OP_T dc.w opcode_05-OP_T dc.w opcode_06-OP_T dc.w opcode_07-OP_T dc.w opcode_08-OP_T dc.w opcode_09-OP_T dc.w opcode_0a-OP_T dc.w opcode_0b-OP_T dc.w opcode_0c-OP_T dc.w opcode_0d-OP_T dc.w opcode_0e-OP_T dc.w opcode_0f-OP_T dc.w opcode_10-OP_T dc.w opcode_11-OP_T dc.w opcode_12-OP_T dc.w opcode_13-OP_T dc.w opcode_14-OP_T dc.w opcode_15-OP_T dc.w opcode_16-OP_T dc.w opcode_17-OP_T dc.w opcode_18-OP_T dc.w opcode_19-OP_T dc.w opcode_1a-OP_T dc.w opcode_1b-OP_T dc.w opcode_1c-OP_T dc.w opcode_1d-OP_T dc.w opcode_1e-OP_T dc.w opcode_1f-OP_T dc.w opcode_20-OP_T dc.w opcode_21-OP_T dc.w opcode_22-OP_T dc.w opcode_23-OP_T dc.w opcode_24-OP_T dc.w opcode_25-OP_T dc.w opcode_26-OP_T dc.w opcode_27-OP_T dc.w opcode_28-OP_T dc.w opcode_29-OP_T dc.w opcode_2a-OP_T dc.w opcode_2b-OP_T dc.w opcode_2c-OP_T dc.w opcode_2d-OP_T dc.w opcode_2e-OP_T dc.w opcode_2f-OP_T dc.w opcode_30-OP_T dc.w opcode_31-OP_T dc.w opcode_32-OP_T dc.w opcode_33-OP_T dc.w opcode_34-OP_T dc.w opcode_35-OP_T dc.w opcode_36-OP_T dc.w opcode_37-OP_T dc.w opcode_38-OP_T dc.w opcode_39-OP_T dc.w opcode_3a-OP_T dc.w opcode_3b-OP_T dc.w opcode_3c-OP_T dc.w opcode_3d-OP_T dc.w opcode_3e-OP_T dc.w opcode_3f-OP_T dc.w opcode_40-OP_T dc.w opcode_41-OP_T dc.w opcode_42-OP_T dc.w opcode_43-OP_T dc.w opcode_44-OP_T dc.w opcode_45-OP_T dc.w opcode_46-OP_T dc.w opcode_47-OP_T dc.w opcode_48-OP_T dc.w opcode_49-OP_T dc.w opcode_4a-OP_T dc.w opcode_4b-OP_T dc.w opcode_4c-OP_T dc.w opcode_4d-OP_T dc.w opcode_4e-OP_T dc.w opcode_4f-OP_T dc.w opcode_50-OP_T dc.w opcode_51-OP_T dc.w opcode_52-OP_T dc.w opcode_53-OP_T dc.w opcode_54-OP_T dc.w opcode_55-OP_T dc.w opcode_56-OP_T dc.w opcode_57-OP_T dc.w opcode_58-OP_T dc.w opcode_59-OP_T dc.w opcode_5a-OP_T dc.w opcode_5b-OP_T dc.w opcode_5c-OP_T dc.w opcode_5d-OP_T dc.w opcode_5e-OP_T dc.w opcode_5f-OP_T dc.w opcode_60-OP_T dc.w opcode_61-OP_T dc.w opcode_62-OP_T dc.w opcode_63-OP_T dc.w opcode_64-OP_T dc.w opcode_65-OP_T dc.w opcode_66-OP_T dc.w opcode_67-OP_T dc.w opcode_68-OP_T dc.w opcode_69-OP_T dc.w opcode_6a-OP_T dc.w opcode_6b-OP_T dc.w opcode_6c-OP_T dc.w opcode_6d-OP_T dc.w opcode_6e-OP_T dc.w opcode_6f-OP_T dc.w opcode_70-OP_T dc.w opcode_71-OP_T dc.w opcode_72-OP_T dc.w opcode_73-OP_T dc.w opcode_74-OP_T dc.w opcode_75-OP_T dc.w opcode_76-OP_T dc.w opcode_77-OP_T dc.w opcode_78-OP_T dc.w opcode_79-OP_T dc.w opcode_7a-OP_T dc.w opcode_7b-OP_T dc.w opcode_7c-OP_T dc.w opcode_7d-OP_T dc.w opcode_7e-OP_T dc.w opcode_7f-OP_T dc.w opcode_80-OP_T dc.w opcode_81-OP_T dc.w opcode_82-OP_T dc.w opcode_83-OP_T dc.w opcode_84-OP_T dc.w opcode_85-OP_T dc.w opcode_86-OP_T dc.w opcode_87-OP_T dc.w opcode_88-OP_T dc.w opcode_89-OP_T dc.w opcode_8a-OP_T dc.w opcode_8b-OP_T dc.w opcode_8c-OP_T dc.w opcode_8d-OP_T dc.w opcode_8e-OP_T dc.w opcode_8f-OP_T dc.w opcode_90-OP_T dc.w opcode_91-OP_T dc.w opcode_92-OP_T dc.w opcode_93-OP_T dc.w opcode_94-OP_T dc.w opcode_95-OP_T dc.w opcode_96-OP_T dc.w opcode_97-OP_T dc.w opcode_98-OP_T dc.w opcode_99-OP_T dc.w opcode_9a-OP_T dc.w opcode_9b-OP_T dc.w opcode_9c-OP_T dc.w opcode_9d-OP_T dc.w opcode_9e-OP_T dc.w opcode_9f-OP_T dc.w opcode_a0-OP_T dc.w opcode_a1-OP_T dc.w opcode_a2-OP_T dc.w opcode_a3-OP_T dc.w opcode_a4-OP_T dc.w opcode_a5-OP_T dc.w opcode_a6-OP_T dc.w opcode_a7-OP_T dc.w opcode_a8-OP_T dc.w opcode_a9-OP_T dc.w opcode_aa-OP_T dc.w opcode_ab-OP_T dc.w opcode_ac-OP_T dc.w opcode_ad-OP_T dc.w opcode_ae-OP_T dc.w opcode_af-OP_T dc.w opcode_b0-OP_T dc.w opcode_b1-OP_T dc.w opcode_b2-OP_T dc.w opcode_b3-OP_T dc.w opcode_b4-OP_T dc.w opcode_b5-OP_T dc.w opcode_b6-OP_T dc.w opcode_b7-OP_T dc.w opcode_b8-OP_T dc.w opcode_b9-OP_T dc.w opcode_ba-OP_T dc.w opcode_bb-OP_T dc.w opcode_bc-OP_T dc.w opcode_bd-OP_T dc.w opcode_be-OP_T dc.w opcode_bf-OP_T dc.w opcode_c0-OP_T dc.w opcode_c1-OP_T dc.w opcode_c2-OP_T dc.w opcode_c3-OP_T dc.w opcode_c4-OP_T dc.w opcode_c5-OP_T dc.w opcode_c6-OP_T dc.w opcode_c7-OP_T dc.w opcode_c8-OP_T dc.w opcode_c9-OP_T dc.w opcode_ca-OP_T dc.w opcode_cb-OP_T dc.w opcode_cc-OP_T dc.w opcode_cd-OP_T dc.w opcode_ce-OP_T dc.w opcode_cf-OP_T dc.w opcode_d0-OP_T dc.w opcode_d1-OP_T dc.w opcode_d2-OP_T dc.w opcode_d3-OP_T dc.w opcode_d4-OP_T dc.w opcode_d5-OP_T dc.w opcode_d6-OP_T dc.w opcode_d7-OP_T dc.w opcode_d8-OP_T dc.w opcode_d9-OP_T dc.w opcode_da-OP_T dc.w opcode_db-OP_T dc.w opcode_dc-OP_T dc.w opcode_dd-OP_T dc.w opcode_de-OP_T dc.w opcode_df-OP_T dc.w opcode_e0-OP_T dc.w opcode_e1-OP_T dc.w opcode_e2-OP_T dc.w opcode_e3-OP_T dc.w opcode_e4-OP_T dc.w opcode_e5-OP_T dc.w opcode_e6-OP_T dc.w opcode_e7-OP_T dc.w opcode_e8-OP_T dc.w opcode_e9-OP_T dc.w opcode_ea-OP_T dc.w opcode_eb-OP_T dc.w opcode_ec-OP_T dc.w opcode_ed-OP_T dc.w opcode_ee-OP_T dc.w opcode_ef-OP_T dc.w opcode_f0-OP_T dc.w opcode_f1-OP_T dc.w opcode_f2-OP_T dc.w opcode_f3-OP_T dc.w opcode_f4-OP_T dc.w opcode_f5-OP_T dc.w opcode_f6-OP_T dc.w opcode_f7-OP_T dc.w opcode_f8-OP_T dc.w opcode_f9-OP_T dc.w opcode_fa-OP_T dc.w opcode_fb-OP_T dc.w opcode_fc-OP_T dc.w opcode_fd-OP_T dc.w opcode_fe-OP_T dc.w opcode_ff-OP_T OPMODE_TABLE_D: OP_T_D: dc.w opcode_00-OP_T_D dc.w opcode_01-OP_T_D dc.w opcode_02-OP_T_D dc.w opcode_03-OP_T_D dc.w opcode_04-OP_T_D dc.w opcode_05-OP_T_D dc.w opcode_06-OP_T_D dc.w opcode_07-OP_T_D dc.w opcode_08-OP_T_D dc.w opcode_09-OP_T_D dc.w opcode_0a-OP_T_D dc.w opcode_0b-OP_T_D dc.w opcode_0c-OP_T_D dc.w opcode_0d-OP_T_D dc.w opcode_0e-OP_T_D dc.w opcode_0f-OP_T_D dc.w opcode_10-OP_T_D dc.w opcode_11-OP_T_D dc.w opcode_12-OP_T_D dc.w opcode_13-OP_T_D dc.w opcode_14-OP_T_D dc.w opcode_15-OP_T_D dc.w opcode_16-OP_T_D dc.w opcode_17-OP_T_D dc.w opcode_18-OP_T_D dc.w opcode_19-OP_T_D dc.w opcode_1a-OP_T_D dc.w opcode_1b-OP_T_D dc.w opcode_1c-OP_T_D dc.w opcode_1d-OP_T_D dc.w opcode_1e-OP_T_D dc.w opcode_1f-OP_T_D dc.w opcode_20-OP_T_D dc.w opcode_21-OP_T_D dc.w opcode_22-OP_T_D dc.w opcode_23-OP_T_D dc.w opcode_24-OP_T_D dc.w opcode_25-OP_T_D dc.w opcode_26-OP_T_D dc.w opcode_27-OP_T_D dc.w opcode_28-OP_T_D dc.w opcode_29-OP_T_D dc.w opcode_2a-OP_T_D dc.w opcode_2b-OP_T_D dc.w opcode_2c-OP_T_D dc.w opcode_2d-OP_T_D dc.w opcode_2e-OP_T_D dc.w opcode_2f-OP_T_D dc.w opcode_30-OP_T_D dc.w opcode_31-OP_T_D dc.w opcode_32-OP_T_D dc.w opcode_33-OP_T_D dc.w opcode_34-OP_T_D dc.w opcode_35-OP_T_D dc.w opcode_36-OP_T_D dc.w opcode_37-OP_T_D dc.w opcode_38-OP_T_D dc.w opcode_39-OP_T_D dc.w opcode_3a-OP_T_D dc.w opcode_3b-OP_T_D dc.w opcode_3c-OP_T_D dc.w opcode_3d-OP_T_D dc.w opcode_3e-OP_T_D dc.w opcode_3f-OP_T_D dc.w opcode_40-OP_T_D dc.w opcode_41-OP_T_D dc.w opcode_42-OP_T_D dc.w opcode_43-OP_T_D dc.w opcode_44-OP_T_D dc.w opcode_45-OP_T_D dc.w opcode_46-OP_T_D dc.w opcode_47-OP_T_D dc.w opcode_48-OP_T_D dc.w opcode_49-OP_T_D dc.w opcode_4a-OP_T_D dc.w opcode_4b-OP_T_D dc.w opcode_4c-OP_T_D dc.w opcode_4d-OP_T_D dc.w opcode_4e-OP_T_D dc.w opcode_4f-OP_T_D dc.w opcode_50-OP_T_D dc.w opcode_51-OP_T_D dc.w opcode_52-OP_T_D dc.w opcode_53-OP_T_D dc.w opcode_54-OP_T_D dc.w opcode_55-OP_T_D dc.w opcode_56-OP_T_D dc.w opcode_57-OP_T_D dc.w opcode_58-OP_T_D dc.w opcode_59-OP_T_D dc.w opcode_5a-OP_T_D dc.w opcode_5b-OP_T_D dc.w opcode_5c-OP_T_D dc.w opcode_5d-OP_T_D dc.w opcode_5e-OP_T_D dc.w opcode_5f-OP_T_D dc.w opcode_60-OP_T_D dc.w opcode_61_D-OP_T_D dc.w opcode_62-OP_T_D dc.w opcode_63-OP_T_D dc.w opcode_64-OP_T_D dc.w opcode_65_D-OP_T_D dc.w opcode_66-OP_T_D dc.w opcode_67-OP_T_D dc.w opcode_68-OP_T_D dc.w opcode_69_D-OP_T_D dc.w opcode_6a-OP_T_D dc.w opcode_6b-OP_T_D dc.w opcode_6c-OP_T_D dc.w opcode_6d_D-OP_T_D dc.w opcode_6e-OP_T_D dc.w opcode_6f-OP_T_D dc.w opcode_70-OP_T_D dc.w opcode_71_D-OP_T_D dc.w opcode_72-OP_T_D dc.w opcode_73-OP_T_D dc.w opcode_74-OP_T_D dc.w opcode_75_D-OP_T_D dc.w opcode_76-OP_T_D dc.w opcode_77-OP_T_D dc.w opcode_78-OP_T_D dc.w opcode_79_D-OP_T_D dc.w opcode_7a-OP_T_D dc.w opcode_7b-OP_T_D dc.w opcode_7c-OP_T_D dc.w opcode_7d_D-OP_T_D dc.w opcode_7e-OP_T_D dc.w opcode_7f-OP_T_D dc.w opcode_80-OP_T_D dc.w opcode_81-OP_T_D dc.w opcode_82-OP_T_D dc.w opcode_83-OP_T_D dc.w opcode_84-OP_T_D dc.w opcode_85-OP_T_D dc.w opcode_86-OP_T_D dc.w opcode_87-OP_T_D dc.w opcode_88-OP_T_D dc.w opcode_89-OP_T_D dc.w opcode_8a-OP_T_D dc.w opcode_8b-OP_T_D dc.w opcode_8c-OP_T_D dc.w opcode_8d-OP_T_D dc.w opcode_8e-OP_T_D dc.w opcode_8f-OP_T_D dc.w opcode_90-OP_T_D dc.w opcode_91-OP_T_D dc.w opcode_92-OP_T_D dc.w opcode_93-OP_T_D dc.w opcode_94-OP_T_D dc.w opcode_95-OP_T_D dc.w opcode_96-OP_T_D dc.w opcode_97-OP_T_D dc.w opcode_98-OP_T_D dc.w opcode_99-OP_T_D dc.w opcode_9a-OP_T_D dc.w opcode_9b-OP_T_D dc.w opcode_9c-OP_T_D dc.w opcode_9d-OP_T_D dc.w opcode_9e-OP_T_D dc.w opcode_9f-OP_T_D dc.w opcode_a0-OP_T_D dc.w opcode_a1-OP_T_D dc.w opcode_a2-OP_T_D dc.w opcode_a3-OP_T_D dc.w opcode_a4-OP_T_D dc.w opcode_a5-OP_T_D dc.w opcode_a6-OP_T_D dc.w opcode_a7-OP_T_D dc.w opcode_a8-OP_T_D dc.w opcode_a9-OP_T_D dc.w opcode_aa-OP_T_D dc.w opcode_ab-OP_T_D dc.w opcode_ac-OP_T_D dc.w opcode_ad-OP_T_D dc.w opcode_ae-OP_T_D dc.w opcode_af-OP_T_D dc.w opcode_b0-OP_T_D dc.w opcode_b1-OP_T_D dc.w opcode_b2-OP_T_D dc.w opcode_b3-OP_T_D dc.w opcode_b4-OP_T_D dc.w opcode_b5-OP_T_D dc.w opcode_b6-OP_T_D dc.w opcode_b7-OP_T_D dc.w opcode_b8-OP_T_D dc.w opcode_b9-OP_T_D dc.w opcode_ba-OP_T_D dc.w opcode_bb-OP_T_D dc.w opcode_bc-OP_T_D dc.w opcode_bd-OP_T_D dc.w opcode_be-OP_T_D dc.w opcode_bf-OP_T_D dc.w opcode_c0-OP_T_D dc.w opcode_c1-OP_T_D dc.w opcode_c2-OP_T_D dc.w opcode_c3-OP_T_D dc.w opcode_c4-OP_T_D dc.w opcode_c5-OP_T_D dc.w opcode_c6-OP_T_D dc.w opcode_c7-OP_T_D dc.w opcode_c8-OP_T_D dc.w opcode_c9-OP_T_D dc.w opcode_ca-OP_T_D dc.w opcode_cb-OP_T_D dc.w opcode_cc-OP_T_D dc.w opcode_cd-OP_T_D dc.w opcode_ce-OP_T_D dc.w opcode_cf-OP_T_D dc.w opcode_d0-OP_T_D dc.w opcode_d1-OP_T_D dc.w opcode_d2-OP_T_D dc.w opcode_d3-OP_T_D dc.w opcode_d4-OP_T_D dc.w opcode_d5-OP_T_D dc.w opcode_d6-OP_T_D dc.w opcode_d7-OP_T_D dc.w opcode_d8-OP_T_D dc.w opcode_d9-OP_T_D dc.w opcode_da-OP_T_D dc.w opcode_db-OP_T_D dc.w opcode_dc-OP_T_D dc.w opcode_dd-OP_T_D dc.w opcode_de-OP_T_D dc.w opcode_df-OP_T_D dc.w opcode_e0-OP_T_D dc.w opcode_e1_D-OP_T_D dc.w opcode_e2-OP_T_D dc.w opcode_e3-OP_T_D dc.w opcode_e4-OP_T_D dc.w opcode_e5_D-OP_T_D dc.w opcode_e6-OP_T_D dc.w opcode_e7-OP_T_D dc.w opcode_e8-OP_T_D dc.w opcode_e9_D-OP_T_D dc.w opcode_ea-OP_T_D dc.w opcode_eb_D-OP_T_D dc.w opcode_ec-OP_T_D dc.w opcode_ed_D-OP_T_D dc.w opcode_ee-OP_T_D dc.w opcode_ef-OP_T_D dc.w opcode_f0-OP_T_D dc.w opcode_f1_D-OP_T_D dc.w opcode_f2-OP_T_D dc.w opcode_f3-OP_T_D dc.w opcode_f4-OP_T_D dc.w opcode_f5_D-OP_T_D dc.w opcode_f6-OP_T_D dc.w opcode_f7-OP_T_D dc.w opcode_f8-OP_T_D dc.w opcode_f9_D-OP_T_D dc.w opcode_fa-OP_T_D dc.w opcode_fb-OP_T_D dc.w opcode_fc-OP_T_D dc.w opcode_fd_D-OP_T_D dc.w opcode_fe-OP_T_D dc.w opcode_ff-OP_T_D cycles: _cycles: ; dc.l for the world outside, equ for internal use cy_CIM equ 2 cy_NOP equ 2 cy_NOP2 equ 2 cy_NOP3 equ 3 cy_NOP4 equ 4 cy_SKW equ 4 cy_BRK equ 7 cy_Sub equ 6 cy_Bcc equ 2 cy_Bcc1 equ 3 cy_Bcc2 equ 4 cy_JmpAbs equ 3 cy_JmpInd equ 5 cy_IndX equ 6 ; indirect X cy_IndY equ 5 ; indirect Y cy_IndY2 equ 6 ; indirect Y (+) cy_IndX_RW equ 8 ; indirect X read/write ( all inofficial ) cy_IndY_RW equ 8 ; indirect Y read/write ( all inofficial ) cy_Abs equ 4 ; absolute cy_Abs_RW equ 6 ; absolute read/write cy_AbsX equ 4 ; absolute X cy_AbsX2 equ 5 ; absolute X (+) cy_AbsX_RW equ 7 ; absolute X read/write cy_AbsY equ 4 ; absolute Y cy_AbsY2 equ 5 ; absolute X (+) cy_AbsY_RW equ 7 ; absolute Y read/write ( all inofficial ) cy_ZP equ 3 ; zero page cy_ZP_RW equ 5 ; zero page read/write cy_ZPX equ 4 ; zero page X cy_ZPX_RW equ 6 ; zero page X read/write cy_ZPY equ 4 ; zero page X cy_Imm equ 2 ; immediate cy_FlagCS equ 2 ; flag clear/set cy_RegChg equ 2 ; register only manipulation cy_RegPH equ 3 ; push register to stack cy_RegPL equ 4 ; pull register from stack dc.l cy_BRK,cy_IndX,cy_CIM,cy_IndX_RW,cy_NOP3,cy_ZP,cy_ZP_RW,cy_ZP_RW dc.l cy_RegPH,cy_Imm,cy_RegChg,cy_Imm,cy_SKW,cy_Abs,cy_Abs_RW,cy_Abs_RW dc.l cy_Bcc,cy_IndY,cy_CIM,cy_IndY_RW,cy_NOP4,cy_ZPX,cy_ZPX_RW,cy_ZPX_RW dc.l cy_FlagCS,cy_AbsY,cy_NOP,cy_AbsY_RW,cy_SKW,cy_AbsX,cy_AbsX_RW,cy_AbsX_RW dc.l cy_Sub,cy_IndX,cy_CIM,cy_IndX_RW,cy_ZP,cy_ZP,cy_ZP_RW,cy_ZP_RW dc.l cy_RegPL,cy_Imm,cy_RegChg,cy_Imm,cy_Abs,cy_Abs,cy_Abs_RW,cy_Abs_RW dc.l cy_Bcc,cy_IndY,cy_CIM,cy_IndY_RW,cy_NOP4,cy_ZPX,cy_ZPX_RW,cy_ZPX_RW dc.l cy_FlagCS,cy_AbsY,cy_NOP,cy_AbsY_RW,cy_SKW,cy_AbsX,cy_AbsX_RW,cy_AbsX_RW dc.l cy_Sub,cy_IndX,cy_CIM,cy_IndX_RW,cy_NOP3,cy_ZP,cy_ZP_RW,cy_ZP_RW dc.l cy_RegPH,cy_Imm,cy_RegChg,cy_Imm,cy_JmpAbs,cy_Abs,cy_Abs_RW,cy_Abs_RW dc.l cy_Bcc,cy_IndY,cy_CIM,cy_IndY_RW,cy_NOP4,cy_ZPX,cy_ZPX_RW,cy_ZPX_RW dc.l cy_FlagCS,cy_AbsY,cy_NOP,cy_AbsY_RW,cy_SKW,cy_AbsX,cy_AbsX_RW,cy_AbsX_RW dc.l cy_Sub,cy_IndX,cy_CIM,cy_IndX_RW,cy_NOP3,cy_ZP,cy_ZP_RW,cy_ZP_RW dc.l cy_RegPL,cy_Imm,cy_RegChg,cy_Imm,cy_JmpInd,cy_Abs,cy_Abs_RW,cy_Abs_RW dc.l cy_Bcc,cy_IndY,cy_CIM,cy_IndY_RW,cy_NOP4,cy_ZPX,cy_ZPX_RW,cy_ZPX_RW dc.l cy_FlagCS,cy_AbsY,cy_NOP,cy_AbsY_RW,cy_SKW,cy_AbsX,cy_AbsX_RW,cy_AbsX_RW dc.l cy_NOP2,cy_IndX,cy_NOP2,cy_IndX,cy_ZP,cy_ZP,cy_ZP,cy_ZP dc.l cy_RegChg,cy_NOP2,cy_RegChg,cy_Imm,cy_Abs,cy_Abs,cy_Abs,cy_Abs dc.l cy_Bcc,cy_IndY2,cy_CIM,cy_IndY2,cy_ZPX,cy_ZPX,cy_ZPY,cy_ZPY dc.l cy_RegChg,cy_IndY2,cy_RegChg,cy_IndY2,cy_AbsX2,cy_AbsX2,cy_IndY2,cy_IndY2 dc.l cy_Imm,cy_IndX,cy_Imm,cy_IndX,cy_ZP,cy_ZP,cy_ZP,cy_ZP dc.l cy_RegChg,cy_Imm,cy_RegChg,cy_Imm,cy_Abs,cy_Abs,cy_Abs,cy_Abs dc.l cy_Bcc,cy_IndY,cy_CIM,cy_IndY,cy_ZPX,cy_ZPX,cy_ZPY,cy_ZPY dc.l cy_FlagCS,cy_AbsY,cy_RegChg,cy_AbsY,cy_AbsX,cy_AbsX,cy_AbsY,cy_AbsY dc.l cy_Imm,cy_IndX,cy_NOP2,cy_IndX_RW,cy_ZP,cy_ZP,cy_ZP_RW,cy_ZP_RW dc.l cy_RegChg,cy_Imm,cy_RegChg,cy_Imm,cy_Abs,cy_Abs,cy_Abs_RW,cy_Abs_RW dc.l cy_Bcc,cy_IndY,cy_CIM,cy_IndY_RW,cy_NOP4,cy_ZPX,cy_ZPX_RW,cy_ZPX_RW dc.l cy_FlagCS,cy_AbsY,cy_NOP,cy_AbsY_RW,cy_SKW,cy_AbsX,cy_AbsX_RW,cy_AbsX_RW dc.l cy_Imm,cy_IndX,cy_NOP2,cy_IndX_RW,cy_ZP,cy_ZP,cy_ZP_RW,cy_ZP_RW dc.l cy_RegChg,cy_Imm,cy_NOP,cy_Imm,cy_Abs,cy_Abs,cy_Abs_RW,cy_Abs_RW dc.l cy_Bcc,cy_IndY,cy_CIM,cy_IndY_RW,cy_NOP4,cy_ZPX,cy_ZPX_RW,cy_ZPX_RW dc.l cy_FlagCS,cy_AbsY,cy_NOP,cy_AbsY_RW,cy_SKW,cy_AbsX,cy_AbsX_RW,cy_AbsX_RW
.global s_prepare_buffers s_prepare_buffers: push %r11 push %r12 push %r14 push %r9 push %rcx push %rdi push %rsi lea addresses_normal_ht+0x9e54, %rcx nop nop nop nop nop cmp $20548, %r12 movups (%rcx), %xmm0 vpextrq $1, %xmm0, %rdi nop sub %r9, %r9 lea addresses_WT_ht+0x6334, %rsi lea addresses_UC_ht+0x163b9, %rdi nop nop nop nop nop and %r14, %r14 mov $31, %rcx rep movsl sub $22795, %rsi lea addresses_WC_ht+0x17718, %rsi nop inc %r12 movb (%rsi), %cl dec %r14 lea addresses_normal_ht+0x599c, %r14 add $56009, %r11 movl $0x61626364, (%r14) nop nop nop nop sub $41097, %r9 pop %rsi pop %rdi pop %rcx pop %r9 pop %r14 pop %r12 pop %r11 ret .global s_faulty_load s_faulty_load: push %r11 push %r13 push %r14 push %rbp push %rcx push %rdi push %rsi // REPMOV lea addresses_PSE+0x1e754, %rsi lea addresses_PSE+0xa3f4, %rdi nop nop sub $41211, %rbp mov $99, %rcx rep movsb nop inc %rcx // Faulty Load lea addresses_US+0x14754, %r14 nop nop nop cmp %r13, %r13 vmovaps (%r14), %ymm7 vextracti128 $1, %ymm7, %xmm7 vpextrq $0, %xmm7, %rbp lea oracles, %r14 and $0xff, %rbp shlq $12, %rbp mov (%r14,%rbp,1), %rbp pop %rsi pop %rdi pop %rcx pop %rbp pop %r14 pop %r13 pop %r11 ret /* <gen_faulty_load> [REF] {'OP': 'LOAD', 'src': {'size': 4, 'NT': False, 'type': 'addresses_US', 'same': True, 'AVXalign': False, 'congruent': 0}} {'OP': 'REPM', 'src': {'same': False, 'type': 'addresses_PSE', 'congruent': 9}, 'dst': {'same': False, 'type': 'addresses_PSE', 'congruent': 4}} [Faulty Load] {'OP': 'LOAD', 'src': {'size': 32, 'NT': False, 'type': 'addresses_US', 'same': True, 'AVXalign': True, 'congruent': 0}} <gen_prepare_buffer> {'OP': 'LOAD', 'src': {'size': 16, 'NT': False, 'type': 'addresses_normal_ht', 'same': False, 'AVXalign': False, 'congruent': 8}} {'OP': 'REPM', 'src': {'same': False, 'type': 'addresses_WT_ht', 'congruent': 4}, 'dst': {'same': False, 'type': 'addresses_UC_ht', 'congruent': 0}} {'OP': 'LOAD', 'src': {'size': 1, 'NT': False, 'type': 'addresses_WC_ht', 'same': False, 'AVXalign': True, 'congruent': 0}} {'OP': 'STOR', 'dst': {'size': 4, 'NT': False, 'type': 'addresses_normal_ht', 'same': False, 'AVXalign': False, 'congruent': 3}} {'49': 362, '00': 233, '33': 582} 00 49 00 33 49 33 00 00 33 00 49 00 33 33 49 33 00 00 33 33 33 49 33 49 00 33 33 33 33 00 33 33 49 33 33 49 33 33 49 00 00 33 49 49 33 49 33 00 33 00 00 49 33 33 33 49 33 33 33 00 33 49 00 33 33 49 33 33 00 49 33 49 33 00 49 49 00 33 33 00 33 00 00 00 33 33 49 49 00 33 33 00 33 33 33 49 33 33 33 00 33 49 00 33 33 33 33 49 33 49 49 33 33 49 00 00 33 49 49 33 00 49 33 00 00 49 00 33 49 33 33 33 00 49 49 33 00 33 33 33 33 00 00 33 49 49 33 00 49 00 33 49 33 33 00 33 33 49 00 49 33 33 00 00 00 00 33 33 49 49 00 49 49 49 33 00 49 00 33 49 33 49 33 33 49 33 33 33 49 33 49 49 49 33 33 33 33 33 49 00 33 33 33 49 49 49 33 00 00 00 49 33 49 49 00 49 33 49 49 49 49 00 00 00 33 49 33 49 33 33 33 33 33 33 00 33 33 33 00 33 00 33 33 33 33 33 49 49 49 00 49 49 33 33 49 33 33 33 00 00 00 49 33 33 33 49 33 00 49 33 33 00 33 49 49 33 33 33 33 33 49 33 33 33 49 33 33 49 49 33 33 33 49 33 49 49 33 33 33 00 33 33 33 33 49 00 00 33 00 00 33 49 00 33 49 00 49 33 49 33 33 33 00 49 33 49 49 33 33 33 33 00 00 49 49 00 33 49 49 33 49 49 33 00 49 33 33 49 49 49 33 49 49 33 33 49 33 00 33 00 33 49 49 33 49 33 33 33 33 33 00 33 00 33 00 33 33 00 00 49 33 00 33 33 00 00 33 49 33 33 33 00 49 33 33 33 33 33 49 33 33 49 33 33 33 00 49 49 49 49 33 49 49 49 49 49 33 49 49 00 33 33 33 00 00 33 33 33 33 33 49 49 33 33 00 33 33 33 49 33 00 33 33 49 49 00 00 33 00 33 49 33 33 33 33 33 33 00 33 49 33 00 00 33 00 33 00 33 33 49 33 33 33 49 49 00 33 33 49 00 00 33 33 49 33 49 33 00 49 33 33 33 33 00 49 49 33 33 49 49 49 33 49 33 00 00 49 49 49 49 49 49 49 49 49 49 33 49 33 00 33 33 33 00 33 49 33 00 49 33 00 00 49 33 33 33 33 49 49 33 33 49 33 00 00 33 33 49 49 00 49 33 33 33 33 33 49 00 00 00 00 49 00 00 33 33 49 33 33 33 49 49 49 33 33 00 00 33 49 33 00 33 49 49 49 33 33 33 33 33 33 33 49 49 33 00 49 33 33 00 00 33 49 33 33 33 33 33 00 49 00 33 00 49 33 49 33 00 33 00 33 49 33 33 33 33 33 49 33 49 00 33 33 00 33 49 33 33 33 33 33 49 33 49 49 33 49 33 33 49 49 33 33 49 33 49 49 33 49 49 33 33 49 33 00 33 33 33 33 00 49 49 33 49 49 33 00 49 49 33 33 49 33 00 49 00 33 33 33 49 49 33 49 49 00 49 49 33 33 49 33 49 33 00 33 49 33 33 49 33 49 33 33 33 33 00 33 33 49 00 33 33 33 33 33 00 00 33 49 00 00 49 33 33 33 49 33 33 33 33 33 49 49 33 00 49 00 49 49 49 00 00 00 00 33 00 00 00 00 33 33 49 00 00 33 00 49 33 33 33 49 49 00 00 00 33 49 49 49 00 00 49 33 00 49 33 33 00 00 33 49 49 49 33 49 33 33 33 00 33 33 49 49 33 00 00 49 33 49 33 49 33 00 33 00 33 49 33 00 49 33 00 33 49 00 00 49 33 49 49 33 49 33 00 00 33 49 49 49 00 33 33 49 49 49 00 49 33 49 49 49 33 33 33 49 00 33 00 33 33 49 33 33 00 49 33 33 33 33 33 49 49 49 33 49 49 33 33 49 00 49 33 00 00 49 00 33 00 00 49 49 33 33 49 33 49 49 33 33 33 33 33 49 33 49 33 49 49 33 33 49 00 00 33 33 33 00 49 49 00 33 33 33 33 33 33 33 49 33 49 33 33 49 33 33 00 00 33 33 49 33 49 33 33 49 33 00 49 33 33 49 33 49 33 00 49 49 49 33 33 49 49 00 33 49 00 49 00 33 33 00 33 33 33 49 33 33 00 49 49 33 49 33 49 49 33 49 33 49 49 00 00 33 49 00 33 33 33 33 49 */
; A037513: Base-4 digits are, in order, the first n terms of the periodic sequence with initial period 2,0,1. ; 2,8,33,134,536,2145,8582,34328,137313,549254,2197016,8788065,35152262,140609048,562436193,2249744774,8998979096,35995916385,143983665542,575934662168,2303738648673,9214954594694,36859818378776,147439273515105,589757094060422,2359028376241688,9436113504966753,37744454019867014,150977816079468056,603911264317872225,2415645057271488902,9662580229085955608,38650320916343822433,154601283665375289734,618405134661501158936,2473620538646004635745,9894482154584018542982,39577928618336074171928,158311714473344296687713,633246857893377186750854,2532987431573508747003416,10131949726294034988013665,40527798905176139952054662,162111195620704559808218648,648444782482818239232874593,2593779129931272956931498374,10375116519725091827725993496,41500466078900367310903973985,166001864315601469243615895942,664007457262405876974463583768,2656029829049623507897854335073,10624119316198494031591417340294,42496477264793976126365669361176,169985909059175904505462677444705,679943636236703618021850709778822,2719774544946814472087402839115288,10879098179787257888349611356461153,43516392719149031553398445425844614,174065570876596126213593781703378456,696262283506384504854375126813513825 mov $1,4 pow $1,$0 mul $1,44 div $1,21 mov $0,$1
BITS 64 ;TEST_FILE_META_BEGIN ;TEST_TYPE=TEST_F ;TEST_IGNOREFLAGS= ;TEST_FILE_META_END ; allocate 16 byte aligned stack space for the packed values lea rcx, [rsp-33] and rcx, 0xfffffffffffffff0 ; load a 128 bit value into xmm0 mov DWORD [rcx], 0x55555555 mov DWORD [rcx+4], 0x14530451 mov DWORD [rcx+8], 0x1badb002 mov DWORD [rcx+12], 0xf0f0f0f0 movaps xmm0, [rcx] lea rcx, [rcx+16] ; load a 128 bit value into xmm1 mov DWORD [rcx], 0xaaaaaaaa mov DWORD [rcx+4], 0xcafebabe mov DWORD [rcx+8], 0x2badb002 mov DWORD [rcx+12], 0x0e0e0e0e movaps xmm1, [rcx] ;TEST_BEGIN_RECORDING paddb xmm0, xmm1 ;TEST_END_RECORDING xor ecx, ecx cvtsi2sd xmm0, ecx cvtsi2sd xmm1, ecx
/***************************************************************************** * * Rokko: Integrated Interface for libraries of eigenvalue decomposition * * Copyright (C) 2012-2020 Rokko Developers https://github.com/t-sakashita/rokko * * Distributed under the Boost Software License, Version 1.0. (See accompanying * file LICENSE_1_0.txt or copy at http://www.boost.org/LICENSE_1_0.txt) * *****************************************************************************/ #ifndef ROKKO_PARALLEL_DENSE_SOLVER_HPP #define ROKKO_PARALLEL_DENSE_SOLVER_HPP #include <rokko/factory.hpp> #include <rokko/matrix_major.hpp> #include <rokko/mapping_bc.hpp> #include <rokko/distributed_matrix.hpp> #include <rokko/eigen3.hpp> #include <rokko/utility/macro_join.hpp> #include <rokko/utility/timer.hpp> #include <rokko/parameters.hpp> namespace rokko { namespace detail { class pd_ev_base { public: virtual ~pd_ev_base() = default; virtual bool is_available_grid_major(grid_row_major_t const& grid_major) = 0; virtual bool is_available_grid_major(grid_col_major_t const& grid_major) = 0; virtual void initialize(int& argc, char**& argv) = 0; virtual void finalize() = 0; // float # eigenvalues/eigenvectors virtual parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<float, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<float, matrix_col_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<float, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<float, matrix_col_major>& eigvecs, parameters const& params) = 0; // float # only eigenvalues virtual parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) = 0; // complex float # eigenvalues/eigenvectors virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<std::complex<float>, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<std::complex<float>, matrix_col_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<std::complex<float>, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<std::complex<float>, matrix_col_major>& eigvecs, parameters const& params) = 0; // complex float # only eigenvalues virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) = 0; // double # eigenvalues/eigenvectors virtual parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<double, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<double, matrix_col_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<double, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<double, matrix_col_major>& eigvecs, parameters const& params) = 0; // double # only eigenvalues virtual parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) = 0; // complex double # eigenvalues/eigenvectors virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<std::complex<double>, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<std::complex<double>, matrix_col_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<std::complex<double>, matrix_row_major>& eigvecs, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<std::complex<double>, matrix_col_major>& eigvecs, parameters const& params) = 0; // complex double # only eigenvalues virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) = 0; virtual parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) = 0; virtual mapping_bc<matrix_col_major> default_mapping(int dim, grid const& g) const = 0; }; template<typename SOLVER> class pd_ev_wrapper : public pd_ev_base { using solver_type = SOLVER; public: pd_ev_wrapper() : solver_impl_() {} virtual ~pd_ev_wrapper() = default; bool is_available_grid_major(grid_row_major_t const& grid_major) override { return solver_impl_.is_available_grid_major(grid_major); } bool is_available_grid_major(grid_col_major_t const& grid_major) override { return solver_impl_.is_available_grid_major(grid_major); } void initialize(int& argc, char**& argv) override { solver_impl_.initialize(argc, argv); } void finalize() override { solver_impl_.finalize(); } // float # eigenvalues/eigenvectors parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<float, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<float, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<float, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<float, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } // float # only eigenvalues parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<float, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<float, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } // complex float # eigenvalues/eigenvectors parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<std::complex<float>, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::VectorXf& eigvals, distributed_matrix<std::complex<float>, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<std::complex<float>, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, distributed_matrix<std::complex<float>, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } // complex float # only eigenvalues parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::VectorXf& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<std::complex<float>, matrix_row_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<std::complex<float>, matrix_col_major>& mat, Eigen::RefVec<float>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } // double # eigenvalues/eigenvectors parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<double, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<double, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<double, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<double, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } // double # only eigenvalues parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<double, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<double, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } // complex double # eigenvalues/eigenvectors parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<std::complex<double>, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::VectorXd& eigvals, distributed_matrix<std::complex<double>, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<std::complex<double>, matrix_row_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, distributed_matrix<std::complex<double>, matrix_col_major>& eigvecs, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, eigvecs, params); } // complex double # only eigenvalues parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::VectorXd& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<std::complex<double>, matrix_row_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } parameters diagonalize(distributed_matrix<std::complex<double>, matrix_col_major>& mat, Eigen::RefVec<double>& eigvals, parameters const& params) override { return solver_impl_.diagonalize(mat, eigvals, params); } // default_mapping mapping_bc<matrix_col_major> default_mapping(int dim, grid const& g) const override { return solver_impl_.default_mapping(dim, g); } private: solver_type solver_impl_; }; using pd_solver_factory = factory<pd_ev_base>; } // end namespace detail class parallel_dense_ev { public: parallel_dense_ev(std::string const& solver_name) : solver_impl_(detail::pd_solver_factory::instance()->make_product(solver_name)), null_params() {}; parallel_dense_ev() : parallel_dense_ev(default_solver()) {} template <typename GRID_MAJOR> bool is_available_grid_major(GRID_MAJOR const& grid_major) { return solver_impl_->is_available_grid_major(grid_major); } void initialize(int& argc, char**& argv) { solver_impl_->initialize(argc, argv); } void finalize() { solver_impl_->finalize(); } // with parameters, eigenvalues/eigenvectors template<typename T, typename MATRIX_MAJOR, typename VEC> parameters diagonalize(distributed_matrix<T, MATRIX_MAJOR>& mat, VEC& eigvals, rokko::distributed_matrix<T, MATRIX_MAJOR>& eigvecs, parameters const& params) { return solver_impl_->diagonalize(mat, eigvals, eigvecs, params); } // with parameters, only eigenvalues template<typename T, typename MATRIX_MAJOR, typename VEC> parameters diagonalize(distributed_matrix<T, MATRIX_MAJOR>& mat, VEC& eigvals, parameters const& params) { return solver_impl_->diagonalize(mat, eigvals, params); } // no parameters, eigenvalues/eigenvectors template<typename T, typename MATRIX_MAJOR, typename VEC> parameters diagonalize(distributed_matrix<T, MATRIX_MAJOR>& mat, VEC& eigvals, rokko::distributed_matrix<T, MATRIX_MAJOR>& eigvecs) { return solver_impl_->diagonalize(mat, eigvals, eigvecs, null_params); } // no parameters, only eigenvalues template<typename T, typename MATRIX_MAJOR, typename VEC> parameters diagonalize(distributed_matrix<T, MATRIX_MAJOR>& mat, VEC& eigvals) { return diagonalize(mat, eigvals, null_params); } mapping_bc<matrix_col_major> default_mapping(int dim, grid const& g) const { return solver_impl_->default_mapping(dim, g); } static std::vector<std::string> solvers() { return detail::pd_solver_factory::product_names(); } static const std::string& default_solver() { return detail::pd_solver_factory::default_product_name(); } private: detail::pd_solver_factory::product_pointer_type solver_impl_; parameters null_params; std::string routine_; }; } // end namespace rokko #define ROKKO_REGISTER_PARALLEL_DENSE_SOLVER(solver, name, priority) \ namespace { namespace ROKKO_JOIN(register, __LINE__) { \ struct register_caller { \ using factory = rokko::detail::pd_solver_factory; \ using product = rokko::detail::pd_ev_wrapper<solver>; \ register_caller() { factory::instance()->register_creator<product>(name, priority); } \ } caller; \ } } #endif // ROKKO_PARALLEL_DENSE_SOLVER_HPP
.global s_prepare_buffers s_prepare_buffers: push %r10 push %r11 push %r13 push %r9 push %rdi push %rdx lea addresses_UC_ht+0x4202, %rdi nop nop nop nop nop sub %r9, %r9 mov (%rdi), %r10w nop add $6102, %r9 lea addresses_UC_ht+0x181f2, %r13 nop nop nop nop nop dec %r11 movups (%r13), %xmm4 vpextrq $0, %xmm4, %rdx nop nop nop nop and %r13, %r13 pop %rdx pop %rdi pop %r9 pop %r13 pop %r11 pop %r10 ret .global s_faulty_load s_faulty_load: push %r10 push %r8 push %rbp push %rcx push %rdi push %rdx push %rsi // Store lea addresses_RW+0x7036, %rdi nop nop nop nop nop inc %rdx movb $0x51, (%rdi) nop nop nop nop xor %rbp, %rbp // Store lea addresses_RW+0xb1f2, %rsi nop nop sub $5068, %r8 movl $0x51525354, (%rsi) nop nop nop add %rdi, %rdi // Faulty Load lea addresses_RW+0xb1f2, %r10 sub %r8, %r8 movb (%r10), %cl lea oracles, %rdi and $0xff, %rcx shlq $12, %rcx mov (%rdi,%rcx,1), %rcx pop %rsi pop %rdx pop %rdi pop %rcx pop %rbp pop %r8 pop %r10 ret /* <gen_faulty_load> [REF] {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_RW', 'NT': False, 'AVXalign': False, 'size': 32, 'congruent': 0}} {'OP': 'STOR', 'dst': {'same': False, 'type': 'addresses_RW', 'NT': False, 'AVXalign': False, 'size': 1, 'congruent': 0}} {'OP': 'STOR', 'dst': {'same': True, 'type': 'addresses_RW', 'NT': False, 'AVXalign': False, 'size': 4, 'congruent': 0}} [Faulty Load] {'OP': 'LOAD', 'src': {'same': True, 'type': 'addresses_RW', 'NT': False, 'AVXalign': False, 'size': 1, 'congruent': 0}} <gen_prepare_buffer> {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_UC_ht', 'NT': False, 'AVXalign': False, 'size': 2, 'congruent': 3}} {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_UC_ht', 'NT': False, 'AVXalign': False, 'size': 16, 'congruent': 11}} {'54': 21829} 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 */
; ;================================================================================================== ; HDSK DISK DRIVER ;================================================================================================== ; ; IO PORT ADDRESSES ; HDSK_IO .EQU $FD ; HDSK_CMDNONE .EQU 0 HDSK_CMDRESET .EQU 1 HDSK_CMDREAD .EQU 2 HDSK_CMDWRITE .EQU 3 HDSK_CMDPARAM .EQU 4 ; ; HDSK DEVICE CONFIGURATION ; HDSK_DEVCNT .EQU 2 ; NUMBER OF HDSK DEVICES SUPPORTED HDSK_CFGSIZ .EQU 6 ; SIZE OF CFG TBL ENTRIES ; HDSK_DEV .EQU 0 ; OFFSET OF DEVICE NUMBER (BYTE) HDSK_STAT .EQU 1 ; OFFSET OF STATUS (BYTE) HDSK_LBA .EQU 2 ; OFFSET OF LBA (DWORD) ; HDSK_CFGTBL: ; DEVICE 0 .DB 0 ; DRIVER DEVICE NUMBER .DB 0 ; DEVICE STATUS .DW 0,0 ; CURRENT LBA ; DEVICE 1 .DB 1 ; DEVICE NUMBER .DB 0 ; DEVICE STATUS .DW 0,0 ; CURRENT LBA ; #IF ($ - HDSK_CFGTBL) != (HDSK_DEVCNT * HDSK_CFGSIZ) .ECHO "*** INVALID HDSK CONFIG TABLE ***\n" #ENDIF ; .DB $FF ; END MARKER ; ; STATUS ; HDSK_STOK .EQU 0 ; OK HDSK_STNOTRDY .EQU -1 ; NOT READY ; ; ; HDSK_INIT: CALL NEWLINE ; FORMATTING PRTS("HDSK:$") PRTS(" DEVICES=$") LD A,HDSK_DEVCNT CALL PRTDECB ; ; SETUP THE DISPATCH TABLE ENTRIES ; XOR A ; ZERO ACCUM LD (HDSK_CURDEV),A ; INIT CURRENT DEVICE NUM LD IY,HDSK_CFGTBL ; START OF DEV CFG TABLE HDSK_INIT0: CALL HDSK_PROBE ; HARDWARE PROBE JR NZ,HDSK_INIT1 ; SKIP DEVICE IF NOT PRESENT LD BC,HDSK_FNTBL ; BC := DRIVER FUNC TABLE ADDRESS PUSH IY ; CFG ENTRY POINTER POP DE ; ... TO DE CALL DIO_ADDENT ; ADD ENTRY TO GLOBAL DISK TABLE CALL HDSK_INITDEV ; PERFORM DEVICE INITIALIZATION HDSK_INIT1: LD BC,HDSK_CFGSIZ ; SIZE OF CFG ENTRY ADD IY,BC ; BUMP IY TO NEXT ENTRY LD HL,HDSK_CURDEV ; POINT TO CURRENT DEVICE INC (HL) ; AND INCREMENT IT LD A,(IY) ; GET FIRST BYTE OF ENTRY INC A ; TEST FOR END OF TABLE ($FF) JR NZ,HDSK_INIT0 ; IF NOT, LOOP ; XOR A ; INIT SUCCEEDED RET ; RETURN ; ; PROBE FOR DEVICE EXISTENCE ; HDSK_PROBE: XOR A ; SIGNAL SUCCESS RET ; AND DONE ; ; INITIALIZE DEVICE ; HDSK_INITDEV: LD (IY+HDSK_STAT),HDSK_STNOTRDY ; STATUS := NOT READY XOR A ; CLEAR ACCUM LD (IY+HDSK_LBA+0),A ; ZERO LBA LD (IY+HDSK_LBA+1),A ; ... LD (IY+HDSK_LBA+2),A ; ... LD (IY+HDSK_LBA+3),A ; ... XOR A ; SIGNAL SUCCESS (REDUNDANT) RET ; AND DONE ; ; DRIVER FUNCTION TABLE ; HDSK_FNTBL: .DW HDSK_STATUS .DW HDSK_RESET .DW HDSK_SEEK .DW HDSK_READ .DW HDSK_WRITE .DW HDSK_VERIFY .DW HDSK_FORMAT .DW HDSK_DEVICE .DW HDSK_MEDIA .DW HDSK_DEFMED .DW HDSK_CAP .DW HDSK_GEOM #IF (($ - HDSK_FNTBL) != (DIO_FNCNT * 2)) .ECHO "*** INVALID HDSK FUNCTION TABLE ***\n" #ENDIF ; ; ; HDSK_VERIFY: HDSK_FORMAT: HDSK_DEFMED: CALL PANIC ; INVALID SUB-FUNCTION ; ; ; HDSK_STATUS: LD A,(IY+HDSK_STAT) ; LOAD STATUS OR A ; SET FLAGS RET ; ; ; HDSK_RESET: JP HDSK_DSKRESET ; ; GET DISK CAPACITY ; RETURN DE:HL=BLOCK COUNT, BC=BLOCK SIZE ; SLICE C/H/S = 65/16/16 OR 16,640 TOTAL SECTORS ; ASSUME 8 SLICES, SO 16640 X 8 = 133,120 TOTAL SECTORS ; HDSK_CAP: LD DE,133120 >> 16 ; BLOCK COUNT MSW LD HL,133120 & $FFFF ; BLOCK COUNT LSW LD BC,512 ; 512 BYTE SECTOR XOR A ; SIGNAL SUCCESS RET ; ; ; HDSK_GEOM: ; FOR LBA, WE SIMULATE CHS ACCESS USING 16 HEADS AND 16 SECTORS ; RETURN HS:CC -> DE:HL, SET HIGH BIT OF D TO INDICATE LBA CAPABLE CALL HDSK_CAP ; GET TOTAL BLOCKS IN DE:HL, BLOCK SIZE TO BC LD L,H ; DIVIDE BY 256 FOR # TRACKS LD H,E ; ... HIGH BYTE DISCARDED, RESULT IN HL LD D,$80 | 16 ; HEADS / CYL = 16, SET LBA BIT LD E,16 ; SECTORS / TRACK = 16 XOR A ; SIGNAL SUCCESS RET ; ; ; HDSK_DEVICE: LD D,DIODEV_HDSK ; D := DEVICE TYPE LD E,(IY+HDSK_DEV) ; E := PHYSICAL DEVICE NUMBER LD C,%00000000 ; C := ATTRIBUTES, NON-REMOVABLE HARD DISK XOR A ; SIGNAL SUCCESS RET ; ; ; HDSK_MEDIA: LD E,MID_HD ; HARD DISK MEDIA LD D,0 ; D:0=0 MEANS NO MEDIA CHANGE XOR A ; SIGNAL SUCCESS RET ; ; ; HDSK_SEEK: BIT 7,D ; CHECK FOR LBA FLAG CALL Z,HB_CHS2LBA ; CLEAR MEANS CHS, CONVERT TO LBA RES 7,D ; CLEAR FLAG REGARDLESS (DOES NO HARM IF ALREADY LBA) LD (IY+HDSK_LBA+0),L ; SAVE NEW LBA LD (IY+HDSK_LBA+1),H ; ... LD (IY+HDSK_LBA+2),E ; ... LD (IY+HDSK_LBA+3),D ; ... XOR A ; SIGNAL SUCCESS RET ; AND RETURN ; ; ; HDSK_READ: LD A,HDSK_CMDREAD JR HDSK_RW ; ; ; HDSK_WRITE: LD A,HDSK_CMDWRITE JR HDSK_RW ; ; ; HDSK_RW: LD (HDSK_CMD),A ; SET COMMAND BYTE LD (HDSK_DMA),HL ; SAVE INITIAL DMA LD A,E ; SECTOR COUNT TO A OR A ; SET FLAGS RET Z ; ZERO SECTOR I/O, RETURN W/ E=0 & A=0 LD B,A ; INIT SECTOR DOWNCOUNTER LD C,0 ; INIT SECTOR READ/WRITE COUNT LD A,(IY+HDSK_DEV) ; GET DEVICE NUMBER LD (HDSK_DRV),A ; ... AND SET FIELD IN HDSK PARM BLOCK ; RESET HDSK INTERFACE IF NEEDED LD A,(IY+HDSK_STAT) ; GET CURRENT STATUS OR A ; SET FLAGS PUSH BC ; SAVE COUNTERS CALL NZ,HDSK_DSKRESET ; RESET IF NOT READY POP BC ; RESTORE COUNTERS JR NZ,HDSK_RW6 ; ABORT ON FAILURE HDSK_RW0: PUSH BC ; SAVE COUNTERS XOR A ; A = 0 LD (HDSK_RC),A ; CLEAR RETURN CODE ; CONVERT LBA HHHH:LLLL (4 BYTES) ; TO HDSK TRACK/SECTOR TTTT:SS (3 BYTES) ; SAVING TO HDSK PARM BLOCK ; (IY+HDSK_LBA+0) ==> (HDSK_SEC) LD A,(IY+HDSK_LBA+0) LD (HDSK_SEC),A ; (IY+HDSK_LBA+1) ==> (HDSK_TRK+0) LD A,(IY+HDSK_LBA+1) LD (HDSK_TRK+0),A ; (IY+HDSK_LBA+2) ==> (HDSK_TRK+1) LD A,(IY+HDSK_LBA+2) LD (HDSK_TRK+1),A ; EXECUTE COMMAND LD B,7 ; SIZE OF PARAMETER BLOCK LD HL,HDSK_PARMBLK ; ADDRESS OF PARAMETER BLOCK LD C,$FD ; HDSK CMD PORT OTIR ; SEND IT ; GET RESULT IN A,(C) ; GET RESULT CODE LD (HDSK_RC),A ; SAVE IT OR A ; SET FLAGS #IF (HDSKTRACE > 0) PUSH AF ; SAVE RETURN CODE #IF (HDSKTRACE == 1) CALL NZ,HDSK_PRT ; DIAGNOSE ERRORS ONLY #ENDIF #IF (HDSKTRACE >= 2) CALL HDSK_PRT ; DISPLAY ALL READ/WRITE RESULTS #ENDIF POP AF ; RESTORE RETURN CODE #ENDIF JR NZ,HDSK_RW5 ; BAIL OUT ON ERROR ; INCREMENT LBA LD A,HDSK_LBA ; LBA OFFSET IN CFG ENTRY CALL LDHLIYA ; HL := IY + A, REG A TRASHED CALL INC32HL ; INCREMENT THE VALUE ; INCREMENT DMA LD HL,HDSK_DMA+1 ; POINT TO MSB OF DMA INC (HL) ; BUMP DMA BY INC (HL) ; ... 512 BYTES XOR A ; A := 0 SIGNALS SUCCESS HDSK_RW5: POP BC ; RECOVER COUNTERS JR NZ,HDSK_RW6 ; IF ERROR, GET OUT INC C ; RECORD SECTOR COMPLETED DJNZ HDSK_RW0 ; LOOP AS NEEDED HDSK_RW6: ; RETURN WITH SECTORS READ IN E AND UPDATED DMA ADDRESS IN HL LD E,C ; SECTOR READ COUNT TO E LD HL,(HDSK_DMA) ; CURRENT DMA TO HL OR A ; SET FLAGS BASED ON RETURN CODE RET ; AND RETURN, A HAS RETURN CODE ; ; ; HDSK_DSKRESET: ; #IF (HDSKTRACE >= 2) CALL NEWLINE LD DE,HDSKSTR_PREFIX CALL WRITESTR CALL PC_SPACE LD DE,HDSKSTR_RESET CALL WRITESTR #ENDIF ; LD B,32 LD A,HDSK_CMDRESET HDSK_DSKRESET1: OUT ($FD),A DJNZ HDSK_DSKRESET1 XOR A ; STATUS = OK LD (IY+HDSK_STAT),A ; SAVE IT RET ; ; ; HDSK_PRT: CALL NEWLINE LD DE,HDSKSTR_PREFIX CALL WRITESTR CALL PC_SPACE LD DE,HDSKSTR_CMD CALL WRITESTR LD A,(HDSK_CMD) CALL PRTHEXBYTE CALL PC_SPACE CALL PC_LBKT LD A,(HDSK_CMD) LD DE,HDSKSTR_NONE CP HDSK_CMDNONE JP Z,HDSK_PRTCMD LD DE,HDSKSTR_RESET CP HDSK_CMDRESET JP Z,HDSK_PRTCMD LD DE,HDSKSTR_READ CP HDSK_CMDREAD JP Z,HDSK_PRTCMD LD DE,HDSKSTR_WRITE CP HDSK_CMDWRITE JP Z,HDSK_PRTCMD LD DE,HDSKSTR_PARAM CP HDSK_CMDPARAM JP Z,HDSK_PRTCMD LD DE,HDSKSTR_UNKCMD HDSK_PRTCMD: CALL WRITESTR CALL PC_RBKT LD A,(HDSK_CMD) CP HDSK_CMDREAD JR Z,HDSK_PRTRW CP HDSK_CMDWRITE JR Z,HDSK_PRTRW RET HDSK_PRTRW: CALL PC_SPACE LD A,(HDSK_DRV) CALL PRTHEXBYTE CALL PC_SPACE LD BC,(HDSK_TRK) CALL PRTHEXWORD CALL PC_SPACE LD A,(HDSK_SEC) CALL PRTHEXBYTE CALL PC_SPACE LD BC,(HDSK_DMA) CALL PRTHEXWORD CALL PC_SPACE LD DE,HDSKSTR_ARROW CALL WRITESTR CALL PC_SPACE LD DE,HDSKSTR_RC CALL WRITESTR LD A,(HDSK_RC) CALL PRTHEXBYTE CALL PC_SPACE CALL PC_LBKT LD A,(HDSK_RC) LD DE,HDSKSTR_STOK CP HDSK_STOK JP Z,HDSK_PRTRC LD DE,HDSKSTR_STUNK HDSK_PRTRC: CALL WRITESTR CALL PC_RBKT RET ; ; ; HDSKSTR_PREFIX .TEXT "HDSK:$" HDSKSTR_CMD .TEXT "CMD=$" HDSKSTR_RC .TEXT "RC=$" HDSKSTR_ARROW .TEXT "-->$" HDSKSTR_NONE .TEXT "NONE$" HDSKSTR_RESET .TEXT "RESET$" HDSKSTR_READ .TEXT "READ$" HDSKSTR_WRITE .TEXT "WRITE$" HDSKSTR_PARAM .TEXT "PARAM$" HDSKSTR_UNKCMD .TEXT "UNKCMD$" HDSKSTR_STOK .TEXT "OK$" HDSKSTR_STUNK .TEXT "UNKNOWN ERROR$" ; ;================================================================================================== ; HDSK DISK DRIVER - DATA ;================================================================================================== ; HDSK_RC .DB 0 ; CURRENT RETURN CODE HDSK_CURDEV .DB 0 ; CURRENT DEVICE NUMBER ; HDSK_PARMBLK: HDSK_CMD .DB 0 ; COMMAND (HDSK_READ, HDSK_WRITE, ...) HDSK_DRV .DB 0 ; 0..7, HDSK DRIVE NUMBER HDSK_SEC .DB 0 ; 0..255 SECTOR HDSK_TRK .DW 0 ; 0..2047 TRACK HDSK_DMA .DW 0 ; ADDRESS FOR SECTOR DATA EXCHANGE
; A186271: a(n)=Product{k=0..n, A001333(k)}. ; Submitted by Jamie Morken(s1) ; 1,1,3,21,357,14637,1449063,346326057,199830134889,278363377900377,936136039878967851,7600488507777339982269,148977175240943640992454669,7049748909576694035403947391749,805384464676770256686653161875581007 mov $1,1 mov $2,1 lpb $0 sub $0,1 add $3,$2 add $4,$3 mul $1,$4 mov $3,$2 mov $2,$4 lpe mov $0,$1
.global s_prepare_buffers s_prepare_buffers: push %r13 push %r14 push %r15 push %r9 push %rbp push %rcx push %rdi push %rsi lea addresses_WT_ht+0x1b97, %rsi lea addresses_normal_ht+0x1d197, %rdi nop dec %r13 mov $80, %rcx rep movsl nop nop cmp %r15, %r15 lea addresses_normal_ht+0x5324, %r9 add %r15, %r15 vmovups (%r9), %ymm6 vextracti128 $0, %ymm6, %xmm6 vpextrq $0, %xmm6, %rcx nop nop nop dec %r13 lea addresses_normal_ht+0x1cdb7, %rdi nop nop nop nop nop add %r14, %r14 mov (%rdi), %r15 nop nop nop nop dec %r9 lea addresses_normal_ht+0x14307, %rsi lea addresses_normal_ht+0x28b7, %rdi nop nop nop nop nop cmp $30744, %rbp mov $34, %rcx rep movsb and %r13, %r13 lea addresses_normal_ht+0x4b7, %rsi lea addresses_A_ht+0xf99f, %rdi xor $60952, %r15 mov $32, %rcx rep movsq nop sub %r14, %r14 lea addresses_WC_ht+0xa6b7, %rsi lea addresses_A_ht+0x19b5f, %rdi nop nop nop nop nop cmp %r14, %r14 mov $38, %rcx rep movsw nop nop nop nop nop sub $31726, %r9 pop %rsi pop %rdi pop %rcx pop %rbp pop %r9 pop %r15 pop %r14 pop %r13 ret .global s_faulty_load s_faulty_load: push %r12 push %r13 push %r14 push %rbp push %rcx push %rdi push %rsi // Store lea addresses_WC+0x1a997, %rbp nop nop nop nop add $16920, %r14 movb $0x51, (%rbp) nop nop nop nop nop and $6203, %r12 // Store lea addresses_WT+0x182b7, %rsi nop nop nop nop sub %rdi, %rdi movw $0x5152, (%rsi) nop nop nop nop nop inc %rbp // Store lea addresses_D+0x42b7, %rbp nop nop nop nop nop xor $47618, %rdi movw $0x5152, (%rbp) nop nop nop nop xor $1526, %r13 // Store lea addresses_A+0x140b7, %r12 nop nop nop sub $52540, %rcx movw $0x5152, (%r12) nop nop and %rcx, %rcx // Store lea addresses_WT+0x170e3, %rdi xor $11697, %r13 movl $0x51525354, (%rdi) nop nop dec %rbp // Store lea addresses_A+0x140b7, %rsi nop nop sub $64651, %r13 mov $0x5152535455565758, %r14 movq %r14, (%rsi) nop nop cmp %rbp, %rbp // Faulty Load lea addresses_A+0x140b7, %rdi nop nop nop nop inc %rbp mov (%rdi), %r12 lea oracles, %r14 and $0xff, %r12 shlq $12, %r12 mov (%r14,%r12,1), %r12 pop %rsi pop %rdi pop %rcx pop %rbp pop %r14 pop %r13 pop %r12 ret /* <gen_faulty_load> [REF] {'OP': 'LOAD', 'src': {'type': 'addresses_A', 'size': 16, 'AVXalign': False, 'NT': False, 'congruent': 0, 'same': False}} {'OP': 'STOR', 'dst': {'type': 'addresses_WC', 'size': 1, 'AVXalign': False, 'NT': False, 'congruent': 5, 'same': False}} {'OP': 'STOR', 'dst': {'type': 'addresses_WT', 'size': 2, 'AVXalign': False, 'NT': False, 'congruent': 9, 'same': False}} {'OP': 'STOR', 'dst': {'type': 'addresses_D', 'size': 2, 'AVXalign': False, 'NT': False, 'congruent': 9, 'same': False}} {'OP': 'STOR', 'dst': {'type': 'addresses_A', 'size': 2, 'AVXalign': False, 'NT': False, 'congruent': 0, 'same': True}} {'OP': 'STOR', 'dst': {'type': 'addresses_WT', 'size': 4, 'AVXalign': False, 'NT': False, 'congruent': 1, 'same': False}} {'OP': 'STOR', 'dst': {'type': 'addresses_A', 'size': 8, 'AVXalign': True, 'NT': False, 'congruent': 0, 'same': True}} [Faulty Load] {'OP': 'LOAD', 'src': {'type': 'addresses_A', 'size': 8, 'AVXalign': False, 'NT': True, 'congruent': 0, 'same': True}} <gen_prepare_buffer> {'OP': 'REPM', 'src': {'type': 'addresses_WT_ht', 'congruent': 5, 'same': False}, 'dst': {'type': 'addresses_normal_ht', 'congruent': 1, 'same': False}} {'OP': 'LOAD', 'src': {'type': 'addresses_normal_ht', 'size': 32, 'AVXalign': False, 'NT': False, 'congruent': 0, 'same': False}} {'OP': 'LOAD', 'src': {'type': 'addresses_normal_ht', 'size': 8, 'AVXalign': False, 'NT': False, 'congruent': 8, 'same': False}} {'OP': 'REPM', 'src': {'type': 'addresses_normal_ht', 'congruent': 4, 'same': False}, 'dst': {'type': 'addresses_normal_ht', 'congruent': 11, 'same': False}} {'OP': 'REPM', 'src': {'type': 'addresses_normal_ht', 'congruent': 9, 'same': False}, 'dst': {'type': 'addresses_A_ht', 'congruent': 2, 'same': False}} {'OP': 'REPM', 'src': {'type': 'addresses_WC_ht', 'congruent': 9, 'same': True}, 'dst': {'type': 'addresses_A_ht', 'congruent': 3, 'same': False}} {'58': 99} 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 */
COMMENT @%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% Copyright (c) Berkeley Softworks 1992 -- All Rights Reserved PROJECT: PC GEOS MODULE: Epson 48-jet driver FILE: epson48bjc800MInfo.asm AUTHOR: Dave Durran REVISION HISTORY: Name Date Description ---- ---- ----------- Dave 12/22/92 Initial revision DESCRIPTION: This file contains the device information for the Canon bjc800 printer (Monochrome mode) Other Printers Supported by this resource: $Id: epson48bjc800MInfo.asm,v 1.1 97/04/18 11:54:59 newdeal Exp $ %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%@ ;---------------------------------------------------------------------------- ; Canon bjc800M ;---------------------------------------------------------------------------- bjc800MInfo segment resource ; info blocks PrinterInfo < ; ---- PrinterType ------------- < PT_RASTER, BMF_MONO >, ; ---- PrinterConnections ------ < IC_NO_IEEE488, CC_NO_CUSTOM, SC_SCSI, RC_RS232C, CC_CENTRONICS, FC_FILE, AC_NO_APPLETALK >, ; ---- PrinterSmarts ----------- PS_DUMB_RASTER, ;-------Custom Entry Routine------- NULL, ;-------Custom Exit Routine------- NULL, ; ---- Mode Info Offsets ------- offset bjc800MlowRes, offset bjc800MmedRes, offset bjc800MhiRes, offset printerFontInfo:lq850draft, offset printerFontInfo:lq850nlq, ; ---- Font Information -------- offset bjc800MfontGeometries, ; ---- Symbol Set list ----------- NULL, ; ---- PaperMargins ------------ < PR_MARGIN_LEFT, ; Tractor Margins PR_MARGIN_TRACTOR, PR_MARGIN_RIGHT, PR_MARGIN_TRACTOR >, < PR_MARGIN_LEFT, ; ASF Margins PR_MARGIN_TOP, PR_MARGIN_RIGHT, 72 >, ; ---- PaperInputOptions ------- < MF_MANUAL1, TF_NO_TRACTOR, ASF_TRAY1 >, ; ---- PaperOutputOptions ------ < OC_NO_COPIES, PS_REVERSE, OD_SIMPLEX, SO_NO_STAPLER, OS_NO_SORTER, OB_NO_OUTPUTBIN >, ; 842, ; paper width (points). NULL, ; Main UI ASF1BinOnlyOptionsDialogBox, ; Options UI PrintEvalASF1BinOnly ; eval routine address > ;---------------------------------------------------------------------------- ; Graphics modes info ;---------------------------------------------------------------------------- bjc800MlowRes GraphicsProperties < LO_RES_X_RES, ; xres LO_RES_Y_RES, ; yres LO_RES_BAND_HEIGHT, ; band height LO_RES_BUFF_HEIGHT, ; buffer height LO_RES_INTERLEAVE_FACTOR, ;#interleaves BMF_MONO, ;color format NULL > ; color format bjc800MmedRes GraphicsProperties < MED_RES_X_RES, ; xres MED_RES_Y_RES, ; yres MED_RES_BAND_HEIGHT, ; band height MED_RES_BUFF_HEIGHT, ; buffer height MED_RES_INTERLEAVE_FACTOR, ;#interleaves BMF_MONO, ;color format handle gamma175 > ; color format bjc800MhiRes GraphicsProperties < HI_RES_X_RES, ; xres HI_RES_Y_RES, ; yres HI_RES_BAND_HEIGHT, ; band height HI_RES_BUFF_HEIGHT, ; buffer height HI_RES_INTERLEAVE_FACTOR, ;#interleaves BMF_MONO, ;color format handle gamma20 > ; color format ;---------------------------------------------------------------------------- ; Text modes info ;---------------------------------------------------------------------------- ;need to add geometries in ascending pointsize, grouped by font bjc800MfontGeometries FontGeometry \ < FID_DTC_URW_ROMAN, 8, offset bjc800M_8ptpitchTab >, < FID_DTC_URW_ROMAN, 12, offset bjc800M_12ptpitchTab >, < FID_DTC_URW_ROMAN, 24, offset bjc800M_24ptpitchTab >, < FID_DTC_URW_SANS, 8, offset bjc800M_8ptpitchTab >, < FID_DTC_URW_SANS, 12, offset bjc800M_12ptpitchTab >, < FID_DTC_URW_SANS, 24, offset bjc800M_24ptpitchTab > word FID_INVALID ;table terminator bjc800M_8ptpitchTab label byte byte TP_15_PITCH byte TP_PROPORTIONAL ;"table Terminator" bjc800M_12ptpitchTab label byte byte TP_20_PITCH byte TP_17_PITCH byte TP_12_PITCH byte TP_10_PITCH byte TP_6_PITCH byte TP_5_PITCH byte TP_PROPORTIONAL ;"table Terminator" bjc800M_24ptpitchTab label byte byte TP_12_PITCH byte TP_10_PITCH byte TP_6_PITCH byte TP_5_PITCH byte TP_PROPORTIONAL ;"table Terminator" bjc800MInfo ends
INCLUDE "config_private.inc" SECTION code_clib SECTION code_math PUBLIC l_mulu_16_8x8 ; compute: hl = l * e ; alters : af, bc, de, hl IF __CPU_Z180__ && ((__CLIB_OPT_IMATH = 0) || (__CLIB_OPT_IMATH = 100)) l_mulu_16_8x8: ld h,e mlt hl ret ELSE IF __CPU_Z80N__ && ((__CLIB_OPT_IMATH = 0) || (__CLIB_OPT_IMATH = 100)) l_mulu_16_8x8: ld d,l mul de ex de,hl ret ELSE IF __IO_LUT_MODULE_AVAILABLE EXTERN l_lut_mulu_16_8x8 defc l_mulu_16_8x8 = l_lut_mulu_16_8x8 ELSE IF __CLIB_OPT_IMATH <= 50 EXTERN l_small_mul_16_16x8 l_mulu_16_8x8: ld d,0 jp l_small_mul_16_16x8 ENDIF IF __CLIB_OPT_IMATH > 50 EXTERN l_fast_mulu_16_8x8 defc l_mulu_16_8x8 = l_fast_mulu_16_8x8 ENDIF ENDIF ENDIF ENDIF
#ifndef NETLIB_IO_STREAM_HANDLER_HPP #define NETLIB_IO_STREAM_HANDLER_HPP // Copyright 2014 Jelle Van den Driessche. // Distributed under the Boost Software License, Version 1.0. // (See accompanying file LICENSE_1_0.txt or copy at // http://www.boost.org/LICENSE_1_0.txt) #if defined(_MSC_VER) && (_MSC_VER >= 1200) #pragma once #endif // defined(_MSC_VER) && (_MSC_VER >= 1200) #include <memory> #include <boost/asio/async_result.hpp> #include <boost/asio/basic_socket.hpp> #include <boost/asio/detail/config.hpp> #include <boost/asio/detail/handler_type_requirements.hpp> #include <boost/asio/detail/push_options.hpp> #include <boost/asio/detail/throw_error.hpp> #include <boost/asio/error.hpp> #include <boost/asio/io_service.hpp> #include <boost/asio/stream_socket_service.hpp> #include <cstddef> #ifdef BOOST_NETWORK_ENABLE_HTTPS #include <boost/asio/ssl.hpp> #endif namespace boost { namespace network { typedef boost::asio::ip::tcp::socket tcp_socket; #ifndef BOOST_NETWORK_ENABLE_HTTPS typedef tcp_socket stream_handler; typedef void ssl_context; #else typedef boost::asio::ssl::stream<boost::asio::ip::tcp::socket> ssl_socket; typedef boost::asio::ssl::context ssl_context; struct stream_handler { public: stream_handler(std::shared_ptr<tcp_socket> socket) : tcp_sock_(std::move(socket)), ssl_enabled(false) {} ~stream_handler() = default; stream_handler(std::shared_ptr<ssl_socket> socket) : ssl_sock_(std::move(socket)), ssl_enabled(true) {} stream_handler(boost::asio::io_service& io, std::shared_ptr<ssl_context> ctx = std::shared_ptr<ssl_context>()) { tcp_sock_ = std::make_shared<tcp_socket>(boost::ref(io)); ssl_enabled = false; if (ctx) { /// SSL is enabled ssl_sock_ = std::make_shared<ssl_socket>(boost::ref(io), boost::ref(*ctx)); ssl_enabled = true; } } template <typename ConstBufferSequence, typename WriteHandler> BOOST_ASIO_INITFN_RESULT_TYPE(WriteHandler, void(boost::system::error_code, std::size_t)) async_write_some(const ConstBufferSequence& buffers, BOOST_ASIO_MOVE_ARG(WriteHandler) handler) { try { if (ssl_enabled) { ssl_sock_->async_write_some(buffers, handler); } else { tcp_sock_->async_write_some(buffers, handler); } } catch (const boost::system::system_error&) { // print system error } } template <typename MutableBufferSequence, typename ReadHandler> BOOST_ASIO_INITFN_RESULT_TYPE(ReadHandler, void(boost::system::error_code, std::size_t)) async_read_some(const MutableBufferSequence& buffers, BOOST_ASIO_MOVE_ARG(ReadHandler) handler) { try { if (ssl_enabled) { ssl_sock_->async_read_some(buffers, handler); } else { tcp_sock_->async_read_some(buffers, handler); } } catch (const boost::system::system_error& e) { // print system error } } void close(boost::system::error_code& e) { if (ssl_enabled) { ssl_sock_->next_layer().close(); } else { tcp_sock_->close(); } } tcp_socket::endpoint_type remote_endpoint(boost::system::error_code& ec) const { if (ssl_enabled) { return ssl_sock_->next_layer().remote_endpoint(ec); } else { return tcp_sock_->remote_endpoint(ec); } } tcp_socket::endpoint_type remote_endpoint() const { boost::system::error_code ec; tcp_socket::endpoint_type r = remote_endpoint(ec); if (ec) { boost::asio::detail::throw_error(ec, "remote_endpoint"); } return r; } void shutdown(boost::asio::socket_base::shutdown_type st, boost::system::error_code& e) { try { if (ssl_enabled) { ssl_sock_->shutdown(e); } else { tcp_sock_->shutdown(boost::asio::ip::tcp::socket::shutdown_send, e); } } catch (const boost::system::system_error&) { } } ssl_socket::next_layer_type& next_layer() const { if (ssl_enabled) { return ssl_sock_->next_layer(); } else { return *tcp_sock_; } } ssl_socket::lowest_layer_type& lowest_layer() const { if (ssl_enabled) { return ssl_sock_->lowest_layer(); } else { return tcp_sock_->lowest_layer(); } } template <typename HandshakeHandler> BOOST_ASIO_INITFN_RESULT_TYPE(HandshakeHandler, void(boost::system::error_code)) async_handshake(ssl_socket::handshake_type type, BOOST_ASIO_MOVE_ARG(HandshakeHandler) handler) { try { if (ssl_enabled) { return ssl_sock_->async_handshake(type, handler); } else { // NOOP } } catch (const boost::system::system_error& e) { } } std::shared_ptr<tcp_socket> get_tcp_socket() { return tcp_sock_; } std::shared_ptr<ssl_socket> get_ssl_socket() { return ssl_sock_; } bool is_ssl_enabled() { return ssl_enabled; } private: std::shared_ptr<tcp_socket> tcp_sock_; std::shared_ptr<ssl_socket> ssl_sock_; bool ssl_enabled; }; #endif } } #endif
/* * Copyright (c) 1999, 2011, Oracle and/or its affiliates. All rights reserved. * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. * * This code is free software; you can redistribute it and/or modify it * under the terms of the GNU General Public License version 2 only, as * published by the Free Software Foundation. * * This code is distributed in the hope that it will be useful, but WITHOUT * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License * version 2 for more details (a copy is included in the LICENSE file that * accompanied this code). * * You should have received a copy of the GNU General Public License version * 2 along with this work; if not, write to the Free Software Foundation, * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. * * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA * or visit www.oracle.com if you need additional information or have any * questions. * */ #include "precompiled.hpp" #include "c1/c1_CFGPrinter.hpp" #include "c1/c1_Canonicalizer.hpp" #include "c1/c1_Compilation.hpp" #include "c1/c1_GraphBuilder.hpp" #include "c1/c1_InstructionPrinter.hpp" #include "ci/ciField.hpp" #include "ci/ciKlass.hpp" #include "compiler/compileBroker.hpp" #include "interpreter/bytecode.hpp" #include "runtime/sharedRuntime.hpp" #include "utilities/bitMap.inline.hpp" class BlockListBuilder VALUE_OBJ_CLASS_SPEC { private: Compilation* _compilation; IRScope* _scope; BlockList _blocks; // internal list of all blocks BlockList* _bci2block; // mapping from bci to blocks for GraphBuilder // fields used by mark_loops BitMap _active; // for iteration of control flow graph BitMap _visited; // for iteration of control flow graph intArray _loop_map; // caches the information if a block is contained in a loop int _next_loop_index; // next free loop number int _next_block_number; // for reverse postorder numbering of blocks // accessors Compilation* compilation() const { return _compilation; } IRScope* scope() const { return _scope; } ciMethod* method() const { return scope()->method(); } XHandlers* xhandlers() const { return scope()->xhandlers(); } // unified bailout support void bailout(const char* msg) const { compilation()->bailout(msg); } bool bailed_out() const { return compilation()->bailed_out(); } // helper functions BlockBegin* make_block_at(int bci, BlockBegin* predecessor); void handle_exceptions(BlockBegin* current, int cur_bci); void handle_jsr(BlockBegin* current, int sr_bci, int next_bci); void store_one(BlockBegin* current, int local); void store_two(BlockBegin* current, int local); void set_entries(int osr_bci); void set_leaders(); void make_loop_header(BlockBegin* block); void mark_loops(); int mark_loops(BlockBegin* b, bool in_subroutine); // debugging #ifndef PRODUCT void print(); #endif public: // creation BlockListBuilder(Compilation* compilation, IRScope* scope, int osr_bci); // accessors for GraphBuilder BlockList* bci2block() const { return _bci2block; } }; // Implementation of BlockListBuilder BlockListBuilder::BlockListBuilder(Compilation* compilation, IRScope* scope, int osr_bci) : _compilation(compilation) , _scope(scope) , _blocks(16) , _bci2block(new BlockList(scope->method()->code_size(), NULL)) , _next_block_number(0) , _active() // size not known yet , _visited() // size not known yet , _next_loop_index(0) , _loop_map() // size not known yet { set_entries(osr_bci); set_leaders(); CHECK_BAILOUT(); mark_loops(); NOT_PRODUCT(if (PrintInitialBlockList) print()); #ifndef PRODUCT if (PrintCFGToFile) { stringStream title; title.print("BlockListBuilder "); scope->method()->print_name(&title); CFGPrinter::print_cfg(_bci2block, title.as_string(), false, false); } #endif } void BlockListBuilder::set_entries(int osr_bci) { // generate start blocks BlockBegin* std_entry = make_block_at(0, NULL); if (scope()->caller() == NULL) { std_entry->set(BlockBegin::std_entry_flag); } if (osr_bci != -1) { BlockBegin* osr_entry = make_block_at(osr_bci, NULL); osr_entry->set(BlockBegin::osr_entry_flag); } // generate exception entry blocks XHandlers* list = xhandlers(); const int n = list->length(); for (int i = 0; i < n; i++) { XHandler* h = list->handler_at(i); BlockBegin* entry = make_block_at(h->handler_bci(), NULL); entry->set(BlockBegin::exception_entry_flag); h->set_entry_block(entry); } } BlockBegin* BlockListBuilder::make_block_at(int cur_bci, BlockBegin* predecessor) { assert(method()->bci_block_start().at(cur_bci), "wrong block starts of MethodLivenessAnalyzer"); BlockBegin* block = _bci2block->at(cur_bci); if (block == NULL) { block = new BlockBegin(cur_bci); block->init_stores_to_locals(method()->max_locals()); _bci2block->at_put(cur_bci, block); _blocks.append(block); assert(predecessor == NULL || predecessor->bci() < cur_bci, "targets for backward branches must already exist"); } if (predecessor != NULL) { if (block->is_set(BlockBegin::exception_entry_flag)) { BAILOUT_("Exception handler can be reached by both normal and exceptional control flow", block); } predecessor->add_successor(block); block->increment_total_preds(); } return block; } inline void BlockListBuilder::store_one(BlockBegin* current, int local) { current->stores_to_locals().set_bit(local); } inline void BlockListBuilder::store_two(BlockBegin* current, int local) { store_one(current, local); store_one(current, local + 1); } void BlockListBuilder::handle_exceptions(BlockBegin* current, int cur_bci) { // Draws edges from a block to its exception handlers XHandlers* list = xhandlers(); const int n = list->length(); for (int i = 0; i < n; i++) { XHandler* h = list->handler_at(i); if (h->covers(cur_bci)) { BlockBegin* entry = h->entry_block(); assert(entry != NULL && entry == _bci2block->at(h->handler_bci()), "entry must be set"); assert(entry->is_set(BlockBegin::exception_entry_flag), "flag must be set"); // add each exception handler only once if (!current->is_successor(entry)) { current->add_successor(entry); entry->increment_total_preds(); } // stop when reaching catchall if (h->catch_type() == 0) break; } } } void BlockListBuilder::handle_jsr(BlockBegin* current, int sr_bci, int next_bci) { // start a new block after jsr-bytecode and link this block into cfg make_block_at(next_bci, current); // start a new block at the subroutine entry at mark it with special flag BlockBegin* sr_block = make_block_at(sr_bci, current); if (!sr_block->is_set(BlockBegin::subroutine_entry_flag)) { sr_block->set(BlockBegin::subroutine_entry_flag); } } void BlockListBuilder::set_leaders() { bool has_xhandlers = xhandlers()->has_handlers(); BlockBegin* current = NULL; // The information which bci starts a new block simplifies the analysis // Without it, backward branches could jump to a bci where no block was created // during bytecode iteration. This would require the creation of a new block at the // branch target and a modification of the successor lists. BitMap bci_block_start = method()->bci_block_start(); ciBytecodeStream s(method()); while (s.next() != ciBytecodeStream::EOBC()) { int cur_bci = s.cur_bci(); if (bci_block_start.at(cur_bci)) { current = make_block_at(cur_bci, current); } assert(current != NULL, "must have current block"); if (has_xhandlers && GraphBuilder::can_trap(method(), s.cur_bc())) { handle_exceptions(current, cur_bci); } switch (s.cur_bc()) { // track stores to local variables for selective creation of phi functions case Bytecodes::_iinc: store_one(current, s.get_index()); break; case Bytecodes::_istore: store_one(current, s.get_index()); break; case Bytecodes::_lstore: store_two(current, s.get_index()); break; case Bytecodes::_fstore: store_one(current, s.get_index()); break; case Bytecodes::_dstore: store_two(current, s.get_index()); break; case Bytecodes::_astore: store_one(current, s.get_index()); break; case Bytecodes::_istore_0: store_one(current, 0); break; case Bytecodes::_istore_1: store_one(current, 1); break; case Bytecodes::_istore_2: store_one(current, 2); break; case Bytecodes::_istore_3: store_one(current, 3); break; case Bytecodes::_lstore_0: store_two(current, 0); break; case Bytecodes::_lstore_1: store_two(current, 1); break; case Bytecodes::_lstore_2: store_two(current, 2); break; case Bytecodes::_lstore_3: store_two(current, 3); break; case Bytecodes::_fstore_0: store_one(current, 0); break; case Bytecodes::_fstore_1: store_one(current, 1); break; case Bytecodes::_fstore_2: store_one(current, 2); break; case Bytecodes::_fstore_3: store_one(current, 3); break; case Bytecodes::_dstore_0: store_two(current, 0); break; case Bytecodes::_dstore_1: store_two(current, 1); break; case Bytecodes::_dstore_2: store_two(current, 2); break; case Bytecodes::_dstore_3: store_two(current, 3); break; case Bytecodes::_astore_0: store_one(current, 0); break; case Bytecodes::_astore_1: store_one(current, 1); break; case Bytecodes::_astore_2: store_one(current, 2); break; case Bytecodes::_astore_3: store_one(current, 3); break; // track bytecodes that affect the control flow case Bytecodes::_athrow: // fall through case Bytecodes::_ret: // fall through case Bytecodes::_ireturn: // fall through case Bytecodes::_lreturn: // fall through case Bytecodes::_freturn: // fall through case Bytecodes::_dreturn: // fall through case Bytecodes::_areturn: // fall through case Bytecodes::_return: current = NULL; break; case Bytecodes::_ifeq: // fall through case Bytecodes::_ifne: // fall through case Bytecodes::_iflt: // fall through case Bytecodes::_ifge: // fall through case Bytecodes::_ifgt: // fall through case Bytecodes::_ifle: // fall through case Bytecodes::_if_icmpeq: // fall through case Bytecodes::_if_icmpne: // fall through case Bytecodes::_if_icmplt: // fall through case Bytecodes::_if_icmpge: // fall through case Bytecodes::_if_icmpgt: // fall through case Bytecodes::_if_icmple: // fall through case Bytecodes::_if_acmpeq: // fall through case Bytecodes::_if_acmpne: // fall through case Bytecodes::_ifnull: // fall through case Bytecodes::_ifnonnull: make_block_at(s.next_bci(), current); make_block_at(s.get_dest(), current); current = NULL; break; case Bytecodes::_goto: make_block_at(s.get_dest(), current); current = NULL; break; case Bytecodes::_goto_w: make_block_at(s.get_far_dest(), current); current = NULL; break; case Bytecodes::_jsr: handle_jsr(current, s.get_dest(), s.next_bci()); current = NULL; break; case Bytecodes::_jsr_w: handle_jsr(current, s.get_far_dest(), s.next_bci()); current = NULL; break; case Bytecodes::_tableswitch: { // set block for each case Bytecode_tableswitch sw(&s); int l = sw.length(); for (int i = 0; i < l; i++) { make_block_at(cur_bci + sw.dest_offset_at(i), current); } make_block_at(cur_bci + sw.default_offset(), current); current = NULL; break; } case Bytecodes::_lookupswitch: { // set block for each case Bytecode_lookupswitch sw(&s); int l = sw.number_of_pairs(); for (int i = 0; i < l; i++) { make_block_at(cur_bci + sw.pair_at(i).offset(), current); } make_block_at(cur_bci + sw.default_offset(), current); current = NULL; break; } } } } void BlockListBuilder::mark_loops() { ResourceMark rm; _active = BitMap(BlockBegin::number_of_blocks()); _active.clear(); _visited = BitMap(BlockBegin::number_of_blocks()); _visited.clear(); _loop_map = intArray(BlockBegin::number_of_blocks(), 0); _next_loop_index = 0; _next_block_number = _blocks.length(); // recursively iterate the control flow graph mark_loops(_bci2block->at(0), false); assert(_next_block_number >= 0, "invalid block numbers"); } void BlockListBuilder::make_loop_header(BlockBegin* block) { if (block->is_set(BlockBegin::exception_entry_flag)) { // exception edges may look like loops but don't mark them as such // since it screws up block ordering. return; } if (!block->is_set(BlockBegin::parser_loop_header_flag)) { block->set(BlockBegin::parser_loop_header_flag); assert(_loop_map.at(block->block_id()) == 0, "must not be set yet"); assert(0 <= _next_loop_index && _next_loop_index < BitsPerInt, "_next_loop_index is used as a bit-index in integer"); _loop_map.at_put(block->block_id(), 1 << _next_loop_index); if (_next_loop_index < 31) _next_loop_index++; } else { // block already marked as loop header assert(is_power_of_2((unsigned int)_loop_map.at(block->block_id())), "exactly one bit must be set"); } } int BlockListBuilder::mark_loops(BlockBegin* block, bool in_subroutine) { int block_id = block->block_id(); if (_visited.at(block_id)) { if (_active.at(block_id)) { // reached block via backward branch make_loop_header(block); } // return cached loop information for this block return _loop_map.at(block_id); } if (block->is_set(BlockBegin::subroutine_entry_flag)) { in_subroutine = true; } // set active and visited bits before successors are processed _visited.set_bit(block_id); _active.set_bit(block_id); intptr_t loop_state = 0; for (int i = block->number_of_sux() - 1; i >= 0; i--) { // recursively process all successors loop_state |= mark_loops(block->sux_at(i), in_subroutine); } // clear active-bit after all successors are processed _active.clear_bit(block_id); // reverse-post-order numbering of all blocks block->set_depth_first_number(_next_block_number); _next_block_number--; if (loop_state != 0 || in_subroutine ) { // block is contained at least in one loop, so phi functions are necessary // phi functions are also necessary for all locals stored in a subroutine scope()->requires_phi_function().set_union(block->stores_to_locals()); } if (block->is_set(BlockBegin::parser_loop_header_flag)) { int header_loop_state = _loop_map.at(block_id); assert(is_power_of_2((unsigned)header_loop_state), "exactly one bit must be set"); // If the highest bit is set (i.e. when integer value is negative), the method // has 32 or more loops. This bit is never cleared because it is used for multiple loops if (header_loop_state >= 0) { clear_bits(loop_state, header_loop_state); } } // cache and return loop information for this block _loop_map.at_put(block_id, loop_state); return loop_state; } #ifndef PRODUCT int compare_depth_first(BlockBegin** a, BlockBegin** b) { return (*a)->depth_first_number() - (*b)->depth_first_number(); } void BlockListBuilder::print() { tty->print("----- initial block list of BlockListBuilder for method "); method()->print_short_name(); tty->cr(); // better readability if blocks are sorted in processing order _blocks.sort(compare_depth_first); for (int i = 0; i < _blocks.length(); i++) { BlockBegin* cur = _blocks.at(i); tty->print("%4d: B%-4d bci: %-4d preds: %-4d ", cur->depth_first_number(), cur->block_id(), cur->bci(), cur->total_preds()); tty->print(cur->is_set(BlockBegin::std_entry_flag) ? " std" : " "); tty->print(cur->is_set(BlockBegin::osr_entry_flag) ? " osr" : " "); tty->print(cur->is_set(BlockBegin::exception_entry_flag) ? " ex" : " "); tty->print(cur->is_set(BlockBegin::subroutine_entry_flag) ? " sr" : " "); tty->print(cur->is_set(BlockBegin::parser_loop_header_flag) ? " lh" : " "); if (cur->number_of_sux() > 0) { tty->print(" sux: "); for (int j = 0; j < cur->number_of_sux(); j++) { BlockBegin* sux = cur->sux_at(j); tty->print("B%d ", sux->block_id()); } } tty->cr(); } } #endif // A simple growable array of Values indexed by ciFields class FieldBuffer: public CompilationResourceObj { private: GrowableArray<Value> _values; public: FieldBuffer() {} void kill() { _values.trunc_to(0); } Value at(ciField* field) { assert(field->holder()->is_loaded(), "must be a loaded field"); int offset = field->offset(); if (offset < _values.length()) { return _values.at(offset); } else { return NULL; } } void at_put(ciField* field, Value value) { assert(field->holder()->is_loaded(), "must be a loaded field"); int offset = field->offset(); _values.at_put_grow(offset, value, NULL); } }; // MemoryBuffer is fairly simple model of the current state of memory. // It partitions memory into several pieces. The first piece is // generic memory where little is known about the owner of the memory. // This is conceptually represented by the tuple <O, F, V> which says // that the field F of object O has value V. This is flattened so // that F is represented by the offset of the field and the parallel // arrays _objects and _values are used for O and V. Loads of O.F can // simply use V. Newly allocated objects are kept in a separate list // along with a parallel array for each object which represents the // current value of its fields. Stores of the default value to fields // which have never been stored to before are eliminated since they // are redundant. Once newly allocated objects are stored into // another object or they are passed out of the current compile they // are treated like generic memory. class MemoryBuffer: public CompilationResourceObj { private: FieldBuffer _values; GrowableArray<Value> _objects; GrowableArray<Value> _newobjects; GrowableArray<FieldBuffer*> _fields; public: MemoryBuffer() {} StoreField* store(StoreField* st) { if (!EliminateFieldAccess) { return st; } Value object = st->obj(); Value value = st->value(); ciField* field = st->field(); if (field->holder()->is_loaded()) { int offset = field->offset(); int index = _newobjects.find(object); if (index != -1) { // newly allocated object with no other stores performed on this field FieldBuffer* buf = _fields.at(index); if (buf->at(field) == NULL && is_default_value(value)) { #ifndef PRODUCT if (PrintIRDuringConstruction && Verbose) { tty->print_cr("Eliminated store for object %d:", index); st->print_line(); } #endif return NULL; } else { buf->at_put(field, value); } } else { _objects.at_put_grow(offset, object, NULL); _values.at_put(field, value); } store_value(value); } else { // if we held onto field names we could alias based on names but // we don't know what's being stored to so kill it all. kill(); } return st; } // return true if this value correspond to the default value of a field. bool is_default_value(Value value) { Constant* con = value->as_Constant(); if (con) { switch (con->type()->tag()) { case intTag: return con->type()->as_IntConstant()->value() == 0; case longTag: return con->type()->as_LongConstant()->value() == 0; case floatTag: return jint_cast(con->type()->as_FloatConstant()->value()) == 0; case doubleTag: return jlong_cast(con->type()->as_DoubleConstant()->value()) == jlong_cast(0); case objectTag: return con->type() == objectNull; default: ShouldNotReachHere(); } } return false; } // return either the actual value of a load or the load itself Value load(LoadField* load) { if (!EliminateFieldAccess) { return load; } if (RoundFPResults && UseSSE < 2 && load->type()->is_float_kind()) { // can't skip load since value might get rounded as a side effect return load; } ciField* field = load->field(); Value object = load->obj(); if (field->holder()->is_loaded() && !field->is_volatile()) { int offset = field->offset(); Value result = NULL; int index = _newobjects.find(object); if (index != -1) { result = _fields.at(index)->at(field); } else if (_objects.at_grow(offset, NULL) == object) { result = _values.at(field); } if (result != NULL) { #ifndef PRODUCT if (PrintIRDuringConstruction && Verbose) { tty->print_cr("Eliminated load: "); load->print_line(); } #endif assert(result->type()->tag() == load->type()->tag(), "wrong types"); return result; } } return load; } // Record this newly allocated object void new_instance(NewInstance* object) { int index = _newobjects.length(); _newobjects.append(object); if (_fields.at_grow(index, NULL) == NULL) { _fields.at_put(index, new FieldBuffer()); } else { _fields.at(index)->kill(); } } void store_value(Value value) { int index = _newobjects.find(value); if (index != -1) { // stored a newly allocated object into another object. // Assume we've lost track of it as separate slice of memory. // We could do better by keeping track of whether individual // fields could alias each other. _newobjects.remove_at(index); // pull out the field info and store it at the end up the list // of field info list to be reused later. _fields.append(_fields.at(index)); _fields.remove_at(index); } } void kill() { _newobjects.trunc_to(0); _objects.trunc_to(0); _values.kill(); } }; // Implementation of GraphBuilder's ScopeData GraphBuilder::ScopeData::ScopeData(ScopeData* parent) : _parent(parent) , _bci2block(NULL) , _scope(NULL) , _has_handler(false) , _stream(NULL) , _work_list(NULL) , _parsing_jsr(false) , _jsr_xhandlers(NULL) , _caller_stack_size(-1) , _continuation(NULL) , _num_returns(0) , _cleanup_block(NULL) , _cleanup_return_prev(NULL) , _cleanup_state(NULL) { if (parent != NULL) { _max_inline_size = (intx) ((float) NestedInliningSizeRatio * (float) parent->max_inline_size() / 100.0f); } else { _max_inline_size = MaxInlineSize; } if (_max_inline_size < MaxTrivialSize) { _max_inline_size = MaxTrivialSize; } } void GraphBuilder::kill_all() { if (UseLocalValueNumbering) { vmap()->kill_all(); } _memory->kill(); } BlockBegin* GraphBuilder::ScopeData::block_at(int bci) { if (parsing_jsr()) { // It is necessary to clone all blocks associated with a // subroutine, including those for exception handlers in the scope // of the method containing the jsr (because those exception // handlers may contain ret instructions in some cases). BlockBegin* block = bci2block()->at(bci); if (block != NULL && block == parent()->bci2block()->at(bci)) { BlockBegin* new_block = new BlockBegin(block->bci()); #ifndef PRODUCT if (PrintInitialBlockList) { tty->print_cr("CFG: cloned block %d (bci %d) as block %d for jsr", block->block_id(), block->bci(), new_block->block_id()); } #endif // copy data from cloned blocked new_block->set_depth_first_number(block->depth_first_number()); if (block->is_set(BlockBegin::parser_loop_header_flag)) new_block->set(BlockBegin::parser_loop_header_flag); // Preserve certain flags for assertion checking if (block->is_set(BlockBegin::subroutine_entry_flag)) new_block->set(BlockBegin::subroutine_entry_flag); if (block->is_set(BlockBegin::exception_entry_flag)) new_block->set(BlockBegin::exception_entry_flag); // copy was_visited_flag to allow early detection of bailouts // if a block that is used in a jsr has already been visited before, // it is shared between the normal control flow and a subroutine // BlockBegin::try_merge returns false when the flag is set, this leads // to a compilation bailout if (block->is_set(BlockBegin::was_visited_flag)) new_block->set(BlockBegin::was_visited_flag); bci2block()->at_put(bci, new_block); block = new_block; } return block; } else { return bci2block()->at(bci); } } XHandlers* GraphBuilder::ScopeData::xhandlers() const { if (_jsr_xhandlers == NULL) { assert(!parsing_jsr(), ""); return scope()->xhandlers(); } assert(parsing_jsr(), ""); return _jsr_xhandlers; } void GraphBuilder::ScopeData::set_scope(IRScope* scope) { _scope = scope; bool parent_has_handler = false; if (parent() != NULL) { parent_has_handler = parent()->has_handler(); } _has_handler = parent_has_handler || scope->xhandlers()->has_handlers(); } void GraphBuilder::ScopeData::set_inline_cleanup_info(BlockBegin* block, Instruction* return_prev, ValueStack* return_state) { _cleanup_block = block; _cleanup_return_prev = return_prev; _cleanup_state = return_state; } void GraphBuilder::ScopeData::add_to_work_list(BlockBegin* block) { if (_work_list == NULL) { _work_list = new BlockList(); } if (!block->is_set(BlockBegin::is_on_work_list_flag)) { // Do not start parsing the continuation block while in a // sub-scope if (parsing_jsr()) { if (block == jsr_continuation()) { return; } } else { if (block == continuation()) { return; } } block->set(BlockBegin::is_on_work_list_flag); _work_list->push(block); sort_top_into_worklist(_work_list, block); } } void GraphBuilder::sort_top_into_worklist(BlockList* worklist, BlockBegin* top) { assert(worklist->top() == top, ""); // sort block descending into work list const int dfn = top->depth_first_number(); assert(dfn != -1, "unknown depth first number"); int i = worklist->length()-2; while (i >= 0) { BlockBegin* b = worklist->at(i); if (b->depth_first_number() < dfn) { worklist->at_put(i+1, b); } else { break; } i --; } if (i >= -1) worklist->at_put(i + 1, top); } BlockBegin* GraphBuilder::ScopeData::remove_from_work_list() { if (is_work_list_empty()) { return NULL; } return _work_list->pop(); } bool GraphBuilder::ScopeData::is_work_list_empty() const { return (_work_list == NULL || _work_list->length() == 0); } void GraphBuilder::ScopeData::setup_jsr_xhandlers() { assert(parsing_jsr(), ""); // clone all the exception handlers from the scope XHandlers* handlers = new XHandlers(scope()->xhandlers()); const int n = handlers->length(); for (int i = 0; i < n; i++) { // The XHandlers need to be adjusted to dispatch to the cloned // handler block instead of the default one but the synthetic // unlocker needs to be handled specially. The synthetic unlocker // should be left alone since there can be only one and all code // should dispatch to the same one. XHandler* h = handlers->handler_at(i); assert(h->handler_bci() != SynchronizationEntryBCI, "must be real"); h->set_entry_block(block_at(h->handler_bci())); } _jsr_xhandlers = handlers; } int GraphBuilder::ScopeData::num_returns() { if (parsing_jsr()) { return parent()->num_returns(); } return _num_returns; } void GraphBuilder::ScopeData::incr_num_returns() { if (parsing_jsr()) { parent()->incr_num_returns(); } else { ++_num_returns; } } // Implementation of GraphBuilder #define INLINE_BAILOUT(msg) { inline_bailout(msg); return false; } void GraphBuilder::load_constant() { ciConstant con = stream()->get_constant(); if (con.basic_type() == T_ILLEGAL) { BAILOUT("could not resolve a constant"); } else { ValueType* t = illegalType; ValueStack* patch_state = NULL; switch (con.basic_type()) { case T_BOOLEAN: t = new IntConstant (con.as_boolean()); break; case T_BYTE : t = new IntConstant (con.as_byte ()); break; case T_CHAR : t = new IntConstant (con.as_char ()); break; case T_SHORT : t = new IntConstant (con.as_short ()); break; case T_INT : t = new IntConstant (con.as_int ()); break; case T_LONG : t = new LongConstant (con.as_long ()); break; case T_FLOAT : t = new FloatConstant (con.as_float ()); break; case T_DOUBLE : t = new DoubleConstant (con.as_double ()); break; case T_ARRAY : t = new ArrayConstant (con.as_object ()->as_array ()); break; case T_OBJECT : { ciObject* obj = con.as_object(); if (!obj->is_loaded() || (PatchALot && obj->klass() != ciEnv::current()->String_klass())) { patch_state = copy_state_before(); t = new ObjectConstant(obj); } else { assert(!obj->is_klass(), "must be java_mirror of klass"); t = new InstanceConstant(obj->as_instance()); } break; } default : ShouldNotReachHere(); } Value x; if (patch_state != NULL) { x = new Constant(t, patch_state); } else { x = new Constant(t); } push(t, append(x)); } } void GraphBuilder::load_local(ValueType* type, int index) { Value x = state()->local_at(index); assert(x != NULL && !x->type()->is_illegal(), "access of illegal local variable"); push(type, x); } void GraphBuilder::store_local(ValueType* type, int index) { Value x = pop(type); store_local(state(), x, type, index); } void GraphBuilder::store_local(ValueStack* state, Value x, ValueType* type, int index) { if (parsing_jsr()) { // We need to do additional tracking of the location of the return // address for jsrs since we don't handle arbitrary jsr/ret // constructs. Here we are figuring out in which circumstances we // need to bail out. if (x->type()->is_address()) { scope_data()->set_jsr_return_address_local(index); // Also check parent jsrs (if any) at this time to see whether // they are using this local. We don't handle skipping over a // ret. for (ScopeData* cur_scope_data = scope_data()->parent(); cur_scope_data != NULL && cur_scope_data->parsing_jsr() && cur_scope_data->scope() == scope(); cur_scope_data = cur_scope_data->parent()) { if (cur_scope_data->jsr_return_address_local() == index) { BAILOUT("subroutine overwrites return address from previous subroutine"); } } } else if (index == scope_data()->jsr_return_address_local()) { scope_data()->set_jsr_return_address_local(-1); } } state->store_local(index, round_fp(x)); } void GraphBuilder::load_indexed(BasicType type) { ValueStack* state_before = copy_state_for_exception(); Value index = ipop(); Value array = apop(); Value length = NULL; if (CSEArrayLength || (array->as_AccessField() && array->as_AccessField()->field()->is_constant()) || (array->as_NewArray() && array->as_NewArray()->length() && array->as_NewArray()->length()->type()->is_constant())) { length = append(new ArrayLength(array, state_before)); } push(as_ValueType(type), append(new LoadIndexed(array, index, length, type, state_before))); } void GraphBuilder::store_indexed(BasicType type) { ValueStack* state_before = copy_state_for_exception(); Value value = pop(as_ValueType(type)); Value index = ipop(); Value array = apop(); Value length = NULL; if (CSEArrayLength || (array->as_AccessField() && array->as_AccessField()->field()->is_constant()) || (array->as_NewArray() && array->as_NewArray()->length() && array->as_NewArray()->length()->type()->is_constant())) { length = append(new ArrayLength(array, state_before)); } StoreIndexed* result = new StoreIndexed(array, index, length, type, value, state_before); append(result); _memory->store_value(value); if (type == T_OBJECT && is_profiling()) { // Note that we'd collect profile data in this method if we wanted it. compilation()->set_would_profile(true); if (profile_checkcasts()) { result->set_profiled_method(method()); result->set_profiled_bci(bci()); result->set_should_profile(true); } } } void GraphBuilder::stack_op(Bytecodes::Code code) { switch (code) { case Bytecodes::_pop: { state()->raw_pop(); } break; case Bytecodes::_pop2: { state()->raw_pop(); state()->raw_pop(); } break; case Bytecodes::_dup: { Value w = state()->raw_pop(); state()->raw_push(w); state()->raw_push(w); } break; case Bytecodes::_dup_x1: { Value w1 = state()->raw_pop(); Value w2 = state()->raw_pop(); state()->raw_push(w1); state()->raw_push(w2); state()->raw_push(w1); } break; case Bytecodes::_dup_x2: { Value w1 = state()->raw_pop(); Value w2 = state()->raw_pop(); Value w3 = state()->raw_pop(); state()->raw_push(w1); state()->raw_push(w3); state()->raw_push(w2); state()->raw_push(w1); } break; case Bytecodes::_dup2: { Value w1 = state()->raw_pop(); Value w2 = state()->raw_pop(); state()->raw_push(w2); state()->raw_push(w1); state()->raw_push(w2); state()->raw_push(w1); } break; case Bytecodes::_dup2_x1: { Value w1 = state()->raw_pop(); Value w2 = state()->raw_pop(); Value w3 = state()->raw_pop(); state()->raw_push(w2); state()->raw_push(w1); state()->raw_push(w3); state()->raw_push(w2); state()->raw_push(w1); } break; case Bytecodes::_dup2_x2: { Value w1 = state()->raw_pop(); Value w2 = state()->raw_pop(); Value w3 = state()->raw_pop(); Value w4 = state()->raw_pop(); state()->raw_push(w2); state()->raw_push(w1); state()->raw_push(w4); state()->raw_push(w3); state()->raw_push(w2); state()->raw_push(w1); } break; case Bytecodes::_swap: { Value w1 = state()->raw_pop(); Value w2 = state()->raw_pop(); state()->raw_push(w1); state()->raw_push(w2); } break; default: ShouldNotReachHere(); break; } } void GraphBuilder::arithmetic_op(ValueType* type, Bytecodes::Code code, ValueStack* state_before) { Value y = pop(type); Value x = pop(type); // NOTE: strictfp can be queried from current method since we don't // inline methods with differing strictfp bits Value res = new ArithmeticOp(code, x, y, method()->is_strict(), state_before); // Note: currently single-precision floating-point rounding on Intel is handled at the LIRGenerator level res = append(res); if (method()->is_strict()) { res = round_fp(res); } push(type, res); } void GraphBuilder::negate_op(ValueType* type) { push(type, append(new NegateOp(pop(type)))); } void GraphBuilder::shift_op(ValueType* type, Bytecodes::Code code) { Value s = ipop(); Value x = pop(type); // try to simplify // Note: This code should go into the canonicalizer as soon as it can // can handle canonicalized forms that contain more than one node. if (CanonicalizeNodes && code == Bytecodes::_iushr) { // pattern: x >>> s IntConstant* s1 = s->type()->as_IntConstant(); if (s1 != NULL) { // pattern: x >>> s1, with s1 constant ShiftOp* l = x->as_ShiftOp(); if (l != NULL && l->op() == Bytecodes::_ishl) { // pattern: (a << b) >>> s1 IntConstant* s0 = l->y()->type()->as_IntConstant(); if (s0 != NULL) { // pattern: (a << s0) >>> s1 const int s0c = s0->value() & 0x1F; // only the low 5 bits are significant for shifts const int s1c = s1->value() & 0x1F; // only the low 5 bits are significant for shifts if (s0c == s1c) { if (s0c == 0) { // pattern: (a << 0) >>> 0 => simplify to: a ipush(l->x()); } else { // pattern: (a << s0c) >>> s0c => simplify to: a & m, with m constant assert(0 < s0c && s0c < BitsPerInt, "adjust code below to handle corner cases"); const int m = (1 << (BitsPerInt - s0c)) - 1; Value s = append(new Constant(new IntConstant(m))); ipush(append(new LogicOp(Bytecodes::_iand, l->x(), s))); } return; } } } } } // could not simplify push(type, append(new ShiftOp(code, x, s))); } void GraphBuilder::logic_op(ValueType* type, Bytecodes::Code code) { Value y = pop(type); Value x = pop(type); push(type, append(new LogicOp(code, x, y))); } void GraphBuilder::compare_op(ValueType* type, Bytecodes::Code code) { ValueStack* state_before = copy_state_before(); Value y = pop(type); Value x = pop(type); ipush(append(new CompareOp(code, x, y, state_before))); } void GraphBuilder::convert(Bytecodes::Code op, BasicType from, BasicType to) { push(as_ValueType(to), append(new Convert(op, pop(as_ValueType(from)), as_ValueType(to)))); } void GraphBuilder::increment() { int index = stream()->get_index(); int delta = stream()->is_wide() ? (signed short)Bytes::get_Java_u2(stream()->cur_bcp() + 4) : (signed char)(stream()->cur_bcp()[2]); load_local(intType, index); ipush(append(new Constant(new IntConstant(delta)))); arithmetic_op(intType, Bytecodes::_iadd); store_local(intType, index); } void GraphBuilder::_goto(int from_bci, int to_bci) { Goto *x = new Goto(block_at(to_bci), to_bci <= from_bci); if (is_profiling()) { compilation()->set_would_profile(true); } if (profile_branches()) { x->set_profiled_method(method()); x->set_profiled_bci(bci()); x->set_should_profile(true); } append(x); } void GraphBuilder::if_node(Value x, If::Condition cond, Value y, ValueStack* state_before) { BlockBegin* tsux = block_at(stream()->get_dest()); BlockBegin* fsux = block_at(stream()->next_bci()); bool is_bb = tsux->bci() < stream()->cur_bci() || fsux->bci() < stream()->cur_bci(); Instruction *i = append(new If(x, cond, false, y, tsux, fsux, is_bb ? state_before : NULL, is_bb)); if (is_profiling()) { If* if_node = i->as_If(); if (if_node != NULL) { // Note that we'd collect profile data in this method if we wanted it. compilation()->set_would_profile(true); // At level 2 we need the proper bci to count backedges if_node->set_profiled_bci(bci()); if (profile_branches()) { // Successors can be rotated by the canonicalizer, check for this case. if_node->set_profiled_method(method()); if_node->set_should_profile(true); if (if_node->tsux() == fsux) { if_node->set_swapped(true); } } return; } // Check if this If was reduced to Goto. Goto *goto_node = i->as_Goto(); if (goto_node != NULL) { compilation()->set_would_profile(true); if (profile_branches()) { goto_node->set_profiled_method(method()); goto_node->set_profiled_bci(bci()); goto_node->set_should_profile(true); // Find out which successor is used. if (goto_node->default_sux() == tsux) { goto_node->set_direction(Goto::taken); } else if (goto_node->default_sux() == fsux) { goto_node->set_direction(Goto::not_taken); } else { ShouldNotReachHere(); } } return; } } } void GraphBuilder::if_zero(ValueType* type, If::Condition cond) { Value y = append(new Constant(intZero)); ValueStack* state_before = copy_state_before(); Value x = ipop(); if_node(x, cond, y, state_before); } void GraphBuilder::if_null(ValueType* type, If::Condition cond) { Value y = append(new Constant(objectNull)); ValueStack* state_before = copy_state_before(); Value x = apop(); if_node(x, cond, y, state_before); } void GraphBuilder::if_same(ValueType* type, If::Condition cond) { ValueStack* state_before = copy_state_before(); Value y = pop(type); Value x = pop(type); if_node(x, cond, y, state_before); } void GraphBuilder::jsr(int dest) { // We only handle well-formed jsrs (those which are "block-structured"). // If the bytecodes are strange (jumping out of a jsr block) then we // might end up trying to re-parse a block containing a jsr which // has already been activated. Watch for this case and bail out. for (ScopeData* cur_scope_data = scope_data(); cur_scope_data != NULL && cur_scope_data->parsing_jsr() && cur_scope_data->scope() == scope(); cur_scope_data = cur_scope_data->parent()) { if (cur_scope_data->jsr_entry_bci() == dest) { BAILOUT("too-complicated jsr/ret structure"); } } push(addressType, append(new Constant(new AddressConstant(next_bci())))); if (!try_inline_jsr(dest)) { return; // bailed out while parsing and inlining subroutine } } void GraphBuilder::ret(int local_index) { if (!parsing_jsr()) BAILOUT("ret encountered while not parsing subroutine"); if (local_index != scope_data()->jsr_return_address_local()) { BAILOUT("can not handle complicated jsr/ret constructs"); } // Rets simply become (NON-SAFEPOINT) gotos to the jsr continuation append(new Goto(scope_data()->jsr_continuation(), false)); } void GraphBuilder::table_switch() { Bytecode_tableswitch sw(stream()); const int l = sw.length(); if (CanonicalizeNodes && l == 1) { // total of 2 successors => use If instead of switch // Note: This code should go into the canonicalizer as soon as it can // can handle canonicalized forms that contain more than one node. Value key = append(new Constant(new IntConstant(sw.low_key()))); BlockBegin* tsux = block_at(bci() + sw.dest_offset_at(0)); BlockBegin* fsux = block_at(bci() + sw.default_offset()); bool is_bb = tsux->bci() < bci() || fsux->bci() < bci(); ValueStack* state_before = is_bb ? copy_state_before() : NULL; append(new If(ipop(), If::eql, true, key, tsux, fsux, state_before, is_bb)); } else { // collect successors BlockList* sux = new BlockList(l + 1, NULL); int i; bool has_bb = false; for (i = 0; i < l; i++) { sux->at_put(i, block_at(bci() + sw.dest_offset_at(i))); if (sw.dest_offset_at(i) < 0) has_bb = true; } // add default successor sux->at_put(i, block_at(bci() + sw.default_offset())); ValueStack* state_before = has_bb ? copy_state_before() : NULL; append(new TableSwitch(ipop(), sux, sw.low_key(), state_before, has_bb)); } } void GraphBuilder::lookup_switch() { Bytecode_lookupswitch sw(stream()); const int l = sw.number_of_pairs(); if (CanonicalizeNodes && l == 1) { // total of 2 successors => use If instead of switch // Note: This code should go into the canonicalizer as soon as it can // can handle canonicalized forms that contain more than one node. // simplify to If LookupswitchPair pair = sw.pair_at(0); Value key = append(new Constant(new IntConstant(pair.match()))); BlockBegin* tsux = block_at(bci() + pair.offset()); BlockBegin* fsux = block_at(bci() + sw.default_offset()); bool is_bb = tsux->bci() < bci() || fsux->bci() < bci(); ValueStack* state_before = is_bb ? copy_state_before() : NULL; append(new If(ipop(), If::eql, true, key, tsux, fsux, state_before, is_bb)); } else { // collect successors & keys BlockList* sux = new BlockList(l + 1, NULL); intArray* keys = new intArray(l, 0); int i; bool has_bb = false; for (i = 0; i < l; i++) { LookupswitchPair pair = sw.pair_at(i); if (pair.offset() < 0) has_bb = true; sux->at_put(i, block_at(bci() + pair.offset())); keys->at_put(i, pair.match()); } // add default successor sux->at_put(i, block_at(bci() + sw.default_offset())); ValueStack* state_before = has_bb ? copy_state_before() : NULL; append(new LookupSwitch(ipop(), sux, keys, state_before, has_bb)); } } void GraphBuilder::call_register_finalizer() { // If the receiver requires finalization then emit code to perform // the registration on return. // Gather some type information about the receiver Value receiver = state()->local_at(0); assert(receiver != NULL, "must have a receiver"); ciType* declared_type = receiver->declared_type(); ciType* exact_type = receiver->exact_type(); if (exact_type == NULL && receiver->as_Local() && receiver->as_Local()->java_index() == 0) { ciInstanceKlass* ik = compilation()->method()->holder(); if (ik->is_final()) { exact_type = ik; } else if (UseCHA && !(ik->has_subklass() || ik->is_interface())) { // test class is leaf class compilation()->dependency_recorder()->assert_leaf_type(ik); exact_type = ik; } else { declared_type = ik; } } // see if we know statically that registration isn't required bool needs_check = true; if (exact_type != NULL) { needs_check = exact_type->as_instance_klass()->has_finalizer(); } else if (declared_type != NULL) { ciInstanceKlass* ik = declared_type->as_instance_klass(); if (!Dependencies::has_finalizable_subclass(ik)) { compilation()->dependency_recorder()->assert_has_no_finalizable_subclasses(ik); needs_check = false; } } if (needs_check) { // Perform the registration of finalizable objects. ValueStack* state_before = copy_state_for_exception(); load_local(objectType, 0); append_split(new Intrinsic(voidType, vmIntrinsics::_Object_init, state()->pop_arguments(1), true, state_before, true)); } } void GraphBuilder::method_return(Value x) { if (RegisterFinalizersAtInit && method()->intrinsic_id() == vmIntrinsics::_Object_init) { call_register_finalizer(); } // Check to see whether we are inlining. If so, Return // instructions become Gotos to the continuation point. if (continuation() != NULL) { assert(!method()->is_synchronized() || InlineSynchronizedMethods, "can not inline synchronized methods yet"); if (compilation()->env()->dtrace_method_probes()) { // Report exit from inline methods Values* args = new Values(1); args->push(append(new Constant(new ObjectConstant(method())))); append(new RuntimeCall(voidType, "dtrace_method_exit", CAST_FROM_FN_PTR(address, SharedRuntime::dtrace_method_exit), args)); } // If the inlined method is synchronized, the monitor must be // released before we jump to the continuation block. if (method()->is_synchronized()) { assert(state()->locks_size() == 1, "receiver must be locked here"); monitorexit(state()->lock_at(0), SynchronizationEntryBCI); } // State at end of inlined method is the state of the caller // without the method parameters on stack, including the // return value, if any, of the inlined method on operand stack. set_state(state()->caller_state()->copy_for_parsing()); if (x != NULL) { state()->push(x->type(), x); } Goto* goto_callee = new Goto(continuation(), false); // See whether this is the first return; if so, store off some // of the state for later examination if (num_returns() == 0) { set_inline_cleanup_info(_block, _last, state()); } // The current bci() is in the wrong scope, so use the bci() of // the continuation point. append_with_bci(goto_callee, scope_data()->continuation()->bci()); incr_num_returns(); return; } state()->truncate_stack(0); if (method()->is_synchronized()) { // perform the unlocking before exiting the method Value receiver; if (!method()->is_static()) { receiver = _initial_state->local_at(0); } else { receiver = append(new Constant(new ClassConstant(method()->holder()))); } append_split(new MonitorExit(receiver, state()->unlock())); } append(new Return(x)); } void GraphBuilder::access_field(Bytecodes::Code code) { bool will_link; ciField* field = stream()->get_field(will_link); ciInstanceKlass* holder = field->holder(); BasicType field_type = field->type()->basic_type(); ValueType* type = as_ValueType(field_type); // call will_link again to determine if the field is valid. const bool needs_patching = !holder->is_loaded() || !field->will_link(method()->holder(), code) || PatchALot; ValueStack* state_before = NULL; if (!holder->is_initialized() || needs_patching) { // save state before instruction for debug info when // deoptimization happens during patching state_before = copy_state_before(); } Value obj = NULL; if (code == Bytecodes::_getstatic || code == Bytecodes::_putstatic) { if (state_before != NULL) { // build a patching constant obj = new Constant(new InstanceConstant(holder->java_mirror()), state_before); } else { obj = new Constant(new InstanceConstant(holder->java_mirror())); } } const int offset = !needs_patching ? field->offset() : -1; switch (code) { case Bytecodes::_getstatic: { // check for compile-time constants, i.e., initialized static final fields Instruction* constant = NULL; if (field->is_constant() && !PatchALot) { ciConstant field_val = field->constant_value(); BasicType field_type = field_val.basic_type(); switch (field_type) { case T_ARRAY: case T_OBJECT: if (field_val.as_object()->should_be_constant()) { constant = new Constant(as_ValueType(field_val)); } break; default: constant = new Constant(as_ValueType(field_val)); } } if (constant != NULL) { push(type, append(constant)); } else { if (state_before == NULL) { state_before = copy_state_for_exception(); } push(type, append(new LoadField(append(obj), offset, field, true, state_before, needs_patching))); } break; } case Bytecodes::_putstatic: { Value val = pop(type); if (state_before == NULL) { state_before = copy_state_for_exception(); } append(new StoreField(append(obj), offset, field, val, true, state_before, needs_patching)); } break; case Bytecodes::_getfield : { if (state_before == NULL) { state_before = copy_state_for_exception(); } LoadField* load = new LoadField(apop(), offset, field, false, state_before, needs_patching); Value replacement = !needs_patching ? _memory->load(load) : load; if (replacement != load) { assert(replacement->is_linked() || !replacement->can_be_linked(), "should already by linked"); push(type, replacement); } else { push(type, append(load)); } break; } case Bytecodes::_putfield : { Value val = pop(type); if (state_before == NULL) { state_before = copy_state_for_exception(); } StoreField* store = new StoreField(apop(), offset, field, val, false, state_before, needs_patching); if (!needs_patching) store = _memory->store(store); if (store != NULL) { append(store); } } break; default : ShouldNotReachHere(); break; } } Dependencies* GraphBuilder::dependency_recorder() const { assert(DeoptC1, "need debug information"); return compilation()->dependency_recorder(); } void GraphBuilder::invoke(Bytecodes::Code code) { bool will_link; ciMethod* target = stream()->get_method(will_link); // we have to make sure the argument size (incl. the receiver) // is correct for compilation (the call would fail later during // linkage anyway) - was bug (gri 7/28/99) if (target->is_loaded() && target->is_static() != (code == Bytecodes::_invokestatic)) BAILOUT("will cause link error"); ciInstanceKlass* klass = target->holder(); // check if CHA possible: if so, change the code to invoke_special ciInstanceKlass* calling_klass = method()->holder(); ciKlass* holder = stream()->get_declared_method_holder(); ciInstanceKlass* callee_holder = ciEnv::get_instance_klass_for_declared_method_holder(holder); ciInstanceKlass* actual_recv = callee_holder; // some methods are obviously bindable without any type checks so // convert them directly to an invokespecial. if (target->is_loaded() && !target->is_abstract() && target->can_be_statically_bound() && code == Bytecodes::_invokevirtual) { code = Bytecodes::_invokespecial; } // NEEDS_CLEANUP // I've added the target-is_loaded() test below but I don't really understand // how klass->is_loaded() can be true and yet target->is_loaded() is false. // this happened while running the JCK invokevirtual tests under doit. TKR ciMethod* cha_monomorphic_target = NULL; ciMethod* exact_target = NULL; if (UseCHA && DeoptC1 && klass->is_loaded() && target->is_loaded() && !target->is_method_handle_invoke()) { Value receiver = NULL; ciInstanceKlass* receiver_klass = NULL; bool type_is_exact = false; // try to find a precise receiver type if (will_link && !target->is_static()) { int index = state()->stack_size() - (target->arg_size_no_receiver() + 1); receiver = state()->stack_at(index); ciType* type = receiver->exact_type(); if (type != NULL && type->is_loaded() && type->is_instance_klass() && !type->as_instance_klass()->is_interface()) { receiver_klass = (ciInstanceKlass*) type; type_is_exact = true; } if (type == NULL) { type = receiver->declared_type(); if (type != NULL && type->is_loaded() && type->is_instance_klass() && !type->as_instance_klass()->is_interface()) { receiver_klass = (ciInstanceKlass*) type; if (receiver_klass->is_leaf_type() && !receiver_klass->is_final()) { // Insert a dependency on this type since // find_monomorphic_target may assume it's already done. dependency_recorder()->assert_leaf_type(receiver_klass); type_is_exact = true; } } } } if (receiver_klass != NULL && type_is_exact && receiver_klass->is_loaded() && code != Bytecodes::_invokespecial) { // If we have the exact receiver type we can bind directly to // the method to call. exact_target = target->resolve_invoke(calling_klass, receiver_klass); if (exact_target != NULL) { target = exact_target; code = Bytecodes::_invokespecial; } } if (receiver_klass != NULL && receiver_klass->is_subtype_of(actual_recv) && actual_recv->is_initialized()) { actual_recv = receiver_klass; } if ((code == Bytecodes::_invokevirtual && callee_holder->is_initialized()) || (code == Bytecodes::_invokeinterface && callee_holder->is_initialized() && !actual_recv->is_interface())) { // Use CHA on the receiver to select a more precise method. cha_monomorphic_target = target->find_monomorphic_target(calling_klass, callee_holder, actual_recv); } else if (code == Bytecodes::_invokeinterface && callee_holder->is_loaded() && receiver != NULL) { // if there is only one implementor of this interface then we // may be able bind this invoke directly to the implementing // klass but we need both a dependence on the single interface // and on the method we bind to. Additionally since all we know // about the receiver type is the it's supposed to implement the // interface we have to insert a check that it's the class we // expect. Interface types are not checked by the verifier so // they are roughly equivalent to Object. ciInstanceKlass* singleton = NULL; if (target->holder()->nof_implementors() == 1) { singleton = target->holder()->implementor(0); } if (singleton) { cha_monomorphic_target = target->find_monomorphic_target(calling_klass, target->holder(), singleton); if (cha_monomorphic_target != NULL) { // If CHA is able to bind this invoke then update the class // to match that class, otherwise klass will refer to the // interface. klass = cha_monomorphic_target->holder(); actual_recv = target->holder(); // insert a check it's really the expected class. CheckCast* c = new CheckCast(klass, receiver, copy_state_for_exception()); c->set_incompatible_class_change_check(); c->set_direct_compare(klass->is_final()); append_split(c); } } } } if (cha_monomorphic_target != NULL) { if (cha_monomorphic_target->is_abstract()) { // Do not optimize for abstract methods cha_monomorphic_target = NULL; } } if (cha_monomorphic_target != NULL) { if (!(target->is_final_method())) { // If we inlined because CHA revealed only a single target method, // then we are dependent on that target method not getting overridden // by dynamic class loading. Be sure to test the "static" receiver // dest_method here, as opposed to the actual receiver, which may // falsely lead us to believe that the receiver is final or private. dependency_recorder()->assert_unique_concrete_method(actual_recv, cha_monomorphic_target); } code = Bytecodes::_invokespecial; } // check if we could do inlining if (!PatchALot && Inline && klass->is_loaded() && (klass->is_initialized() || klass->is_interface() && target->holder()->is_initialized()) && target->will_link(klass, callee_holder, code)) { // callee is known => check if we have static binding assert(target->is_loaded(), "callee must be known"); if (code == Bytecodes::_invokestatic || code == Bytecodes::_invokespecial || code == Bytecodes::_invokevirtual && target->is_final_method() ) { // static binding => check if callee is ok ciMethod* inline_target = (cha_monomorphic_target != NULL) ? cha_monomorphic_target : target; bool res = try_inline(inline_target, (cha_monomorphic_target != NULL) || (exact_target != NULL)); CHECK_BAILOUT(); #ifndef PRODUCT // printing if (PrintInlining && !res) { // if it was successfully inlined, then it was already printed. print_inline_result(inline_target, res); } #endif clear_inline_bailout(); if (res) { // Register dependence if JVMTI has either breakpoint // setting or hotswapping of methods capabilities since they may // cause deoptimization. if (compilation()->env()->jvmti_can_hotswap_or_post_breakpoint()) { dependency_recorder()->assert_evol_method(inline_target); } return; } } } // If we attempted an inline which did not succeed because of a // bailout during construction of the callee graph, the entire // compilation has to be aborted. This is fairly rare and currently // seems to only occur for jasm-generated classes which contain // jsr/ret pairs which are not associated with finally clauses and // do not have exception handlers in the containing method, and are // therefore not caught early enough to abort the inlining without // corrupting the graph. (We currently bail out with a non-empty // stack at a ret in these situations.) CHECK_BAILOUT(); // inlining not successful => standard invoke bool is_loaded = target->is_loaded(); bool has_receiver = code == Bytecodes::_invokespecial || code == Bytecodes::_invokevirtual || code == Bytecodes::_invokeinterface; bool is_invokedynamic = code == Bytecodes::_invokedynamic; ValueType* result_type = as_ValueType(target->return_type()); // We require the debug info to be the "state before" because // invokedynamics may deoptimize. ValueStack* state_before = is_invokedynamic ? copy_state_before() : copy_state_exhandling(); Values* args = state()->pop_arguments(target->arg_size_no_receiver()); Value recv = has_receiver ? apop() : NULL; int vtable_index = methodOopDesc::invalid_vtable_index; #ifdef SPARC // Currently only supported on Sparc. // The UseInlineCaches only controls dispatch to invokevirtuals for // loaded classes which we weren't able to statically bind. if (!UseInlineCaches && is_loaded && code == Bytecodes::_invokevirtual && !target->can_be_statically_bound()) { // Find a vtable index if one is available vtable_index = target->resolve_vtable_index(calling_klass, callee_holder); } #endif if (recv != NULL && (code == Bytecodes::_invokespecial || !is_loaded || target->is_final())) { // invokespecial always needs a NULL check. invokevirtual where // the target is final or where it's not known that whether the // target is final requires a NULL check. Otherwise normal // invokevirtual will perform the null check during the lookup // logic or the unverified entry point. Profiling of calls // requires that the null check is performed in all cases. null_check(recv); } if (is_profiling()) { if (recv != NULL && profile_calls()) { null_check(recv); } // Note that we'd collect profile data in this method if we wanted it. compilation()->set_would_profile(true); if (profile_calls()) { assert(cha_monomorphic_target == NULL || exact_target == NULL, "both can not be set"); ciKlass* target_klass = NULL; if (cha_monomorphic_target != NULL) { target_klass = cha_monomorphic_target->holder(); } else if (exact_target != NULL) { target_klass = exact_target->holder(); } profile_call(recv, target_klass); } } Invoke* result = new Invoke(code, result_type, recv, args, vtable_index, target, state_before); // push result append_split(result); if (result_type != voidType) { if (method()->is_strict()) { push(result_type, round_fp(result)); } else { push(result_type, result); } } } void GraphBuilder::new_instance(int klass_index) { ValueStack* state_before = copy_state_exhandling(); bool will_link; ciKlass* klass = stream()->get_klass(will_link); assert(klass->is_instance_klass(), "must be an instance klass"); NewInstance* new_instance = new NewInstance(klass->as_instance_klass(), state_before); _memory->new_instance(new_instance); apush(append_split(new_instance)); } void GraphBuilder::new_type_array() { ValueStack* state_before = copy_state_exhandling(); apush(append_split(new NewTypeArray(ipop(), (BasicType)stream()->get_index(), state_before))); } void GraphBuilder::new_object_array() { bool will_link; ciKlass* klass = stream()->get_klass(will_link); ValueStack* state_before = !klass->is_loaded() || PatchALot ? copy_state_before() : copy_state_exhandling(); NewArray* n = new NewObjectArray(klass, ipop(), state_before); apush(append_split(n)); } bool GraphBuilder::direct_compare(ciKlass* k) { if (k->is_loaded() && k->is_instance_klass() && !UseSlowPath) { ciInstanceKlass* ik = k->as_instance_klass(); if (ik->is_final()) { return true; } else { if (DeoptC1 && UseCHA && !(ik->has_subklass() || ik->is_interface())) { // test class is leaf class dependency_recorder()->assert_leaf_type(ik); return true; } } } return false; } void GraphBuilder::check_cast(int klass_index) { bool will_link; ciKlass* klass = stream()->get_klass(will_link); ValueStack* state_before = !klass->is_loaded() || PatchALot ? copy_state_before() : copy_state_for_exception(); CheckCast* c = new CheckCast(klass, apop(), state_before); apush(append_split(c)); c->set_direct_compare(direct_compare(klass)); if (is_profiling()) { // Note that we'd collect profile data in this method if we wanted it. compilation()->set_would_profile(true); if (profile_checkcasts()) { c->set_profiled_method(method()); c->set_profiled_bci(bci()); c->set_should_profile(true); } } } void GraphBuilder::instance_of(int klass_index) { bool will_link; ciKlass* klass = stream()->get_klass(will_link); ValueStack* state_before = !klass->is_loaded() || PatchALot ? copy_state_before() : copy_state_exhandling(); InstanceOf* i = new InstanceOf(klass, apop(), state_before); ipush(append_split(i)); i->set_direct_compare(direct_compare(klass)); if (is_profiling()) { // Note that we'd collect profile data in this method if we wanted it. compilation()->set_would_profile(true); if (profile_checkcasts()) { i->set_profiled_method(method()); i->set_profiled_bci(bci()); i->set_should_profile(true); } } } void GraphBuilder::monitorenter(Value x, int bci) { // save state before locking in case of deoptimization after a NullPointerException ValueStack* state_before = copy_state_for_exception_with_bci(bci); append_with_bci(new MonitorEnter(x, state()->lock(x), state_before), bci); kill_all(); } void GraphBuilder::monitorexit(Value x, int bci) { append_with_bci(new MonitorExit(x, state()->unlock()), bci); kill_all(); } void GraphBuilder::new_multi_array(int dimensions) { bool will_link; ciKlass* klass = stream()->get_klass(will_link); ValueStack* state_before = !klass->is_loaded() || PatchALot ? copy_state_before() : copy_state_exhandling(); Values* dims = new Values(dimensions, NULL); // fill in all dimensions int i = dimensions; while (i-- > 0) dims->at_put(i, ipop()); // create array NewArray* n = new NewMultiArray(klass, dims, state_before); apush(append_split(n)); } void GraphBuilder::throw_op(int bci) { // We require that the debug info for a Throw be the "state before" // the Throw (i.e., exception oop is still on TOS) ValueStack* state_before = copy_state_before_with_bci(bci); Throw* t = new Throw(apop(), state_before); // operand stack not needed after a throw state()->truncate_stack(0); append_with_bci(t, bci); } Value GraphBuilder::round_fp(Value fp_value) { // no rounding needed if SSE2 is used if (RoundFPResults && UseSSE < 2) { // Must currently insert rounding node for doubleword values that // are results of expressions (i.e., not loads from memory or // constants) if (fp_value->type()->tag() == doubleTag && fp_value->as_Constant() == NULL && fp_value->as_Local() == NULL && // method parameters need no rounding fp_value->as_RoundFP() == NULL) { return append(new RoundFP(fp_value)); } } return fp_value; } Instruction* GraphBuilder::append_with_bci(Instruction* instr, int bci) { Canonicalizer canon(compilation(), instr, bci); Instruction* i1 = canon.canonical(); if (i1->is_linked() || !i1->can_be_linked()) { // Canonicalizer returned an instruction which was already // appended so simply return it. return i1; } if (UseLocalValueNumbering) { // Lookup the instruction in the ValueMap and add it to the map if // it's not found. Instruction* i2 = vmap()->find_insert(i1); if (i2 != i1) { // found an entry in the value map, so just return it. assert(i2->is_linked(), "should already be linked"); return i2; } ValueNumberingEffects vne(vmap()); i1->visit(&vne); } // i1 was not eliminated => append it assert(i1->next() == NULL, "shouldn't already be linked"); _last = _last->set_next(i1, canon.bci()); if (++_instruction_count >= InstructionCountCutoff && !bailed_out()) { // set the bailout state but complete normal processing. We // might do a little more work before noticing the bailout so we // want processing to continue normally until it's noticed. bailout("Method and/or inlining is too large"); } #ifndef PRODUCT if (PrintIRDuringConstruction) { InstructionPrinter ip; ip.print_line(i1); if (Verbose) { state()->print(); } } #endif // save state after modification of operand stack for StateSplit instructions StateSplit* s = i1->as_StateSplit(); if (s != NULL) { if (EliminateFieldAccess) { Intrinsic* intrinsic = s->as_Intrinsic(); if (s->as_Invoke() != NULL || (intrinsic && !intrinsic->preserves_state())) { _memory->kill(); } } s->set_state(state()->copy(ValueStack::StateAfter, canon.bci())); } // set up exception handlers for this instruction if necessary if (i1->can_trap()) { i1->set_exception_handlers(handle_exception(i1)); assert(i1->exception_state() != NULL || !i1->needs_exception_state() || bailed_out(), "handle_exception must set exception state"); } return i1; } Instruction* GraphBuilder::append(Instruction* instr) { assert(instr->as_StateSplit() == NULL || instr->as_BlockEnd() != NULL, "wrong append used"); return append_with_bci(instr, bci()); } Instruction* GraphBuilder::append_split(StateSplit* instr) { return append_with_bci(instr, bci()); } void GraphBuilder::null_check(Value value) { if (value->as_NewArray() != NULL || value->as_NewInstance() != NULL) { return; } else { Constant* con = value->as_Constant(); if (con) { ObjectType* c = con->type()->as_ObjectType(); if (c && c->is_loaded()) { ObjectConstant* oc = c->as_ObjectConstant(); if (!oc || !oc->value()->is_null_object()) { return; } } } } append(new NullCheck(value, copy_state_for_exception())); } XHandlers* GraphBuilder::handle_exception(Instruction* instruction) { if (!has_handler() && (!instruction->needs_exception_state() || instruction->exception_state() != NULL)) { assert(instruction->exception_state() == NULL || instruction->exception_state()->kind() == ValueStack::EmptyExceptionState || (instruction->exception_state()->kind() == ValueStack::ExceptionState && _compilation->env()->jvmti_can_access_local_variables()), "exception_state should be of exception kind"); return new XHandlers(); } XHandlers* exception_handlers = new XHandlers(); ScopeData* cur_scope_data = scope_data(); ValueStack* cur_state = instruction->state_before(); ValueStack* prev_state = NULL; int scope_count = 0; assert(cur_state != NULL, "state_before must be set"); do { int cur_bci = cur_state->bci(); assert(cur_scope_data->scope() == cur_state->scope(), "scopes do not match"); assert(cur_bci == SynchronizationEntryBCI || cur_bci == cur_scope_data->stream()->cur_bci(), "invalid bci"); // join with all potential exception handlers XHandlers* list = cur_scope_data->xhandlers(); const int n = list->length(); for (int i = 0; i < n; i++) { XHandler* h = list->handler_at(i); if (h->covers(cur_bci)) { // h is a potential exception handler => join it compilation()->set_has_exception_handlers(true); BlockBegin* entry = h->entry_block(); if (entry == block()) { // It's acceptable for an exception handler to cover itself // but we don't handle that in the parser currently. It's // very rare so we bailout instead of trying to handle it. BAILOUT_("exception handler covers itself", exception_handlers); } assert(entry->bci() == h->handler_bci(), "must match"); assert(entry->bci() == -1 || entry == cur_scope_data->block_at(entry->bci()), "blocks must correspond"); // previously this was a BAILOUT, but this is not necessary // now because asynchronous exceptions are not handled this way. assert(entry->state() == NULL || cur_state->total_locks_size() == entry->state()->total_locks_size(), "locks do not match"); // xhandler start with an empty expression stack if (cur_state->stack_size() != 0) { cur_state = cur_state->copy(ValueStack::ExceptionState, cur_state->bci()); } if (instruction->exception_state() == NULL) { instruction->set_exception_state(cur_state); } // Note: Usually this join must work. However, very // complicated jsr-ret structures where we don't ret from // the subroutine can cause the objects on the monitor // stacks to not match because blocks can be parsed twice. // The only test case we've seen so far which exhibits this // problem is caught by the infinite recursion test in // GraphBuilder::jsr() if the join doesn't work. if (!entry->try_merge(cur_state)) { BAILOUT_("error while joining with exception handler, prob. due to complicated jsr/rets", exception_handlers); } // add current state for correct handling of phi functions at begin of xhandler int phi_operand = entry->add_exception_state(cur_state); // add entry to the list of xhandlers of this block _block->add_exception_handler(entry); // add back-edge from xhandler entry to this block if (!entry->is_predecessor(_block)) { entry->add_predecessor(_block); } // clone XHandler because phi_operand and scope_count can not be shared XHandler* new_xhandler = new XHandler(h); new_xhandler->set_phi_operand(phi_operand); new_xhandler->set_scope_count(scope_count); exception_handlers->append(new_xhandler); // fill in exception handler subgraph lazily assert(!entry->is_set(BlockBegin::was_visited_flag), "entry must not be visited yet"); cur_scope_data->add_to_work_list(entry); // stop when reaching catchall if (h->catch_type() == 0) { return exception_handlers; } } } if (exception_handlers->length() == 0) { // This scope and all callees do not handle exceptions, so the local // variables of this scope are not needed. However, the scope itself is // required for a correct exception stack trace -> clear out the locals. if (_compilation->env()->jvmti_can_access_local_variables()) { cur_state = cur_state->copy(ValueStack::ExceptionState, cur_state->bci()); } else { cur_state = cur_state->copy(ValueStack::EmptyExceptionState, cur_state->bci()); } if (prev_state != NULL) { prev_state->set_caller_state(cur_state); } if (instruction->exception_state() == NULL) { instruction->set_exception_state(cur_state); } } // Set up iteration for next time. // If parsing a jsr, do not grab exception handlers from the // parent scopes for this method (already got them, and they // needed to be cloned) while (cur_scope_data->parsing_jsr()) { cur_scope_data = cur_scope_data->parent(); } assert(cur_scope_data->scope() == cur_state->scope(), "scopes do not match"); assert(cur_state->locks_size() == 0 || cur_state->locks_size() == 1, "unlocking must be done in a catchall exception handler"); prev_state = cur_state; cur_state = cur_state->caller_state(); cur_scope_data = cur_scope_data->parent(); scope_count++; } while (cur_scope_data != NULL); return exception_handlers; } // Helper class for simplifying Phis. class PhiSimplifier : public BlockClosure { private: bool _has_substitutions; Value simplify(Value v); public: PhiSimplifier(BlockBegin* start) : _has_substitutions(false) { start->iterate_preorder(this); if (_has_substitutions) { SubstitutionResolver sr(start); } } void block_do(BlockBegin* b); bool has_substitutions() const { return _has_substitutions; } }; Value PhiSimplifier::simplify(Value v) { Phi* phi = v->as_Phi(); if (phi == NULL) { // no phi function return v; } else if (v->has_subst()) { // already substituted; subst can be phi itself -> simplify return simplify(v->subst()); } else if (phi->is_set(Phi::cannot_simplify)) { // already tried to simplify phi before return phi; } else if (phi->is_set(Phi::visited)) { // break cycles in phi functions return phi; } else if (phi->type()->is_illegal()) { // illegal phi functions are ignored anyway return phi; } else { // mark phi function as processed to break cycles in phi functions phi->set(Phi::visited); // simplify x = [y, x] and x = [y, y] to y Value subst = NULL; int opd_count = phi->operand_count(); for (int i = 0; i < opd_count; i++) { Value opd = phi->operand_at(i); assert(opd != NULL, "Operand must exist!"); if (opd->type()->is_illegal()) { // if one operand is illegal, the entire phi function is illegal phi->make_illegal(); phi->clear(Phi::visited); return phi; } Value new_opd = simplify(opd); assert(new_opd != NULL, "Simplified operand must exist!"); if (new_opd != phi && new_opd != subst) { if (subst == NULL) { subst = new_opd; } else { // no simplification possible phi->set(Phi::cannot_simplify); phi->clear(Phi::visited); return phi; } } } // sucessfully simplified phi function assert(subst != NULL, "illegal phi function"); _has_substitutions = true; phi->clear(Phi::visited); phi->set_subst(subst); #ifndef PRODUCT if (PrintPhiFunctions) { tty->print_cr("simplified phi function %c%d to %c%d (Block B%d)", phi->type()->tchar(), phi->id(), subst->type()->tchar(), subst->id(), phi->block()->block_id()); } #endif return subst; } } void PhiSimplifier::block_do(BlockBegin* b) { for_each_phi_fun(b, phi, simplify(phi); ); #ifdef ASSERT for_each_phi_fun(b, phi, assert(phi->operand_count() != 1 || phi->subst() != phi, "missed trivial simplification"); ); ValueStack* state = b->state()->caller_state(); for_each_state_value(state, value, Phi* phi = value->as_Phi(); assert(phi == NULL || phi->block() != b, "must not have phi function to simplify in caller state"); ); #endif } // This method is called after all blocks are filled with HIR instructions // It eliminates all Phi functions of the form x = [y, y] and x = [y, x] void GraphBuilder::eliminate_redundant_phis(BlockBegin* start) { PhiSimplifier simplifier(start); } void GraphBuilder::connect_to_end(BlockBegin* beg) { // setup iteration kill_all(); _block = beg; _state = beg->state()->copy_for_parsing(); _last = beg; iterate_bytecodes_for_block(beg->bci()); } BlockEnd* GraphBuilder::iterate_bytecodes_for_block(int bci) { #ifndef PRODUCT if (PrintIRDuringConstruction) { tty->cr(); InstructionPrinter ip; ip.print_instr(_block); tty->cr(); ip.print_stack(_block->state()); tty->cr(); ip.print_inline_level(_block); ip.print_head(); tty->print_cr("locals size: %d stack size: %d", state()->locals_size(), state()->stack_size()); } #endif _skip_block = false; assert(state() != NULL, "ValueStack missing!"); ciBytecodeStream s(method()); s.reset_to_bci(bci); int prev_bci = bci; scope_data()->set_stream(&s); // iterate Bytecodes::Code code = Bytecodes::_illegal; bool push_exception = false; if (block()->is_set(BlockBegin::exception_entry_flag) && block()->next() == NULL) { // first thing in the exception entry block should be the exception object. push_exception = true; } while (!bailed_out() && last()->as_BlockEnd() == NULL && (code = stream()->next()) != ciBytecodeStream::EOBC() && (block_at(s.cur_bci()) == NULL || block_at(s.cur_bci()) == block())) { assert(state()->kind() == ValueStack::Parsing, "invalid state kind"); // Check for active jsr during OSR compilation if (compilation()->is_osr_compile() && scope()->is_top_scope() && parsing_jsr() && s.cur_bci() == compilation()->osr_bci()) { bailout("OSR not supported while a jsr is active"); } if (push_exception) { apush(append(new ExceptionObject())); push_exception = false; } // handle bytecode switch (code) { case Bytecodes::_nop : /* nothing to do */ break; case Bytecodes::_aconst_null : apush(append(new Constant(objectNull ))); break; case Bytecodes::_iconst_m1 : ipush(append(new Constant(new IntConstant (-1)))); break; case Bytecodes::_iconst_0 : ipush(append(new Constant(intZero ))); break; case Bytecodes::_iconst_1 : ipush(append(new Constant(intOne ))); break; case Bytecodes::_iconst_2 : ipush(append(new Constant(new IntConstant ( 2)))); break; case Bytecodes::_iconst_3 : ipush(append(new Constant(new IntConstant ( 3)))); break; case Bytecodes::_iconst_4 : ipush(append(new Constant(new IntConstant ( 4)))); break; case Bytecodes::_iconst_5 : ipush(append(new Constant(new IntConstant ( 5)))); break; case Bytecodes::_lconst_0 : lpush(append(new Constant(new LongConstant ( 0)))); break; case Bytecodes::_lconst_1 : lpush(append(new Constant(new LongConstant ( 1)))); break; case Bytecodes::_fconst_0 : fpush(append(new Constant(new FloatConstant ( 0)))); break; case Bytecodes::_fconst_1 : fpush(append(new Constant(new FloatConstant ( 1)))); break; case Bytecodes::_fconst_2 : fpush(append(new Constant(new FloatConstant ( 2)))); break; case Bytecodes::_dconst_0 : dpush(append(new Constant(new DoubleConstant( 0)))); break; case Bytecodes::_dconst_1 : dpush(append(new Constant(new DoubleConstant( 1)))); break; case Bytecodes::_bipush : ipush(append(new Constant(new IntConstant(((signed char*)s.cur_bcp())[1])))); break; case Bytecodes::_sipush : ipush(append(new Constant(new IntConstant((short)Bytes::get_Java_u2(s.cur_bcp()+1))))); break; case Bytecodes::_ldc : // fall through case Bytecodes::_ldc_w : // fall through case Bytecodes::_ldc2_w : load_constant(); break; case Bytecodes::_iload : load_local(intType , s.get_index()); break; case Bytecodes::_lload : load_local(longType , s.get_index()); break; case Bytecodes::_fload : load_local(floatType , s.get_index()); break; case Bytecodes::_dload : load_local(doubleType , s.get_index()); break; case Bytecodes::_aload : load_local(instanceType, s.get_index()); break; case Bytecodes::_iload_0 : load_local(intType , 0); break; case Bytecodes::_iload_1 : load_local(intType , 1); break; case Bytecodes::_iload_2 : load_local(intType , 2); break; case Bytecodes::_iload_3 : load_local(intType , 3); break; case Bytecodes::_lload_0 : load_local(longType , 0); break; case Bytecodes::_lload_1 : load_local(longType , 1); break; case Bytecodes::_lload_2 : load_local(longType , 2); break; case Bytecodes::_lload_3 : load_local(longType , 3); break; case Bytecodes::_fload_0 : load_local(floatType , 0); break; case Bytecodes::_fload_1 : load_local(floatType , 1); break; case Bytecodes::_fload_2 : load_local(floatType , 2); break; case Bytecodes::_fload_3 : load_local(floatType , 3); break; case Bytecodes::_dload_0 : load_local(doubleType, 0); break; case Bytecodes::_dload_1 : load_local(doubleType, 1); break; case Bytecodes::_dload_2 : load_local(doubleType, 2); break; case Bytecodes::_dload_3 : load_local(doubleType, 3); break; case Bytecodes::_aload_0 : load_local(objectType, 0); break; case Bytecodes::_aload_1 : load_local(objectType, 1); break; case Bytecodes::_aload_2 : load_local(objectType, 2); break; case Bytecodes::_aload_3 : load_local(objectType, 3); break; case Bytecodes::_iaload : load_indexed(T_INT ); break; case Bytecodes::_laload : load_indexed(T_LONG ); break; case Bytecodes::_faload : load_indexed(T_FLOAT ); break; case Bytecodes::_daload : load_indexed(T_DOUBLE); break; case Bytecodes::_aaload : load_indexed(T_OBJECT); break; case Bytecodes::_baload : load_indexed(T_BYTE ); break; case Bytecodes::_caload : load_indexed(T_CHAR ); break; case Bytecodes::_saload : load_indexed(T_SHORT ); break; case Bytecodes::_istore : store_local(intType , s.get_index()); break; case Bytecodes::_lstore : store_local(longType , s.get_index()); break; case Bytecodes::_fstore : store_local(floatType , s.get_index()); break; case Bytecodes::_dstore : store_local(doubleType, s.get_index()); break; case Bytecodes::_astore : store_local(objectType, s.get_index()); break; case Bytecodes::_istore_0 : store_local(intType , 0); break; case Bytecodes::_istore_1 : store_local(intType , 1); break; case Bytecodes::_istore_2 : store_local(intType , 2); break; case Bytecodes::_istore_3 : store_local(intType , 3); break; case Bytecodes::_lstore_0 : store_local(longType , 0); break; case Bytecodes::_lstore_1 : store_local(longType , 1); break; case Bytecodes::_lstore_2 : store_local(longType , 2); break; case Bytecodes::_lstore_3 : store_local(longType , 3); break; case Bytecodes::_fstore_0 : store_local(floatType , 0); break; case Bytecodes::_fstore_1 : store_local(floatType , 1); break; case Bytecodes::_fstore_2 : store_local(floatType , 2); break; case Bytecodes::_fstore_3 : store_local(floatType , 3); break; case Bytecodes::_dstore_0 : store_local(doubleType, 0); break; case Bytecodes::_dstore_1 : store_local(doubleType, 1); break; case Bytecodes::_dstore_2 : store_local(doubleType, 2); break; case Bytecodes::_dstore_3 : store_local(doubleType, 3); break; case Bytecodes::_astore_0 : store_local(objectType, 0); break; case Bytecodes::_astore_1 : store_local(objectType, 1); break; case Bytecodes::_astore_2 : store_local(objectType, 2); break; case Bytecodes::_astore_3 : store_local(objectType, 3); break; case Bytecodes::_iastore : store_indexed(T_INT ); break; case Bytecodes::_lastore : store_indexed(T_LONG ); break; case Bytecodes::_fastore : store_indexed(T_FLOAT ); break; case Bytecodes::_dastore : store_indexed(T_DOUBLE); break; case Bytecodes::_aastore : store_indexed(T_OBJECT); break; case Bytecodes::_bastore : store_indexed(T_BYTE ); break; case Bytecodes::_castore : store_indexed(T_CHAR ); break; case Bytecodes::_sastore : store_indexed(T_SHORT ); break; case Bytecodes::_pop : // fall through case Bytecodes::_pop2 : // fall through case Bytecodes::_dup : // fall through case Bytecodes::_dup_x1 : // fall through case Bytecodes::_dup_x2 : // fall through case Bytecodes::_dup2 : // fall through case Bytecodes::_dup2_x1 : // fall through case Bytecodes::_dup2_x2 : // fall through case Bytecodes::_swap : stack_op(code); break; case Bytecodes::_iadd : arithmetic_op(intType , code); break; case Bytecodes::_ladd : arithmetic_op(longType , code); break; case Bytecodes::_fadd : arithmetic_op(floatType , code); break; case Bytecodes::_dadd : arithmetic_op(doubleType, code); break; case Bytecodes::_isub : arithmetic_op(intType , code); break; case Bytecodes::_lsub : arithmetic_op(longType , code); break; case Bytecodes::_fsub : arithmetic_op(floatType , code); break; case Bytecodes::_dsub : arithmetic_op(doubleType, code); break; case Bytecodes::_imul : arithmetic_op(intType , code); break; case Bytecodes::_lmul : arithmetic_op(longType , code); break; case Bytecodes::_fmul : arithmetic_op(floatType , code); break; case Bytecodes::_dmul : arithmetic_op(doubleType, code); break; case Bytecodes::_idiv : arithmetic_op(intType , code, copy_state_for_exception()); break; case Bytecodes::_ldiv : arithmetic_op(longType , code, copy_state_for_exception()); break; case Bytecodes::_fdiv : arithmetic_op(floatType , code); break; case Bytecodes::_ddiv : arithmetic_op(doubleType, code); break; case Bytecodes::_irem : arithmetic_op(intType , code, copy_state_for_exception()); break; case Bytecodes::_lrem : arithmetic_op(longType , code, copy_state_for_exception()); break; case Bytecodes::_frem : arithmetic_op(floatType , code); break; case Bytecodes::_drem : arithmetic_op(doubleType, code); break; case Bytecodes::_ineg : negate_op(intType ); break; case Bytecodes::_lneg : negate_op(longType ); break; case Bytecodes::_fneg : negate_op(floatType ); break; case Bytecodes::_dneg : negate_op(doubleType); break; case Bytecodes::_ishl : shift_op(intType , code); break; case Bytecodes::_lshl : shift_op(longType, code); break; case Bytecodes::_ishr : shift_op(intType , code); break; case Bytecodes::_lshr : shift_op(longType, code); break; case Bytecodes::_iushr : shift_op(intType , code); break; case Bytecodes::_lushr : shift_op(longType, code); break; case Bytecodes::_iand : logic_op(intType , code); break; case Bytecodes::_land : logic_op(longType, code); break; case Bytecodes::_ior : logic_op(intType , code); break; case Bytecodes::_lor : logic_op(longType, code); break; case Bytecodes::_ixor : logic_op(intType , code); break; case Bytecodes::_lxor : logic_op(longType, code); break; case Bytecodes::_iinc : increment(); break; case Bytecodes::_i2l : convert(code, T_INT , T_LONG ); break; case Bytecodes::_i2f : convert(code, T_INT , T_FLOAT ); break; case Bytecodes::_i2d : convert(code, T_INT , T_DOUBLE); break; case Bytecodes::_l2i : convert(code, T_LONG , T_INT ); break; case Bytecodes::_l2f : convert(code, T_LONG , T_FLOAT ); break; case Bytecodes::_l2d : convert(code, T_LONG , T_DOUBLE); break; case Bytecodes::_f2i : convert(code, T_FLOAT , T_INT ); break; case Bytecodes::_f2l : convert(code, T_FLOAT , T_LONG ); break; case Bytecodes::_f2d : convert(code, T_FLOAT , T_DOUBLE); break; case Bytecodes::_d2i : convert(code, T_DOUBLE, T_INT ); break; case Bytecodes::_d2l : convert(code, T_DOUBLE, T_LONG ); break; case Bytecodes::_d2f : convert(code, T_DOUBLE, T_FLOAT ); break; case Bytecodes::_i2b : convert(code, T_INT , T_BYTE ); break; case Bytecodes::_i2c : convert(code, T_INT , T_CHAR ); break; case Bytecodes::_i2s : convert(code, T_INT , T_SHORT ); break; case Bytecodes::_lcmp : compare_op(longType , code); break; case Bytecodes::_fcmpl : compare_op(floatType , code); break; case Bytecodes::_fcmpg : compare_op(floatType , code); break; case Bytecodes::_dcmpl : compare_op(doubleType, code); break; case Bytecodes::_dcmpg : compare_op(doubleType, code); break; case Bytecodes::_ifeq : if_zero(intType , If::eql); break; case Bytecodes::_ifne : if_zero(intType , If::neq); break; case Bytecodes::_iflt : if_zero(intType , If::lss); break; case Bytecodes::_ifge : if_zero(intType , If::geq); break; case Bytecodes::_ifgt : if_zero(intType , If::gtr); break; case Bytecodes::_ifle : if_zero(intType , If::leq); break; case Bytecodes::_if_icmpeq : if_same(intType , If::eql); break; case Bytecodes::_if_icmpne : if_same(intType , If::neq); break; case Bytecodes::_if_icmplt : if_same(intType , If::lss); break; case Bytecodes::_if_icmpge : if_same(intType , If::geq); break; case Bytecodes::_if_icmpgt : if_same(intType , If::gtr); break; case Bytecodes::_if_icmple : if_same(intType , If::leq); break; case Bytecodes::_if_acmpeq : if_same(objectType, If::eql); break; case Bytecodes::_if_acmpne : if_same(objectType, If::neq); break; case Bytecodes::_goto : _goto(s.cur_bci(), s.get_dest()); break; case Bytecodes::_jsr : jsr(s.get_dest()); break; case Bytecodes::_ret : ret(s.get_index()); break; case Bytecodes::_tableswitch : table_switch(); break; case Bytecodes::_lookupswitch : lookup_switch(); break; case Bytecodes::_ireturn : method_return(ipop()); break; case Bytecodes::_lreturn : method_return(lpop()); break; case Bytecodes::_freturn : method_return(fpop()); break; case Bytecodes::_dreturn : method_return(dpop()); break; case Bytecodes::_areturn : method_return(apop()); break; case Bytecodes::_return : method_return(NULL ); break; case Bytecodes::_getstatic : // fall through case Bytecodes::_putstatic : // fall through case Bytecodes::_getfield : // fall through case Bytecodes::_putfield : access_field(code); break; case Bytecodes::_invokevirtual : // fall through case Bytecodes::_invokespecial : // fall through case Bytecodes::_invokestatic : // fall through case Bytecodes::_invokedynamic : // fall through case Bytecodes::_invokeinterface: invoke(code); break; case Bytecodes::_new : new_instance(s.get_index_u2()); break; case Bytecodes::_newarray : new_type_array(); break; case Bytecodes::_anewarray : new_object_array(); break; case Bytecodes::_arraylength : { ValueStack* state_before = copy_state_for_exception(); ipush(append(new ArrayLength(apop(), state_before))); break; } case Bytecodes::_athrow : throw_op(s.cur_bci()); break; case Bytecodes::_checkcast : check_cast(s.get_index_u2()); break; case Bytecodes::_instanceof : instance_of(s.get_index_u2()); break; case Bytecodes::_monitorenter : monitorenter(apop(), s.cur_bci()); break; case Bytecodes::_monitorexit : monitorexit (apop(), s.cur_bci()); break; case Bytecodes::_wide : ShouldNotReachHere(); break; case Bytecodes::_multianewarray : new_multi_array(s.cur_bcp()[3]); break; case Bytecodes::_ifnull : if_null(objectType, If::eql); break; case Bytecodes::_ifnonnull : if_null(objectType, If::neq); break; case Bytecodes::_goto_w : _goto(s.cur_bci(), s.get_far_dest()); break; case Bytecodes::_jsr_w : jsr(s.get_far_dest()); break; case Bytecodes::_breakpoint : BAILOUT_("concurrent setting of breakpoint", NULL); default : ShouldNotReachHere(); break; } // save current bci to setup Goto at the end prev_bci = s.cur_bci(); } CHECK_BAILOUT_(NULL); // stop processing of this block (see try_inline_full) if (_skip_block) { _skip_block = false; assert(_last && _last->as_BlockEnd(), ""); return _last->as_BlockEnd(); } // if there are any, check if last instruction is a BlockEnd instruction BlockEnd* end = last()->as_BlockEnd(); if (end == NULL) { // all blocks must end with a BlockEnd instruction => add a Goto end = new Goto(block_at(s.cur_bci()), false); append(end); } assert(end == last()->as_BlockEnd(), "inconsistency"); assert(end->state() != NULL, "state must already be present"); assert(end->as_Return() == NULL || end->as_Throw() == NULL || end->state()->stack_size() == 0, "stack not needed for return and throw"); // connect to begin & set state // NOTE that inlining may have changed the block we are parsing block()->set_end(end); // propagate state for (int i = end->number_of_sux() - 1; i >= 0; i--) { BlockBegin* sux = end->sux_at(i); assert(sux->is_predecessor(block()), "predecessor missing"); // be careful, bailout if bytecodes are strange if (!sux->try_merge(end->state())) BAILOUT_("block join failed", NULL); scope_data()->add_to_work_list(end->sux_at(i)); } scope_data()->set_stream(NULL); // done return end; } void GraphBuilder::iterate_all_blocks(bool start_in_current_block_for_inlining) { do { if (start_in_current_block_for_inlining && !bailed_out()) { iterate_bytecodes_for_block(0); start_in_current_block_for_inlining = false; } else { BlockBegin* b; while ((b = scope_data()->remove_from_work_list()) != NULL) { if (!b->is_set(BlockBegin::was_visited_flag)) { if (b->is_set(BlockBegin::osr_entry_flag)) { // we're about to parse the osr entry block, so make sure // we setup the OSR edge leading into this block so that // Phis get setup correctly. setup_osr_entry_block(); // this is no longer the osr entry block, so clear it. b->clear(BlockBegin::osr_entry_flag); } b->set(BlockBegin::was_visited_flag); connect_to_end(b); } } } } while (!bailed_out() && !scope_data()->is_work_list_empty()); } bool GraphBuilder::_can_trap [Bytecodes::number_of_java_codes]; void GraphBuilder::initialize() { // the following bytecodes are assumed to potentially // throw exceptions in compiled code - note that e.g. // monitorexit & the return bytecodes do not throw // exceptions since monitor pairing proved that they // succeed (if monitor pairing succeeded) Bytecodes::Code can_trap_list[] = { Bytecodes::_ldc , Bytecodes::_ldc_w , Bytecodes::_ldc2_w , Bytecodes::_iaload , Bytecodes::_laload , Bytecodes::_faload , Bytecodes::_daload , Bytecodes::_aaload , Bytecodes::_baload , Bytecodes::_caload , Bytecodes::_saload , Bytecodes::_iastore , Bytecodes::_lastore , Bytecodes::_fastore , Bytecodes::_dastore , Bytecodes::_aastore , Bytecodes::_bastore , Bytecodes::_castore , Bytecodes::_sastore , Bytecodes::_idiv , Bytecodes::_ldiv , Bytecodes::_irem , Bytecodes::_lrem , Bytecodes::_getstatic , Bytecodes::_putstatic , Bytecodes::_getfield , Bytecodes::_putfield , Bytecodes::_invokevirtual , Bytecodes::_invokespecial , Bytecodes::_invokestatic , Bytecodes::_invokedynamic , Bytecodes::_invokeinterface , Bytecodes::_new , Bytecodes::_newarray , Bytecodes::_anewarray , Bytecodes::_arraylength , Bytecodes::_athrow , Bytecodes::_checkcast , Bytecodes::_instanceof , Bytecodes::_monitorenter , Bytecodes::_multianewarray }; // inititialize trap tables for (int i = 0; i < Bytecodes::number_of_java_codes; i++) { _can_trap[i] = false; } // set standard trap info for (uint j = 0; j < ARRAY_SIZE(can_trap_list); j++) { _can_trap[can_trap_list[j]] = true; } } BlockBegin* GraphBuilder::header_block(BlockBegin* entry, BlockBegin::Flag f, ValueStack* state) { assert(entry->is_set(f), "entry/flag mismatch"); // create header block BlockBegin* h = new BlockBegin(entry->bci()); h->set_depth_first_number(0); Value l = h; BlockEnd* g = new Goto(entry, false); l->set_next(g, entry->bci()); h->set_end(g); h->set(f); // setup header block end state ValueStack* s = state->copy(ValueStack::StateAfter, entry->bci()); // can use copy since stack is empty (=> no phis) assert(s->stack_is_empty(), "must have empty stack at entry point"); g->set_state(s); return h; } BlockBegin* GraphBuilder::setup_start_block(int osr_bci, BlockBegin* std_entry, BlockBegin* osr_entry, ValueStack* state) { BlockBegin* start = new BlockBegin(0); // This code eliminates the empty start block at the beginning of // each method. Previously, each method started with the // start-block created below, and this block was followed by the // header block that was always empty. This header block is only // necesary if std_entry is also a backward branch target because // then phi functions may be necessary in the header block. It's // also necessary when profiling so that there's a single block that // can increment the interpreter_invocation_count. BlockBegin* new_header_block; if (std_entry->number_of_preds() > 0 || count_invocations() || count_backedges()) { new_header_block = header_block(std_entry, BlockBegin::std_entry_flag, state); } else { new_header_block = std_entry; } // setup start block (root for the IR graph) Base* base = new Base( new_header_block, osr_entry ); start->set_next(base, 0); start->set_end(base); // create & setup state for start block start->set_state(state->copy(ValueStack::StateAfter, std_entry->bci())); base->set_state(state->copy(ValueStack::StateAfter, std_entry->bci())); if (base->std_entry()->state() == NULL) { // setup states for header blocks base->std_entry()->merge(state); } assert(base->std_entry()->state() != NULL, ""); return start; } void GraphBuilder::setup_osr_entry_block() { assert(compilation()->is_osr_compile(), "only for osrs"); int osr_bci = compilation()->osr_bci(); ciBytecodeStream s(method()); s.reset_to_bci(osr_bci); s.next(); scope_data()->set_stream(&s); // create a new block to be the osr setup code _osr_entry = new BlockBegin(osr_bci); _osr_entry->set(BlockBegin::osr_entry_flag); _osr_entry->set_depth_first_number(0); BlockBegin* target = bci2block()->at(osr_bci); assert(target != NULL && target->is_set(BlockBegin::osr_entry_flag), "must be there"); // the osr entry has no values for locals ValueStack* state = target->state()->copy(); _osr_entry->set_state(state); kill_all(); _block = _osr_entry; _state = _osr_entry->state()->copy(); assert(_state->bci() == osr_bci, "mismatch"); _last = _osr_entry; Value e = append(new OsrEntry()); e->set_needs_null_check(false); // OSR buffer is // // locals[nlocals-1..0] // monitors[number_of_locks-1..0] // // locals is a direct copy of the interpreter frame so in the osr buffer // so first slot in the local array is the last local from the interpreter // and last slot is local[0] (receiver) from the interpreter // // Similarly with locks. The first lock slot in the osr buffer is the nth lock // from the interpreter frame, the nth lock slot in the osr buffer is 0th lock // in the interpreter frame (the method lock if a sync method) // Initialize monitors in the compiled activation. int index; Value local; // find all the locals that the interpreter thinks contain live oops const BitMap live_oops = method()->live_local_oops_at_bci(osr_bci); // compute the offset into the locals so that we can treat the buffer // as if the locals were still in the interpreter frame int locals_offset = BytesPerWord * (method()->max_locals() - 1); for_each_local_value(state, index, local) { int offset = locals_offset - (index + local->type()->size() - 1) * BytesPerWord; Value get; if (local->type()->is_object_kind() && !live_oops.at(index)) { // The interpreter thinks this local is dead but the compiler // doesn't so pretend that the interpreter passed in null. get = append(new Constant(objectNull)); } else { get = append(new UnsafeGetRaw(as_BasicType(local->type()), e, append(new Constant(new IntConstant(offset))), 0, true /*unaligned*/, true /*wide*/)); } _state->store_local(index, get); } // the storage for the OSR buffer is freed manually in the LIRGenerator. assert(state->caller_state() == NULL, "should be top scope"); state->clear_locals(); Goto* g = new Goto(target, false); append(g); _osr_entry->set_end(g); target->merge(_osr_entry->end()->state()); scope_data()->set_stream(NULL); } ValueStack* GraphBuilder::state_at_entry() { ValueStack* state = new ValueStack(scope(), NULL); // Set up locals for receiver int idx = 0; if (!method()->is_static()) { // we should always see the receiver state->store_local(idx, new Local(method()->holder(), objectType, idx)); idx = 1; } // Set up locals for incoming arguments ciSignature* sig = method()->signature(); for (int i = 0; i < sig->count(); i++) { ciType* type = sig->type_at(i); BasicType basic_type = type->basic_type(); // don't allow T_ARRAY to propagate into locals types if (basic_type == T_ARRAY) basic_type = T_OBJECT; ValueType* vt = as_ValueType(basic_type); state->store_local(idx, new Local(type, vt, idx)); idx += type->size(); } // lock synchronized method if (method()->is_synchronized()) { state->lock(NULL); } return state; } GraphBuilder::GraphBuilder(Compilation* compilation, IRScope* scope) : _scope_data(NULL) , _instruction_count(0) , _osr_entry(NULL) , _memory(new MemoryBuffer()) , _compilation(compilation) , _inline_bailout_msg(NULL) { int osr_bci = compilation->osr_bci(); // determine entry points and bci2block mapping BlockListBuilder blm(compilation, scope, osr_bci); CHECK_BAILOUT(); BlockList* bci2block = blm.bci2block(); BlockBegin* start_block = bci2block->at(0); push_root_scope(scope, bci2block, start_block); // setup state for std entry _initial_state = state_at_entry(); start_block->merge(_initial_state); // complete graph _vmap = new ValueMap(); switch (scope->method()->intrinsic_id()) { case vmIntrinsics::_dabs : // fall through case vmIntrinsics::_dsqrt : // fall through case vmIntrinsics::_dsin : // fall through case vmIntrinsics::_dcos : // fall through case vmIntrinsics::_dtan : // fall through case vmIntrinsics::_dlog : // fall through case vmIntrinsics::_dlog10 : // fall through { // Compiles where the root method is an intrinsic need a special // compilation environment because the bytecodes for the method // shouldn't be parsed during the compilation, only the special // Intrinsic node should be emitted. If this isn't done the the // code for the inlined version will be different than the root // compiled version which could lead to monotonicity problems on // intel. // Set up a stream so that appending instructions works properly. ciBytecodeStream s(scope->method()); s.reset_to_bci(0); scope_data()->set_stream(&s); s.next(); // setup the initial block state _block = start_block; _state = start_block->state()->copy_for_parsing(); _last = start_block; load_local(doubleType, 0); // Emit the intrinsic node. bool result = try_inline_intrinsics(scope->method()); if (!result) BAILOUT("failed to inline intrinsic"); method_return(dpop()); // connect the begin and end blocks and we're all done. BlockEnd* end = last()->as_BlockEnd(); block()->set_end(end); break; } case vmIntrinsics::_Reference_get: { if (UseG1GC) { // With java.lang.ref.reference.get() we must go through the // intrinsic - when G1 is enabled - even when get() is the root // method of the compile so that, if necessary, the value in // the referent field of the reference object gets recorded by // the pre-barrier code. // Specifically, if G1 is enabled, the value in the referent // field is recorded by the G1 SATB pre barrier. This will // result in the referent being marked live and the reference // object removed from the list of discovered references during // reference processing. // Set up a stream so that appending instructions works properly. ciBytecodeStream s(scope->method()); s.reset_to_bci(0); scope_data()->set_stream(&s); s.next(); // setup the initial block state _block = start_block; _state = start_block->state()->copy_for_parsing(); _last = start_block; load_local(objectType, 0); // Emit the intrinsic node. bool result = try_inline_intrinsics(scope->method()); if (!result) BAILOUT("failed to inline intrinsic"); method_return(apop()); // connect the begin and end blocks and we're all done. BlockEnd* end = last()->as_BlockEnd(); block()->set_end(end); break; } // Otherwise, fall thru } default: scope_data()->add_to_work_list(start_block); iterate_all_blocks(); break; } CHECK_BAILOUT(); _start = setup_start_block(osr_bci, start_block, _osr_entry, _initial_state); eliminate_redundant_phis(_start); NOT_PRODUCT(if (PrintValueNumbering && Verbose) print_stats()); // for osr compile, bailout if some requirements are not fulfilled if (osr_bci != -1) { BlockBegin* osr_block = blm.bci2block()->at(osr_bci); assert(osr_block->is_set(BlockBegin::was_visited_flag),"osr entry must have been visited for osr compile"); // check if osr entry point has empty stack - we cannot handle non-empty stacks at osr entry points if (!osr_block->state()->stack_is_empty()) { BAILOUT("stack not empty at OSR entry point"); } } #ifndef PRODUCT if (PrintCompilation && Verbose) tty->print_cr("Created %d Instructions", _instruction_count); #endif } ValueStack* GraphBuilder::copy_state_before() { return copy_state_before_with_bci(bci()); } ValueStack* GraphBuilder::copy_state_exhandling() { return copy_state_exhandling_with_bci(bci()); } ValueStack* GraphBuilder::copy_state_for_exception() { return copy_state_for_exception_with_bci(bci()); } ValueStack* GraphBuilder::copy_state_before_with_bci(int bci) { return state()->copy(ValueStack::StateBefore, bci); } ValueStack* GraphBuilder::copy_state_exhandling_with_bci(int bci) { if (!has_handler()) return NULL; return state()->copy(ValueStack::StateBefore, bci); } ValueStack* GraphBuilder::copy_state_for_exception_with_bci(int bci) { ValueStack* s = copy_state_exhandling_with_bci(bci); if (s == NULL) { if (_compilation->env()->jvmti_can_access_local_variables()) { s = state()->copy(ValueStack::ExceptionState, bci); } else { s = state()->copy(ValueStack::EmptyExceptionState, bci); } } return s; } int GraphBuilder::recursive_inline_level(ciMethod* cur_callee) const { int recur_level = 0; for (IRScope* s = scope(); s != NULL; s = s->caller()) { if (s->method() == cur_callee) { ++recur_level; } } return recur_level; } bool GraphBuilder::try_inline(ciMethod* callee, bool holder_known) { // Clear out any existing inline bailout condition clear_inline_bailout(); if (callee->should_exclude()) { // callee is excluded INLINE_BAILOUT("excluded by CompilerOracle") } else if (!callee->can_be_compiled()) { // callee is not compilable (prob. has breakpoints) INLINE_BAILOUT("not compilable") } else if (callee->intrinsic_id() != vmIntrinsics::_none && try_inline_intrinsics(callee)) { // intrinsics can be native or not return true; } else if (callee->is_native()) { // non-intrinsic natives cannot be inlined INLINE_BAILOUT("non-intrinsic native") } else if (callee->is_abstract()) { INLINE_BAILOUT("abstract") } else { return try_inline_full(callee, holder_known); } } bool GraphBuilder::try_inline_intrinsics(ciMethod* callee) { if (!InlineNatives ) INLINE_BAILOUT("intrinsic method inlining disabled"); if (callee->is_synchronized()) { // We don't currently support any synchronized intrinsics return false; } // callee seems like a good candidate // determine id bool preserves_state = false; bool cantrap = true; vmIntrinsics::ID id = callee->intrinsic_id(); switch (id) { case vmIntrinsics::_arraycopy : if (!InlineArrayCopy) return false; break; case vmIntrinsics::_currentTimeMillis: case vmIntrinsics::_nanoTime: preserves_state = true; cantrap = false; break; case vmIntrinsics::_floatToRawIntBits : case vmIntrinsics::_intBitsToFloat : case vmIntrinsics::_doubleToRawLongBits : case vmIntrinsics::_longBitsToDouble : if (!InlineMathNatives) return false; preserves_state = true; cantrap = false; break; case vmIntrinsics::_getClass : if (!InlineClassNatives) return false; preserves_state = true; break; case vmIntrinsics::_currentThread : if (!InlineThreadNatives) return false; preserves_state = true; cantrap = false; break; case vmIntrinsics::_dabs : // fall through case vmIntrinsics::_dsqrt : // fall through case vmIntrinsics::_dsin : // fall through case vmIntrinsics::_dcos : // fall through case vmIntrinsics::_dtan : // fall through case vmIntrinsics::_dlog : // fall through case vmIntrinsics::_dlog10 : // fall through if (!InlineMathNatives) return false; cantrap = false; preserves_state = true; break; // sun/misc/AtomicLong.attemptUpdate case vmIntrinsics::_attemptUpdate : if (!VM_Version::supports_cx8()) return false; if (!InlineAtomicLong) return false; preserves_state = true; break; // Use special nodes for Unsafe instructions so we can more easily // perform an address-mode optimization on the raw variants case vmIntrinsics::_getObject : return append_unsafe_get_obj(callee, T_OBJECT, false); case vmIntrinsics::_getBoolean: return append_unsafe_get_obj(callee, T_BOOLEAN, false); case vmIntrinsics::_getByte : return append_unsafe_get_obj(callee, T_BYTE, false); case vmIntrinsics::_getShort : return append_unsafe_get_obj(callee, T_SHORT, false); case vmIntrinsics::_getChar : return append_unsafe_get_obj(callee, T_CHAR, false); case vmIntrinsics::_getInt : return append_unsafe_get_obj(callee, T_INT, false); case vmIntrinsics::_getLong : return append_unsafe_get_obj(callee, T_LONG, false); case vmIntrinsics::_getFloat : return append_unsafe_get_obj(callee, T_FLOAT, false); case vmIntrinsics::_getDouble : return append_unsafe_get_obj(callee, T_DOUBLE, false); case vmIntrinsics::_putObject : return append_unsafe_put_obj(callee, T_OBJECT, false); case vmIntrinsics::_putBoolean: return append_unsafe_put_obj(callee, T_BOOLEAN, false); case vmIntrinsics::_putByte : return append_unsafe_put_obj(callee, T_BYTE, false); case vmIntrinsics::_putShort : return append_unsafe_put_obj(callee, T_SHORT, false); case vmIntrinsics::_putChar : return append_unsafe_put_obj(callee, T_CHAR, false); case vmIntrinsics::_putInt : return append_unsafe_put_obj(callee, T_INT, false); case vmIntrinsics::_putLong : return append_unsafe_put_obj(callee, T_LONG, false); case vmIntrinsics::_putFloat : return append_unsafe_put_obj(callee, T_FLOAT, false); case vmIntrinsics::_putDouble : return append_unsafe_put_obj(callee, T_DOUBLE, false); case vmIntrinsics::_getObjectVolatile : return append_unsafe_get_obj(callee, T_OBJECT, true); case vmIntrinsics::_getBooleanVolatile: return append_unsafe_get_obj(callee, T_BOOLEAN, true); case vmIntrinsics::_getByteVolatile : return append_unsafe_get_obj(callee, T_BYTE, true); case vmIntrinsics::_getShortVolatile : return append_unsafe_get_obj(callee, T_SHORT, true); case vmIntrinsics::_getCharVolatile : return append_unsafe_get_obj(callee, T_CHAR, true); case vmIntrinsics::_getIntVolatile : return append_unsafe_get_obj(callee, T_INT, true); case vmIntrinsics::_getLongVolatile : return append_unsafe_get_obj(callee, T_LONG, true); case vmIntrinsics::_getFloatVolatile : return append_unsafe_get_obj(callee, T_FLOAT, true); case vmIntrinsics::_getDoubleVolatile : return append_unsafe_get_obj(callee, T_DOUBLE, true); case vmIntrinsics::_putObjectVolatile : return append_unsafe_put_obj(callee, T_OBJECT, true); case vmIntrinsics::_putBooleanVolatile: return append_unsafe_put_obj(callee, T_BOOLEAN, true); case vmIntrinsics::_putByteVolatile : return append_unsafe_put_obj(callee, T_BYTE, true); case vmIntrinsics::_putShortVolatile : return append_unsafe_put_obj(callee, T_SHORT, true); case vmIntrinsics::_putCharVolatile : return append_unsafe_put_obj(callee, T_CHAR, true); case vmIntrinsics::_putIntVolatile : return append_unsafe_put_obj(callee, T_INT, true); case vmIntrinsics::_putLongVolatile : return append_unsafe_put_obj(callee, T_LONG, true); case vmIntrinsics::_putFloatVolatile : return append_unsafe_put_obj(callee, T_FLOAT, true); case vmIntrinsics::_putDoubleVolatile : return append_unsafe_put_obj(callee, T_DOUBLE, true); case vmIntrinsics::_getByte_raw : return append_unsafe_get_raw(callee, T_BYTE); case vmIntrinsics::_getShort_raw : return append_unsafe_get_raw(callee, T_SHORT); case vmIntrinsics::_getChar_raw : return append_unsafe_get_raw(callee, T_CHAR); case vmIntrinsics::_getInt_raw : return append_unsafe_get_raw(callee, T_INT); case vmIntrinsics::_getLong_raw : return append_unsafe_get_raw(callee, T_LONG); case vmIntrinsics::_getFloat_raw : return append_unsafe_get_raw(callee, T_FLOAT); case vmIntrinsics::_getDouble_raw : return append_unsafe_get_raw(callee, T_DOUBLE); case vmIntrinsics::_putByte_raw : return append_unsafe_put_raw(callee, T_BYTE); case vmIntrinsics::_putShort_raw : return append_unsafe_put_raw(callee, T_SHORT); case vmIntrinsics::_putChar_raw : return append_unsafe_put_raw(callee, T_CHAR); case vmIntrinsics::_putInt_raw : return append_unsafe_put_raw(callee, T_INT); case vmIntrinsics::_putLong_raw : return append_unsafe_put_raw(callee, T_LONG); case vmIntrinsics::_putFloat_raw : return append_unsafe_put_raw(callee, T_FLOAT); case vmIntrinsics::_putDouble_raw : return append_unsafe_put_raw(callee, T_DOUBLE); case vmIntrinsics::_prefetchRead : return append_unsafe_prefetch(callee, false, false); case vmIntrinsics::_prefetchWrite : return append_unsafe_prefetch(callee, false, true); case vmIntrinsics::_prefetchReadStatic : return append_unsafe_prefetch(callee, true, false); case vmIntrinsics::_prefetchWriteStatic : return append_unsafe_prefetch(callee, true, true); case vmIntrinsics::_checkIndex : if (!InlineNIOCheckIndex) return false; preserves_state = true; break; case vmIntrinsics::_putOrderedObject : return append_unsafe_put_obj(callee, T_OBJECT, true); case vmIntrinsics::_putOrderedInt : return append_unsafe_put_obj(callee, T_INT, true); case vmIntrinsics::_putOrderedLong : return append_unsafe_put_obj(callee, T_LONG, true); case vmIntrinsics::_compareAndSwapLong: if (!VM_Version::supports_cx8()) return false; // fall through case vmIntrinsics::_compareAndSwapInt: case vmIntrinsics::_compareAndSwapObject: append_unsafe_CAS(callee); return true; case vmIntrinsics::_Reference_get: // It is only when G1 is enabled that we absolutely // need to use the intrinsic version of Reference.get() // so that the value in the referent field, if necessary, // can be registered by the pre-barrier code. if (!UseG1GC) return false; preserves_state = true; break; default : return false; // do not inline } // create intrinsic node const bool has_receiver = !callee->is_static(); ValueType* result_type = as_ValueType(callee->return_type()); ValueStack* state_before = copy_state_for_exception(); Values* args = state()->pop_arguments(callee->arg_size()); if (is_profiling()) { // Don't profile in the special case where the root method // is the intrinsic if (callee != method()) { // Note that we'd collect profile data in this method if we wanted it. compilation()->set_would_profile(true); if (profile_calls()) { Value recv = NULL; if (has_receiver) { recv = args->at(0); null_check(recv); } profile_call(recv, NULL); } } } Intrinsic* result = new Intrinsic(result_type, id, args, has_receiver, state_before, preserves_state, cantrap); // append instruction & push result Value value = append_split(result); if (result_type != voidType) push(result_type, value); #ifndef PRODUCT // printing if (PrintInlining) { print_inline_result(callee, true); } #endif // done return true; } bool GraphBuilder::try_inline_jsr(int jsr_dest_bci) { // Introduce a new callee continuation point - all Ret instructions // will be replaced with Gotos to this point. BlockBegin* cont = block_at(next_bci()); assert(cont != NULL, "continuation must exist (BlockListBuilder starts a new block after a jsr"); // Note: can not assign state to continuation yet, as we have to // pick up the state from the Ret instructions. // Push callee scope push_scope_for_jsr(cont, jsr_dest_bci); // Temporarily set up bytecode stream so we can append instructions // (only using the bci of this stream) scope_data()->set_stream(scope_data()->parent()->stream()); BlockBegin* jsr_start_block = block_at(jsr_dest_bci); assert(jsr_start_block != NULL, "jsr start block must exist"); assert(!jsr_start_block->is_set(BlockBegin::was_visited_flag), "should not have visited jsr yet"); Goto* goto_sub = new Goto(jsr_start_block, false); // Must copy state to avoid wrong sharing when parsing bytecodes assert(jsr_start_block->state() == NULL, "should have fresh jsr starting block"); jsr_start_block->set_state(copy_state_before_with_bci(jsr_dest_bci)); append(goto_sub); _block->set_end(goto_sub); _last = _block = jsr_start_block; // Clear out bytecode stream scope_data()->set_stream(NULL); scope_data()->add_to_work_list(jsr_start_block); // Ready to resume parsing in subroutine iterate_all_blocks(); // If we bailed out during parsing, return immediately (this is bad news) CHECK_BAILOUT_(false); // Detect whether the continuation can actually be reached. If not, // it has not had state set by the join() operations in // iterate_bytecodes_for_block()/ret() and we should not touch the // iteration state. The calling activation of // iterate_bytecodes_for_block will then complete normally. if (cont->state() != NULL) { if (!cont->is_set(BlockBegin::was_visited_flag)) { // add continuation to work list instead of parsing it immediately scope_data()->parent()->add_to_work_list(cont); } } assert(jsr_continuation() == cont, "continuation must not have changed"); assert(!jsr_continuation()->is_set(BlockBegin::was_visited_flag) || jsr_continuation()->is_set(BlockBegin::parser_loop_header_flag), "continuation can only be visited in case of backward branches"); assert(_last && _last->as_BlockEnd(), "block must have end"); // continuation is in work list, so end iteration of current block _skip_block = true; pop_scope_for_jsr(); return true; } // Inline the entry of a synchronized method as a monitor enter and // register the exception handler which releases the monitor if an // exception is thrown within the callee. Note that the monitor enter // cannot throw an exception itself, because the receiver is // guaranteed to be non-null by the explicit null check at the // beginning of inlining. void GraphBuilder::inline_sync_entry(Value lock, BlockBegin* sync_handler) { assert(lock != NULL && sync_handler != NULL, "lock or handler missing"); monitorenter(lock, SynchronizationEntryBCI); assert(_last->as_MonitorEnter() != NULL, "monitor enter expected"); _last->set_needs_null_check(false); sync_handler->set(BlockBegin::exception_entry_flag); sync_handler->set(BlockBegin::is_on_work_list_flag); ciExceptionHandler* desc = new ciExceptionHandler(method()->holder(), 0, method()->code_size(), -1, 0); XHandler* h = new XHandler(desc); h->set_entry_block(sync_handler); scope_data()->xhandlers()->append(h); scope_data()->set_has_handler(); } // If an exception is thrown and not handled within an inlined // synchronized method, the monitor must be released before the // exception is rethrown in the outer scope. Generate the appropriate // instructions here. void GraphBuilder::fill_sync_handler(Value lock, BlockBegin* sync_handler, bool default_handler) { BlockBegin* orig_block = _block; ValueStack* orig_state = _state; Instruction* orig_last = _last; _last = _block = sync_handler; _state = sync_handler->state()->copy(); assert(sync_handler != NULL, "handler missing"); assert(!sync_handler->is_set(BlockBegin::was_visited_flag), "is visited here"); assert(lock != NULL || default_handler, "lock or handler missing"); XHandler* h = scope_data()->xhandlers()->remove_last(); assert(h->entry_block() == sync_handler, "corrupt list of handlers"); block()->set(BlockBegin::was_visited_flag); Value exception = append_with_bci(new ExceptionObject(), SynchronizationEntryBCI); assert(exception->is_pinned(), "must be"); int bci = SynchronizationEntryBCI; if (compilation()->env()->dtrace_method_probes()) { // Report exit from inline methods. We don't have a stream here // so pass an explicit bci of SynchronizationEntryBCI. Values* args = new Values(1); args->push(append_with_bci(new Constant(new ObjectConstant(method())), bci)); append_with_bci(new RuntimeCall(voidType, "dtrace_method_exit", CAST_FROM_FN_PTR(address, SharedRuntime::dtrace_method_exit), args), bci); } if (lock) { assert(state()->locks_size() > 0 && state()->lock_at(state()->locks_size() - 1) == lock, "lock is missing"); if (!lock->is_linked()) { lock = append_with_bci(lock, bci); } // exit the monitor in the context of the synchronized method monitorexit(lock, bci); // exit the context of the synchronized method if (!default_handler) { pop_scope(); bci = _state->caller_state()->bci(); _state = _state->caller_state()->copy_for_parsing(); } } // perform the throw as if at the the call site apush(exception); throw_op(bci); BlockEnd* end = last()->as_BlockEnd(); block()->set_end(end); _block = orig_block; _state = orig_state; _last = orig_last; } bool GraphBuilder::try_inline_full(ciMethod* callee, bool holder_known) { assert(!callee->is_native(), "callee must not be native"); if (count_backedges() && callee->has_loops()) { INLINE_BAILOUT("too complex for tiered"); } // first perform tests of things it's not possible to inline if (callee->has_exception_handlers() && !InlineMethodsWithExceptionHandlers) INLINE_BAILOUT("callee has exception handlers"); if (callee->is_synchronized() && !InlineSynchronizedMethods ) INLINE_BAILOUT("callee is synchronized"); if (!callee->holder()->is_initialized()) INLINE_BAILOUT("callee's klass not initialized yet"); if (!callee->has_balanced_monitors()) INLINE_BAILOUT("callee's monitors do not match"); // Proper inlining of methods with jsrs requires a little more work. if (callee->has_jsrs() ) INLINE_BAILOUT("jsrs not handled properly by inliner yet"); // now perform tests that are based on flag settings if (inline_level() > MaxInlineLevel ) INLINE_BAILOUT("too-deep inlining"); if (recursive_inline_level(callee) > MaxRecursiveInlineLevel) INLINE_BAILOUT("too-deep recursive inlining"); if (callee->code_size() > max_inline_size() ) INLINE_BAILOUT("callee is too large"); // don't inline throwable methods unless the inlining tree is rooted in a throwable class if (callee->name() == ciSymbol::object_initializer_name() && callee->holder()->is_subclass_of(ciEnv::current()->Throwable_klass())) { // Throwable constructor call IRScope* top = scope(); while (top->caller() != NULL) { top = top->caller(); } if (!top->method()->holder()->is_subclass_of(ciEnv::current()->Throwable_klass())) { INLINE_BAILOUT("don't inline Throwable constructors"); } } // When SSE2 is used on intel, then no special handling is needed // for strictfp because the enum-constant is fixed at compile time, // the check for UseSSE2 is needed here if (strict_fp_requires_explicit_rounding && UseSSE < 2 && method()->is_strict() != callee->is_strict()) { INLINE_BAILOUT("caller and callee have different strict fp requirements"); } if (compilation()->env()->num_inlined_bytecodes() > DesiredMethodLimit) { INLINE_BAILOUT("total inlining greater than DesiredMethodLimit"); } if (is_profiling() && !callee->ensure_method_data()) { INLINE_BAILOUT("mdo allocation failed"); } #ifndef PRODUCT // printing if (PrintInlining) { print_inline_result(callee, true); } #endif // NOTE: Bailouts from this point on, which occur at the // GraphBuilder level, do not cause bailout just of the inlining but // in fact of the entire compilation. BlockBegin* orig_block = block(); const int args_base = state()->stack_size() - callee->arg_size(); assert(args_base >= 0, "stack underflow during inlining"); // Insert null check if necessary Value recv = NULL; if (code() != Bytecodes::_invokestatic) { // note: null check must happen even if first instruction of callee does // an implicit null check since the callee is in a different scope // and we must make sure exception handling does the right thing assert(!callee->is_static(), "callee must not be static"); assert(callee->arg_size() > 0, "must have at least a receiver"); recv = state()->stack_at(args_base); null_check(recv); } if (is_profiling()) { // Note that we'd collect profile data in this method if we wanted it. // this may be redundant here... compilation()->set_would_profile(true); if (profile_calls()) { profile_call(recv, holder_known ? callee->holder() : NULL); } if (profile_inlined_calls()) { profile_invocation(callee, copy_state_before()); } } // Introduce a new callee continuation point - if the callee has // more than one return instruction or the return does not allow // fall-through of control flow, all return instructions of the // callee will need to be replaced by Goto's pointing to this // continuation point. BlockBegin* cont = block_at(next_bci()); bool continuation_existed = true; if (cont == NULL) { cont = new BlockBegin(next_bci()); // low number so that continuation gets parsed as early as possible cont->set_depth_first_number(0); #ifndef PRODUCT if (PrintInitialBlockList) { tty->print_cr("CFG: created block %d (bci %d) as continuation for inline at bci %d", cont->block_id(), cont->bci(), bci()); } #endif continuation_existed = false; } // Record number of predecessors of continuation block before // inlining, to detect if inlined method has edges to its // continuation after inlining. int continuation_preds = cont->number_of_preds(); // Push callee scope push_scope(callee, cont); // the BlockListBuilder for the callee could have bailed out CHECK_BAILOUT_(false); // Temporarily set up bytecode stream so we can append instructions // (only using the bci of this stream) scope_data()->set_stream(scope_data()->parent()->stream()); // Pass parameters into callee state: add assignments // note: this will also ensure that all arguments are computed before being passed ValueStack* callee_state = state(); ValueStack* caller_state = state()->caller_state(); { int i = args_base; while (i < caller_state->stack_size()) { const int par_no = i - args_base; Value arg = caller_state->stack_at_inc(i); // NOTE: take base() of arg->type() to avoid problems storing // constants store_local(callee_state, arg, arg->type()->base(), par_no); } } // Remove args from stack. // Note that we preserve locals state in case we can use it later // (see use of pop_scope() below) caller_state->truncate_stack(args_base); assert(callee_state->stack_size() == 0, "callee stack must be empty"); Value lock; BlockBegin* sync_handler; // Inline the locking of the receiver if the callee is synchronized if (callee->is_synchronized()) { lock = callee->is_static() ? append(new Constant(new InstanceConstant(callee->holder()->java_mirror()))) : state()->local_at(0); sync_handler = new BlockBegin(SynchronizationEntryBCI); inline_sync_entry(lock, sync_handler); } if (compilation()->env()->dtrace_method_probes()) { Values* args = new Values(1); args->push(append(new Constant(new ObjectConstant(method())))); append(new RuntimeCall(voidType, "dtrace_method_entry", CAST_FROM_FN_PTR(address, SharedRuntime::dtrace_method_entry), args)); } BlockBegin* callee_start_block = block_at(0); if (callee_start_block != NULL) { assert(callee_start_block->is_set(BlockBegin::parser_loop_header_flag), "must be loop header"); Goto* goto_callee = new Goto(callee_start_block, false); // The state for this goto is in the scope of the callee, so use // the entry bci for the callee instead of the call site bci. append_with_bci(goto_callee, 0); _block->set_end(goto_callee); callee_start_block->merge(callee_state); _last = _block = callee_start_block; scope_data()->add_to_work_list(callee_start_block); } // Clear out bytecode stream scope_data()->set_stream(NULL); // Ready to resume parsing in callee (either in the same block we // were in before or in the callee's start block) iterate_all_blocks(callee_start_block == NULL); // If we bailed out during parsing, return immediately (this is bad news) if (bailed_out()) return false; // iterate_all_blocks theoretically traverses in random order; in // practice, we have only traversed the continuation if we are // inlining into a subroutine assert(continuation_existed || !continuation()->is_set(BlockBegin::was_visited_flag), "continuation should not have been parsed yet if we created it"); // If we bailed out during parsing, return immediately (this is bad news) CHECK_BAILOUT_(false); // At this point we are almost ready to return and resume parsing of // the caller back in the GraphBuilder. The only thing we want to do // first is an optimization: during parsing of the callee we // generated at least one Goto to the continuation block. If we // generated exactly one, and if the inlined method spanned exactly // one block (and we didn't have to Goto its entry), then we snip // off the Goto to the continuation, allowing control to fall // through back into the caller block and effectively performing // block merging. This allows load elimination and CSE to take place // across multiple callee scopes if they are relatively simple, and // is currently essential to making inlining profitable. if ( num_returns() == 1 && block() == orig_block && block() == inline_cleanup_block()) { _last = inline_cleanup_return_prev(); _state = inline_cleanup_state(); } else if (continuation_preds == cont->number_of_preds()) { // Inlining caused that the instructions after the invoke in the // caller are not reachable any more. So skip filling this block // with instructions! assert (cont == continuation(), ""); assert(_last && _last->as_BlockEnd(), ""); _skip_block = true; } else { // Resume parsing in continuation block unless it was already parsed. // Note that if we don't change _last here, iteration in // iterate_bytecodes_for_block will stop when we return. if (!continuation()->is_set(BlockBegin::was_visited_flag)) { // add continuation to work list instead of parsing it immediately assert(_last && _last->as_BlockEnd(), ""); scope_data()->parent()->add_to_work_list(continuation()); _skip_block = true; } } // Fill the exception handler for synchronized methods with instructions if (callee->is_synchronized() && sync_handler->state() != NULL) { fill_sync_handler(lock, sync_handler); } else { pop_scope(); } compilation()->notice_inlined_method(callee); return true; } void GraphBuilder::inline_bailout(const char* msg) { assert(msg != NULL, "inline bailout msg must exist"); _inline_bailout_msg = msg; } void GraphBuilder::clear_inline_bailout() { _inline_bailout_msg = NULL; } void GraphBuilder::push_root_scope(IRScope* scope, BlockList* bci2block, BlockBegin* start) { ScopeData* data = new ScopeData(NULL); data->set_scope(scope); data->set_bci2block(bci2block); _scope_data = data; _block = start; } void GraphBuilder::push_scope(ciMethod* callee, BlockBegin* continuation) { IRScope* callee_scope = new IRScope(compilation(), scope(), bci(), callee, -1, false); scope()->add_callee(callee_scope); BlockListBuilder blb(compilation(), callee_scope, -1); CHECK_BAILOUT(); if (!blb.bci2block()->at(0)->is_set(BlockBegin::parser_loop_header_flag)) { // this scope can be inlined directly into the caller so remove // the block at bci 0. blb.bci2block()->at_put(0, NULL); } set_state(new ValueStack(callee_scope, state()->copy(ValueStack::CallerState, bci()))); ScopeData* data = new ScopeData(scope_data()); data->set_scope(callee_scope); data->set_bci2block(blb.bci2block()); data->set_continuation(continuation); _scope_data = data; } void GraphBuilder::push_scope_for_jsr(BlockBegin* jsr_continuation, int jsr_dest_bci) { ScopeData* data = new ScopeData(scope_data()); data->set_parsing_jsr(); data->set_jsr_entry_bci(jsr_dest_bci); data->set_jsr_return_address_local(-1); // Must clone bci2block list as we will be mutating it in order to // properly clone all blocks in jsr region as well as exception // handlers containing rets BlockList* new_bci2block = new BlockList(bci2block()->length()); new_bci2block->push_all(bci2block()); data->set_bci2block(new_bci2block); data->set_scope(scope()); data->setup_jsr_xhandlers(); data->set_continuation(continuation()); data->set_jsr_continuation(jsr_continuation); _scope_data = data; } void GraphBuilder::pop_scope() { int number_of_locks = scope()->number_of_locks(); _scope_data = scope_data()->parent(); // accumulate minimum number of monitor slots to be reserved scope()->set_min_number_of_locks(number_of_locks); } void GraphBuilder::pop_scope_for_jsr() { _scope_data = scope_data()->parent(); } bool GraphBuilder::append_unsafe_get_obj(ciMethod* callee, BasicType t, bool is_volatile) { if (InlineUnsafeOps) { Values* args = state()->pop_arguments(callee->arg_size()); null_check(args->at(0)); Instruction* offset = args->at(2); #ifndef _LP64 offset = append(new Convert(Bytecodes::_l2i, offset, as_ValueType(T_INT))); #endif Instruction* op = append(new UnsafeGetObject(t, args->at(1), offset, is_volatile)); push(op->type(), op); compilation()->set_has_unsafe_access(true); } return InlineUnsafeOps; } bool GraphBuilder::append_unsafe_put_obj(ciMethod* callee, BasicType t, bool is_volatile) { if (InlineUnsafeOps) { Values* args = state()->pop_arguments(callee->arg_size()); null_check(args->at(0)); Instruction* offset = args->at(2); #ifndef _LP64 offset = append(new Convert(Bytecodes::_l2i, offset, as_ValueType(T_INT))); #endif Instruction* op = append(new UnsafePutObject(t, args->at(1), offset, args->at(3), is_volatile)); compilation()->set_has_unsafe_access(true); kill_all(); } return InlineUnsafeOps; } bool GraphBuilder::append_unsafe_get_raw(ciMethod* callee, BasicType t) { if (InlineUnsafeOps) { Values* args = state()->pop_arguments(callee->arg_size()); null_check(args->at(0)); Instruction* op = append(new UnsafeGetRaw(t, args->at(1), false)); push(op->type(), op); compilation()->set_has_unsafe_access(true); } return InlineUnsafeOps; } bool GraphBuilder::append_unsafe_put_raw(ciMethod* callee, BasicType t) { if (InlineUnsafeOps) { Values* args = state()->pop_arguments(callee->arg_size()); null_check(args->at(0)); Instruction* op = append(new UnsafePutRaw(t, args->at(1), args->at(2))); compilation()->set_has_unsafe_access(true); } return InlineUnsafeOps; } bool GraphBuilder::append_unsafe_prefetch(ciMethod* callee, bool is_static, bool is_store) { if (InlineUnsafeOps) { Values* args = state()->pop_arguments(callee->arg_size()); int obj_arg_index = 1; // Assume non-static case if (is_static) { obj_arg_index = 0; } else { null_check(args->at(0)); } Instruction* offset = args->at(obj_arg_index + 1); #ifndef _LP64 offset = append(new Convert(Bytecodes::_l2i, offset, as_ValueType(T_INT))); #endif Instruction* op = is_store ? append(new UnsafePrefetchWrite(args->at(obj_arg_index), offset)) : append(new UnsafePrefetchRead (args->at(obj_arg_index), offset)); compilation()->set_has_unsafe_access(true); } return InlineUnsafeOps; } void GraphBuilder::append_unsafe_CAS(ciMethod* callee) { ValueStack* state_before = copy_state_for_exception(); ValueType* result_type = as_ValueType(callee->return_type()); assert(result_type->is_int(), "int result"); Values* args = state()->pop_arguments(callee->arg_size()); // Pop off some args to speically handle, then push back Value newval = args->pop(); Value cmpval = args->pop(); Value offset = args->pop(); Value src = args->pop(); Value unsafe_obj = args->pop(); // Separately handle the unsafe arg. It is not needed for code // generation, but must be null checked null_check(unsafe_obj); #ifndef _LP64 offset = append(new Convert(Bytecodes::_l2i, offset, as_ValueType(T_INT))); #endif args->push(src); args->push(offset); args->push(cmpval); args->push(newval); // An unsafe CAS can alias with other field accesses, but we don't // know which ones so mark the state as no preserved. This will // cause CSE to invalidate memory across it. bool preserves_state = false; Intrinsic* result = new Intrinsic(result_type, callee->intrinsic_id(), args, false, state_before, preserves_state); append_split(result); push(result_type, result); compilation()->set_has_unsafe_access(true); } #ifndef PRODUCT void GraphBuilder::print_inline_result(ciMethod* callee, bool res) { CompileTask::print_inlining(callee, scope()->level(), bci(), _inline_bailout_msg); if (res && CIPrintMethodCodes) { callee->print_codes(); } } void GraphBuilder::print_stats() { vmap()->print(); } #endif // PRODUCT void GraphBuilder::profile_call(Value recv, ciKlass* known_holder) { append(new ProfileCall(method(), bci(), recv, known_holder)); } void GraphBuilder::profile_invocation(ciMethod* callee, ValueStack* state) { append(new ProfileInvoke(callee, state)); }
PAGE 75, 132 TITLE Lunar_Lander - John Lockwood - 3/97 COMMENT % LUNAR LANDER ------------------- ECE291: Machine Problem 4 Prof. John W. Lockwood Unversity of Illinois, Dept. of Electrical & Computer Engineering Spring 1997 Documentation: http://www.ece.uiuc.edu/~ece291/mp/mp4/mp4.html Revision 1.0 % ;====== Constants ========================================================= VIDTXTSEG EQU 0B800h ; VGA Video Segment Adddress (Text Mode) ;====== Externals ========================================================= ; -- LIB291 Routines (Free) --- extrn dspmsg:near, binasc:near, kbdin:near ; -- LIBMP4 Routines (You need to write these) extern InstTime:near ; Remove this line to use your own code extern MyTimeInt:near ; Remove this line to use your own code extern DeInstallTime:near ; Remove this line to use your own code extern InstKey:near ; Remove this line to use your own code extern MyKeyInt:near ; Remove this line to use your own code extern DeInstallKey:near ; Remove this line to use your own code extern DrawScreen:near ; Remove this line to use your own code extern ReDrawScreen:near ; Remove this line to use your own code extern FinalScreen:near ; Remove this line to use your own code extern MainLIB:near ; Remove this line to use your own code extern mp4xit:near ;====== Stack ============================================================ stkseg segment stack db 64 dup ('STACK ') stkseg ends ;====== Begin Code/Data segment ========================================== cseg segment public assume cs:cseg, ds:cseg, ss:stkseg, es:nothing ;====== Variables ======================================================== x dw 0 ; Horizontal Position (1/324 m) v_x dw 18 ; Horizontal Velocity (1/18 m/s) a_x dw 0 ; Horizontal Acceleration (m/s^2) y dw 60*324 ; Vertical Position (1/324 m) v_y dw 0 ; Vertical Velocity (1/18 m/s) a_y dw 0 ; Vertical Acceleration (m/s^s) G dw 3 ; Gravity (m/s^2) T dw 0 ; Main Thruster (m/s^2) TL dw 0 ; Left Thruster (m/s^2) TR dw 0 ; Right Thruster (m/s^2) Time dw 0 ; Flight Time (1/18 sec) Fuel_Init dw 2000 ; Initial Amount of Fuel (Full Tank) fuel dw ? ExitFlag db 0 ; 0=Run, 1=Exit - Set by keyboard Interrupt handler PUBLIC x,v_x,a_x,y,v_y,a_y,G,T,TL,TR ; Variables available to LIBMP4 PUBLIC Time,Fuel_Init,fuel,ExitFLag ;====== Procedures ======================================================= ; -------------------------------------- ; Your subroutines go here ; -------------------------------------- ;====== SECTION 6: Main procedure ========================================= main proc far mov ax, cseg ; Initialize DS=CS mov ds, ax mov ax,0B800h ; Load ES with video Segment mov es,ax mov AX,2 ; Set 80x25 Text Mode int 10h MOV AX,Fuel_Init ; Initialize Fuel with full tank MOV Fuel,AX ; -------------------------------------- CALL MainLib ; Your MAIN goes here ; -------------------------------------- Call mp4xit main endp cseg ends end main
; A060372: p(n), positive part of n when n=p(n)-q(n) with p(n), q(n), p(n)+q(n) in A005836, integers written without 2 in base 3. ; Submitted by Jon Maiga ; 0,1,3,3,4,9,9,10,9,9,10,12,12,13,27,27,28,27,27,28,30,30,31,27,27,28,27,27,28,30,30,31,36,36,37,36,36,37,39,39,40,81,81,82,81,81,82,84,84,85,81,81,82,81,81,82,84,84,85,90,90,91,90,90,91,93,93,94,81,81,82,81,81,82,84,84,85,81,81,82,81,81,82,84,84,85,90,90,91,90,90,91,93,93,94,108,108,109,108,108 mov $1,$0 seq $1,60374 ; a(n)=p+q, where n=p-q and p, q, p+q are in A005836 (integers written without 2 in base 3). add $0,$1 div $0,2
; A141913: Primes congruent to 9 mod 23. ; Submitted by Jon Maiga ; 101,193,239,331,607,653,883,929,1021,1297,1481,1619,1987,2309,2447,2539,2677,2861,2953,2999,3137,3229,3413,3643,3919,4057,4241,4517,4793,4931,5023,5437,5483,5851,5897,6173,6311,6449,6679,6863,7001,7369,7507,7691,7829,8059,8243,8887,8933,9209,9439,9623,10037,10267,10313,10589,10957,11003,11279,11831,11923,11969,12107,12613,12659,12889,13441,13487,13763,13901,14177,14407,14591,14683,14821,14867,15373,15511,15649,15787,15971,16063,16339,16477,16661,16937,17029,17167,17351,17443,17489,17581,17627 mov $2,$0 add $2,6 pow $2,2 mov $4,8 lpb $2 mov $3,$4 seq $3,10051 ; Characteristic function of primes: 1 if n is prime, else 0. sub $0,$3 mov $1,$0 max $1,0 cmp $1,$0 mul $2,$1 sub $2,1 add $4,46 lpe mov $0,$4 add $0,1
; ; jcgryext.asm - grayscale colorspace conversion (MMX) ; ; Copyright 2009 Pierre Ossman <ossman@cendio.se> for Cendio AB ; Copyright (C) 2011, D. R. Commander. ; ; Based on the x86 SIMD extension for IJG JPEG library ; Copyright (C) 1999-2006, MIYASAKA Masaru. ; For conditions of distribution and use, see copyright notice in jsimdext.inc ; ; This file should be assembled with NASM (Netwide Assembler), ; can *not* be assembled with Microsoft's MASM or any compatible ; assembler (including Borland's Turbo Assembler). ; NASM is available from http://nasm.sourceforge.net/ or ; http://sourceforge.net/project/showfiles.php?group_id=6208 ; ; [TAB8] %include "jcolsamp.inc" ; -------------------------------------------------------------------------- ; ; Convert some rows of samples to the output colorspace. ; ; GLOBAL(void) ; jsimd_rgb_gray_convert_mmx (JDIMENSION img_width, ; JSAMPARRAY input_buf, JSAMPIMAGE output_buf, ; JDIMENSION output_row, int num_rows); ; %define img_width(b) (b)+8 ; JDIMENSION img_width %define input_buf(b) (b)+12 ; JSAMPARRAY input_buf %define output_buf(b) (b)+16 ; JSAMPIMAGE output_buf %define output_row(b) (b)+20 ; JDIMENSION output_row %define num_rows(b) (b)+24 ; int num_rows %define original_ebp ebp+0 %define wk(i) ebp-(WK_NUM-(i))*SIZEOF_MMWORD ; mmword wk[WK_NUM] %define WK_NUM 2 %define gotptr wk(0)-SIZEOF_POINTER ; void * gotptr align 16 global EXTN(jsimd_rgb_gray_convert_mmx) PRIVATE EXTN(jsimd_rgb_gray_convert_mmx): push ebp mov eax,esp ; eax = original ebp sub esp, byte 4 and esp, byte (-SIZEOF_MMWORD) ; align to 64 bits mov [esp],eax mov ebp,esp ; ebp = aligned ebp lea esp, [wk(0)] pushpic eax ; make a room for GOT address push ebx ; push ecx ; need not be preserved ; push edx ; need not be preserved push esi push edi get_GOT ebx ; get GOT address movpic POINTER [gotptr], ebx ; save GOT address mov ecx, JDIMENSION [img_width(eax)] ; num_cols test ecx,ecx jz near .return push ecx mov esi, JSAMPIMAGE [output_buf(eax)] mov ecx, JDIMENSION [output_row(eax)] mov edi, JSAMPARRAY [esi+0*SIZEOF_JSAMPARRAY] lea edi, [edi+ecx*SIZEOF_JSAMPROW] pop ecx mov esi, JSAMPARRAY [input_buf(eax)] mov eax, INT [num_rows(eax)] test eax,eax jle near .return alignx 16,7 .rowloop: pushpic eax push edi push esi push ecx ; col mov esi, JSAMPROW [esi] ; inptr mov edi, JSAMPROW [edi] ; outptr0 movpic eax, POINTER [gotptr] ; load GOT address (eax) cmp ecx, byte SIZEOF_MMWORD jae short .columnloop alignx 16,7 %if RGB_PIXELSIZE == 3 ; --------------- .column_ld1: push eax push edx lea ecx,[ecx+ecx*2] ; imul ecx,RGB_PIXELSIZE test cl, SIZEOF_BYTE jz short .column_ld2 sub ecx, byte SIZEOF_BYTE xor eax,eax mov al, BYTE [esi+ecx] .column_ld2: test cl, SIZEOF_WORD jz short .column_ld4 sub ecx, byte SIZEOF_WORD xor edx,edx mov dx, WORD [esi+ecx] shl eax, WORD_BIT or eax,edx .column_ld4: movd mmA,eax pop edx pop eax test cl, SIZEOF_DWORD jz short .column_ld8 sub ecx, byte SIZEOF_DWORD movd mmG, DWORD [esi+ecx] psllq mmA, DWORD_BIT por mmA,mmG .column_ld8: test cl, SIZEOF_MMWORD jz short .column_ld16 movq mmG,mmA movq mmA, MMWORD [esi+0*SIZEOF_MMWORD] mov ecx, SIZEOF_MMWORD jmp short .rgb_gray_cnv .column_ld16: test cl, 2*SIZEOF_MMWORD mov ecx, SIZEOF_MMWORD jz short .rgb_gray_cnv movq mmF,mmA movq mmA, MMWORD [esi+0*SIZEOF_MMWORD] movq mmG, MMWORD [esi+1*SIZEOF_MMWORD] jmp short .rgb_gray_cnv alignx 16,7 .columnloop: movq mmA, MMWORD [esi+0*SIZEOF_MMWORD] movq mmG, MMWORD [esi+1*SIZEOF_MMWORD] movq mmF, MMWORD [esi+2*SIZEOF_MMWORD] .rgb_gray_cnv: ; mmA=(00 10 20 01 11 21 02 12) ; mmG=(22 03 13 23 04 14 24 05) ; mmF=(15 25 06 16 26 07 17 27) movq mmD,mmA psllq mmA,4*BYTE_BIT ; mmA=(-- -- -- -- 00 10 20 01) psrlq mmD,4*BYTE_BIT ; mmD=(11 21 02 12 -- -- -- --) punpckhbw mmA,mmG ; mmA=(00 04 10 14 20 24 01 05) psllq mmG,4*BYTE_BIT ; mmG=(-- -- -- -- 22 03 13 23) punpcklbw mmD,mmF ; mmD=(11 15 21 25 02 06 12 16) punpckhbw mmG,mmF ; mmG=(22 26 03 07 13 17 23 27) movq mmE,mmA psllq mmA,4*BYTE_BIT ; mmA=(-- -- -- -- 00 04 10 14) psrlq mmE,4*BYTE_BIT ; mmE=(20 24 01 05 -- -- -- --) punpckhbw mmA,mmD ; mmA=(00 02 04 06 10 12 14 16) psllq mmD,4*BYTE_BIT ; mmD=(-- -- -- -- 11 15 21 25) punpcklbw mmE,mmG ; mmE=(20 22 24 26 01 03 05 07) punpckhbw mmD,mmG ; mmD=(11 13 15 17 21 23 25 27) pxor mmH,mmH movq mmC,mmA punpcklbw mmA,mmH ; mmA=(00 02 04 06) punpckhbw mmC,mmH ; mmC=(10 12 14 16) movq mmB,mmE punpcklbw mmE,mmH ; mmE=(20 22 24 26) punpckhbw mmB,mmH ; mmB=(01 03 05 07) movq mmF,mmD punpcklbw mmD,mmH ; mmD=(11 13 15 17) punpckhbw mmF,mmH ; mmF=(21 23 25 27) %else ; RGB_PIXELSIZE == 4 ; ----------- .column_ld1: test cl, SIZEOF_MMWORD/8 jz short .column_ld2 sub ecx, byte SIZEOF_MMWORD/8 movd mmA, DWORD [esi+ecx*RGB_PIXELSIZE] .column_ld2: test cl, SIZEOF_MMWORD/4 jz short .column_ld4 sub ecx, byte SIZEOF_MMWORD/4 movq mmF,mmA movq mmA, MMWORD [esi+ecx*RGB_PIXELSIZE] .column_ld4: test cl, SIZEOF_MMWORD/2 mov ecx, SIZEOF_MMWORD jz short .rgb_gray_cnv movq mmD,mmA movq mmC,mmF movq mmA, MMWORD [esi+0*SIZEOF_MMWORD] movq mmF, MMWORD [esi+1*SIZEOF_MMWORD] jmp short .rgb_gray_cnv alignx 16,7 .columnloop: movq mmA, MMWORD [esi+0*SIZEOF_MMWORD] movq mmF, MMWORD [esi+1*SIZEOF_MMWORD] movq mmD, MMWORD [esi+2*SIZEOF_MMWORD] movq mmC, MMWORD [esi+3*SIZEOF_MMWORD] .rgb_gray_cnv: ; mmA=(00 10 20 30 01 11 21 31) ; mmF=(02 12 22 32 03 13 23 33) ; mmD=(04 14 24 34 05 15 25 35) ; mmC=(06 16 26 36 07 17 27 37) movq mmB,mmA punpcklbw mmA,mmF ; mmA=(00 02 10 12 20 22 30 32) punpckhbw mmB,mmF ; mmB=(01 03 11 13 21 23 31 33) movq mmG,mmD punpcklbw mmD,mmC ; mmD=(04 06 14 16 24 26 34 36) punpckhbw mmG,mmC ; mmG=(05 07 15 17 25 27 35 37) movq mmE,mmA punpcklwd mmA,mmD ; mmA=(00 02 04 06 10 12 14 16) punpckhwd mmE,mmD ; mmE=(20 22 24 26 30 32 34 36) movq mmH,mmB punpcklwd mmB,mmG ; mmB=(01 03 05 07 11 13 15 17) punpckhwd mmH,mmG ; mmH=(21 23 25 27 31 33 35 37) pxor mmF,mmF movq mmC,mmA punpcklbw mmA,mmF ; mmA=(00 02 04 06) punpckhbw mmC,mmF ; mmC=(10 12 14 16) movq mmD,mmB punpcklbw mmB,mmF ; mmB=(01 03 05 07) punpckhbw mmD,mmF ; mmD=(11 13 15 17) movq mmG,mmE punpcklbw mmE,mmF ; mmE=(20 22 24 26) punpckhbw mmG,mmF ; mmG=(30 32 34 36) punpcklbw mmF,mmH punpckhbw mmH,mmH psrlw mmF,BYTE_BIT ; mmF=(21 23 25 27) psrlw mmH,BYTE_BIT ; mmH=(31 33 35 37) %endif ; RGB_PIXELSIZE ; --------------- ; mm0=(R0 R2 R4 R6)=RE, mm2=(G0 G2 G4 G6)=GE, mm4=(B0 B2 B4 B6)=BE ; mm1=(R1 R3 R5 R7)=RO, mm3=(G1 G3 G5 G7)=GO, mm5=(B1 B3 B5 B7)=BO ; (Original) ; Y = 0.29900 * R + 0.58700 * G + 0.11400 * B ; ; (This implementation) ; Y = 0.29900 * R + 0.33700 * G + 0.11400 * B + 0.25000 * G movq mm6,mm1 punpcklwd mm1,mm3 punpckhwd mm6,mm3 pmaddwd mm1,[GOTOFF(eax,PW_F0299_F0337)] ; mm1=ROL*FIX(0.299)+GOL*FIX(0.337) pmaddwd mm6,[GOTOFF(eax,PW_F0299_F0337)] ; mm6=ROH*FIX(0.299)+GOH*FIX(0.337) movq mm7, mm6 ; mm7=ROH*FIX(0.299)+GOH*FIX(0.337) movq mm6,mm0 punpcklwd mm0,mm2 punpckhwd mm6,mm2 pmaddwd mm0,[GOTOFF(eax,PW_F0299_F0337)] ; mm0=REL*FIX(0.299)+GEL*FIX(0.337) pmaddwd mm6,[GOTOFF(eax,PW_F0299_F0337)] ; mm6=REH*FIX(0.299)+GEH*FIX(0.337) movq MMWORD [wk(0)], mm0 ; wk(0)=REL*FIX(0.299)+GEL*FIX(0.337) movq MMWORD [wk(1)], mm6 ; wk(1)=REH*FIX(0.299)+GEH*FIX(0.337) movq mm0, mm5 ; mm0=BO movq mm6, mm4 ; mm6=BE movq mm4,mm0 punpcklwd mm0,mm3 punpckhwd mm4,mm3 pmaddwd mm0,[GOTOFF(eax,PW_F0114_F0250)] ; mm0=BOL*FIX(0.114)+GOL*FIX(0.250) pmaddwd mm4,[GOTOFF(eax,PW_F0114_F0250)] ; mm4=BOH*FIX(0.114)+GOH*FIX(0.250) movq mm3,[GOTOFF(eax,PD_ONEHALF)] ; mm3=[PD_ONEHALF] paddd mm0, mm1 paddd mm4, mm7 paddd mm0,mm3 paddd mm4,mm3 psrld mm0,SCALEBITS ; mm0=YOL psrld mm4,SCALEBITS ; mm4=YOH packssdw mm0,mm4 ; mm0=YO movq mm4,mm6 punpcklwd mm6,mm2 punpckhwd mm4,mm2 pmaddwd mm6,[GOTOFF(eax,PW_F0114_F0250)] ; mm6=BEL*FIX(0.114)+GEL*FIX(0.250) pmaddwd mm4,[GOTOFF(eax,PW_F0114_F0250)] ; mm4=BEH*FIX(0.114)+GEH*FIX(0.250) movq mm2,[GOTOFF(eax,PD_ONEHALF)] ; mm2=[PD_ONEHALF] paddd mm6, MMWORD [wk(0)] paddd mm4, MMWORD [wk(1)] paddd mm6,mm2 paddd mm4,mm2 psrld mm6,SCALEBITS ; mm6=YEL psrld mm4,SCALEBITS ; mm4=YEH packssdw mm6,mm4 ; mm6=YE psllw mm0,BYTE_BIT por mm6,mm0 ; mm6=Y movq MMWORD [edi], mm6 ; Save Y sub ecx, byte SIZEOF_MMWORD add esi, byte RGB_PIXELSIZE*SIZEOF_MMWORD ; inptr add edi, byte SIZEOF_MMWORD ; outptr0 cmp ecx, byte SIZEOF_MMWORD jae near .columnloop test ecx,ecx jnz near .column_ld1 pop ecx ; col pop esi pop edi poppic eax add esi, byte SIZEOF_JSAMPROW ; input_buf add edi, byte SIZEOF_JSAMPROW dec eax ; num_rows jg near .rowloop emms ; empty MMX state .return: pop edi pop esi ; pop edx ; need not be preserved ; pop ecx ; need not be preserved pop ebx mov esp,ebp ; esp <- aligned ebp pop esp ; esp <- original ebp pop ebp ret ; For some reason, the OS X linker does not honor the request to align the ; segment unless we do this. align 16
.global s_prepare_buffers s_prepare_buffers: push %r12 push %r13 push %r9 push %rbx push %rcx push %rdi push %rdx push %rsi lea addresses_WT_ht+0x5445, %rdi clflush (%rdi) nop nop nop xor $49260, %r13 mov $0x6162636465666768, %rdx movq %rdx, (%rdi) dec %rcx lea addresses_WC_ht+0x1b061, %rsi lea addresses_WC_ht+0x100d5, %rdi nop xor %r9, %r9 mov $65, %rcx rep movsb nop nop nop dec %rdx lea addresses_A_ht+0xfc61, %r13 clflush (%r13) nop inc %rdi movb (%r13), %cl nop nop nop nop sub %rcx, %rcx lea addresses_WC_ht+0x12f81, %rsi nop nop nop nop nop sub %rbx, %rbx movl $0x61626364, (%rsi) nop nop add $63136, %r9 lea addresses_D_ht+0x1d561, %r13 nop nop nop nop inc %rdx movw $0x6162, (%r13) nop nop nop nop nop xor %rbx, %rbx lea addresses_A_ht+0xc392, %rsi sub %rcx, %rcx movl $0x61626364, (%rsi) nop nop sub $51860, %r9 lea addresses_A_ht+0x3929, %r9 nop nop nop add %r13, %r13 mov (%r9), %edi nop nop nop nop sub %rcx, %rcx lea addresses_A_ht+0x14521, %rsi lea addresses_WT_ht+0x1c61, %rdi nop nop add $14351, %r12 mov $100, %rcx rep movsb nop nop nop and $42396, %r13 lea addresses_A_ht+0x1b5ac, %rsi lea addresses_UC_ht+0x2e29, %rdi nop nop nop nop nop xor %rdx, %rdx mov $77, %rcx rep movsq nop nop add $5199, %rdx lea addresses_A_ht+0x93c1, %rsi lea addresses_WT_ht+0x1a5c1, %rdi nop nop nop nop sub $10213, %rbx mov $110, %rcx rep movsw nop nop nop nop sub $61262, %rdi lea addresses_UC_ht+0x111b7, %rdi clflush (%rdi) nop and $55038, %r13 mov $0x6162636465666768, %r9 movq %r9, %xmm7 movups %xmm7, (%rdi) inc %rdx pop %rsi pop %rdx pop %rdi pop %rcx pop %rbx pop %r9 pop %r13 pop %r12 ret .global s_faulty_load s_faulty_load: push %r10 push %r11 push %r14 push %rbp push %rbx push %rcx push %rdi // Load lea addresses_UC+0x1be61, %r10 nop add %rbx, %rbx mov (%r10), %bp nop nop dec %r11 // Store lea addresses_WT+0x8461, %rbp nop nop nop and %r11, %r11 movw $0x5152, (%rbp) nop nop nop nop nop sub %rbp, %rbp // Faulty Load lea addresses_RW+0xbc61, %rdi nop nop nop nop mfence movb (%rdi), %r11b lea oracles, %r14 and $0xff, %r11 shlq $12, %r11 mov (%r14,%r11,1), %r11 pop %rdi pop %rcx pop %rbx pop %rbp pop %r14 pop %r11 pop %r10 ret /* <gen_faulty_load> [REF] {'OP': 'LOAD', 'src': {'same': False, 'NT': False, 'AVXalign': False, 'size': 1, 'type': 'addresses_RW', 'congruent': 0}} {'OP': 'LOAD', 'src': {'same': False, 'NT': False, 'AVXalign': False, 'size': 2, 'type': 'addresses_UC', 'congruent': 9}} {'dst': {'same': False, 'NT': False, 'AVXalign': False, 'size': 2, 'type': 'addresses_WT', 'congruent': 11}, 'OP': 'STOR'} [Faulty Load] {'OP': 'LOAD', 'src': {'same': True, 'NT': False, 'AVXalign': False, 'size': 1, 'type': 'addresses_RW', 'congruent': 0}} <gen_prepare_buffer> {'dst': {'same': False, 'NT': True, 'AVXalign': False, 'size': 8, 'type': 'addresses_WT_ht', 'congruent': 1}, 'OP': 'STOR'} {'dst': {'same': False, 'congruent': 2, 'type': 'addresses_WC_ht'}, 'OP': 'REPM', 'src': {'same': False, 'congruent': 9, 'type': 'addresses_WC_ht'}} {'OP': 'LOAD', 'src': {'same': False, 'NT': False, 'AVXalign': False, 'size': 1, 'type': 'addresses_A_ht', 'congruent': 9}} {'dst': {'same': False, 'NT': False, 'AVXalign': False, 'size': 4, 'type': 'addresses_WC_ht', 'congruent': 3}, 'OP': 'STOR'} {'dst': {'same': True, 'NT': False, 'AVXalign': False, 'size': 2, 'type': 'addresses_D_ht', 'congruent': 8}, 'OP': 'STOR'} {'dst': {'same': False, 'NT': False, 'AVXalign': False, 'size': 4, 'type': 'addresses_A_ht', 'congruent': 0}, 'OP': 'STOR'} {'OP': 'LOAD', 'src': {'same': False, 'NT': True, 'AVXalign': False, 'size': 4, 'type': 'addresses_A_ht', 'congruent': 2}} {'dst': {'same': False, 'congruent': 11, 'type': 'addresses_WT_ht'}, 'OP': 'REPM', 'src': {'same': False, 'congruent': 3, 'type': 'addresses_A_ht'}} {'dst': {'same': False, 'congruent': 3, 'type': 'addresses_UC_ht'}, 'OP': 'REPM', 'src': {'same': True, 'congruent': 0, 'type': 'addresses_A_ht'}} {'dst': {'same': False, 'congruent': 4, 'type': 'addresses_WT_ht'}, 'OP': 'REPM', 'src': {'same': False, 'congruent': 5, 'type': 'addresses_A_ht'}} {'dst': {'same': False, 'NT': False, 'AVXalign': False, 'size': 16, 'type': 'addresses_UC_ht', 'congruent': 0}, 'OP': 'STOR'} {'32': 21829} 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 */
; A181176: The minimum absolute value obtainable by partitioning the first n consecutive integers into two sets and subtracting the two sums of the sets. ; 0,1,1,0,2,3,1,2,6,3,1,6,6,1,5,10,4,3,11,8,0,9,13,4,6,17,9,2,14,15,3,10,22,9,5,20,16,1,15,24,8,9,27,16,2,21,25,6,14,35,15,6,28,25,3,20,36,13,11,36,24,1,27,36,10,17,45,22,6,35,35,6,24,49,19,12,44,33,1,32,48,15,19 add $0,1 bin $0,2 cal $0,4738 ; Concatenation of sequences (1,2,...,n-1,n,n-1,...,2) for n >= 2. mov $2,$0 add $2,$0 add $2,3 add $0,$2 add $0,1 mov $1,$0 sub $1,7 div $1,3
; ; Copyright (C) 2008-2020 Advanced Micro Devices, Inc. All rights reserved. ; ; Redistribution and use in source and binary forms, with or without modification, ; are permitted provided that the following conditions are met: ; 1. Redistributions of source code must retain the above copyright notice, ; this list of conditions and the following disclaimer. ; 2. Redistributions in binary form must reproduce the above copyright notice, ; this list of conditions and the following disclaimer in the documentation ; and/or other materials provided with the distribution. ; 3. Neither the name of the copyright holder nor the names of its contributors ; may be used to endorse or promote products derived from this software without ; specific prior written permission. ; ; THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ; ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED ; WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. ; IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, ; INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, ; BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, ; OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, ; WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ; ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE ; POSSIBILITY OF SUCH DAMAGE. ; include exp_tables.inc include fm.inc FN_PROTOTYPE_FMA3 vrd2_exp2 text SEGMENT EXECUTE stack_size EQU 088h save_xmm10 equ 20h save_xmm9 equ 40h PUBLIC fname fname PROC FRAME StackAllocate stack_size SaveXmm xmm10,save_xmm10 SaveXmm xmm9,save_xmm9 .ENDPROLOG movupd xmm0, XMMWORD PTR [rcx] vmovdqa xmm10,xmm0 ; save for later use ; x * (64) vmulpd xmm3,xmm0,L__real_64 ; n = int( x * (64)) vcvttpd2dq xmm4,xmm3 ;xmm4 = 0,0,(int)n1,(int)n0 vcvtdq2pd xmm3,xmm4 ;xmm3 = (double)n1,n0 vmovq rcx,xmm4 ;rcx = (int)n1,n0 ; r = x - n * 1/64 ;r *= ln2; vfmadd132pd xmm3,xmm0,L__mone_by_64 vmulpd xmm2,xmm3,L__ln_2 ;xmm2 = r r_0,_1 ;j = n & 03fh mov rax,00000003f0000003fh and rax,rcx ;rax = j1,j0 mov ecx,eax ;rcx = j0 shr rax,32 ;rax = j1 ; m = (n - j) / 64 vpsrad xmm5,xmm4,6 ;xmm5 = 0,0,m m0,1 ; q = r + r^2*1/2 + r^3*1/6 + r^4 *1/24 + r^5*1/120 + r^6*1/720 ; q = r + r*r*(1/2 + r*(1/6+ r*(1/24 + r*(1/120 + r*(1/720))))) vmovapd xmm3,L__real_1_by_720 vfmadd213pd xmm3 , xmm2, L__real_1_by_120 vfmadd213pd xmm3 , xmm2, L__real_1_by_24 vfmadd213pd xmm3 , xmm2, L__real_1_by_6 vfmadd213pd xmm3 , xmm2, L__real_1_by_2 vmulpd xmm0 , xmm2, xmm2 vfmadd213pd xmm0 , xmm3, xmm2 ; (f)*(q) + f2 + f1 lea rdx,L__two_to_jby64_table lea r11,L__two_to_jby64_tail_table lea r10,L__two_to_jby64_head_table vmovsd xmm2,QWORD PTR[rdx + rcx * 8] vmovhpd xmm1,xmm2,QWORD PTR[rdx + rax * 8] ;xmm1 = f f_0,_1 vmovsd xmm2,QWORD PTR[r11 + rcx * 8] vmovhpd xmm3,xmm2,QWORD PTR[r11 + rax * 8] ;xmm3 = f2 f2_0,_1 vmovsd xmm4,QWORD PTR[r10 + rcx * 8] vmovhpd xmm2,xmm4,QWORD PTR[r10 + rax * 8] ;xmm2 = f1 f1_0,_1 vfmadd213pd xmm0 ,xmm1, xmm3 vaddpd xmm0 ,xmm2, xmm0 ; normal results vpmovsxdq xmm4,xmm5 ;xmm4 = m1,m0 vpsllq xmm5,xmm4,52 ;xmm5 = 2^m 2,1^m0 vpaddq xmm1,xmm0,xmm5 ;xmm1 = normal results ;check and process denormals vcmppd xmm3 ,xmm0,L__real_one,1 ;check e^r < 1 vpcmpeqq xmm2,xmm5,XMMWORD PTR L__m1022 ;check m == -1022 vpand xmm3,xmm3,xmm2 ;xmm3 = ( e^r < 1 and m = -1022 ) vmovdqa xmm2, XMMWORD PTR L__m1022 vpcmpgtq xmm2,xmm2,xmm5 ;check m < -1022 vpor xmm2,xmm2,xmm3 ;xmm2 = mask for inputs requiring denormal processing vpmovmskb eax,xmm2 cmp eax,0 je L__check_min ;jmp to avoid any accidental intermediate denormal results vpaddq xmm3,xmm4,L__ulong_1074 ;xmm3 = 1074 + m vunpckhpd xmm9,xmm3,xmm3 ;store high to xmm9 vmovdqa xmm5,XMMWORD PTR L__ulong_1 vpsllq xmm4,xmm5,xmm3 vpsllq xmm9,xmm5,xmm9 vunpcklpd xmm4,xmm4,xmm9 vmulpd xmm3,xmm0,xmm4 ;xmm3 = results for denormal numbers vandnpd xmm9,xmm2,xmm1 vandpd xmm1,xmm3,xmm2 vorpd xmm1,xmm1,xmm9 L__check_min: ;;special case for any x < min remove,_exp_arg this code if the above code takes care of this vcmppd xmm2 ,xmm10,L__min_exp2_arg,2 ;cmp x<= min_exp_arg vpxor xmm4,xmm3,xmm3 ;make zeros to put in place of x<= min_exp_arg vandnpd xmm9,xmm2,xmm1 vandpd xmm1,xmm4,xmm2 vorpd xmm1,xmm1,xmm9 ;;special case for any x > max remove,_exp_arg this code if the above code takes care of this vcmppd xmm2 ,xmm10,L__max_exp2_arg,1 ;cmp x < max_exp_arg vmovdqa xmm3,XMMWORD PTR L__real_inf ;inf to put in place of any x >= max_exp_arg vandnpd xmm9,xmm2,xmm3 vandpd xmm1,xmm1,xmm2 vorpd xmm1,xmm1,xmm9 ;;special case for any x = na remove,n this code if the above code takes care of this vcmppd xmm2 ,xmm10,xmm10,00h vaddpd xmm3,xmm10,xmm10 ;make qnan to put in place of any x =nan vandnpd xmm9,xmm2,xmm3 vandpd xmm0,xmm1,xmm2 vorpd xmm0,xmm0,xmm9 RestoreXmm xmm10, save_xmm10 RestoreXmm xmm9, save_xmm9 StackDeallocate stack_size ret fname endp TEXT ENDS data SEGMENT READ PAGE ALIGN 16 L__max_exp2_arg DQ 04090000000000000h, 04090000000000000h L__min_exp2_arg DQ 0c090c80000000000h, 0c090c80000000000h L__real_64 DQ 04050000000000000h, 04050000000000000h ; 64 L__ln_2 DQ 03FE62E42FEFA39EFh, 03FE62E42FEFA39EFh L__mone_by_64 DQ 0bF90000000000000h, 0bF90000000000000h L__real_one DQ 03ff0000000000000h, 03ff0000000000000h L__real_inf DQ 07ff0000000000000h, 07ff0000000000000h L__m1022 DQ 0c020000000000000h, 0c020000000000000h L__ulong_1074 DQ 00000000000000432h, 00000000000000432h L__ulong_1 DQ 00000000000000001h, 00000000000000001h data ENDS END
; ; This file is automatically generated ; ; Do not edit!!! ; ; djm 12/2/2000 ; ; ZSock Lib function: sock_setssize XLIB sock_setssize LIB no_zsock INCLUDE "packages.def" INCLUDE "zsock.def" .sock_setssize ld a,r_sock_setssize call_pkg(tcp_all) ret nc ; We failed..are we installed? cp rc_pnf scf ;signal error ret nz ;Internal error call_pkg(tcp_ayt) jr nc,sock_setssize jp no_zsock
.386 assume cs:code,ds:data data segment use16 file db 80 dup('$') ;保存文件名 filePointer dw 0 ;指向文件数据 isPointer dd 0 ;表示当前的阅读的文件位置 countIndex dd 0 ;用于计数,表征文件容量 dataIndex dw 0 ;指示控制台显示的数据量大小 controlLine db 9 dup('$') ;行输出控制的指示符 dataPerPage db 0100h dup('$') ;保存当前显示的文件数据信息 Welcome db 'Please input filename:','$' ;输入文件名前的提示 Error db 'Cannot open file!','$' ;文件名不存在的提示 whereAscii dw 0 ;指示打印数据ASCII值位置 whereData dw 0 ;指示打印数据位置 data ends code segment use16 switchKey: mov ah,0 int 16h ;读取键盘信息 cmp ax,011Bh ;cmp with Esc jz whilePressEsc cmp ax,4700h ;cmp with Home jz whilePressHome cmp ax,4F00h ;cmp with End jz whilePressEnd cmp ax,4900h ;cmp with PageUp jz whilePressPageUp cmp ax,5100h ;cmp with PageDown jz whilePressPageDown call whilePressEsc whilePressHome: ;对Home键进行响应 mov isPointer,0 mov ah,42h mov bx,filePointer xor ecx,ecx xor edx,edx int 21h jmp Refresh ;刷新显示 whilePressEnd: ;对End键进行响应 xor eax,eax xor ebx,ebx ;清空eax、ebx寄存器,以保证下面正确计数 inPageDownLoop: ;循环向下翻页 add eax,100h cmp eax,countIndex jc isEndOfPage ;判断是是否到达页尾 mov isPointer,ebx ;移动文件指针 call whilePressPageDown ;反复向下翻页 isEndOfPage: ;到达页尾 add ebx,100h ;循环后更新ebx,也即用eax判断是否到达末尾 jmp inPageDownLoop whilePressPageUp: ;对PageUp键进行响应 mov eax,isPointer cmp eax,100h jc switchKey ;判断是否在页首,页首时屏蔽PageUp键 sub eax,100h mov isPointer,eax mov edx,eax ;移动文件指针到新位置 shr eax,010h mov ecx,eax mov ah,42h mov bx,filePointer int 21h jmp Refresh ;刷新显示 whilePressPageDown: ;对PageDown键进行响应 mov eax,isPointer ;获取当前位置 add eax,100h ;判断是否位于页末,页末屏蔽PageDown cmp eax,countIndex jbe pageTurning sub eax,100h ;超过文件大小则变为原值 pageTurning: ;向下翻页 mov isPointer,eax mov edx,eax ;移动文件指针 shr eax,010h mov ecx,eax mov ah,42h mov bx,filePointer ;更新相关参数 int 21h jmp Refresh ;刷新显示 begin: mov ax,0B800h mov es,ax ;es与显卡关联 mov ax,data mov ds,ax ;关联data和ds mov ah,09h lea dx,Welcome int 21h mov ah,02h mov dx,0Dh int 21h mov dx,0Ah int 21h ;打印输入文件名提示信息 lea dx,file mov ah,0Ah int 21h ;读入文件名 mov cl,file+1 add cx,offset file+2 mov di,cx ;将读入的文件名末尾置'\0' mov ax,3D30h lea dx,file+2 mov byte ptr[di],0 int 21h ;打开用户指定的文件 jnc Initialise ;当文件名不存在时报错并关闭程序,否则跳过报错开始初始化程序 mov ah,02h mov dx,0Dh int 21h mov dx,0Ah int 21h mov ah,09h lea dx,Error int 21h whilePressEsc: ;退出程序的入口,在退出程序时首先关闭文件 mov ah,02h mov dx,0Ah int 21h mov ah, 3Eh mov bx, filePointer int 21h mov ax, 4C00h int 21h ;退出程序 Initialise: ;此函数用于计算、存储文件信息并初始化窗口 mov filePointer, ax push ax ;存储文件相关信息 xor edx,edx mov ax,4202h pop bx xor cx,cx int 21h ;计算文件大小,调整指向文件的指针的位置 shl edx,10h mov countIndex,eax add countIndex,edx ;计算文件容量 mov ax,4200h ;置ah为42,同时清空al int 21h ;初始化首页的16行字符 Refresh: ;用于刷新各类型数据信息 lea di,controlLine+7 ;调整数组位置信息 mov eax,isPointer ;加载首字符的位置信息 mov ebx,10h ;与16进行除法运算,对行号转换 mov ecx,08h ;设置8次循环加载文件十六进制显示时的8位数行号 transLineIndexLoop: ;循环转换行号 cmp eax,0 ;对eax除法结果进行判断,如果为0,则行号循环转换结束,否则持续循环 mov edx,0 ;清空余数edx,防止Divide Overflow错误 jnz inLineLoop mov edx,30h jmp saveLineIndex inLineLoop: ;对行号转换的内循环 div ebx ;除法运算完成行号数据格式转换 add edx,30h ;转换为对应字符串 cmp edx,39h ;判断是否发生进位 jng saveLineIndex add edx,07h ;对字母判断 saveLineIndex: ;保存行号并完成相关参数配置工作 mov [di],dl sub edi,1 loop transLineIndexLoop ;进入转换循环,循环完成行号信息设置 add edi,09h mov edx,':' mov [di],dl ;行号后输出冒号 mov ecx,10h xor esi,esi xor ebx,ebx resetMonitor: ;更新控制台的显示 mov es:[bx+si],ax add esi,02h cmp esi,0A0h ;换行判断 jnz resetMonitor xor esi,esi add ebx,0A0h loop resetMonitor ;转入下一行并继续循环 lea di,dataPerPage mov ecx,0100h inDataLoop: ;更新页面中实时显示的数据信息 mov [di],al add edi,1 loop inDataLoop mov eax,countIndex sub eax,isPointer cmp ax,0100h ;判断当前控制台窗口中数据量是否符合预期 jnae capacityLessThanExpected ;当数据量足够填满页面,则要求数据填满,否则将数据加载完即可 mov dataIndex,0100h jmp loadChar capacityLessThanExpected: mov dataIndex,ax loadChar: ;加载当前页数据的字符信息 mov ah,3Fh ;为显示数据对应字符信息初始化空间 mov bx,filePointer mov cx,dataIndex lea edx,dataPerPage lea edi,dataPerPage int 21h ;初始化各项数据并加载信息 xor ebx,ebx xor ecx,ecx mov edx,076h mov whereData,dx mov edx,014h mov whereAscii,dx printLine: ;打印行号 cmp edx,014h ;对当前行是否输出完全进行判断,判断此函数是否应该被执行 jnz printChar xor esi,esi push di lea di,controlLine charOfLineControl: ;对打印过程中是否为首行、字符位是否需要改变等细节进行控制,保证输出正确 cmp ecx,010h ;关于是否为首行进行判断 mov ax,[di] jc lineControlWhilePrinting ;第一行输出时要控制行参数加一 cmp esi,0Ch ;对字符进位的判断与控制 jnz lineControlWhilePrinting inc eax ;对进位字符控制,将其自增1 cmp al,3Ah ;判断是否需要对数字转换为字母 jnz lineControlWhilePrinting add eax,07h lineControlWhilePrinting: ;在打印行号时进行必要格式控制与转换 mov [di],al mov ah,07h mov es:[ebx+esi],eax add di,1 add esi,02h ;加载行号信息 cmp esi,012h jnz charOfLineControl ;若尚未完成加载则循环完成加载 pop di ;解除保护,重新恢复di初始值 printChar: ;打印字符它的十六进制形式ASCII码 mov si,whereData mov ah,07h mov al,[di] mov es:[bx+si],ax add esi,02h add ecx,1 mov whereData,si mov si,whereAscii mov ax,[di] and ax,0FFh mov dl,010h div dl ;读取字符ASCII码值 cmp al,0Ah jnae isLower add eax,07h isLower: ;对低位ASCII码取出讨论 add eax,030h mov dh,al ;dh寄存器保存当前第一个ASCII字符数据 cmp ah,0Ah jnae isHigher add eax,0700h isHigher: ;对高位ASCII码取出讨论 add eax,3000h ;将ah加'0' push ax ;目的在于将低位ASCII码ah压入堆栈保护 mov al,dh ;恢复先前al数值 mov ah,07h mov es:[ebx+esi],eax add esi,02h ;实现对高位ASCII码显示 pop ax mov al,ah mov ah,07h ;恢复ah值 mov es:[ebx+esi],eax add esi,02h ;实现对低位ASCII码显示 cmp esi,05Ah jz setSeparator cmp esi,042h jz setSeparator cmp esi,02Ah jz setSeparator mov al,' ' jmp short printSet setSeparator: ;设置打印分界线 mov al,'|' mov ah,0Fh ;设置颜色 printSet: ;设置打印参数 mov es:[ebx+esi],eax add esi,02h mov whereAscii,si mov dx,whereData add edi,1 ;存储有关参数 cmp edx,96h jnz lineFeed ;换行输出 add ebx,0A0h mov edx,76h mov whereData,dx mov edx,14h mov whereAscii,dx ;控制输出格式参数 lineFeed: cmp cx,dataIndex jnz printLine call switchKey code ends end begin
%define SYS_EXIT 60 BITS 64 segment .text global main extern printf print: mov rdi, format ; set 1st parameter (format) mov rsi, rax ; set 2nd parameter (current_number) xor rax, rax ; because printf is varargs ; Stack is already aligned because we pushed three 8 byte registers call printf WRT ..plt ; printf(format, current_number) ret main: call print ; sub pop rbx pop rax sub rax, rbx push rax ; add pop rax pop rbx add rax, rbx push rax ; sub pop rbx pop rax sub rax, rbx push rax ; add pop rax pop rbx add rax, rbx push rax call print ; add pop rax pop rbx add rax, rbx push rax ; add pop rax pop rbx add rax, rbx push rax call print ; sub pop rbx pop rax sub rax, rbx push rax ; sub pop rbx pop rax sub rax, rbx push rax ; sub pop rbx pop rax sub rax, rbx push rax call print call print call print mov rax, SYS_EXIT mov rdi, 69 syscall section .data format db "%20ld", 10, 0
; tentative move effect constants ; {stat}_(UP|DOWN)(1|2) means that the move raises the user's (or lowers the target's) corresponding stat modifier by 1 (or 2) stages ; {status condition}_side_effect means that the move has a side chance of causing that condition ; {status condition}_effect means that the move causes the status condition every time it hits the target const_value = 0 const NO_ADDITIONAL_EFFECT ; $00 const UNUSED_EFFECT_01 ; $01 const POISON_SIDE_EFFECT1 ; $02 const DRAIN_HP_EFFECT ; $03 const BURN_SIDE_EFFECT1 ; $04 const FREEZE_SIDE_EFFECT ; $05 const PARALYZE_SIDE_EFFECT1 ; $06 const EXPLODE_EFFECT ; $07 Explosion, Self Destruct const DREAM_EATER_EFFECT ; $08 const MIRROR_MOVE_EFFECT ; $09 const ATTACK_UP1_EFFECT ; $0A const DEFENSE_UP1_EFFECT ; $0B const SPEED_UP1_EFFECT ; $0C const SPECIAL_UP1_EFFECT ; $0D const ACCURACY_UP1_EFFECT ; $0E const EVASION_UP1_EFFECT ; $0F const PAY_DAY_EFFECT ; $10 const SWIFT_EFFECT ; $11 const ATTACK_DOWN1_EFFECT ; $12 const DEFENSE_DOWN1_EFFECT ; $13 const SPEED_DOWN1_EFFECT ; $14 const SPECIAL_DOWN1_EFFECT ; $15 const ACCURACY_DOWN1_EFFECT ; $16 const EVASION_DOWN1_EFFECT ; $17 const CONVERSION_EFFECT ; $18 const HAZE_EFFECT ; $19 const BIDE_EFFECT ; $1A const THRASH_PETAL_DANCE_EFFECT ; $1B const SWITCH_AND_TELEPORT_EFFECT ; $1C const TWO_TO_FIVE_ATTACKS_EFFECT ; $1D const UNUSED_EFFECT_1E ; $1E const FLINCH_SIDE_EFFECT1 ; $1F const SLEEP_EFFECT ; $20 const POISON_SIDE_EFFECT2 ; $21 const BURN_SIDE_EFFECT2 ; $22 const UNUSED_EFFECT_23 ; $23 const PARALYZE_SIDE_EFFECT2 ; $24 const FLINCH_SIDE_EFFECT2 ; $25 const OHKO_EFFECT ; $26 moves like Horn Drill const CHARGE_EFFECT ; $27 moves like Solar Beam const SUPER_FANG_EFFECT ; $28 const SPECIAL_DAMAGE_EFFECT ; $29 Seismic Toss, Night Shade, Sonic Boom, Dragon Rage, Psywave const TRAPPING_EFFECT ; $2A moves like Wrap const FLY_EFFECT ; $2B const ATTACK_TWICE_EFFECT ; $2C const JUMP_KICK_EFFECT ; $2D Jump Kick and Hi Jump Kick effect const MIST_EFFECT ; $2E const FOCUS_ENERGY_EFFECT ; $2F const RECOIL_EFFECT ; $30 moves like Double Edge const CONFUSION_EFFECT ; $31 Confuse Ray, Supersonic (not the move Confusion) const ATTACK_UP2_EFFECT ; $32 const DEFENSE_UP2_EFFECT ; $33 const SPEED_UP2_EFFECT ; $34 const SPECIAL_UP2_EFFECT ; $35 const ACCURACY_UP2_EFFECT ; $36 const EVASION_UP2_EFFECT ; $37 const HEAL_EFFECT ; $38 Recover, Softboiled, Rest const TRANSFORM_EFFECT ; $39 const ATTACK_DOWN2_EFFECT ; $3A const DEFENSE_DOWN2_EFFECT ; $3B const SPEED_DOWN2_EFFECT ; $3C const SPECIAL_DOWN2_EFFECT ; $3D const ACCURACY_DOWN2_EFFECT ; $3E const EVASION_DOWN2_EFFECT ; $3F const LIGHT_SCREEN_EFFECT ; $40 const REFLECT_EFFECT ; $41 const POISON_EFFECT ; $42 const PARALYZE_EFFECT ; $43 const ATTACK_DOWN_SIDE_EFFECT ; $44 const DEFENSE_DOWN_SIDE_EFFECT ; $45 const SPEED_DOWN_SIDE_EFFECT ; $46 const SPECIAL_DOWN_SIDE_EFFECT ; $47 const UNUSED_EFFECT_48 ; $48 const UNUSED_EFFECT_49 ; $49 const UNUSED_EFFECT_4A ; $4A const UNUSED_EFFECT_4B ; $4B const CONFUSION_SIDE_EFFECT ; $4C const TWINEEDLE_EFFECT ; $4D const UNUSED_EFFECT_4E ; $4E const SUBSTITUTE_EFFECT ; $4F const HYPER_BEAM_EFFECT ; $50 const RAGE_EFFECT ; $51 const MIMIC_EFFECT ; $52 const METRONOME_EFFECT ; $53 const LEECH_SEED_EFFECT ; $54 const SPLASH_EFFECT ; $55 const DISABLE_EFFECT ; $56 ; fixed damage constants SONICBOOM_DAMAGE EQU 20 DRAGON_RAGE_DAMAGE EQU 40
; A285185: Expansion of (2*x+4*x^2) / (1-2*x-2*x^2+2*x^3). ; Submitted by Christian Krause ; 0,2,8,20,52,128,320,792,1968,4880,12112,30048,74560,184992,459008,1138880,2825792,7011328,17396480,43164032,107098368,265731840,659332352,1635931648,4059064320,10071327232,24988919808,62002365440,153839916032,381706723328,947088547840,2349910710272,5830585069568,14466814464000,35894977646592,89062414082048,220981154529280,548297181929472,1360431844753408,3375495744307200,8375260814262272,20780649427632128,51560828995174400,127932435217088512,317425229569261568,787593671582351360 mov $1,2 mov $3,1 lpb $0 sub $0,1 add $2,$3 mov $3,$1 mov $1,$2 mul $1,2 add $4,$2 mov $2,$4 lpe mov $0,$2 mul $0,2
; PIO driver sets up the parallel port as a subtype of Serial/Char device. ; ; ; HBIOS initializes driver by: ; ; 1) Calling Pre-initialization ; ; This involves setting up all the data structures describing the devices. ; If possible, do a hardware test to verify it is available for adding to available devices. ; ; 2) Calling device initialization. ; ; Hardware initialization. ; Configure to initial state or to a new state. ; ; Implementation limitations: ; ; The fully functionality of the Z80 PIO can only be realized by using Z80 interrupt mode 2. ; Registers cannot be interrogated for interrupts status and the originating interrupt ; device cannot be determine. ; ; Full implementation of IM2 functionality for an ECB-ZP and ECB-4P board would require the ; allocation of an interrupt handler for each chip channel. Thus, 12 interrupt handlers ; would be required to support this configuration. As the HBIOS only has an allocation of ; 16, a full implmentation is impractical. ; ; The compromise solution is to allow 4 interrupts for the PIO driver. All remaining PIO's ; are limited to Bit mode or blind read and write to the input/output ports. ; ; Zilog PIO reset state: ; ; Both port mask registers are reset to inhibit All port data bits. ; Port data bus lines are set to a high-impedance state and the Ready "handshake" ; Mode 1 (output) is automatically selected. ; The vector address registers are not reset. ; Both port interrupt enable flip-flops are reset. ; Both port output registers are reset. ; ; Register addressing for ECB-ZP and ECB-4P assuming base address 90h and 88h respectively. ; ; PIO ----ZP---- ----4P---- ; 0 DATA 0 90h DATA 0 B8h ; 0 DATA 1 91h DATA 1 B9h ; 0 CMD 0 92h CMD 0 BAh ; 0 CMD 1 93h CMD 1 BBh ; 1 DATA 0 94h DATA 0 BCh ; 1 DATA 1 95h DATA 1 BDh ; 1 CMD 0 96h CMD 0 BEh ; 1 CMD 1 97h CMD 1 BFh ; 2 DATA 0 C0h ; 2 DATA 1 C1h ; 2 CMD 0 C2h ; 2 CMD 1 C3h ; 3 DATA 0 C4h ; 3 DATA 1 C5h ; 3 CMD 0 C6h ; 3 CMD 1 C7h ; PIODEBUG .EQU 1 ; M_Output .EQU $00 << 6 M_Input .EQU $01 << 6 M_Bidir .EQU $02 << 6 M_BitCtrl .EQU $03 << 6 M_BitAllIn .EQU $FF M_BitAllOut .EQU $00 ; PIO_NONE .EQU 0 PIO_ZPIO .EQU 1 PIO_8255 .EQU 2 PIO_PORT .EQU 3 ; SET MAXIMUM NUMBER OF INTERRUPTS AVAILABLE FOR ALL ; ENSURE INTERRUPTS ARE NOT TURNED ON IF IM2 IS NOT SET. INT_ALLOC .DB 0 INT_N .EQU 00000000B #IF (INTMODE == 2) INT_Y .EQU 00000100B INT_ALLOW .EQU 4 #ELSE INT_Y .EQU INT_N INT_ALLOW .EQU 0 #ENDIF ; INT0 .EQU 00000000B INT1 .EQU 00000001B INT2 .EQU 00000010B INT3 .EQU 00000011B ; ; SETUP THE DISPATCH TABLE ENTRIES ; ; PIO_CNT HOLDS THE NUMBER OF DEVICED CALCULATED FROM THE NUMBER OF DEFPIO MACROS ; PIO_CNT SHOULD INCREASE BY 2 FOR EVERY PIO CHIP ADDED. ; ; PIO_PREINIT WILL READ THROUGH ALL PIOCFG TABLES AND CONFIGURE EACH TABLE. ; IT WITH THEN CALL PIO_INITUNIT TO INITIALIZE EACH DEVICE TO ITS DEFAULT STATE ; ; EXPECTS NOTHING ON ENTRY ; PIO_PREINIT: CALL NEWLINE ;D LD B,PIO_CNT ; LOOP CONTROL LD C,0 ; PHYSICAL UNIT INDEX XOR A ; ZERO TO ACCUM ; LD (PIO_DEV),A ; CURRENT DEVICE NUMBER LD (INT_ALLOC),A ; START WITH NO INTERRUPTS ALLOCATED PIO_PREINIT0: PUSH BC ; SAVE LOOP CONTROL ; LD A,C ; INITIALIZE THE UNIT ; PUSH AF ;D ; LD A,'u' ;D ; CALL COUT ;D ; POP AF ;D ; CALL PRTHEXBYTE ;D UNIT ; CALL PC_SPACE ;D ; RLCA ; MULTIPLY BY CFG TABLE ENTRY SIZE (32 BYTES) ; RLCA ; ... ; RLCA ; ... TO GET OFFSET INTO CFG TABLE ; RLCA ;; RLCA ; LD HL,PIO_CFG ; POINT TO START OF CFG TABLE ; PUSH AF ; CALL ADDHLA ; HL := ENTRY ADDRESS ; POP AF ; CALL ADDHLA ; HL := ENTRY ADDRESS ; PUSH HL ; SAVE IT ; POP IY ; ... TO IY CALL IDXCFG LD (HL),C PUSH AF ;D LD A,'c' ;D CALL COUT ;D POP AF ;D PUSH BC ;D PUSH HL ;D POP BC ;D CALL PRTHEXWORD ;D CONFIG TABLE CALL PC_SPACE ;D POP BC ;D LD A,(IY+1) ; GET THE PIO TYPE DETECTED CP PIO_PORT ; SET FLAGS PUSH AF ;D LD A,'t' ;D CALL COUT ;D POP AF ;D CALL PRTHEXBYTE ;D TYPE CALL PC_SPACE ;D ; JR Z,BADINIT ; PUSH BC ; SAVE LOOP CONTROL ; LD BC,PIO_FNTBL ; BC := FUNCTION TABLE ADDRESS ; DEC A ; JR Z,TYPFND ; SKIP IT IF NOTHING FOUND ; LD BC,PPI_FNTBL ; BC := FUNCTION TABLE ADDRESS ; DEC A ; JR Z,TYPFND ; ADD ENTRY IF PIO FOUND, BC:DE ; LD BC,PRT_FNTBL ; DEC A ; JR Z,TYPFND ; POP BC ; JR BADINIT PUSH HL LD DE,-1 ; INITIALIZE THIS DEVICE WITH CALL PIO_INITDEV ; DEFAULT VALUES POP HL ; JR NZ,SKPINIT ; AT THIS POINT WE KNOW WE ; HAVE A VALID DEVICE SO ADD IT LD A,8 ; CALCULATE THE FUNCTION TABLE CALL ADDHLA ; POSITION WHICH FOLLOWS THE PUSH HL ; CONFIGURATION TABLE OF EACH POP BC ; DEVICE TYPFND: PUSH AF ;D LD A,'f' ;D CALL COUT ;D POP AF ;D PUSH BC ;D CALL PRTHEXWORD ;D FUNCTION TABLE POP BC ;D CALL NEWLINE ;D PUSH IY ; ADD ENTRY IF PIO FOUND, BC:DE POP DE ; BC: DRIVER FUNCTION TABLE CALL CIO_ADDENT ; DE: ADDRESS OF UNIT INSTANCE DATA BADINIT:POP BC ; RESTORE LOOP CONTROL INC C ; NEXT PHYSICAL UNIT SKPINIT:DJNZ PIO_PREINIT0 ; LOOP UNTIL DONE PUSH AF ;D PRTS("INTS=$") ;D LD A,(INT_ALLOC) ;D CALL PRTHEXBYTE ;D POP AF ;D PUSH DE ;D LD DE,CIO_TBL-3 ;D CALL DUMP_BUFFER ;D POP DE ;D XOR A ; SIGNAL SUCCESS RET ; AND RETURN ; ; INDEX INTO THE CONFIG TABLE ; ON ENTRY C = UNIT NUMBER ; ON EXIT IY = CONFIG DATA POINTER ; ON EXIT DE = CONFIG TABLE START ; ; EACH CONFIG TABLE IS 24 BYTES LONG ; CFG_SIZ .EQU 24 ; IDXCFG: LD A,C RLCA ; X 2 RLCA ; X 4 RLCA ; X 8 LD H,0 LD L,A ; HL = X 8 PUSH HL ADD HL,HL ; HL = X 16 POP DE ADD HL,DE ; HL = X 24 LD DE,PIO_CFG ADD HL,DE PUSH HL ; COPY CFG DATA PTR POP IY ; ... TO IY RET ; PIO_INITDEV - INITIALIZE DEVICE ; ; IF DE = FFFF THEN THE SETUP PARAMETER WORD WILL BE READ FROM THE DEVICE CONFIGURATION ; TABLE POINTED TO BY IY AND THE PIO PORT WILL BE PROGRAMMED BASED ON THAT CONFIGURATION. ; ; OTHERWISE THE PIO PORT WILL BE PROGRAMMED BY THE SETUP PARAMETER WORD IN DE AND THIS ; WILL BE SAVED IN THE DEVICE CONFIGURATION TABLE POINTED TO BY IY. ; ; ALL OTHER CONFIGURATION OF THE DEVICE CONFIGURATION TABLE IS DONE UPSTEAM BY PIO_PREINIT PIO_INITDEV: ; TEST FOR -1 (FFFF) WHICH MEANS USE CURRENT CONFIG (JUST REINIT) LD A,D ; TEST DE FOR AND E ; ... VALUE OF -1 INC A ; ... SO Z SET IF -1 JR NZ,PIO_INITDEV1 ; IF DE == -1, REINIT CURRENT CONFIG PIO_INITDEV0: ; LOAD EXISTING CONFIG (DCW) TO REINIT LD E,(IY+4) ; LOW BYTE LD D,(IY+5) ; HIGH BYTE ; PIO_INITDEV1: ; WHICH DEVICE TYPE? LD A,(IY+1) CP PIO_ZPIO JR Z,SETPIO0 CP PIO_8255 JP Z,SET_8255 CP PIO_PORT JP Z,SET_PORT BAD_SET:OR $FF ; UNKNOWN DEVICE RET SETPIO0:LD A,E ; GET MODE AND 11000000B ; BITS (B7B6) CP 10000000B ; IS IT BIDIR? JR NZ,SETPIO1 LD A,(IY+2) ; GET CHANNEL OR A JR NZ,BAD_SET ; CAN'T DO ON CH1 ; VALIDATE INTERRUPT REQUEST ; GRANT INTERRUPT IF THERE IS A FREE INTERRUPT ; GRANT INTERRUPT IF AN INTERRUPT IS ALREADY ALLOCATED TO THIS UNIT SETPIO1:PUSH AF ;D LD A,'[' ;D CALL COUT ;D LD A,(IY) ;D CALL PRTHEXBYTE ;D LD A,']' ;D CALL COUT ;D POP AF ;D BIT 2,E ; SKIP IF WE ARE NOT REQUESTING JP Z,SETPIO2 ; AN INTERRUPT PRTS("[INTREQ]$") ;D ; LD A,(IY+4) ; GET CURRENT INTERRUPT SETTING ; BIT 2,A ; SKIP IF IT IS ALREADY ; JP NZ,SETPIO2 ; ALLOCATED TO THIS UNIT LD A,(INT_ALLOC) ; WE NEED TO ALLOCATE AN CP INT_ALLOW ; INTERRUPT. DO WE HAVE JR NC,BAD_SET ; ONE FREE? PRTS("[ALLOCINT]$") ;D ; WHICH INTERRUPT IS FREE ? ; SCAN THROUGH THE CFG TABLES ; AND FIND A FREE ONE PUSH AF ; NESTED LOOP LD DE,CFG_SIZ ; OUTSIDE LOOP IS INTERRUPT LD B,INT_ALLOW ; INSIDE LOOP IS DEVICE SETPIOP: LD C,B DEC C PUSH BC LD B,PIO_CNT LD HL,PIO_CFG+4 SETPIOX: LD A,(HL) BIT 2,A ; JUMP TO NEXT DEVICE JR Z,SETPIOY ; IF NO INTERRUPT ON AND 00000011B ; THIS DEVICE CP C ; IF WE MATCH AN INTERRUPT HERE THEN IT IS NOT FREE. JR NZ,SETPIOY ; SO EXIT INSIDE LOOP AND TRY NEXT INTERRUPT XOR A ; WE MATCH INT 0 - IF WE ARE CHECKING FOR IT THEN OR C ; WE REGARD IS AS FREE. JR NZ,SETPIOZ SETPIOY: ADD HL,DE DJNZ SETPIOX JR SETPIOQ ; WE GET HERE IF THE CURRENT INTERRUPT ; WAS NOT MATCHED SO IT IS FREE SETPIOZ: POP BC DJNZ SETPIOP POP AF PRTS("[NONEFREE]$") RET SETPIOQ:PUSH AF ; AVAILABLE INTERRUPT IS IN C PRTS("[FREE]=$") LD A,C CALL PRTHEXBYTE POP AF POP AF POP AF SETPIOR:LD HL,INT_ALLOC ; INCREASE THE COUNT INC (HL) ; OF USED INTERRUPTS LD A,(HL) ; LD A,(IY) ; IS THIS UNIT ; INC A ; UNITIALIZED? ; JR Z,SETPIO6 LD A,(IY+4) ; IT IS UNITIALIZED SO OR C ; SAVE THE ALLOCATES LD (IY+4),A ; INTERRUPT ; ; FOR THIS DEVICE AND INTERRUPT, UPDATE THE CONFIG TABLE FOR THIS DEVICE. ; PIO_IN, PIO_OUT, PIO_IST, PIO_OST ENTRIES NEED TO BE REDIRECTED. ; INTERRUPT VECTOR NEEDS TO BE UPDATED ; LD A,(IY+0) LD HL,0 ; SETUP PIO INTERRUPT VECTOR IN IVT LD HL,HBX_IV09+1 ; CALL SPK_BEEP ; SETPIO6:RET ; EXIT WITH FREE INTERRUPT IN C LD A,C LD (INT_ALLOC),A LD A,E AND 11000000B OR 00000100B OR C LD E,A LD (IY+5),A ; ; TODO: DEALLOCATE AN INTERRUPT ; ; LD A,(INT_ALLOC) ; DEC A ; LD (INT_ALLOC),A ; SETPIO2: ; DE CONTAINS THE MODE IF INTERRUPT ROUTINE SKIPPED PRTS("[NOINTREQ]$") ;D ; LD A,(IY+4) LD A,E ; GET MODE AND CREATE COMMAND AND 11000000B ; $B0 OR 00001111B ; $0F LD C,(IY+3) ; GET DATA PORT INC C ; POINT TO CMD INC C ; PORT OUT (C),A ; SET MODE CP (M_BitCtrl | $0F) ; IF MODE 3 JR NZ,SETPIO3 LD A,(IY+5) ; SET I/O DIRECTION OUT (C),A ; FOR MODE 3 SETPIO3:; INTERUPT HANDLING JP SETPIO4 ; SETUP THE INTERRUPT VECTOR LD A,E AND 00000011B ; DEC A ; INDEX INTO THE ADD A,A ; THE VECTOR TABLE ADD A,A ; LD C,A LD B,0 LD HL,HBX_IV09+1 ADD HL,BC ; GET THE ADDRESS OF PUSH DE LD D,(HL) ; THAT INTERRUPT INC HL ; HANDLER LD E,(HL) LD HL,0 ;HBX_IVT+IVT_PIO0 ; POPULATE THE LD A,L ; GET LOW BYTE OF IVT ADDRESS ADD HL,BC ; INTERRUPT TABLE LD (HL),D ; WITH THE INTERRUPT INC HL ; HANDLER ADDRESS FOR LD (HL),E ; THIS UNIT POP DE LD HL,INT_ALLOC LD C,(HL) LD B,0 LD HL,PRTTAB-1 ; SAVE THE DATA ADD HL,BC ; PORT FOR EACH INTERRUPT LD C,(IY+3) LD (HL),C INC C ; POINT TO CMD PORT INC C DI ; SET THE VECTOR ADDRESS OUT (C),A ; LD A,10000011B ; ENABLE INTERRUPTS ON OUT (C),A ; THIS UNIT EI ; JR GUD_SET ; SETPIO4:LD A,00000111B ; $07 OUT (C),A ; NO INTERRUPTS ; ; SUCCESSFULL SO SAVE DEVICE CONFIGURATION WORD (DCW) ; GUD_SET:LD (IY+4),E ; LOW BYTE LD (IY+5),D ; HIGH BYTE ; ; UPDATE THE DEVICE TABLE WITH THE ADDRESSES FOR THE CORRECT ROUTINE. ; LD A,E AND 00000111B LD HL,INTMATRIX ; POINT TO EITHER THE INTERRUPT JR NZ, USEIM LD HL,POLMATRIX ; MATRIX OR THE POLLED MATRIX USEIM: PUSH HL PUSH IY ; CALCULATE THE DESTINATION POP HL ; ADDRESS IN THE PIO_CFG TABLE LD BC,8 ; FOR THE FOUR ADDESSES TO BE ADD HL,BC ; COPIED TO ; LD B,0 ; 00000000 CALCULATE THE SOURCE ADDRESS LD C,E ; XX?????? FROM THE MATRIX. EACH ENTRY SRL C ; 0XX????? IN THE MATRIX IS 8 BYTES SO SRL C ; 00XX???? SOURCE = MATRIX BASE + (8 * MODE) SRL C ; 000XX??? POP DE ; LOAD THE MATRIX BASE ; LD DE,POLMATRIX EX DE,HL ADD HL,BC ; HL = SOURCE LD C,8 ; COPY 8 BYTES LDIR ; PUSH IY ; POP DE ; CALL DUMP_BUFFER XOR A RET PRTTAB: .DB 0 .DB 0 .DB 0 .DB 0 ; ;----------------------------------------------------------------------------- ; ; INPUT INTERRUPT VECTOR MACRO AND DEFINITION FOR FOUR PORTS ; #DEFINE PIOMIVT(PIOIN,PIOIST,PIOPRT) \ #DEFCONT ;\ #DEFCONT ; RETURN WITH ERROR IF THERE IS \ #DEFCONT ; ALREADY A CHARACTER IN BUFFER \ #DEFCONT ;\ #DEFCONT ; OTHERWISE CHANGE THE STATUS TO \ #DEFCONT ; SHOW THERE IS ONE CHARACTER IN \ #DEFCONT ; THE BUFFER AND READ IT IN AND \ #DEFCONT ; AND STORE IT.RETURN GOOD STATUS.\ #DEFCONT ;\ #DEFCONT \ LD A,(_CIST) #DEFCONT \ OR A #DEFCONT \ JR NZ,_OVFL #DEFCONT \ LD A,(PIOPRT) #DEFCONT \ LD C,A #DEFCONT \ LD A,1 #DEFCONT \ LD (_CIST),A #DEFCONT \ IN A,(C) #DEFCONT \ LD (_CICH),A #DEFCONT \ OR $FF #DEFCONT \ RET #DEFCONT \_OVFL:XOR A #DEFCONT \ RET #DEFCONT ;\ #DEFCONT ;\ #DEFCONT ;\ #DEFCONT ;\ #DEFCONT ;\ #DEFCONT ;\ #DEFCONT \PIOIN:CALL PIOIST #DEFCONT \ JR Z,PIOIN #DEFCONT \ LD A,(_CICH) #DEFCONT \ LD E,A #DEFCONT \ XOR A #DEFCONT \ LD (_CIST),A #DEFCONT \ RET #DEFCONT ;\ #DEFCONT ; If THERE A CHARACTER \ #DEFCONT ; AVAILABLE? RETURN NUMBER \ #DEFCONT ; IN A - 0 OR 1 \ #DEFCONT ;\ #DEFCONT \PIOIST:LD A,(_CIST) #DEFCONT \ AND 00000001B #DEFCONT \ RET #DEFCONT ;\ #DEFCONT ; CIST : 01 = CHARACTER READY ELSE NOT READY \ #DEFCONT ; CISH : CHARACTER STORED BY INTERRUPT \ #DEFCONT ;\ #DEFCONT \_CIST .DB 00 #DEFCONT \_CICH .DB 00 ; PIOIVT0:.MODULE PIOIVT0 PIOMIVT(PIO0IN,PI0_IST,PRTTAB+0) PIOIVT1:.MODULE PIOIVT1 PIOMIVT(PIO1IN,PI1_IST,PRTTAB+1) PIOIVT2:.MODULE PIOIVT2 PIOMIVT(PIO2IN,PI2_IST,PRTTAB+2) PIOIVT3:.MODULE PIOIVT3 PIOMIVT(PIO3IN,PI3_IST,PRTTAB+3) ; ;----------------------------------------------------------------------------- ; ; OUTPUT INTERRUPT VECTOR MACRO AND DEFINITION FOR FOUR PORTS ; ; AN INTERRUPT IS GENERATED WHEN THE RECEIVING DEVICE CAN ACCEPT A CHARACTER ; #DEFINE PIOMOVT(PIOOUT,PIOOST,PIOPRT) \ #DEFCONT ;\ #DEFCONT ; RETURN IF WE ARE WAITING FOR A \ #DEFCONT ; CHARACTER (COST = 00) \ #DEFCONT ;\ #DEFCONT ; IF ZERO CHARACTERS READY #DEFCONT ; (COST = 01) CHANGE STATUS TO \ #DEFCONT ; WAITING FOR CHARACTER (COST 00) \ #DEFCONT ;\ #DEFCONT ; IF A CHARACTER IS READY THEN \ #DEFCONT ; OUTPUT AND CHANGE STATUS TO \ #DEFCONT ; ZERO CHARACTERS READY \ #DEFCONT ;\ #DEFCONT \ LD A,(_COST) #DEFCONT \ DEC A #DEFCONT \ RET M #DEFCONT \ JR Z,_WFC #DEFCONT \ LD A,(_COCH) #DEFCONT \ LD E,A #DEFCONT \_ONOW:LD A,(PIOPRT) #DEFCONT \ LD C,A #DEFCONT \ OUT (C),E #DEFCONT \ LD A,1 #DEFCONT \_WFC: LD (_COST),A #DEFCONT \ RET #DEFCONT ;\ #DEFCONT ; WAIT FOR SPACE FOR THE CHARACTER\ #DEFCONT ; IF WE ARE WAITING FOR A \ #DEFCONT ; CHARACTRE THEN OUTPUT IT NOW \ #DEFCONT ; OTHERWISE STORE IT UNTIL THE \ #DEFCONT ; INTERRUPT CALLS FOR IT \ #DEFCONT ;\ #DEFCONT \PIOOUT:LD A,(_COST) #DEFCONT \ CP 2 #DEFCONT \ JR C,_ONOW #DEFCONT \ LD A,E #DEFCONT \ LD (_COCH),A #DEFCONT \ LD A,2 #DEFCONT \ LD (_COST),A #DEFCONT \ JR PIOOUT #DEFCONT ;\ #DEFCONT ; RETURN WITH NUMBER OF \ #DEFCONT ; CHARACTERS AVAILABLE 0 or 1 \ #DEFCONT ;\ #DEFCONT \PIOOST:LD A,(_COST) #DEFCONT \ DEC A #DEFCONT \ DEC A #DEFCONT \ RET Z #DEFCONT \ LD A,1 #DEFCONT \ RET #DEFCONT ;\ #DEFCONT ; COST : 00 WAITING FOR CHARACTER\ #DEFCONT ; 01 ZERO CHARACTERS READY\ #DEFCONT ; 02 ONE CHARACTER READY \ #DEFCONT ; COCH : CHARACTER TO OUTPUT \ #DEFCONT ;\ #DEFCONT \_COST .DB 01 #DEFCONT \_COCH .DB 00 ; PIOOVT0:.MODULE PIOOVT0 PIOMOVT(PIO0OUT,PI0_OST,PRTTAB+0) PIOOVT1:.MODULE PIOOVT1 PIOMOVT(PIO1OUT,PI1_OST,PRTTAB+1) PIOOVT2:.MODULE PIOOVT2 PIOMOVT(PIO2OUT,PI2_OST,PRTTAB+2) PIOOVT3:.MODULE PIOOVT3 PIOMOVT(PIO3OUT,PI3_OST,PRTTAB+3) ; ;----------------------------------------------------------------------------- ; ; NON INTERRUPT OUTPUT ROUTINE - SHARED ; ; INPUT WILL ALWAYS RETURN ERROR, CHARACTER RETURNED IS UNDEFINED. ; OUTPUT WILL ALWAYS RETURN SUCCESS ; INPUT-STATUS WILL ALWAYS RETURN 0 CHARACTERS IN BUFFER. ; OUTPUT-STATUS WILL ALWAYS RETURN 1 CHARACTER SPACE IN BUFFER. PIOSHO_IN: LD A,1 RET ; PIOSHO_OUT: LD C,(IY+3) OUT (C),E XOR A RET ; PIOSHO_IST: XOR A RET ; PIOSH_OST: LD A,1 RET ; ;----------------------------------------------------------------------------- ; ; NON INTERRUPT INPUT ROUTINE - SHARED ; ; INPUT WILL ALWAYS A CHARACTER AND SUCCESS. ; OUTPUT WILL ALWAYS RETURN FAILURE ; INPUT STATUS WILL ALWAYS RETURN 1 CHARACTER IN BUFFER. ;OUTPUT-STATUS WILL ALWAYS RETURN 0 CHARACTER SPACE IN BUFFER. ; PIOSHI_IN: LD C,(IY+3) IN A,(C) LD E,A XOR A RET ; PIOSHI_OUT: LD A,1 RET ; PIOSH_IST: LD A,1 RET ; PIOSHI_OST: XOR A RET ; ;----------------------------------------------------------------------------- ; ; ON ENTRY IY POINTS TO THE DEVICE RECORD. GET AND RETURN THE CONFIGURATION WORD IN DE ; PIO_QUERY: PPI_QUERY: LD E,(IY+4) ; FIRST CONFIG BYTE TO E LD D,(IY+5) ; SECOND CONFIG BYTE TO D XOR A ; SIGNAL SUCCESS RET ; ;----------------------------------------------------------------------------- ; ; ON ENTRY IY POINTS TO THE DEVICE RECORD. FOR CHARACTER DEVICES BIT 6 OF ATTRIBUTE ; INDICATES PARALLEL PORT IF 1 SO WE SET IT. COMMON TO ALL PORTS ; PIO_DEVICE: PPI_DEVICE: LD D,CIODEV_PIO ; D := DEVICE TYPE LD E,(IY) ; E := PHYSICAL UNIT LD C,$40 ; C := ATTRIBUTE LD H,0 ; H := 0, DRIVER HAS NO MODES LD L,(IY+3) ; L := BASE I/O ADDRESS XOR A ; SIGNAL SUCCESS RET ; INTMATRIX: .DW PIO0IN, PIO0OUT, PI0_IST, PI0_OST .DW PIO1IN, PIO1OUT, PI1_IST, PI1_OST .DW PIO2IN, PIO2OUT, PI2_IST, PI2_OST .DW PIO3IN, PIO3OUT, PI3_IST, PI3_OST POLMATRIX: .DW PIOSHO_IN, PIOSHO_OUT, PIOSHO_IST, PIOSH_OST ; OUTPUT .DW PIOSHI_IN, PIOSHI_OUT, PIOSH_IST, PIOSHI_OST ; INPUT .DW 0,0,0,0 ; BIDIR .DW 0,0,0,0 ; BIT MODE SET_8255: RET ; SET_BYE: XOR A ; SIGNAL SUCCESS RET ; ; ------------------------------------ ; i8255 FUNCTION TABLE ROUTINES ;------------------------------------- PPI_IN: XOR A ; SIGNAL SUCCESS RET ; PPI_OUT: XOR A ; SIGNAL SUCCESS RET ; PPI_IST: RET ; PPI_OST: RET ; ; PIO_INITDEV - Configure device. ; If DE = FFFF then extract the configuratio information from the table of devices and program the device using those settings. ; Otherwise use the configuration information in DE to program those settings and save them in the device table PPI_INITDEV: XOR A ; SIGNAL SUCCESS RET PPI_INT:OR $FF ; NZ SET TO INDICATE INT HANDLED RET ; PIO_PRTCFG: ; ANNOUNCE PORT CALL NEWLINE ; FORMATTING PRTS("PIO$") ; FORMATTING LD A,(IY) ; DEVICE NUM CALL PRTDECB ; PRINT DEVICE NUM PRTS(": IO=0x$") ; FORMATTING LD A,(IY+3) ; GET BASE PORT CALL PRTHEXBYTE ; PRINT BASE PORT ; ; PRINT THE PIO TYPE CALL PC_SPACE ; FORMATTING LD A,(IY+1) ; GET PIO TYPE BYTE LD DE,PIO_TYPE_STR ; POINT HL TO TYPE MAP TABLE CALL PRTIDXDEA ; ALL DONE IF NO PIO WAS DETECTED LD A,(IY+1) ; GET PIO TYPE BYTE OR A ; SET FLAGS RET Z ; IF ZERO, NOT PRESENT ; PRTS(" MODE=$") ; FORMATTING LD E,(IY+4) ; LOAD CONFIG LD D,(IY+5) ; ... WORD TO DE CALL PS_PRTPC0 ; PRINT CONFIG ; LD A,(IY+4) ; PRINT BIT 2,A ; ALLOCATED JR Z,NOINT ; INTERRUPT PRTS("/i$") LD A,(IY+4) AND 00000011B CALL PRTDECB NOINT: XOR A RET ; ; WORKING VARIABLES ; PIO_DEV .DB 0 ; DEVICE NUM USED DURING INIT ; ; DESCRIPTION OF DIFFERENT PORT TYPES ; PIO_TYPE_STR: .TEXT "<NOT PRESENT>$" ; IDX 0 .TEXT "Zilog PIO$" ; IDX 1 .TEXT "i8255 PPI$" ; IDX 2 .TEXT "IO Port$" ; IDX 3 ; ; Z80 PIO PORT TABLE - EACH ENTRY IS FOR 1 CHIP I.E. TWO PORTS ; ; 32 BYTE DATA STRUCTURE FOR EACH PORT ; ; .DB 0 ; IY+0 CIO DEVICE NUMBER (SET DURING PRE-INIT, THEN FIXED) ; .DB 0 ; IY+1 PIO TYPE (SET AT ASSEMBLY, FIXED) ; .DB 0 ; IY+2 PIO CHANNEL (SET AT ASSEMBLY, FIXED) ; .DB PIOBASE+2 ; IY+3 BASE DATA PORT (SET AT ASSEMBLY, FIXED) ; .DB 0 ; IY+4 SPW - MODE 3 I/O DIRECTION BYTE (SET AT ASSEMBLE, SET WITH INIT) ; .DB 0 ; IY+5 SPW - MODE, INTERRUPT (SET AT ASSEMBLY, SET WITH INIT) ; .DW 0 ; IY+6/7 FUNCTION TABLE (SET AT ASSEMBLY, SET DURING PRE-INIT AND AT INIT) ; .DW PIO_IN ; IY+8 ADDR FOR DEVICE INPUT (SET WITH INIT) ; .DW PIO_OUT ; IY+10 ADDR FOR DEVICE OUTPUT (SET WITH INIT) ; .DW PIO_IST ; IY+12 ADDR FOR DEVICE INPUT STATUS (SET WITH INIT) ; .DW PIO_OST ; IY+14 ADDR FOR DEVICE OUTPUT STATUS (SET WITH INIT) ; .DW PIO_INITDEV ; IY+16 ADDR FOR INITIALIZE DEVICE ROUTINE (SET AT ASSEMBLY, FIXED) ; .DW PIO_QUERY ; IY+18 ADDR FOR QUERY DEVICE RECORD ROUTINE (SET AT ASSEMBLY, FIXED) ; .DW PIO_DEVICE ; IY+20 ADDR FOR DEVICE TYPE ROUTINE (SET AT ASSEMBLY, FIXED) ; .FILL 10 ; ; SETUP PARAMETER WORD: ; ; +-------------------------------+ +-------+-----------+---+-------+ ; | BIT CONTROL | | MODE | | A | INT | ; +-------------------------------+ --------------------+-----------+ ; F E D C B A 9 8 7 6 5 4 3 2 1 0 ; -- MSB (D REGISTER) -- -- LSB (E REGISTER) -- ; ; ; MSB = BIT CONTROL MAP USE IN MODE 3 ; ; MODE B7 B6 = 00 Mode 0 Output ; 01 Mode 1 Input ; 10 Mode 2 Bidir ; 11 Mode 3 Bit Mode ; ; INTERRUPT ALLOCATED B2 = 0 NOT ALLOCATED ; = 1 IS ALLOCATED ; ; WHICH IVT IS ALLOCATES B1 B0 00 IVT_PIO0 ; 01 IVT_PIO1 ; 10 IVT_PIO2 ; 11 IVT_PIO3 ; #DEFINE DEFPIO(MPIOBASE,MPIOCH0,MPIOCH1,MPIOCH0X,MPIOCH1X,MPIOIN0,MPIOIN1) \ #DEFCONT \ .DB 0 #DEFCONT \ .DB PIO_ZPIO #DEFCONT \ .DB 0 #DEFCONT \ .DB MPIOBASE #DEFCONT \ .DB (MPIOCH0|MPIOIN0) #DEFCONT \ .DB MPIOCH0X #DEFCONT \ .DW 0 #DEFCONT \ .DW 0,0,0,0, PIO_INITDEV,PIO_QUERY,PIO_DEVICE #DEFCONT \ .FILL 2 #DEFCONT \ .DB 0 #DEFCONT \ .DB PIO_ZPIO #DEFCONT \ .DB 1 #DEFCONT \ .DB MPIOBASE+1 #DEFCONT \ .DB (MPIOCH1|MPIOIN1) #DEFCONT \ .DB MPIOCH1X #DEFCONT \ .DW 0 #DEFCONT \ .DW 0,0,0,0, PIO_INITDEV,PIO_QUERY,PIO_DEVICE #DEFCONT \ .FILL 2 ; ; i8255 PORT TABLE - EACH ENTRY IS FOR 1 CHIP I.E. THREE PORTS ; #DEFINE DEFPPI(MPPIBASE,MPPICH1,MPPICH2,MPPICH3,MPPICH1X,MPPICH2X,MPPICH3X) \ #DEFCONT \ .DB 0 #DEFCONT \ .DB PIO_8255 #DEFCONT \ .DB 0 #DEFCONT \ .DB MPPIBASE #DEFCONT \ .DB (MPPICH1|00001000B) #DEFCONT \ .DB MPPICH1X #DEFCONT \ .DW 0 #DEFCONT \ .DW PPI_IN,PPI_OUT,PPI_IST,PPI_OST,PPI_INITDEV,PPI_QUERY,PPI_DEVICE #DEFCONT \ .FILL 2 #DEFCONT \ .DB 0 #DEFCONT \ .DB PIO_8255 #DEFCONT \ .DB 1 #DEFCONT \ .DB MPPIBASE+2 #DEFCONT \ .DB (MPPICH2|00010000B) #DEFCONT \ .DB MPPICH2X #DEFCONT \ .DW 0 #DEFCONT \ .DW PPI_IN,PPI_OUT,PPI_IST,PPI_OST,PPI_INITDEV,PPI_QUERY,PPI_DEVICE #DEFCONT \ .FILL 2 #DEFCONT \ .DB 0 #DEFCONT \ .DB PIO_8255 #DEFCONT \ .DB 2 #DEFCONT \ .DB MPPIBASE+4 #DEFCONT \ .DB (MPPICH3|00100000B) #DEFCONT \ .DB MPPICH3X #DEFCONT \ .DW 0 #DEFCONT \ .DW PPI_IN,PPI_OUT,PPI_IST,PPI_OST,PPI_INITDEV,PPI_QUERY,PPI_DEVICE #DEFCONT \ .FILL 2 ; ; HERE WE ACTUALLY DEFINE THE HARDWARE THAT THE HBIOS CAN ACCESS ; THE INIT ROUTINES READ AND SET THE INITIAL MODES FROM THIS INFO ; PIO_CFG: ; #IF PIO_4P DEFPIO(PIO4BASE+0,M_Output,M_Input,M_BitAllOut,M_BitAllOut,INT_N,INT_N) DEFPIO(PIO4BASE+4,M_Input,M_Input,M_BitAllOut,M_BitAllOut,INT_N,INT_N) DEFPIO(PIO4BASE+8,M_Output,M_Output,M_BitAllOut,M_BitAllOut,INT_N,INT_N) DEFPIO(PIO4BASE+12,M_Output,M_Output,M_BitAllOut,M_Output,INT_N,INT_N) #ENDIF #IF PIO_ZP DEFPIO(PIOZBASE+0,M_Input,M_Input,M_BitAllOut,M_BitAllOut,INT_N,INT_N) DEFPIO(PIOZBASE+4,M_Output,M_Output,M_BitAllOut,M_BitAllOut,INT_N,INT_N) #ENDIF ; PPI_SBC & (PLATFORM == PLT_SBC) & (PPIDEMODE != PPIDEMODE_SBC)) #IF PPI_SBC DEFPPI(PPIBASE,M_Output,M_Output,M_Output,M_BitAllOut,M_BitAllOut,M_BitAllOut) #ENDIF ; PIO_CNT .EQU ($ - PIO_CFG) / CFG_SIZ ; ;------------------------------------------------------------------- ; WHEN WE GET HERE IY POINTS TO THE PIO_CFG TABLE WE ARE WORKING ON. ; C IS THE UNIT NUMBER ;------------------------------------------------------------------- ; ;PIO_INITUNIT: ; LD A,C ; SET THE UNIT NUMBER ; LD (IY),A ; ; LD DE,-1 ; LEAVE CONFIG ALONE ; CALL PIO_INITDEV ; IMPLEMENT IT AND RETURN ; XOR A ; SIGNAL SUCCESS ; RET ; AND RETURN ; PIO_INIT: ; CALL SPK_BEEP LD B,PIO_CNT ; COUNT OF POSSIBLE PIO UNITS LD C,0 ; INDEX INTO PIO CONFIG TABLE PIO_INIT1: PUSH BC ; SAVE LOOP CONTROL ; LD A,C ; PHYSICAL UNIT TO A ; RLCA ; MULTIPLY BY CFG TABLE ENTRY SIZE (32 BYTES) ; RLCA ; ... ; RLCA ; ... TO GET OFFSET INTO CFG TABLE ; RLCA ;; RLCA ; LD HL,PIO_CFG ; POINT TO START OF CFG TABLE ; PUSH AF ; CALL ADDHLA ; HL := ENTRY ADDRESS ; POP AF ; CALL ADDHLA ; HL := ENTRY ADDRESS ; PUSH HL ; COPY CFG DATA PTR ; POP IY ; ... TO IY ; POP IY ; ... TO IY CALL IDXCFG LD A,(IY+1) ; GET PIO TYPE OR A ; SET FLAGS CALL NZ,PIO_PRTCFG ; PRINT IF NOT ZERO ; PUSH DE ; LD DE,$FFFF ; INITIALIZE DEVICE/CHANNEL ; CALL PIO_INITDEV ; BASED ON DPW ; POP DE POP BC ; RESTORE LOOP CONTROL INC C ; NEXT UNIT DJNZ PIO_INIT1 ; LOOP TILL DONE ; XOR A ; SIGNAL SUCCESS RET ; DONE ; SET_PORT: ; DEVICE TYPE IS I/O PORT SO JUST WRITE $00 TO IT LD C,(IY+3) OUT (C),A XOR A RET
global rrf0 global rrf1 global rrf2 global rrf3 global rrf4 global rrf5 global rrf6 global rrf7 global rrf8 global rrf9 global rrfcl global rrfscl global rrflt global rrfeq global rrfgt global rrfqm global rrfat global rrfA global rrfB global rrfC global rrfD global rrfE global rrfF global rrfG global rrfH global rrfI global rrfJ global rrfK global rrfL global rrfM global rrfN global rrfO global rrfP global rrfQ global rrfR global rrfS global rrfT global rrfU global rrfV global rrfW global rrfX global rrfY global rrfZ global rrflb global rrfbs global rrfrb global rrfct global rrfus global rrftl global rrfa global rrfb global rrfc global rrfd global rrfe global rrff global rrfg global rrfh global rrfi global rrfj global rrfk global rrfl global rrfm global rrfn global rrfo global rrfp global rrfq global rrfr global rrfs global rrft global rrfu global rrfv global rrfw global rrfx global rrfy global rrfz global rrflcb global rrfst global rrfrcb global rrf00 global add global sub global xor global main extern write SECTION .text rrf0: mov eax, 48 ret rrf1: mov eax, 49 ret rrf2: mov eax, 50 ret rrf3: mov eax, 51 ret rrf4: mov eax, 52 ret rrf5: mov eax, 53 ret rrf6: mov eax, 54 ret rrf7: mov eax, 55 ret rrf8: mov eax, 56 ret rrf9: mov eax, 57 ret rrfcl: mov eax, 58 ret rrfscl: mov eax, 59 ret rrflt: mov eax, 60 ret rrfeq: mov eax, 61 ret rrfgt: mov eax, 62 ret rrfqm: mov eax, 63 ret rrfat: mov eax, 64 ret rrfA: mov eax, 65 ret rrfB: mov eax, 66 ret rrfC: mov eax, 67 ret rrfD: mov eax, 68 ret rrfE: mov eax, 69 ret rrfF: mov eax, 70 ret rrfG: mov eax, 71 ret rrfH: mov eax, 72 ret rrfI: mov eax, 73 ret rrfJ: mov eax, 74 ret rrfK: mov eax, 75 ret rrfL: mov eax, 76 ret rrfM: mov eax, 77 ret rrfN: mov eax, 78 ret rrfO: mov eax, 79 ret rrfP: mov eax, 80 ret rrfQ: mov eax, 81 ret rrfR: mov eax, 82 ret rrfS: mov eax, 83 ret rrfT: mov eax, 84 ret rrfU: mov eax, 85 ret rrfV: mov eax, 86 ret rrfW: mov eax, 87 ret rrfX: mov eax, 88 ret rrfY: mov eax, 89 ret rrfZ: mov eax, 90 ret rrflb: mov eax, 91 ret rrfbs: mov eax, 92 ret rrfrb: mov eax, 93 ret rrfct: mov eax, 94 ret rrfus: mov eax, 95 ret rrftl: mov eax, 96 ret rrfa: mov eax, 97 ret rrfb: mov eax, 98 ret rrfc: mov eax, 99 ret rrfd: mov eax, 100 ret rrfe: mov eax, 101 ret rrff: mov eax, 102 ret rrfg: mov eax, 103 ret rrfh: mov eax, 104 ret rrfi: mov eax, 105 ret rrfj: mov eax, 106 ret rrfk: mov eax, 107 ret rrfl: mov eax, 108 ret rrfm: mov eax, 109 ret rrfn: mov eax, 110 ret rrfo: mov eax, 111 ret rrfp: mov eax, 112 ret rrfq: mov eax, 113 ret rrfr: mov eax, 114 ret rrfs: mov eax, 115 ret rrft: mov eax, 116 ret rrfu: mov eax, 117 ret rrfv: mov eax, 118 ret rrfw: mov eax, 119 ret rrfx: mov eax, 120 ret rrfy: mov eax, 121 ret rrfz: mov eax, 122 ret rrflcb: mov eax, 123 ret rrfst: mov eax, 124 ret rrfrcb: mov eax, 125 ret rrf00: mov eax, 0 ret add: movsx ecx, byte [esp+4H] sub ecx, 48 add ecx, dword [esp+8H] mov edx, 3524075731 mov eax, ecx imul edx add edx, ecx sar edx, 6 mov eax, ecx sar eax, 31 sub edx, eax imul edx, edx, 78 sub ecx, edx lea eax, [ecx+30H] ret sub: movsx ecx, byte [esp+4H] sub ecx, 48 sub ecx, dword [esp+8H] mov edx, 3524075731 mov eax, ecx imul edx add edx, ecx sar edx, 6 mov eax, ecx sar eax, 31 sub edx, eax imul edx, edx, 78 sub ecx, edx mov edx, ecx lea ecx, [ecx+7EH] lea eax, [edx+30H] test edx, edx cmovs eax, ecx ret xor: movsx ecx, byte [esp+4H] sub ecx, 48 mov eax, dword [esp+8H] and eax, 07H xor ecx, eax mov edx, 3524075731 mov eax, ecx imul edx add edx, ecx sar edx, 6 mov eax, ecx sar eax, 31 sub edx, eax imul edx, edx, 78 sub ecx, edx lea eax, [ecx+30H] ret main: lea ecx, [esp+4H] and esp, 0FFFFFFF0H push dword [ecx-4H] push ebp mov ebp, esp push esi push ebx push ecx sub esp, 60 push 39 push 49 call sub add esp, 8 movsx ecx, al sub ecx, 24 mov ebx, 3524075731 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-44H], cl push 56 push 83 call sub add esp, 8 mov byte [ebp-42H], al push 19 push 90 call sub add esp, 8 push 43 movsx ecx, al sub ecx, 48 xor ecx, 07H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax lea eax, [ecx+30H] movsx eax, al push eax call sub add esp, 8 mov byte [ebp-40H], al push 33 push 89 call sub add esp, 8 push 23 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-3EH], al mov byte [ebp-3CH], 67 push 25 push 109 call sub add esp, 8 mov byte [ebp-3AH], al push 19 push 104 call sub add esp, 8 push 21 movsx eax, al push eax call sub add esp, 8 movsx ecx, al sub ecx, 48 xor ecx, 06H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-38H], cl push 25 push 102 call sub add esp, 8 push 55 movsx eax, al lea ecx, [eax-19H] mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax mov eax, ecx add eax, 48 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-36H], al mov byte [ebp-34H], 49 push 38 push 80 call sub add esp, 8 push 30 movsx ecx, al sub ecx, 48 xor ecx, 05H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax lea eax, [ecx+30H] movsx eax, al push eax call sub add esp, 8 mov byte [ebp-32H], al push 53 push 78 call sub add esp, 8 push 54 movsx eax, al push eax call sub add esp, 8 movsx ecx, al add ecx, 7 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-30H], cl push 24 push 109 call sub add esp, 8 push 34 movsx ecx, al sub ecx, 48 xor ecx, 07H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax lea eax, [ecx+30H] movsx eax, al push eax call sub add esp, 8 mov byte [ebp-2EH], al push 33 push 115 call sub add esp, 8 push 48 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-2CH], al push 29 push 105 call sub add esp, 8 movsx ecx, al add ecx, 5 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-2AH], cl push 46 push 112 call sub add esp, 8 movsx ecx, al sub ecx, 21 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 movsx ecx, cl sub ecx, 48 xor ecx, 02H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-28H], cl push 49 push 93 call sub add esp, 8 movsx ecx, al sub ecx, 48 xor ecx, 03H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-26H], cl push 32 push 60 call sub add esp, 8 movsx ecx, al sub ecx, 25 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 movsx ecx, cl sub ecx, 48 xor ecx, 03H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-24H], cl push 54 push 95 call sub add esp, 8 movsx ecx, al add ecx, 5 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 movsx ecx, cl sub ecx, 25 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-22H], cl push 46 push 115 call sub add esp, 8 push 52 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-20H], al mov byte [ebp-1EH], 99 push 18 push 113 call sub add esp, 8 push 47 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-1CH], al push 54 push 98 call sub add esp, 8 movsx ecx, al sub ecx, 23 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 movsx ecx, cl sub ecx, 8 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-1AH], cl push 48 push 110 call sub add esp, 8 push 53 movsx eax, al push eax call sub add esp, 8 movsx ecx, al sub ecx, 48 xor ecx, 07H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-43H], cl push 32 push 108 call sub add esp, 8 push 48 movsx eax, al push eax call sub add esp, 8 movsx ecx, al sub ecx, 27 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-41H], cl push 49 push 79 call sub add esp, 8 mov byte [ebp-3FH], al push 50 push 90 call sub add esp, 8 push 31 movsx eax, al push eax call sub add esp, 8 push 36 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-3DH], al mov byte [ebp-3BH], 100 mov byte [ebp-39H], 95 mov byte [ebp-37H], 116 push 34 push 112 call sub add esp, 8 movsx ecx, al sub ecx, 48 xor ecx, 06H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-35H], cl push 20 push 122 call sub add esp, 8 push 53 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-33H], al mov byte [ebp-31H], 53 mov byte [ebp-2FH], 95 push 19 push 76 call sub add esp, 8 mov byte [ebp-2DH], al push 35 push 85 call sub add esp, 8 movsx ecx, al sub ecx, 48 xor ecx, 06H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-2BH], cl push 24 push 60 call sub add esp, 8 movsx ecx, al sub ecx, 30 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 movsx ecx, cl sub ecx, 48 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-29H], cl mov byte [ebp-27H], 57 mov byte [ebp-25H], 56 mov byte [ebp-23H], 54 push 53 push 106 call sub add esp, 8 movsx ecx, al sub ecx, 48 mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 movsx ecx, cl sub ecx, 48 xor ecx, 06H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-21H], cl push 19 push 87 call sub add esp, 8 push 46 movsx eax, al lea ecx, [eax-0FH] mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax mov eax, ecx add eax, 48 movsx eax, al push eax call sub add esp, 8 mov byte [ebp-1FH], al mov byte [ebp-1DH], 57 mov byte [ebp-1BH], 51 push 28 push 77 call sub add esp, 8 movsx ecx, al sub ecx, 48 xor ecx, 02H mov eax, ecx imul ebx lea eax, [edx+ecx] sar eax, 6 mov edx, ecx sar edx, 31 sub eax, edx imul eax, eax, 78 sub ecx, eax add ecx, 48 mov byte [ebp-19H], cl lea ebx, [ebp-44H] lea esi, [ebp-18H] L_001: sub esp, 4 push 1 push ebx push 1 call write add ebx, 2 add esp, 16 cmp esi, ebx jnz L_001 lea ebx, [ebp-43H] lea esi, [ebp-17H] L_002: sub esp, 4 push 1 push ebx push 1 call write add ebx, 2 add esp, 16 cmp esi, ebx jnz L_002 mov eax, 0 lea esp, [ebp-0CH] pop ecx pop ebx pop esi pop ebp lea esp, [ecx-4H] ret
#include <iostream> #include <bits/stdc++.h> using namespace std; int minOperation (int arr[], int n) { int operations = 0; int i = 0; int j = n - 1; while (i < j) { if (arr[i] == arr[j]) { i++; j--; } else if (arr[i] < arr[j]) { i++; arr[i] += arr[i - 1]; operations++; } else { j--; arr[j] += arr[j + 1]; operations++; } } return operations; } int main() { int n; cin >> n; int arr[n]; for (int i = 0; i < n; i++) { cin >> arr[i]; } cout << minOperation(arr, n); return 0; }
format PE start: int3 push 10 push 10 lea eax,[A_character_] call drawChar64_16 drawChar64_16: xor edx,edx xor ecx,ecx xor ebx,ebx mov cx,8 dC6416Subrt: mov dx,8 mov bl,byte [eax] dC6416Subrt0: push ebx and ebx,01 test ebx,ebx jz dC6416NotPixel call hehehe dC6416NotPixel: pop ebx shr bl,1 dec dx jnz dC6416Subrt0 inc eax dec cx jnz dC6416Subrt ret hehehe: nop nop nop nop ret chars: dd 0 dd 0 dd 0 A_character_: db 00000000b db 00011000b db 00100100b db 01000010b db 01111110b db 01000010b db 01000010b db 00000000b
; void SMS_setLineInterruptHandler(void *theHandlerFunction) SECTION code_clib SECTION code_SMSlib PUBLIC _SMS_setLineInterruptHandler EXTERN asm_SMSlib_setLineInterruptHandler _SMS_setLineInterruptHandler: pop af pop hl push hl push af jp asm_SMSlib_setLineInterruptHandler
; Square Root Calculator by Lee Davison ; ; How to calculate the 8-bit unsigned integer square root of an unsigned 16-bit integer. ; By Lee Davison (leeedavison@googlemail.com), 23 July 2001. ; Calculates the 8 bit root and 9 bit remainder of a 16 bit unsigned integer in ; Numberl/Numberh. The result is always in the range 0 to 255 and is held in ; Root, the remainder is in the range 0 to 511 and is held in Reml/Remh ; ; partial results are held in templ/temph ; ; This routine is the complement to the integer square program. ; ; Destroys A, X registers. ; ; variables - must be in RAM ; Originally published on http://6502.org/source/integers/root.htm ; Adapted by Marco Spedaletti for ugBASIC ; ; @thirdparts Lee Davison * * Numberl = $F0 ; number to find square root of low byte Numberh = Numberl+1 ; number to find square root of high byte Reml = $F2 ; remainder low byte Remh = Reml+1 ; remainder high byte templ = $F4 ; temp partial low byte temph = templ+1 ; temp partial high byte Root = $F6 ; square root SQROOT: LDA #$00 ; clear A STA Reml ; clear remainder low byte STA Remh ; clear remainder high byte STA Root ; clear Root LDX #$08 ; 8 pairs of bits to do SQROOTL1: ASL Root ; Root = Root * 2 ASL Numberl ; shift highest bit of number .. ROL Numberh ; ROL Reml ; .. into remainder ROL Remh ; ASL Numberl ; shift highest bit of number .. ROL Numberh ; ROL Reml ; .. into remainder ROL Remh ; LDA Root ; copy Root .. STA templ ; .. to templ LDA #$00 ; clear byte STA temph ; clear temp high byte SEC ; +1 ROL templ ; temp = temp * 2 + 1 ROL temph ; LDA Remh ; get remainder high byte CMP temph ; comapre with partial high byte BCC SQROOTNX ; skip sub if remainder high byte smaller BNE SQROOTSB ; do sub if <> (must be remainder>partial !) LDA Reml ; get remainder low byte CMP templ ; comapre with partial low byte BCC SQROOTNX ; skip sub if remainder low byte smaller ; else remainder>=partial so subtract then ; and add 1 to root. carry is always set here SQROOTSB: LDA Reml ; get remainder low byte SBC templ ; subtract partial low byte STA Reml ; save remainder low byte LDA Remh ; get remainder high byte SBC temph ; subtract partial high byte STA Remh ; save remainder high byte INC Root ; increment Root SQROOTNX: DEX ; decrement bit pair count BNE SQROOTL1 ; loop if not all done RTS
; A021165: Decimal expansion of 1/161. ; Submitted by Jamie Morken(s3) ; 0,0,6,2,1,1,1,8,0,1,2,4,2,2,3,6,0,2,4,8,4,4,7,2,0,4,9,6,8,9,4,4,0,9,9,3,7,8,8,8,1,9,8,7,5,7,7,6,3,9,7,5,1,5,5,2,7,9,5,0,3,1,0,5,5,9,0,0,6,2,1,1,1,8,0,1,2,4,2,2,3,6,0,2,4,8,4,4,7,2,0,4,9,6,8,9,4,4,0 add $0,1 mov $1,10 pow $1,$0 mul $1,84 div $1,13524 mod $1,10 mov $0,$1
; A168053: Expansion of (1-2*x^2-3*x^3)/((1-x)^2*(1+x+x^2)). ; 1,1,-1,-3,-3,-5,-7,-7,-9,-11,-11,-13,-15,-15,-17,-19,-19,-21,-23,-23,-25,-27,-27,-29,-31,-31,-33,-35,-35,-37,-39,-39,-41,-43,-43,-45,-47,-47,-49,-51,-51,-53,-55,-55,-57,-59,-59,-61,-63,-63,-65,-67,-67,-69,-71,-71,-73,-75,-75,-77,-79,-79,-81,-83,-83,-85,-87,-87,-89,-91,-91,-93,-95,-95,-97,-99,-99,-101,-103,-103,-105,-107,-107,-109,-111,-111,-113,-115,-115,-117,-119,-119,-121,-123,-123,-125,-127,-127,-129,-131 mul $0,2 div $0,-3 mul $0,2 add $0,1
_lab2: file format elf32-i386 Disassembly of section .text: 00000000 <main>: #include "types.h" #include "user.h" int main(int argc, char *argv[]) { 0: 55 push %ebp 1: 89 e5 mov %esp,%ebp 3: 83 e4 f0 and $0xfffffff0,%esp 6: 83 ec 10 sub $0x10,%esp int PScheduler(void); printf(1, "\n This program tests the correctness of your lab#2\n"); 9: c7 44 24 04 f8 09 00 movl $0x9f8,0x4(%esp) 10: 00 11: c7 04 24 01 00 00 00 movl $0x1,(%esp) 18: e8 c3 04 00 00 call 4e0 <printf> PScheduler(); 1d: e8 0e 00 00 00 call 30 <PScheduler> 22: 66 90 xchg %ax,%ax 24: 66 90 xchg %ax,%ax 26: 66 90 xchg %ax,%ax 28: 66 90 xchg %ax,%ax 2a: 66 90 xchg %ax,%ax 2c: 66 90 xchg %ax,%ax 2e: 66 90 xchg %ax,%ax 00000030 <PScheduler>: return 0; } int PScheduler(void){ 30: 55 push %ebp 31: 89 e5 mov %esp,%ebp 33: 53 push %ebx printf(1, "\n Step 2: testing the priority scheduler and setpriority(int priority)) systema call:\n"); printf(1, "\n Step 2: Assuming that the priorities range between range between 0 to 31\n"); printf(1, "\n Step 2: 0 is the highest priority. All processes have a default priority of 10\n"); printf(1, "\n Step 2: The parent processes will switch to priority 0\n"); set_prior(0); for (i = 0; i < 3; i++) { 34: 31 db xor %ebx,%ebx int PScheduler(void){ 36: 83 ec 24 sub $0x24,%esp printf(1, "\n Step 2: testing the priority scheduler and setpriority(int priority)) systema call:\n"); 39: c7 44 24 04 48 08 00 movl $0x848,0x4(%esp) 40: 00 41: c7 04 24 01 00 00 00 movl $0x1,(%esp) 48: e8 93 04 00 00 call 4e0 <printf> printf(1, "\n Step 2: Assuming that the priorities range between range between 0 to 31\n"); 4d: c7 44 24 04 a0 08 00 movl $0x8a0,0x4(%esp) 54: 00 55: c7 04 24 01 00 00 00 movl $0x1,(%esp) 5c: e8 7f 04 00 00 call 4e0 <printf> printf(1, "\n Step 2: 0 is the highest priority. All processes have a default priority of 10\n"); 61: c7 44 24 04 f0 08 00 movl $0x8f0,0x4(%esp) 68: 00 69: c7 04 24 01 00 00 00 movl $0x1,(%esp) 70: e8 6b 04 00 00 call 4e0 <printf> printf(1, "\n Step 2: The parent processes will switch to priority 0\n"); 75: c7 44 24 04 44 09 00 movl $0x944,0x4(%esp) 7c: 00 7d: c7 04 24 01 00 00 00 movl $0x1,(%esp) 84: e8 57 04 00 00 call 4e0 <printf> set_prior(0); 89: c7 04 24 00 00 00 00 movl $0x0,(%esp) 90: e8 9d 03 00 00 call 432 <set_prior> pid = fork(); 95: e8 e0 02 00 00 call 37a <fork> if (pid > 0 ) { 9a: 83 f8 00 cmp $0x0,%eax 9d: 7e 49 jle e8 <PScheduler+0xb8> for (i = 0; i < 3; i++) { 9f: 83 c3 01 add $0x1,%ebx a2: 83 fb 03 cmp $0x3,%ebx a5: 75 ee jne 95 <PScheduler+0x65> printf(2," \n Error \n"); } } if(pid > 0) { a7: 85 c0 test %eax,%eax a9: 7e 38 jle e3 <PScheduler+0xb3> for (i = 0; i < 3; i++) { wait(0); ab: c7 04 24 00 00 00 00 movl $0x0,(%esp) b2: e8 d3 02 00 00 call 38a <wait> b7: c7 04 24 00 00 00 00 movl $0x0,(%esp) be: e8 c7 02 00 00 call 38a <wait> c3: c7 04 24 00 00 00 00 movl $0x0,(%esp) ca: e8 bb 02 00 00 call 38a <wait> } printf(1,"\n if processes with highest priority finished first then its correct \n"); cf: c7 44 24 04 b0 09 00 movl $0x9b0,0x4(%esp) d6: 00 d7: c7 04 24 01 00 00 00 movl $0x1,(%esp) de: e8 fd 03 00 00 call 4e0 <printf> } exit(); e3: e8 9a 02 00 00 call 382 <exit> else if ( pid == 0) { e8: 74 1c je 106 <PScheduler+0xd6> printf(2," \n Error \n"); ea: c7 44 24 04 2c 0a 00 movl $0xa2c,0x4(%esp) f1: 00 f2: c7 04 24 02 00 00 00 movl $0x2,(%esp) f9: 89 45 f4 mov %eax,-0xc(%ebp) fc: e8 df 03 00 00 call 4e0 <printf> 101: 8b 45 f4 mov -0xc(%ebp),%eax 104: eb 99 jmp 9f <PScheduler+0x6f> set_prior(30-10*i); 106: 6b db f6 imul $0xfffffff6,%ebx,%ebx 109: 83 c3 1e add $0x1e,%ebx 10c: 89 1c 24 mov %ebx,(%esp) 10f: e8 1e 03 00 00 call 432 <set_prior> 114: ba 50 c3 00 00 mov $0xc350,%edx 119: 8d b4 26 00 00 00 00 lea 0x0(%esi,%eiz,1),%esi for (i = 0; i < 3; i++) { 120: b8 e8 03 00 00 mov $0x3e8,%eax 125: 8d 76 00 lea 0x0(%esi),%esi asm("nop"); }} 128: 90 nop for(k=0;k<1000;k++) { 129: 83 e8 01 sub $0x1,%eax 12c: 75 fa jne 128 <PScheduler+0xf8> for (j=0;j<50000;j++) { 12e: 83 ea 01 sub $0x1,%edx 131: 75 ed jne 120 <PScheduler+0xf0> printf(1, "\n child# %d with priority %d has finished! \n",getpid(),30-10*i); 133: e8 ca 02 00 00 call 402 <getpid> 138: 89 5c 24 0c mov %ebx,0xc(%esp) 13c: c7 44 24 04 80 09 00 movl $0x980,0x4(%esp) 143: 00 144: c7 04 24 01 00 00 00 movl $0x1,(%esp) 14b: 89 44 24 08 mov %eax,0x8(%esp) 14f: e8 8c 03 00 00 call 4e0 <printf> exit(); 154: e8 29 02 00 00 call 382 <exit> 159: 66 90 xchg %ax,%ax 15b: 66 90 xchg %ax,%ax 15d: 66 90 xchg %ax,%ax 15f: 90 nop 00000160 <strcpy>: #include "user.h" #include "x86.h" char* strcpy(char *s, const char *t) { 160: 55 push %ebp 161: 89 e5 mov %esp,%ebp 163: 8b 45 08 mov 0x8(%ebp),%eax 166: 8b 4d 0c mov 0xc(%ebp),%ecx 169: 53 push %ebx char *os; os = s; while((*s++ = *t++) != 0) 16a: 89 c2 mov %eax,%edx 16c: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi 170: 83 c1 01 add $0x1,%ecx 173: 0f b6 59 ff movzbl -0x1(%ecx),%ebx 177: 83 c2 01 add $0x1,%edx 17a: 84 db test %bl,%bl 17c: 88 5a ff mov %bl,-0x1(%edx) 17f: 75 ef jne 170 <strcpy+0x10> ; return os; } 181: 5b pop %ebx 182: 5d pop %ebp 183: c3 ret 184: 8d b6 00 00 00 00 lea 0x0(%esi),%esi 18a: 8d bf 00 00 00 00 lea 0x0(%edi),%edi 00000190 <strcmp>: int strcmp(const char *p, const char *q) { 190: 55 push %ebp 191: 89 e5 mov %esp,%ebp 193: 8b 55 08 mov 0x8(%ebp),%edx 196: 53 push %ebx 197: 8b 4d 0c mov 0xc(%ebp),%ecx while(*p && *p == *q) 19a: 0f b6 02 movzbl (%edx),%eax 19d: 84 c0 test %al,%al 19f: 74 2d je 1ce <strcmp+0x3e> 1a1: 0f b6 19 movzbl (%ecx),%ebx 1a4: 38 d8 cmp %bl,%al 1a6: 74 0e je 1b6 <strcmp+0x26> 1a8: eb 2b jmp 1d5 <strcmp+0x45> 1aa: 8d b6 00 00 00 00 lea 0x0(%esi),%esi 1b0: 38 c8 cmp %cl,%al 1b2: 75 15 jne 1c9 <strcmp+0x39> p++, q++; 1b4: 89 d9 mov %ebx,%ecx 1b6: 83 c2 01 add $0x1,%edx while(*p && *p == *q) 1b9: 0f b6 02 movzbl (%edx),%eax p++, q++; 1bc: 8d 59 01 lea 0x1(%ecx),%ebx while(*p && *p == *q) 1bf: 0f b6 49 01 movzbl 0x1(%ecx),%ecx 1c3: 84 c0 test %al,%al 1c5: 75 e9 jne 1b0 <strcmp+0x20> 1c7: 31 c0 xor %eax,%eax return (uchar)*p - (uchar)*q; 1c9: 29 c8 sub %ecx,%eax } 1cb: 5b pop %ebx 1cc: 5d pop %ebp 1cd: c3 ret 1ce: 0f b6 09 movzbl (%ecx),%ecx while(*p && *p == *q) 1d1: 31 c0 xor %eax,%eax 1d3: eb f4 jmp 1c9 <strcmp+0x39> 1d5: 0f b6 cb movzbl %bl,%ecx 1d8: eb ef jmp 1c9 <strcmp+0x39> 1da: 8d b6 00 00 00 00 lea 0x0(%esi),%esi 000001e0 <strlen>: uint strlen(const char *s) { 1e0: 55 push %ebp 1e1: 89 e5 mov %esp,%ebp 1e3: 8b 4d 08 mov 0x8(%ebp),%ecx int n; for(n = 0; s[n]; n++) 1e6: 80 39 00 cmpb $0x0,(%ecx) 1e9: 74 12 je 1fd <strlen+0x1d> 1eb: 31 d2 xor %edx,%edx 1ed: 8d 76 00 lea 0x0(%esi),%esi 1f0: 83 c2 01 add $0x1,%edx 1f3: 80 3c 11 00 cmpb $0x0,(%ecx,%edx,1) 1f7: 89 d0 mov %edx,%eax 1f9: 75 f5 jne 1f0 <strlen+0x10> ; return n; } 1fb: 5d pop %ebp 1fc: c3 ret for(n = 0; s[n]; n++) 1fd: 31 c0 xor %eax,%eax } 1ff: 5d pop %ebp 200: c3 ret 201: eb 0d jmp 210 <memset> 203: 90 nop 204: 90 nop 205: 90 nop 206: 90 nop 207: 90 nop 208: 90 nop 209: 90 nop 20a: 90 nop 20b: 90 nop 20c: 90 nop 20d: 90 nop 20e: 90 nop 20f: 90 nop 00000210 <memset>: void* memset(void *dst, int c, uint n) { 210: 55 push %ebp 211: 89 e5 mov %esp,%ebp 213: 8b 55 08 mov 0x8(%ebp),%edx 216: 57 push %edi } static inline void stosb(void *addr, int data, int cnt) { asm volatile("cld; rep stosb" : 217: 8b 4d 10 mov 0x10(%ebp),%ecx 21a: 8b 45 0c mov 0xc(%ebp),%eax 21d: 89 d7 mov %edx,%edi 21f: fc cld 220: f3 aa rep stos %al,%es:(%edi) stosb(dst, c, n); return dst; } 222: 89 d0 mov %edx,%eax 224: 5f pop %edi 225: 5d pop %ebp 226: c3 ret 227: 89 f6 mov %esi,%esi 229: 8d bc 27 00 00 00 00 lea 0x0(%edi,%eiz,1),%edi 00000230 <strchr>: char* strchr(const char *s, char c) { 230: 55 push %ebp 231: 89 e5 mov %esp,%ebp 233: 8b 45 08 mov 0x8(%ebp),%eax 236: 53 push %ebx 237: 8b 55 0c mov 0xc(%ebp),%edx for(; *s; s++) 23a: 0f b6 18 movzbl (%eax),%ebx 23d: 84 db test %bl,%bl 23f: 74 1d je 25e <strchr+0x2e> if(*s == c) 241: 38 d3 cmp %dl,%bl 243: 89 d1 mov %edx,%ecx 245: 75 0d jne 254 <strchr+0x24> 247: eb 17 jmp 260 <strchr+0x30> 249: 8d b4 26 00 00 00 00 lea 0x0(%esi,%eiz,1),%esi 250: 38 ca cmp %cl,%dl 252: 74 0c je 260 <strchr+0x30> for(; *s; s++) 254: 83 c0 01 add $0x1,%eax 257: 0f b6 10 movzbl (%eax),%edx 25a: 84 d2 test %dl,%dl 25c: 75 f2 jne 250 <strchr+0x20> return (char*)s; return 0; 25e: 31 c0 xor %eax,%eax } 260: 5b pop %ebx 261: 5d pop %ebp 262: c3 ret 263: 8d b6 00 00 00 00 lea 0x0(%esi),%esi 269: 8d bc 27 00 00 00 00 lea 0x0(%edi,%eiz,1),%edi 00000270 <gets>: char* gets(char *buf, int max) { 270: 55 push %ebp 271: 89 e5 mov %esp,%ebp 273: 57 push %edi 274: 56 push %esi int i, cc; char c; for(i=0; i+1 < max; ){ 275: 31 f6 xor %esi,%esi { 277: 53 push %ebx 278: 83 ec 2c sub $0x2c,%esp cc = read(0, &c, 1); 27b: 8d 7d e7 lea -0x19(%ebp),%edi for(i=0; i+1 < max; ){ 27e: eb 31 jmp 2b1 <gets+0x41> cc = read(0, &c, 1); 280: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 287: 00 288: 89 7c 24 04 mov %edi,0x4(%esp) 28c: c7 04 24 00 00 00 00 movl $0x0,(%esp) 293: e8 02 01 00 00 call 39a <read> if(cc < 1) 298: 85 c0 test %eax,%eax 29a: 7e 1d jle 2b9 <gets+0x49> break; buf[i++] = c; 29c: 0f b6 45 e7 movzbl -0x19(%ebp),%eax for(i=0; i+1 < max; ){ 2a0: 89 de mov %ebx,%esi buf[i++] = c; 2a2: 8b 55 08 mov 0x8(%ebp),%edx if(c == '\n' || c == '\r') 2a5: 3c 0d cmp $0xd,%al buf[i++] = c; 2a7: 88 44 1a ff mov %al,-0x1(%edx,%ebx,1) if(c == '\n' || c == '\r') 2ab: 74 0c je 2b9 <gets+0x49> 2ad: 3c 0a cmp $0xa,%al 2af: 74 08 je 2b9 <gets+0x49> for(i=0; i+1 < max; ){ 2b1: 8d 5e 01 lea 0x1(%esi),%ebx 2b4: 3b 5d 0c cmp 0xc(%ebp),%ebx 2b7: 7c c7 jl 280 <gets+0x10> break; } buf[i] = '\0'; 2b9: 8b 45 08 mov 0x8(%ebp),%eax 2bc: c6 04 30 00 movb $0x0,(%eax,%esi,1) return buf; } 2c0: 83 c4 2c add $0x2c,%esp 2c3: 5b pop %ebx 2c4: 5e pop %esi 2c5: 5f pop %edi 2c6: 5d pop %ebp 2c7: c3 ret 2c8: 90 nop 2c9: 8d b4 26 00 00 00 00 lea 0x0(%esi,%eiz,1),%esi 000002d0 <stat>: int stat(const char *n, struct stat *st) { 2d0: 55 push %ebp 2d1: 89 e5 mov %esp,%ebp 2d3: 56 push %esi 2d4: 53 push %ebx 2d5: 83 ec 10 sub $0x10,%esp int fd; int r; fd = open(n, O_RDONLY); 2d8: 8b 45 08 mov 0x8(%ebp),%eax 2db: c7 44 24 04 00 00 00 movl $0x0,0x4(%esp) 2e2: 00 2e3: 89 04 24 mov %eax,(%esp) 2e6: e8 d7 00 00 00 call 3c2 <open> if(fd < 0) 2eb: 85 c0 test %eax,%eax fd = open(n, O_RDONLY); 2ed: 89 c3 mov %eax,%ebx if(fd < 0) 2ef: 78 27 js 318 <stat+0x48> return -1; r = fstat(fd, st); 2f1: 8b 45 0c mov 0xc(%ebp),%eax 2f4: 89 1c 24 mov %ebx,(%esp) 2f7: 89 44 24 04 mov %eax,0x4(%esp) 2fb: e8 da 00 00 00 call 3da <fstat> close(fd); 300: 89 1c 24 mov %ebx,(%esp) r = fstat(fd, st); 303: 89 c6 mov %eax,%esi close(fd); 305: e8 a0 00 00 00 call 3aa <close> return r; 30a: 89 f0 mov %esi,%eax } 30c: 83 c4 10 add $0x10,%esp 30f: 5b pop %ebx 310: 5e pop %esi 311: 5d pop %ebp 312: c3 ret 313: 90 nop 314: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi return -1; 318: b8 ff ff ff ff mov $0xffffffff,%eax 31d: eb ed jmp 30c <stat+0x3c> 31f: 90 nop 00000320 <atoi>: int atoi(const char *s) { 320: 55 push %ebp 321: 89 e5 mov %esp,%ebp 323: 8b 4d 08 mov 0x8(%ebp),%ecx 326: 53 push %ebx int n; n = 0; while('0' <= *s && *s <= '9') 327: 0f be 11 movsbl (%ecx),%edx 32a: 8d 42 d0 lea -0x30(%edx),%eax 32d: 3c 09 cmp $0x9,%al n = 0; 32f: b8 00 00 00 00 mov $0x0,%eax while('0' <= *s && *s <= '9') 334: 77 17 ja 34d <atoi+0x2d> 336: 66 90 xchg %ax,%ax n = n*10 + *s++ - '0'; 338: 83 c1 01 add $0x1,%ecx 33b: 8d 04 80 lea (%eax,%eax,4),%eax 33e: 8d 44 42 d0 lea -0x30(%edx,%eax,2),%eax while('0' <= *s && *s <= '9') 342: 0f be 11 movsbl (%ecx),%edx 345: 8d 5a d0 lea -0x30(%edx),%ebx 348: 80 fb 09 cmp $0x9,%bl 34b: 76 eb jbe 338 <atoi+0x18> return n; } 34d: 5b pop %ebx 34e: 5d pop %ebp 34f: c3 ret 00000350 <memmove>: void* memmove(void *vdst, const void *vsrc, int n) { 350: 55 push %ebp char *dst; const char *src; dst = vdst; src = vsrc; while(n-- > 0) 351: 31 d2 xor %edx,%edx { 353: 89 e5 mov %esp,%ebp 355: 56 push %esi 356: 8b 45 08 mov 0x8(%ebp),%eax 359: 53 push %ebx 35a: 8b 5d 10 mov 0x10(%ebp),%ebx 35d: 8b 75 0c mov 0xc(%ebp),%esi while(n-- > 0) 360: 85 db test %ebx,%ebx 362: 7e 12 jle 376 <memmove+0x26> 364: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi *dst++ = *src++; 368: 0f b6 0c 16 movzbl (%esi,%edx,1),%ecx 36c: 88 0c 10 mov %cl,(%eax,%edx,1) 36f: 83 c2 01 add $0x1,%edx while(n-- > 0) 372: 39 da cmp %ebx,%edx 374: 75 f2 jne 368 <memmove+0x18> return vdst; } 376: 5b pop %ebx 377: 5e pop %esi 378: 5d pop %ebp 379: c3 ret 0000037a <fork>: name: \ movl $SYS_ ## name, %eax; \ int $T_SYSCALL; \ ret SYSCALL(fork) 37a: b8 01 00 00 00 mov $0x1,%eax 37f: cd 40 int $0x40 381: c3 ret 00000382 <exit>: SYSCALL(exit) 382: b8 02 00 00 00 mov $0x2,%eax 387: cd 40 int $0x40 389: c3 ret 0000038a <wait>: SYSCALL(wait) 38a: b8 03 00 00 00 mov $0x3,%eax 38f: cd 40 int $0x40 391: c3 ret 00000392 <pipe>: SYSCALL(pipe) 392: b8 04 00 00 00 mov $0x4,%eax 397: cd 40 int $0x40 399: c3 ret 0000039a <read>: SYSCALL(read) 39a: b8 05 00 00 00 mov $0x5,%eax 39f: cd 40 int $0x40 3a1: c3 ret 000003a2 <write>: SYSCALL(write) 3a2: b8 10 00 00 00 mov $0x10,%eax 3a7: cd 40 int $0x40 3a9: c3 ret 000003aa <close>: SYSCALL(close) 3aa: b8 15 00 00 00 mov $0x15,%eax 3af: cd 40 int $0x40 3b1: c3 ret 000003b2 <kill>: SYSCALL(kill) 3b2: b8 06 00 00 00 mov $0x6,%eax 3b7: cd 40 int $0x40 3b9: c3 ret 000003ba <exec>: SYSCALL(exec) 3ba: b8 07 00 00 00 mov $0x7,%eax 3bf: cd 40 int $0x40 3c1: c3 ret 000003c2 <open>: SYSCALL(open) 3c2: b8 0f 00 00 00 mov $0xf,%eax 3c7: cd 40 int $0x40 3c9: c3 ret 000003ca <mknod>: SYSCALL(mknod) 3ca: b8 11 00 00 00 mov $0x11,%eax 3cf: cd 40 int $0x40 3d1: c3 ret 000003d2 <unlink>: SYSCALL(unlink) 3d2: b8 12 00 00 00 mov $0x12,%eax 3d7: cd 40 int $0x40 3d9: c3 ret 000003da <fstat>: SYSCALL(fstat) 3da: b8 08 00 00 00 mov $0x8,%eax 3df: cd 40 int $0x40 3e1: c3 ret 000003e2 <link>: SYSCALL(link) 3e2: b8 13 00 00 00 mov $0x13,%eax 3e7: cd 40 int $0x40 3e9: c3 ret 000003ea <mkdir>: SYSCALL(mkdir) 3ea: b8 14 00 00 00 mov $0x14,%eax 3ef: cd 40 int $0x40 3f1: c3 ret 000003f2 <chdir>: SYSCALL(chdir) 3f2: b8 09 00 00 00 mov $0x9,%eax 3f7: cd 40 int $0x40 3f9: c3 ret 000003fa <dup>: SYSCALL(dup) 3fa: b8 0a 00 00 00 mov $0xa,%eax 3ff: cd 40 int $0x40 401: c3 ret 00000402 <getpid>: SYSCALL(getpid) 402: b8 0b 00 00 00 mov $0xb,%eax 407: cd 40 int $0x40 409: c3 ret 0000040a <sbrk>: SYSCALL(sbrk) 40a: b8 0c 00 00 00 mov $0xc,%eax 40f: cd 40 int $0x40 411: c3 ret 00000412 <sleep>: SYSCALL(sleep) 412: b8 0d 00 00 00 mov $0xd,%eax 417: cd 40 int $0x40 419: c3 ret 0000041a <uptime>: SYSCALL(uptime) 41a: b8 0e 00 00 00 mov $0xe,%eax 41f: cd 40 int $0x40 421: c3 ret 00000422 <exitS>: SYSCALL(exitS) 422: b8 16 00 00 00 mov $0x16,%eax 427: cd 40 int $0x40 429: c3 ret 0000042a <waitpid>: SYSCALL(waitpid) 42a: b8 17 00 00 00 mov $0x17,%eax 42f: cd 40 int $0x40 431: c3 ret 00000432 <set_prior>: SYSCALL(set_prior) 432: b8 18 00 00 00 mov $0x18,%eax 437: cd 40 int $0x40 439: c3 ret 43a: 66 90 xchg %ax,%ax 43c: 66 90 xchg %ax,%ax 43e: 66 90 xchg %ax,%ax 00000440 <printint>: write(fd, &c, 1); } static void printint(int fd, int xx, int base, int sgn) { 440: 55 push %ebp 441: 89 e5 mov %esp,%ebp 443: 57 push %edi 444: 56 push %esi 445: 89 c6 mov %eax,%esi 447: 53 push %ebx 448: 83 ec 4c sub $0x4c,%esp char buf[16]; int i, neg; uint x; neg = 0; if(sgn && xx < 0){ 44b: 8b 5d 08 mov 0x8(%ebp),%ebx 44e: 85 db test %ebx,%ebx 450: 74 09 je 45b <printint+0x1b> 452: 89 d0 mov %edx,%eax 454: c1 e8 1f shr $0x1f,%eax 457: 84 c0 test %al,%al 459: 75 75 jne 4d0 <printint+0x90> neg = 1; x = -xx; } else { x = xx; 45b: 89 d0 mov %edx,%eax neg = 0; 45d: c7 45 c4 00 00 00 00 movl $0x0,-0x3c(%ebp) 464: 89 75 c0 mov %esi,-0x40(%ebp) } i = 0; 467: 31 ff xor %edi,%edi 469: 89 ce mov %ecx,%esi 46b: 8d 5d d7 lea -0x29(%ebp),%ebx 46e: eb 02 jmp 472 <printint+0x32> do{ buf[i++] = digits[x % base]; 470: 89 cf mov %ecx,%edi 472: 31 d2 xor %edx,%edx 474: f7 f6 div %esi 476: 8d 4f 01 lea 0x1(%edi),%ecx 479: 0f b6 92 3e 0a 00 00 movzbl 0xa3e(%edx),%edx }while((x /= base) != 0); 480: 85 c0 test %eax,%eax buf[i++] = digits[x % base]; 482: 88 14 0b mov %dl,(%ebx,%ecx,1) }while((x /= base) != 0); 485: 75 e9 jne 470 <printint+0x30> if(neg) 487: 8b 55 c4 mov -0x3c(%ebp),%edx buf[i++] = digits[x % base]; 48a: 89 c8 mov %ecx,%eax 48c: 8b 75 c0 mov -0x40(%ebp),%esi if(neg) 48f: 85 d2 test %edx,%edx 491: 74 08 je 49b <printint+0x5b> buf[i++] = '-'; 493: 8d 4f 02 lea 0x2(%edi),%ecx 496: c6 44 05 d8 2d movb $0x2d,-0x28(%ebp,%eax,1) while(--i >= 0) 49b: 8d 79 ff lea -0x1(%ecx),%edi 49e: 66 90 xchg %ax,%ax 4a0: 0f b6 44 3d d8 movzbl -0x28(%ebp,%edi,1),%eax 4a5: 83 ef 01 sub $0x1,%edi write(fd, &c, 1); 4a8: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 4af: 00 4b0: 89 5c 24 04 mov %ebx,0x4(%esp) 4b4: 89 34 24 mov %esi,(%esp) 4b7: 88 45 d7 mov %al,-0x29(%ebp) 4ba: e8 e3 fe ff ff call 3a2 <write> while(--i >= 0) 4bf: 83 ff ff cmp $0xffffffff,%edi 4c2: 75 dc jne 4a0 <printint+0x60> putc(fd, buf[i]); } 4c4: 83 c4 4c add $0x4c,%esp 4c7: 5b pop %ebx 4c8: 5e pop %esi 4c9: 5f pop %edi 4ca: 5d pop %ebp 4cb: c3 ret 4cc: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi x = -xx; 4d0: 89 d0 mov %edx,%eax 4d2: f7 d8 neg %eax neg = 1; 4d4: c7 45 c4 01 00 00 00 movl $0x1,-0x3c(%ebp) 4db: eb 87 jmp 464 <printint+0x24> 4dd: 8d 76 00 lea 0x0(%esi),%esi 000004e0 <printf>: // Print to the given fd. Only understands %d, %x, %p, %s. void printf(int fd, const char *fmt, ...) { 4e0: 55 push %ebp 4e1: 89 e5 mov %esp,%ebp 4e3: 57 push %edi char *s; int c, i, state; uint *ap; state = 0; 4e4: 31 ff xor %edi,%edi { 4e6: 56 push %esi 4e7: 53 push %ebx 4e8: 83 ec 3c sub $0x3c,%esp ap = (uint*)(void*)&fmt + 1; for(i = 0; fmt[i]; i++){ 4eb: 8b 5d 0c mov 0xc(%ebp),%ebx ap = (uint*)(void*)&fmt + 1; 4ee: 8d 45 10 lea 0x10(%ebp),%eax { 4f1: 8b 75 08 mov 0x8(%ebp),%esi ap = (uint*)(void*)&fmt + 1; 4f4: 89 45 d4 mov %eax,-0x2c(%ebp) for(i = 0; fmt[i]; i++){ 4f7: 0f b6 13 movzbl (%ebx),%edx 4fa: 83 c3 01 add $0x1,%ebx 4fd: 84 d2 test %dl,%dl 4ff: 75 39 jne 53a <printf+0x5a> 501: e9 c2 00 00 00 jmp 5c8 <printf+0xe8> 506: 66 90 xchg %ax,%ax c = fmt[i] & 0xff; if(state == 0){ if(c == '%'){ 508: 83 fa 25 cmp $0x25,%edx 50b: 0f 84 bf 00 00 00 je 5d0 <printf+0xf0> write(fd, &c, 1); 511: 8d 45 e2 lea -0x1e(%ebp),%eax 514: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 51b: 00 51c: 89 44 24 04 mov %eax,0x4(%esp) 520: 89 34 24 mov %esi,(%esp) state = '%'; } else { putc(fd, c); 523: 88 55 e2 mov %dl,-0x1e(%ebp) write(fd, &c, 1); 526: e8 77 fe ff ff call 3a2 <write> 52b: 83 c3 01 add $0x1,%ebx for(i = 0; fmt[i]; i++){ 52e: 0f b6 53 ff movzbl -0x1(%ebx),%edx 532: 84 d2 test %dl,%dl 534: 0f 84 8e 00 00 00 je 5c8 <printf+0xe8> if(state == 0){ 53a: 85 ff test %edi,%edi c = fmt[i] & 0xff; 53c: 0f be c2 movsbl %dl,%eax if(state == 0){ 53f: 74 c7 je 508 <printf+0x28> } } else if(state == '%'){ 541: 83 ff 25 cmp $0x25,%edi 544: 75 e5 jne 52b <printf+0x4b> if(c == 'd'){ 546: 83 fa 64 cmp $0x64,%edx 549: 0f 84 31 01 00 00 je 680 <printf+0x1a0> printint(fd, *ap, 10, 1); ap++; } else if(c == 'x' || c == 'p'){ 54f: 25 f7 00 00 00 and $0xf7,%eax 554: 83 f8 70 cmp $0x70,%eax 557: 0f 84 83 00 00 00 je 5e0 <printf+0x100> printint(fd, *ap, 16, 0); ap++; } else if(c == 's'){ 55d: 83 fa 73 cmp $0x73,%edx 560: 0f 84 a2 00 00 00 je 608 <printf+0x128> s = "(null)"; while(*s != 0){ putc(fd, *s); s++; } } else if(c == 'c'){ 566: 83 fa 63 cmp $0x63,%edx 569: 0f 84 35 01 00 00 je 6a4 <printf+0x1c4> putc(fd, *ap); ap++; } else if(c == '%'){ 56f: 83 fa 25 cmp $0x25,%edx 572: 0f 84 e0 00 00 00 je 658 <printf+0x178> write(fd, &c, 1); 578: 8d 45 e6 lea -0x1a(%ebp),%eax 57b: 83 c3 01 add $0x1,%ebx 57e: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 585: 00 } else { // Unknown % sequence. Print it to draw attention. putc(fd, '%'); putc(fd, c); } state = 0; 586: 31 ff xor %edi,%edi write(fd, &c, 1); 588: 89 44 24 04 mov %eax,0x4(%esp) 58c: 89 34 24 mov %esi,(%esp) 58f: 89 55 d0 mov %edx,-0x30(%ebp) 592: c6 45 e6 25 movb $0x25,-0x1a(%ebp) 596: e8 07 fe ff ff call 3a2 <write> putc(fd, c); 59b: 8b 55 d0 mov -0x30(%ebp),%edx write(fd, &c, 1); 59e: 8d 45 e7 lea -0x19(%ebp),%eax 5a1: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 5a8: 00 5a9: 89 44 24 04 mov %eax,0x4(%esp) 5ad: 89 34 24 mov %esi,(%esp) putc(fd, c); 5b0: 88 55 e7 mov %dl,-0x19(%ebp) write(fd, &c, 1); 5b3: e8 ea fd ff ff call 3a2 <write> for(i = 0; fmt[i]; i++){ 5b8: 0f b6 53 ff movzbl -0x1(%ebx),%edx 5bc: 84 d2 test %dl,%dl 5be: 0f 85 76 ff ff ff jne 53a <printf+0x5a> 5c4: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi } } } 5c8: 83 c4 3c add $0x3c,%esp 5cb: 5b pop %ebx 5cc: 5e pop %esi 5cd: 5f pop %edi 5ce: 5d pop %ebp 5cf: c3 ret state = '%'; 5d0: bf 25 00 00 00 mov $0x25,%edi 5d5: e9 51 ff ff ff jmp 52b <printf+0x4b> 5da: 8d b6 00 00 00 00 lea 0x0(%esi),%esi printint(fd, *ap, 16, 0); 5e0: 8b 45 d4 mov -0x2c(%ebp),%eax 5e3: b9 10 00 00 00 mov $0x10,%ecx state = 0; 5e8: 31 ff xor %edi,%edi printint(fd, *ap, 16, 0); 5ea: c7 04 24 00 00 00 00 movl $0x0,(%esp) 5f1: 8b 10 mov (%eax),%edx 5f3: 89 f0 mov %esi,%eax 5f5: e8 46 fe ff ff call 440 <printint> ap++; 5fa: 83 45 d4 04 addl $0x4,-0x2c(%ebp) 5fe: e9 28 ff ff ff jmp 52b <printf+0x4b> 603: 90 nop 604: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi s = (char*)*ap; 608: 8b 45 d4 mov -0x2c(%ebp),%eax ap++; 60b: 83 45 d4 04 addl $0x4,-0x2c(%ebp) s = (char*)*ap; 60f: 8b 38 mov (%eax),%edi s = "(null)"; 611: b8 37 0a 00 00 mov $0xa37,%eax 616: 85 ff test %edi,%edi 618: 0f 44 f8 cmove %eax,%edi while(*s != 0){ 61b: 0f b6 07 movzbl (%edi),%eax 61e: 84 c0 test %al,%al 620: 74 2a je 64c <printf+0x16c> 622: 8d b6 00 00 00 00 lea 0x0(%esi),%esi 628: 88 45 e3 mov %al,-0x1d(%ebp) write(fd, &c, 1); 62b: 8d 45 e3 lea -0x1d(%ebp),%eax s++; 62e: 83 c7 01 add $0x1,%edi write(fd, &c, 1); 631: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 638: 00 639: 89 44 24 04 mov %eax,0x4(%esp) 63d: 89 34 24 mov %esi,(%esp) 640: e8 5d fd ff ff call 3a2 <write> while(*s != 0){ 645: 0f b6 07 movzbl (%edi),%eax 648: 84 c0 test %al,%al 64a: 75 dc jne 628 <printf+0x148> state = 0; 64c: 31 ff xor %edi,%edi 64e: e9 d8 fe ff ff jmp 52b <printf+0x4b> 653: 90 nop 654: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi write(fd, &c, 1); 658: 8d 45 e5 lea -0x1b(%ebp),%eax state = 0; 65b: 31 ff xor %edi,%edi write(fd, &c, 1); 65d: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 664: 00 665: 89 44 24 04 mov %eax,0x4(%esp) 669: 89 34 24 mov %esi,(%esp) 66c: c6 45 e5 25 movb $0x25,-0x1b(%ebp) 670: e8 2d fd ff ff call 3a2 <write> 675: e9 b1 fe ff ff jmp 52b <printf+0x4b> 67a: 8d b6 00 00 00 00 lea 0x0(%esi),%esi printint(fd, *ap, 10, 1); 680: 8b 45 d4 mov -0x2c(%ebp),%eax 683: b9 0a 00 00 00 mov $0xa,%ecx state = 0; 688: 66 31 ff xor %di,%di printint(fd, *ap, 10, 1); 68b: c7 04 24 01 00 00 00 movl $0x1,(%esp) 692: 8b 10 mov (%eax),%edx 694: 89 f0 mov %esi,%eax 696: e8 a5 fd ff ff call 440 <printint> ap++; 69b: 83 45 d4 04 addl $0x4,-0x2c(%ebp) 69f: e9 87 fe ff ff jmp 52b <printf+0x4b> putc(fd, *ap); 6a4: 8b 45 d4 mov -0x2c(%ebp),%eax state = 0; 6a7: 31 ff xor %edi,%edi putc(fd, *ap); 6a9: 8b 00 mov (%eax),%eax write(fd, &c, 1); 6ab: c7 44 24 08 01 00 00 movl $0x1,0x8(%esp) 6b2: 00 6b3: 89 34 24 mov %esi,(%esp) putc(fd, *ap); 6b6: 88 45 e4 mov %al,-0x1c(%ebp) write(fd, &c, 1); 6b9: 8d 45 e4 lea -0x1c(%ebp),%eax 6bc: 89 44 24 04 mov %eax,0x4(%esp) 6c0: e8 dd fc ff ff call 3a2 <write> ap++; 6c5: 83 45 d4 04 addl $0x4,-0x2c(%ebp) 6c9: e9 5d fe ff ff jmp 52b <printf+0x4b> 6ce: 66 90 xchg %ax,%ax 000006d0 <free>: static Header base; static Header *freep; void free(void *ap) { 6d0: 55 push %ebp Header *bp, *p; bp = (Header*)ap - 1; for(p = freep; !(bp > p && bp < p->s.ptr); p = p->s.ptr) 6d1: a1 d0 0c 00 00 mov 0xcd0,%eax { 6d6: 89 e5 mov %esp,%ebp 6d8: 57 push %edi 6d9: 56 push %esi 6da: 53 push %ebx 6db: 8b 5d 08 mov 0x8(%ebp),%ebx if(p >= p->s.ptr && (bp > p || bp < p->s.ptr)) 6de: 8b 08 mov (%eax),%ecx bp = (Header*)ap - 1; 6e0: 8d 53 f8 lea -0x8(%ebx),%edx for(p = freep; !(bp > p && bp < p->s.ptr); p = p->s.ptr) 6e3: 39 d0 cmp %edx,%eax 6e5: 72 11 jb 6f8 <free+0x28> 6e7: 90 nop if(p >= p->s.ptr && (bp > p || bp < p->s.ptr)) 6e8: 39 c8 cmp %ecx,%eax 6ea: 72 04 jb 6f0 <free+0x20> 6ec: 39 ca cmp %ecx,%edx 6ee: 72 10 jb 700 <free+0x30> 6f0: 89 c8 mov %ecx,%eax for(p = freep; !(bp > p && bp < p->s.ptr); p = p->s.ptr) 6f2: 39 d0 cmp %edx,%eax if(p >= p->s.ptr && (bp > p || bp < p->s.ptr)) 6f4: 8b 08 mov (%eax),%ecx for(p = freep; !(bp > p && bp < p->s.ptr); p = p->s.ptr) 6f6: 73 f0 jae 6e8 <free+0x18> 6f8: 39 ca cmp %ecx,%edx 6fa: 72 04 jb 700 <free+0x30> if(p >= p->s.ptr && (bp > p || bp < p->s.ptr)) 6fc: 39 c8 cmp %ecx,%eax 6fe: 72 f0 jb 6f0 <free+0x20> break; if(bp + bp->s.size == p->s.ptr){ 700: 8b 73 fc mov -0x4(%ebx),%esi 703: 8d 3c f2 lea (%edx,%esi,8),%edi 706: 39 cf cmp %ecx,%edi 708: 74 1e je 728 <free+0x58> bp->s.size += p->s.ptr->s.size; bp->s.ptr = p->s.ptr->s.ptr; } else bp->s.ptr = p->s.ptr; 70a: 89 4b f8 mov %ecx,-0x8(%ebx) if(p + p->s.size == bp){ 70d: 8b 48 04 mov 0x4(%eax),%ecx 710: 8d 34 c8 lea (%eax,%ecx,8),%esi 713: 39 f2 cmp %esi,%edx 715: 74 28 je 73f <free+0x6f> p->s.size += bp->s.size; p->s.ptr = bp->s.ptr; } else p->s.ptr = bp; 717: 89 10 mov %edx,(%eax) freep = p; 719: a3 d0 0c 00 00 mov %eax,0xcd0 } 71e: 5b pop %ebx 71f: 5e pop %esi 720: 5f pop %edi 721: 5d pop %ebp 722: c3 ret 723: 90 nop 724: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi bp->s.size += p->s.ptr->s.size; 728: 03 71 04 add 0x4(%ecx),%esi 72b: 89 73 fc mov %esi,-0x4(%ebx) bp->s.ptr = p->s.ptr->s.ptr; 72e: 8b 08 mov (%eax),%ecx 730: 8b 09 mov (%ecx),%ecx 732: 89 4b f8 mov %ecx,-0x8(%ebx) if(p + p->s.size == bp){ 735: 8b 48 04 mov 0x4(%eax),%ecx 738: 8d 34 c8 lea (%eax,%ecx,8),%esi 73b: 39 f2 cmp %esi,%edx 73d: 75 d8 jne 717 <free+0x47> p->s.size += bp->s.size; 73f: 03 4b fc add -0x4(%ebx),%ecx freep = p; 742: a3 d0 0c 00 00 mov %eax,0xcd0 p->s.size += bp->s.size; 747: 89 48 04 mov %ecx,0x4(%eax) p->s.ptr = bp->s.ptr; 74a: 8b 53 f8 mov -0x8(%ebx),%edx 74d: 89 10 mov %edx,(%eax) } 74f: 5b pop %ebx 750: 5e pop %esi 751: 5f pop %edi 752: 5d pop %ebp 753: c3 ret 754: 8d b6 00 00 00 00 lea 0x0(%esi),%esi 75a: 8d bf 00 00 00 00 lea 0x0(%edi),%edi 00000760 <malloc>: return freep; } void* malloc(uint nbytes) { 760: 55 push %ebp 761: 89 e5 mov %esp,%ebp 763: 57 push %edi 764: 56 push %esi 765: 53 push %ebx 766: 83 ec 1c sub $0x1c,%esp Header *p, *prevp; uint nunits; nunits = (nbytes + sizeof(Header) - 1)/sizeof(Header) + 1; 769: 8b 45 08 mov 0x8(%ebp),%eax if((prevp = freep) == 0){ 76c: 8b 1d d0 0c 00 00 mov 0xcd0,%ebx nunits = (nbytes + sizeof(Header) - 1)/sizeof(Header) + 1; 772: 8d 48 07 lea 0x7(%eax),%ecx 775: c1 e9 03 shr $0x3,%ecx if((prevp = freep) == 0){ 778: 85 db test %ebx,%ebx nunits = (nbytes + sizeof(Header) - 1)/sizeof(Header) + 1; 77a: 8d 71 01 lea 0x1(%ecx),%esi if((prevp = freep) == 0){ 77d: 0f 84 9b 00 00 00 je 81e <malloc+0xbe> 783: 8b 13 mov (%ebx),%edx 785: 8b 7a 04 mov 0x4(%edx),%edi base.s.ptr = freep = prevp = &base; base.s.size = 0; } for(p = prevp->s.ptr; ; prevp = p, p = p->s.ptr){ if(p->s.size >= nunits){ 788: 39 fe cmp %edi,%esi 78a: 76 64 jbe 7f0 <malloc+0x90> 78c: 8d 04 f5 00 00 00 00 lea 0x0(,%esi,8),%eax if(nu < 4096) 793: bb 00 80 00 00 mov $0x8000,%ebx 798: 89 45 e4 mov %eax,-0x1c(%ebp) 79b: eb 0e jmp 7ab <malloc+0x4b> 79d: 8d 76 00 lea 0x0(%esi),%esi for(p = prevp->s.ptr; ; prevp = p, p = p->s.ptr){ 7a0: 8b 02 mov (%edx),%eax if(p->s.size >= nunits){ 7a2: 8b 78 04 mov 0x4(%eax),%edi 7a5: 39 fe cmp %edi,%esi 7a7: 76 4f jbe 7f8 <malloc+0x98> 7a9: 89 c2 mov %eax,%edx p->s.size = nunits; } freep = prevp; return (void*)(p + 1); } if(p == freep) 7ab: 3b 15 d0 0c 00 00 cmp 0xcd0,%edx 7b1: 75 ed jne 7a0 <malloc+0x40> if(nu < 4096) 7b3: 8b 45 e4 mov -0x1c(%ebp),%eax 7b6: 81 fe 00 10 00 00 cmp $0x1000,%esi 7bc: bf 00 10 00 00 mov $0x1000,%edi 7c1: 0f 43 fe cmovae %esi,%edi 7c4: 0f 42 c3 cmovb %ebx,%eax p = sbrk(nu * sizeof(Header)); 7c7: 89 04 24 mov %eax,(%esp) 7ca: e8 3b fc ff ff call 40a <sbrk> if(p == (char*)-1) 7cf: 83 f8 ff cmp $0xffffffff,%eax 7d2: 74 18 je 7ec <malloc+0x8c> hp->s.size = nu; 7d4: 89 78 04 mov %edi,0x4(%eax) free((void*)(hp + 1)); 7d7: 83 c0 08 add $0x8,%eax 7da: 89 04 24 mov %eax,(%esp) 7dd: e8 ee fe ff ff call 6d0 <free> return freep; 7e2: 8b 15 d0 0c 00 00 mov 0xcd0,%edx if((p = morecore(nunits)) == 0) 7e8: 85 d2 test %edx,%edx 7ea: 75 b4 jne 7a0 <malloc+0x40> return 0; 7ec: 31 c0 xor %eax,%eax 7ee: eb 20 jmp 810 <malloc+0xb0> if(p->s.size >= nunits){ 7f0: 89 d0 mov %edx,%eax 7f2: 89 da mov %ebx,%edx 7f4: 8d 74 26 00 lea 0x0(%esi,%eiz,1),%esi if(p->s.size == nunits) 7f8: 39 fe cmp %edi,%esi 7fa: 74 1c je 818 <malloc+0xb8> p->s.size -= nunits; 7fc: 29 f7 sub %esi,%edi 7fe: 89 78 04 mov %edi,0x4(%eax) p += p->s.size; 801: 8d 04 f8 lea (%eax,%edi,8),%eax p->s.size = nunits; 804: 89 70 04 mov %esi,0x4(%eax) freep = prevp; 807: 89 15 d0 0c 00 00 mov %edx,0xcd0 return (void*)(p + 1); 80d: 83 c0 08 add $0x8,%eax } } 810: 83 c4 1c add $0x1c,%esp 813: 5b pop %ebx 814: 5e pop %esi 815: 5f pop %edi 816: 5d pop %ebp 817: c3 ret prevp->s.ptr = p->s.ptr; 818: 8b 08 mov (%eax),%ecx 81a: 89 0a mov %ecx,(%edx) 81c: eb e9 jmp 807 <malloc+0xa7> base.s.ptr = freep = prevp = &base; 81e: c7 05 d0 0c 00 00 d4 movl $0xcd4,0xcd0 825: 0c 00 00 base.s.size = 0; 828: ba d4 0c 00 00 mov $0xcd4,%edx base.s.ptr = freep = prevp = &base; 82d: c7 05 d4 0c 00 00 d4 movl $0xcd4,0xcd4 834: 0c 00 00 base.s.size = 0; 837: c7 05 d8 0c 00 00 00 movl $0x0,0xcd8 83e: 00 00 00 841: e9 46 ff ff ff jmp 78c <malloc+0x2c>
// Boost.Geometry (aka GGL, Generic Geometry Library) // Unit Test // Copyright (c) 2010-2012 Barend Gehrels, Amsterdam, the Netherlands. // Use, modification and distribution is subject to the Boost Software License, // Version 1.0. (See accompanying file LICENSE_1_0.txt or copy at // http://www.boost.org/LICENSE_1_0.txt) #include <iostream> #include <string> #include <algorithms/test_union.hpp> #include <algorithms/test_overlay.hpp> #include <multi/algorithms/overlay/multi_overlay_cases.hpp> #include <boost/geometry/multi/algorithms/correct.hpp> #include <boost/geometry/multi/algorithms/intersection.hpp> #include <boost/geometry/multi/algorithms/within.hpp> #include <boost/geometry/geometries/point_xy.hpp> #include <boost/geometry/multi/geometries/multi_linestring.hpp> #include <boost/geometry/multi/geometries/multi_polygon.hpp> #include <boost/geometry/multi/io/wkt/read.hpp> template <typename Ring, typename Polygon, typename MultiPolygon> void test_areal() { test_one<Polygon, MultiPolygon, MultiPolygon>("simplex_multi", case_multi_simplex[0], case_multi_simplex[1], 1, 0, 20, 14.58); test_one<Polygon, Polygon, MultiPolygon>("simplex_multi_p_mp", case_single_simplex, case_multi_simplex[0], 1, 0, 20, 14.58); test_one<Polygon, MultiPolygon, Polygon>("simplex_multi_mp_p", case_multi_simplex[0], case_single_simplex, 1, 0, 20, 14.58); test_one<Polygon, Ring, MultiPolygon>("simplex_multi_r_mp", case_single_simplex, case_multi_simplex[0], 1, 0, 20, 14.58); test_one<Ring, MultiPolygon, Polygon>("simplex_multi_mp_r", case_multi_simplex[0], case_single_simplex, 1, 0, 20, 14.58); // Normal test cases test_one<Polygon, MultiPolygon, MultiPolygon>("case_multi_no_ip", case_multi_no_ip[0], case_multi_no_ip[1], 4, 0, 16, 66.5); test_one<Polygon, MultiPolygon, MultiPolygon>("case_multi_2", case_multi_2[0], case_multi_2[1], 3, 0, 16, 59.1); // Constructed cases for multi/touch/equal/etc test_one<Polygon, MultiPolygon, MultiPolygon>("case_61_multi", case_61_multi[0], case_61_multi[1], 1, 0, 11, 4.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_62_multi", case_62_multi[0], case_62_multi[1], 2, 0, 10, 2.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_63_multi", case_63_multi[0], case_63_multi[1], 2, 0, 10, 2.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_64_multi", case_64_multi[0], case_64_multi[1], 1, 0, 9, 3.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_65_multi", case_65_multi[0], case_65_multi[1], 3, 0, 15, 4.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_66_multi", case_66_multi[0], case_66_multi[1], 3, 0, 23, 7.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_75_multi", case_75_multi[0], case_75_multi[1], 5, 0, 25, 5.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_76_multi", case_76_multi[0], case_76_multi[1], 5, 0, 31, 8.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_89_multi", case_89_multi[0], case_89_multi[1], 1, 0, 13, 6); test_one<Polygon, MultiPolygon, MultiPolygon>("case_101_multi", case_101_multi[0], case_101_multi[1], 1, 0, 32, 22.25); test_one<Polygon, MultiPolygon, MultiPolygon>("case_103_multi", case_103_multi[0], case_103_multi[1], 1, 0, 7, 25); test_one<Polygon, MultiPolygon, MultiPolygon>("case_104_multi", case_104_multi[0], case_104_multi[1], 1, 0, 8, 25); test_one<Polygon, MultiPolygon, MultiPolygon>("case_105_multi", case_105_multi[0], case_105_multi[1], 1, 0, 5, 25); test_one<Polygon, MultiPolygon, MultiPolygon>("case_recursive_boxes_1", case_recursive_boxes_1[0], case_recursive_boxes_1[1], 1, 1, 36, 97.0); test_one<Polygon, MultiPolygon, MultiPolygon>("case_recursive_boxes_2", case_recursive_boxes_2[0], case_recursive_boxes_2[1], 1, 0, 14, 100.0); // Area from SQL Server test_one<Polygon, MultiPolygon, MultiPolygon>("case_recursive_boxes_3", case_recursive_boxes_3[0], case_recursive_boxes_3[1], 17, 0, 159, 56.5); // Area from SQL Server } template <typename P> void test_all() { { typedef bg::model::ring<P> ring; typedef bg::model::polygon<P> polygon; typedef bg::model::multi_polygon<polygon> multi_polygon; test_areal<ring, polygon, multi_polygon>(); } { typedef bg::model::ring<P, false> ring_ccw; typedef bg::model::polygon<P, false> polygon_ccw; typedef bg::model::multi_polygon<polygon_ccw> multi_polygon_ccw; test_areal<ring_ccw, polygon_ccw, multi_polygon_ccw>(); } } int test_main(int, char* []) { test_all<bg::model::d2::point_xy<double> >(); #ifdef HAVE_TTMATH std::cout << "Testing TTMATH" << std::endl; test_all<bg::model::d2::point_xy<ttmath_big> >(); #endif return 0; }
// -*- mode: c++; indent-tabs-mode: nil; -*- // // Paragraph // Copyright (c) 2016-2019 Illumina, Inc. // All rights reserved. // // Licensed under the Apache License, Version 2.0 (the "License"); // You may not use this file except in compliance with the License. // You may obtain a copy of the License at // // http://www.apache.org/licenses/LICENSE-2.0 // // Unless required by applicable law or agreed to in writing, software // distributed under the License is distributed on an "AS IS" BASIS, // WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied // See the License for the specific language governing permissions and limitations // // /** * \brief Abstract base class to fit univariate Gaussian distributions * * \file AbstractGaussian.hh * \author Mitch Bekritsky * \email mbekritsky@illumina.com * */ #pragma once #include <cmath> #include <limits> #include <memory> #include <vector> namespace statistics { class AbstractGaussian { public: AbstractGaussian() { mean_ = std::numeric_limits<double>::quiet_NaN(); variance_ = std::numeric_limits<double>::quiet_NaN(); } AbstractGaussian(AbstractGaussian const&) noexcept = default; AbstractGaussian(AbstractGaussian&&) noexcept = default; AbstractGaussian& operator=(AbstractGaussian const&) noexcept = default; AbstractGaussian& operator=(AbstractGaussian&&) noexcept = default; virtual ~AbstractGaussian() = default; /** * Fit the observed data to a Gaussian (method specified in * derived class) */ virtual void fit(const std::vector<double>&) = 0; /** * Get the mean of the fitted distribution * @return double */ double mean() const { return mean_; }; /** * Get the variance of the fitted distribution * @return double */ double variance() const { return variance_; } /** * Get the standard deviation of the fitted distribution * @return double */ double standard_deviation() const { return sqrt(variance_); }; protected: void mean(double mean) { mean_ = mean; } void variance(double variance) { variance_ = variance; } private: double mean_, variance_; }; }
.model small .stack 120h .data Ecolor byte 04d ;red .code main proc mov AX, @data mov DS, AX mov AX, 0 mov ah, 0 mov al, 13H int 10h mov CX, 160d mov DX, 100d push CX mov ah, 0ch ;row 1 Exit: mov ah, 04ch int 21h main endp end
; unsigned char esx_f_mkdir(unsigned char *pathname) SECTION code_esxdos PUBLIC esx_f_mkdir EXTERN asm_esx_f_mkdir defc esx_f_mkdir = asm_esx_f_mkdir ; SDCC bridge for Classic IF __CLASSIC PUBLIC _esx_f_mkdir defc _esx_f_mkdir = esx_f_mkdir ENDIF
; ============================================================================= ; BareMetal -- a 64-bit OS written in Assembly for x86-64 systems ; Copyright (C) 2008-2015 Return Infinity -- see LICENSE.TXT ; ; Interrupts ; ============================================================================= ; ----------------------------------------------------------------------------- ; Default exception handler align 16 exception_gate: mov rsi, int_string00 call os_output mov rsi, exc_string call os_output jmp $ ; Hang ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Default interrupt handler align 16 interrupt_gate: ; handler for all other interrupts iretq ; It was an undefined interrupt so return to caller ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Keyboard interrupt. IRQ 0x01, INT 0x21 ; This IRQ runs whenever there is input on the keyboard align 16 keyboard: push rdi push rbx push rax pushfq xor eax, eax in al, 0x60 ; Get the scan code from the keyboard cmp al, 0x01 je keyboard_escape cmp al, 0x2A ; Left Shift Make je keyboard_shift cmp al, 0x36 ; Right Shift Make je keyboard_shift cmp al, 0xAA ; Left Shift Break je keyboard_noshift cmp al, 0xB6 ; Right Shift Break je keyboard_noshift test al, 0x80 jz keydown jmp keyup keydown: cmp byte [key_shift], 0x00 je keyboard_lowercase keyboard_uppercase: mov rbx, keylayoutupper jmp keyboard_processkey keyboard_lowercase: mov rbx, keylayoutlower keyboard_processkey: ; Convert the scan code add rbx, rax mov bl, [rbx] mov [key], bl jmp keyboard_done keyboard_escape: jmp reboot keyup: jmp keyboard_done keyboard_shift: mov byte [key_shift], 0x01 jmp keyboard_done keyboard_noshift: mov byte [key_shift], 0x00 jmp keyboard_done keyboard_done: mov al, 0x20 ; Acknowledge the IRQ out 0x20, al call os_smp_wakeup_all ; A terrible hack popfq pop rax pop rbx pop rdi iretq ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Cascade interrupt. IRQ 0x02, INT 0x22 align 16 cascade: push rax mov al, 0x20 ; Acknowledge the IRQ out 0x20, al pop rax iretq ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Real-time clock interrupt. IRQ 0x08, INT 0x28 ; Currently this IRQ runs 8 times per second (As defined in init_64.asm) ; The supervisor lives here align 16 rtc: push rax pushfq add qword [os_ClockCounter], 1 ; 64-bit counter started at boot-up cmp qword [os_ClockCallback], 0 ; Is it valid? je rtc_end ; If not then bail out. ; We could do a 'call [os_ClockCallback]' here but that would not be ideal. ; A defective callback would hang the system if it never returned back to the ; interrupt handler. Instead, we modify the stack so that the callback is ; executed after the interrupt handler has finished. Once the callback has ; finished, the execution flow will pick up back in the program. push rdi push rsi push rcx mov rcx, clock_callback ; RCX stores the callback function address mov rsi, rsp ; Copy the current stack pointer to RSI sub rsp, 8 ; Subtract 8 since we add a 64-bit value to the stack mov rdi, rsp ; Copy the 'new' stack pointer to RDI movsq ; RCX movsq ; RSI movsq ; RDI movsq ; Flags movsq ; RAX lodsq ; RIP xchg rax, rcx stosq ; Callback address movsq ; CS movsq ; Flags lodsq ; RSP sub rax, 8 stosq movsq ; SS mov [rax], rcx ; Original RIP pop rcx pop rsi pop rdi rtc_end: mov al, 0x0C ; Select RTC register C out 0x70, al ; Port 0x70 is the RTC index, and 0x71 is the RTC data in al, 0x71 ; Read the value in register C mov al, 0x20 ; Acknowledge the IRQ out 0xA0, al out 0x20, al popfq pop rax iretq ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Network interrupt. align 16 network: push rdi push rsi push rcx push rax pushfq cld ; Clear direction flag call os_net_ack_int ; Call the driver function to acknowledge the interrupt internally bt ax, 0 ; TX bit set (caused the IRQ?) jc network_tx ; If so then jump past RX section bt ax, 7 ; RX bit set jnc network_end network_rx_as_well: mov byte [os_NetActivity_RX], 1 mov rdi, os_EthernetBuffer ; Raw packet is copied here push rdi add rdi, 2 call os_net_rx_from_interrupt pop rdi mov rax, rcx stosw ; Store the size of the packet cmp qword [os_NetworkCallback], 0 ; Is it valid? je network_end ; If not then bail out. ; We could do a 'call [os_NetworkCallback]' here but that would not be ideal. ; A defective callback would hang the system if it never returned back to the ; interrupt handler. Instead, we modify the stack so that the callback is ; executed after the interrupt handler has finished. Once the callback has ; finished, the execution flow will pick up back in the program. mov rcx, network_callback ; RCX stores the callback function address mov rsi, rsp ; Copy the current stack pointer to RSI sub rsp, 8 ; Subtract 8 since we add a 64-bit value to the stack mov rdi, rsp ; Copy the 'new' stack pointer to RDI movsq ; Flags movsq ; RAX movsq ; RCX movsq ; RSI movsq ; RDI lodsq ; RIP xchg rax, rcx stosq ; Callback address movsq ; CS movsq ; Flags lodsq ; RSP sub rax, 8 stosq movsq ; SS mov [rax], rcx ; Original RIP jmp network_end network_tx: mov byte [os_NetActivity_TX], 1 bt ax, 7 jc network_rx_as_well network_end: mov al, 0x20 ; Acknowledge the IRQ on the PIC(s) cmp byte [os_NetIRQ], 8 jl network_ack_only_low ; If the network IRQ is less than 8 then the other PIC does not need to be ack'ed out 0xA0, al network_ack_only_low: out 0x20, al popfq pop rax pop rcx pop rsi pop rdi iretq ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Network interrupt. align 16 network_callback: pushfq call [os_NetworkCallback] popfq ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Network interrupt. align 16 clock_callback: pushfq call [os_ClockCallback] popfq ret ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; A simple interrupt that just acknowledges an IPI. Useful for getting an AP past a 'hlt' in the code. align 16 ap_wakeup: push rdi push rax mov rdi, [os_LocalAPICAddress] ; Acknowledge the IPI add rdi, 0xB0 xor eax, eax stosd pop rax pop rdi iretq ; Return from the IPI. ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; Resets a CPU to execute ap_clear align 16 ap_reset: mov rax, ap_clear ; Set RAX to the address of ap_clear mov [rsp], rax ; Overwrite the return address on the CPU's stack mov rdi, [os_LocalAPICAddress] ; Acknowledge the IPI add rdi, 0xB0 xor eax, eax stosd iretq ; Return from the IPI. CPU will execute code at ap_clear ; ----------------------------------------------------------------------------- ; ----------------------------------------------------------------------------- ; CPU Exception Gates align 16 exception_gate_00: push rax mov al, 0x00 jmp exception_gate_main align 16 exception_gate_01: push rax mov al, 0x01 jmp exception_gate_main align 16 exception_gate_02: push rax mov al, 0x02 jmp exception_gate_main align 16 exception_gate_03: push rax mov al, 0x03 jmp exception_gate_main align 16 exception_gate_04: push rax mov al, 0x04 jmp exception_gate_main align 16 exception_gate_05: push rax mov al, 0x05 jmp exception_gate_main align 16 exception_gate_06: push rax mov al, 0x06 jmp exception_gate_main align 16 exception_gate_07: push rax mov al, 0x07 jmp exception_gate_main align 16 exception_gate_08: push rax mov al, 0x08 jmp exception_gate_main align 16 exception_gate_09: push rax mov al, 0x09 jmp exception_gate_main align 16 exception_gate_10: push rax mov al, 0x0A jmp exception_gate_main align 16 exception_gate_11: push rax mov al, 0x0B jmp exception_gate_main align 16 exception_gate_12: push rax mov al, 0x0C jmp exception_gate_main align 16 exception_gate_13: push rax mov al, 0x0D jmp exception_gate_main align 16 exception_gate_14: push rax mov al, 0x0E jmp exception_gate_main align 16 exception_gate_15: push rax mov al, 0x0F jmp exception_gate_main align 16 exception_gate_16: push rax mov al, 0x10 jmp exception_gate_main align 16 exception_gate_17: push rax mov al, 0x11 jmp exception_gate_main align 16 exception_gate_18: push rax mov al, 0x12 jmp exception_gate_main align 16 exception_gate_19: push rax mov al, 0x13 jmp exception_gate_main align 16 exception_gate_main: mov qword [os_NetworkCallback], 0 ; Reset the network callback push rbx push rdi push rsi push rax ; Save RAX since os_smp_get_id clobbers it call os_print_newline mov rsi, int_string00 call os_output call os_smp_get_id ; Get the local CPU ID and print it call os_debug_dump_ax mov rsi, int_string01 call os_output mov rsi, exc_string00 pop rax and rax, 0x00000000000000FF ; Clear out everything in RAX except for AL push rax mov bl, 8 ; Length of each message mul bl ; AX = AL x BL add rsi, rax ; Use the value in RAX as an offset to get to the right message pop rax mov bl, 0x0F call os_output call os_print_newline pop rsi pop rdi pop rbx pop rax call os_print_newline call os_debug_dump_reg mov rsi, rip_string call os_output push rax mov rax, [rsp+0x08] ; RIP of caller call os_debug_dump_rax pop rax call os_print_newline push rax push rcx push rsi mov rsi, stack_string call os_output mov rsi, rsp add rsi, 0x18 mov rcx, 4 next_stack: lodsq call os_debug_dump_rax mov al, ' ' call os_output_char loop next_stack call os_print_newline pop rsi pop rcx pop rax ; jmp $ ; For debugging call init_memory_map jmp ap_clear ; jump to AP clear code int_string00 db 'BareMetal OS - CPU 0x', 0 int_string01 db ' - Interrupt ', 0 ; Strings for the error messages exc_string db 'Unknown Fatal Exception!', 0 exc_string00 db '00 (DE)', 0 exc_string01 db '01 (DB)', 0 exc_string02 db '02 ', 0 exc_string03 db '03 (BP)', 0 exc_string04 db '04 (OF)', 0 exc_string05 db '05 (BR)', 0 exc_string06 db '06 (UD)', 0 exc_string07 db '07 (NM)', 0 exc_string08 db '08 (DF)', 0 exc_string09 db '09 ', 0 ; No longer generated on new CPU's exc_string10 db '10 (TS)', 0 exc_string11 db '11 (NP)', 0 exc_string12 db '12 (SS)', 0 exc_string13 db '13 (GP)', 0 exc_string14 db '14 (PF)', 0 exc_string15 db '15 ', 0 exc_string16 db '16 (MF)', 0 exc_string17 db '17 (AC)', 0 exc_string18 db '18 (MC)', 0 exc_string19 db '19 (XM)', 0 rip_string db ' IP:', 0 stack_string db ' ST:', 0 ; ============================================================================= ; EOF
// Copyright 2019 The Chromium Authors. All rights reserved. // Use of this source code is governed by a BSD-style license that can be // found in the LICENSE file. #include "ios/chrome/browser/ui/dialogs/java_script_dialog_metrics.h" #include "base/metrics/histogram_macros.h" // Records a histogram for a dialog dismissal for |cause|. void RecordDialogDismissalCause(IOSJavaScriptDialogDismissalCause cause) { UMA_HISTOGRAM_ENUMERATION("IOS.Dialogs.JavaScriptDialogClosed", cause); }
; A343840: a(n) = Sum_{k=0..n}(-1)^(n-k)*binomial(n, k)*|A021009(n, k)|. ; Submitted by Christian Krause ; 1,0,-5,22,9,-1244,14335,-79470,-586943,25131304,-434574909,4418399470,8524321465,-1771817986548,53502570125719,-1052208254769014,11804172888840705,131741085049224400,-12970386000411511733,482732550618027365574,-12599999790172579025879 mov $1,1 mov $3,$0 mov $4,1 lpb $3 mul $1,$3 mul $1,-1 mul $1,$3 add $5,$4 div $1,$5 mul $1,$3 add $2,$1 sub $3,1 add $4,2 lpe mov $0,$2 add $0,1
; MURDER-SUICIDE ;Example of killing a process with the kill API. API calls found in this example program: ; kill ; Go back in time and identify parent (using ppid API) ; Murder parent, effectively killing current-time self: ; Murder Suicide section .text global _start _start: ; Get Parent Process ID ;------------------------------------------------------------------------------ mov eax, 64 ; get the Parent Process ID of self getppid() int 0x80 mov [ppid], eax ; make note of Parent process ID ; Kill Parent ;------------------------------------------------------------------------------ mov eax, 37 ; kill mov ebx, [ppid] ; Parent's process ID (Could be bash, could be gdb) mov ecx, 9 ; kill -9 int 0x80 section .bss ppid resb 4 ; Some misc notes on return value from kill API call ;------------------------------------------------------------------------------ ; You can set the sig field (in ecx) to 0, which doesn't do any killing at all ; but it does offer some good recon about the process with the following ; return codes: ; If response is -3 (ESRCH), the process doesn't exist ; This is a hacky way of seeing if a process ID exists or notes ; If response is -1 (EPERM), you don't have permissions to kill the process ; But it does confirm that the process exists ; If response is 0 (no error), not only does the process exist, but you can kill it
;****************************************************************************** ; ; host.asm ; IKForth ; ; Unlicense since 1999 by Illya Kysil ; ;****************************************************************************** ; Contains words, provided by hosting application. ;****************************************************************************** MACRO $CSYSCALL NAME { MOV EAX,DWORD [FUNC_TABLE_VAR + IMAGE_BASE] MOV EAX,DWORD [EAX + FUNC_#NAME * CELL_SIZE] CALL EAX } MACRO $FSYSCALL NAME { PUSHRS EDI $CSYSCALL NAME POPRS EDI } MACRO CGET_LAST_ERROR { $FSYSCALL GET_LAST_ERROR PUSHDS EAX } MACRO $STDCALL_SAVE { PUSHDS EBP MOV EBP,ESP PUSHDS EDI PUSHDS ESI PUSHDS EBX } MACRO $STDCALL_RESTORE { POPDS EBX POPDS ESI POPDS EDI POPDS EBP } ;****************************************************************************** ; FACILITY words ;****************************************************************************** ; (BYE) $CODE '(BYE)',$PBYE $FSYSCALL BYE $NEXT ;****************************************************************************** ; DLL support ;****************************************************************************** ; GetLastError $CODE 'GetLastError' CGET_LAST_ERROR $NEXT ; (LoadLibrary) $CODE '(LoadLibrary)' $FSYSCALL LOAD_LIBRARY PUSHDS EAX $NEXT ; FreeLibrary $CODE 'FreeLibrary' $FSYSCALL FREE_LIBRARY $NEXT ; (GetProcAddress) $CODE '(GetProcAddress)' $FSYSCALL GET_PROC_ADDRESS PUSHDS EAX $NEXT ;****************************************************************************** ; FILE access words ;****************************************************************************** $CODE 'CLOSE-FILE',$CLOSE_FILE $FSYSCALL FILE_CLOSE CGET_LAST_ERROR $NEXT $CODE 'CREATE-FILE',$CREATE_FILE $FSYSCALL FILE_CREATE PUSHDS EAX CGET_LAST_ERROR $NEXT $CODE 'FILE-POSITION',$FILE_POSITION $FSYSCALL FILE_POSITION PUSHDS EAX PUSHDS EDX CGET_LAST_ERROR $NEXT $CODE 'OPEN-FILE',$OPEN_FILE $FSYSCALL FILE_OPEN PUSHDS EAX CGET_LAST_ERROR $NEXT $CODE 'REPOSITION-FILE',$REPOSITION_FILE $FSYSCALL FILE_REPOSITION CGET_LAST_ERROR $NEXT $CODE <>,$_READ_LINE $FSYSCALL FILE_READ_LINE PUSHDS EAX PUSHDS EDX CGET_LAST_ERROR $NEXT ; 6.1.1320 EMIT ; Emit a char to output ; D: char -- $CODE 'EMIT',$EMIT $FSYSCALL EMIT $NEXT ; 6.1.2310 TYPE ; Display the character string specified by addr and length n ; D: addr n -- $CODE 'TYPE',$TYPE $FSYSCALL TYPE $NEXT ;****************************************************************************** ; Threads ;****************************************************************************** ; THREAD $CODE 'THREAD',$THREAD PUSHDS EDI $FSYSCALL START_THREAD PUSHDS EAX $NEXT ;****************************************************************************** ; Memory ;****************************************************************************** $CODE 'ALLOCATE' $FSYSCALL ALLOCATE PUSHDS EAX CGET_LAST_ERROR $NEXT $CODE 'FREE' $FSYSCALL FREE CGET_LAST_ERROR $NEXT $CODE 'RESIZE' $FSYSCALL REALLOCATE PUSHDS EAX CGET_LAST_ERROR $NEXT
.INCLUDE "joypad.inc" ;;;=========================================================================;;; .ZEROPAGE ;;; ButtonsHeld: A bitfield indicating which player 1 buttons are currently ;;; being held. .EXPORTZP Zp_P1ButtonsHeld_u8 Zp_P1ButtonsHeld_u8: .res 1 ;;; ButtonsPressed: A bitfield indicating which player 1 buttons have been ;;; newly pressed since the previous call to Func_UpdateButtons. .EXPORTZP Zp_P1ButtonsPressed_u8 Zp_P1ButtonsPressed_u8: .res 1 ;;;=========================================================================;;; .CODE ;;; Helper function for Func_UpdateButtons. Reads buttons from joypad and ;;; populates Zp_P1ButtonsHeld_u8. ;;; @preserve X, Y .PROC Func_ReadButtons ;; This function's code comes almost directly from ;; https://wiki.nesdev.org/w/index.php/Controller_reading_code. lda #1 ;; While the strobe bit is set, buttons will be continuously reloaded. ;; This means that reading from rJOYPAD1 will only return the state of the ;; first button: button A. sta rJOYPAD1 sta Zp_P1ButtonsHeld_u8 ; Initialize with a 1 bit, to be used later. lsr a ; now A is 0 ;; By storing 0 into rJOYPAD1, the strobe bit is cleared and the reloading ;; stops. This allows all 8 buttons (newly reloaded) to be read from ;; JOYPAD1. sta rJOYPAD1 @loop: lda rJOYPAD1 lsr a ; bit 0 -> Carry rol Zp_P1ButtonsHeld_u8 ; Carry -> bit 0; bit 7 -> Carry bcc @loop ; Stop when the initial 1 bit is finally shifted into Carry. rts .ENDPROC ;;; Reads buttons from joypad and populates Zp_P1ButtonsHeld_u8 and ;;; Zp_P1ButtonsPressed_u8. .EXPORT Func_UpdateButtons .PROC Func_UpdateButtons ;; Store the buttons *not* held last frame in Y. lda Zp_P1ButtonsHeld_u8 eor #$ff tay ;; Apparently, when using APU DMC playback, controller reading will ;; sometimes glitch. One standard workaround (used by e.g. Super Mario ;; Bros. 3) is to read the controller repeatedly until you get the same ;; result twice in a row. This part of the code is adapted from ;; https://wiki.nesdev.org/w/index.php/Controller_reading_code. jsr Func_ReadButtons ; preserves X and Y @rereadLoop: ldx Zp_P1ButtonsHeld_u8 jsr Func_ReadButtons ; preserves X and Y txa cmp Zp_P1ButtonsHeld_u8 bne @rereadLoop ;; Now that we have a reliable value for Zp_P1ButtonsHeld_u8, we can set ;; Zp_P1ButtonsPressed_u8 to the buttons that are newly held this frame. tya and Zp_P1ButtonsHeld_u8 sta Zp_P1ButtonsPressed_u8 rts .ENDPROC ;;;=========================================================================;;;
; A229151: a(n) = n^8*(5*n+4). ; 0,9,3584,124659,1572864,11328125,57106944,224827239,738197504,2109289329,5400000000,12647173979,27518828544,56285419749,109208390144,202468359375,360777252864,620842412249,1035876294144,1681372741059,2662400000000,4122691670349,6255849583104,9319007248439,13649338957824,19683837890625,27982826653184,39257705570859,54403487760384,74536715531189,101039400000000,135609674953119,180319906955264,237683056482729,310728139451904,403085694921875,519084222971904,663858616791069,843471674868224 mov $1,$0 pow $0,8 mov $2,$1 mul $2,5 mov $3,$2 add $3,4 mul $3,4 mul $0,$3 mul $0,10 div $0,40
#include "stdafx.h" #include "XMLList.h" #include "LearningSkill.h" bool LearningSkill::SetXML( const XMLPaser& ReadXML ) { XMLList SkillXMLList; SkillXMLList.Query( ReadXML, _T("Skill") ); long Count = SkillXMLList.GetCount(); if( Count <= 0 )return false; SkillList.reserve( SkillList.size() + Count ); for( long i = 0; i < Count; i++ ) { AddSkill( SkillXMLList.GetItem(i) ); } return true; } bool LearningSkill::AddSkill( const XMLPaser& ReadXML ) { Data AddData; AddData.name = String(ReadXML.AttributeString(TAG::NAME)); if( AddData.name.IsNone() )return false; AddData.Level = ReadXML.AttributeLong(TAG::LEV); if( AddData.Level <= 0 )AddData.Level = 1; SkillList.push_back( AddData ); return true; }
.global s_prepare_buffers s_prepare_buffers: push %r11 push %r15 push %rbp push %rbx push %rcx push %rdi push %rdx push %rsi lea addresses_WT_ht+0x2f7d, %r15 nop xor %rdi, %rdi mov (%r15), %r11 nop nop nop cmp %rbp, %rbp lea addresses_WC_ht+0x1bf3d, %r11 nop nop nop add $39282, %r15 mov (%r11), %rcx sub %rbp, %rbp lea addresses_D_ht+0x5b31, %rbx nop sub %rsi, %rsi mov (%rbx), %r11w nop nop nop sub %rdi, %rdi lea addresses_UC_ht+0x763d, %rbp clflush (%rbp) xor %r15, %r15 mov (%rbp), %di nop sub %r15, %r15 lea addresses_D_ht+0x3a3d, %rsi lea addresses_UC_ht+0x1293d, %rdi nop nop sub %rdx, %rdx mov $44, %rcx rep movsb nop lfence lea addresses_WT_ht+0x21b1, %rdx nop nop nop add %r15, %r15 mov $0x6162636465666768, %rbx movq %rbx, %xmm5 and $0xffffffffffffffc0, %rdx vmovaps %ymm5, (%rdx) cmp $30969, %r15 pop %rsi pop %rdx pop %rdi pop %rcx pop %rbx pop %rbp pop %r15 pop %r11 ret .global s_faulty_load s_faulty_load: push %r11 push %r12 push %r8 push %rbp push %rbx push %rcx push %rdi // Store lea addresses_WC+0x10428, %r12 clflush (%r12) nop xor $44810, %rdi mov $0x5152535455565758, %rcx movq %rcx, %xmm2 vmovups %ymm2, (%r12) nop nop nop nop sub %rcx, %rcx // Store lea addresses_UC+0x1563d, %r11 nop nop nop cmp $26432, %rbp movl $0x51525354, (%r11) nop nop nop cmp $51316, %rbx // Faulty Load lea addresses_normal+0x363d, %rcx xor %rdi, %rdi mov (%rcx), %r12w lea oracles, %rbp and $0xff, %r12 shlq $12, %r12 mov (%rbp,%r12,1), %r12 pop %rdi pop %rcx pop %rbx pop %rbp pop %r8 pop %r12 pop %r11 ret /* <gen_faulty_load> [REF] {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_normal', 'NT': False, 'AVXalign': False, 'size': 4, 'congruent': 0}} {'OP': 'STOR', 'dst': {'same': False, 'type': 'addresses_WC', 'NT': False, 'AVXalign': False, 'size': 32, 'congruent': 0}} {'OP': 'STOR', 'dst': {'same': False, 'type': 'addresses_UC', 'NT': False, 'AVXalign': False, 'size': 4, 'congruent': 10}} [Faulty Load] {'OP': 'LOAD', 'src': {'same': True, 'type': 'addresses_normal', 'NT': False, 'AVXalign': False, 'size': 2, 'congruent': 0}} <gen_prepare_buffer> {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_WT_ht', 'NT': False, 'AVXalign': False, 'size': 8, 'congruent': 4}} {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_WC_ht', 'NT': False, 'AVXalign': False, 'size': 8, 'congruent': 7}} {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_D_ht', 'NT': False, 'AVXalign': False, 'size': 2, 'congruent': 2}} {'OP': 'LOAD', 'src': {'same': False, 'type': 'addresses_UC_ht', 'NT': False, 'AVXalign': False, 'size': 2, 'congruent': 11}} {'OP': 'REPM', 'src': {'same': False, 'congruent': 9, 'type': 'addresses_D_ht'}, 'dst': {'same': False, 'congruent': 7, 'type': 'addresses_UC_ht'}} {'OP': 'STOR', 'dst': {'same': False, 'type': 'addresses_WT_ht', 'NT': False, 'AVXalign': True, 'size': 32, 'congruent': 0}} {'34': 21829} 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 */
; nes music_engine.asm .autoimport on .importzp sp, sreg, regsave, regbank .importzp tmp1, tmp2, tmp3, tmp4, ptr1, ptr2, ptr3, ptr4 .importzp Pulse1ControlCache .importzp Pulse2ControlCache .importzp TriangleControlCache .include "nes.asm" NUMBER_OF_VOICES = 3 .segment "CODE" ; NOTE: Platform specific (NES). NOTE_FREQ_1_C = 3419 ; C-1 NOTE_FREQ_1_CS = 3227 ; C#-1 NOTE_FREQ_1_D = 3046 ; D-1 NOTE_FREQ_1_DS = 2875 ; D#-1 NOTE_FREQ_1_E = 2714 ; E-1 NOTE_FREQ_1_F = 2561 ; F-1 NOTE_FREQ_1_FS = 2417 ; F#-1 NOTE_FREQ_1_G = 2281 ; G-1 NOTE_FREQ_1_GS = 2153 ; G#-1 NOTE_FREQ_1_A = 2032 ; A-1 NOTE_FREQ_1_AS = 1918 ; A#-1 NOTE_FREQ_1_B = 1810 ; B-1 NOTE_FREQ_2_C = 1709 ; C-2 NOTE_FREQ_2_CS = 1613 ; C#-2 NOTE_FREQ_2_D = 1522 ; D-2 NOTE_FREQ_2_DS = 1437 ; D#-2 NOTE_FREQ_2_E = 1356 ; E-2 NOTE_FREQ_2_F = 1280 ; F-2 NOTE_FREQ_2_FS = 1208 ; F#-2 NOTE_FREQ_2_G = 1140 ; G-2 NOTE_FREQ_2_GS = 1076 ; G#-2 NOTE_FREQ_2_A = 1015 ; A-2 NOTE_FREQ_2_AS = 958 ; A#-2 NOTE_FREQ_2_B = 904 ; B-2 NOTE_FREQ_3_C = 854 ; C-3 NOTE_FREQ_3_CS = 806 ; C#-3 NOTE_FREQ_3_D = 760 ; D-3 NOTE_FREQ_3_DS = 718 ; D#-3 NOTE_FREQ_3_E = 677 ; E-3 NOTE_FREQ_3_F = 639 ; F-3 NOTE_FREQ_3_FS = 603 ; F#-3 NOTE_FREQ_3_G = 569 ; G-3 NOTE_FREQ_3_GS = 537 ; G#-3 NOTE_FREQ_3_A = 507 ; A-3 NOTE_FREQ_3_AS = 478 ; A#-3 NOTE_FREQ_3_B = 451 ; B-3 NOTE_FREQ_4_C = 426 ; C-4 NOTE_FREQ_4_CS = 402 ; C#-4 NOTE_FREQ_4_D = 379 ; D-4 NOTE_FREQ_4_DS = 358 ; D#-4 NOTE_FREQ_4_E = 338 ; E-4 NOTE_FREQ_4_F = 319 ; F-4 NOTE_FREQ_4_FS = 301 ; F#-4 NOTE_FREQ_4_G = 284 ; G-4 NOTE_FREQ_4_GS = 268 ; G#-4 NOTE_FREQ_4_A = 253 ; A-4 NOTE_FREQ_4_AS = 238 ; A#-4 NOTE_FREQ_4_B = 225 ; B-4 NOTE_FREQ_5_C = 212 ; C-5 NOTE_FREQ_5_CS = 200 ; C#-5 NOTE_FREQ_5_D = 189 ; D-5 NOTE_FREQ_5_DS = 178 ; D#-5 NOTE_FREQ_5_E = 168 ; E-5 NOTE_FREQ_5_F = 159 ; F-5 NOTE_FREQ_5_FS = 150 ; F#-5 NOTE_FREQ_5_G = 141 ; G-5 NOTE_FREQ_5_GS = 133 ; G#-5 NOTE_FREQ_5_A = 126 ; A-5 NOTE_FREQ_5_AS = 118 ; A#-5 NOTE_FREQ_5_B = 112 ; B-5 NOTE_FREQ_6_C = 105 ; C-6 NOTE_FREQ_6_CS = 99 ; C#-6 NOTE_FREQ_6_D = 94 ; D-6 NOTE_FREQ_6_DS = 88 ; D#-6 NOTE_FREQ_6_E = 83 ; E-6 NOTE_FREQ_6_F = 79 ; F-6 NOTE_FREQ_6_FS = 74 ; F#-6 NOTE_FREQ_6_G = 70 ; G-6 NOTE_FREQ_6_GS = 66 ; G#-6 NOTE_FREQ_6_A = 62 ; A-6 NOTE_FREQ_6_AS = 58 ; A#-6 NOTE_FREQ_6_B = 55 ; B-6 ;--------------------------------------- ; NES specific (accounts for lower triangle voice). MusicEngineV1FreqTableHi = MusicEngineNoteFreqTableHi1C MusicEngineV1FreqTableLo = MusicEngineNoteFreqTableLo1C MusicEngineV2FreqTableHi = MusicEngineNoteFreqTableHi1C MusicEngineV2FreqTableLo = MusicEngineNoteFreqTableLo1C MusicEngineV3FreqTableHi = MusicEngineNoteFreqTableHi2C MusicEngineV3FreqTableLo = MusicEngineNoteFreqTableLo2C ;------------------------------------------------------------------ .macro setVoiceFrequencyV1 ; Macro for voice 1 frequency load. lda MusicEngineV1FreqTableHi,x sta APU_PULSE1CTUNE lda MusicEngineV1FreqTableLo,x sta APU_PULSE1FTUNE .endmacro .macro setVoiceFrequencyV2 ; Macro for voice 2 frequency load. lda MusicEngineV2FreqTableHi,x sta APU_PULSE2CTUNE lda MusicEngineV2FreqTableLo,x sta APU_PULSE2FTUNE .endmacro .macro setVoiceFrequencyV3 ; Macro for voice 3 frequency load. lda MusicEngineV3FreqTableHi,x sta APU_TRIFREQ2 lda MusicEngineV3FreqTableLo,x sta APU_TRIFREQ1 .endmacro .macro disableVoice1 ; Disable Voice 1. lda Pulse1ControlCache and #%11110000 sta APU_PULSE1CTRL sta Pulse1ControlCache .endmacro .macro disableVoice2 ; Disable Voice 2. lda Pulse2ControlCache and #%11110000 sta APU_PULSE2CTRL sta Pulse2ControlCache .endmacro .macro disableVoice3 ; Disable Voice 3. lda TriangleControlCache and #%10000000 sta APU_TRICTRL1 sta TriangleControlCache .endmacro .macro enableVoice1 ; Gate Voice 1. lda Pulse1ControlCache ora #%00001111 sta APU_PULSE1CTRL sta Pulse1ControlCache .endmacro .macro enableVoice2 ; Gate Voice 2. lda Pulse2ControlCache ora #%00001111 sta APU_PULSE2CTRL sta Pulse2ControlCache .endmacro .macro enableVoice3 ; Gate Voice 3. lda TriangleControlCache ora #%10000001 sta APU_TRICTRL1 sta TriangleControlCache .endmacro .include "../base/music_engine.asm"
; A003079: One of the basic cycles in the x->3x-1 (x odd) or x/2 (x even) problem. ; 5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10,5,14,7,20,10 add $0,2 mul $0,2 mod $0,5 mul $0,2 add $0,10 mov $2,841 div $2,$0 add $0,$2 sub $0,63 div $0,2 add $0,5
org 0x7c00 ; from https://stackoverflow.com/a/32871939 bits 16 cli mov ax,0x0E61 int 0x10 hlt times 510 - ($-$$) db 0 dw 0xaa55
;****************************************************************************** ;* TI ARM C/C++ Codegen Unix v16.9.6.LTS * ;* Date/Time created: Thu Dec 28 17:45:45 2017 * ;****************************************************************************** .compiler_opts --abi=eabi --arm_vmrs_si_workaround=off --code_state=16 --embedded_constants=on --endian=little --float_support=vfplib --hll_source=on --object_format=elf --quiet --section_sizes=on --silicon_version=7M4 --symdebug:dwarf --symdebug:dwarf_version=3 --unaligned_access=on .thumb $C$DW$CU .dwtag DW_TAG_compile_unit .dwattr $C$DW$CU, DW_AT_name("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$CU, DW_AT_producer("TI TI ARM C/C++ Codegen Unix v16.9.6.LTS Copyright (c) 1996-2017 Texas Instruments Incorporated") .dwattr $C$DW$CU, DW_AT_TI_version(0x01) .dwattr $C$DW$CU, DW_AT_comp_dir("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/ccs/Release") $C$DW$1 .dwtag DW_TAG_subprogram .dwattr $C$DW$1, DW_AT_name("memset") .dwattr $C$DW$1, DW_AT_TI_symbol_name("memset") .dwattr $C$DW$1, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$1, DW_AT_declaration .dwattr $C$DW$1, DW_AT_external .dwattr $C$DW$1, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/string.h") .dwattr $C$DW$1, DW_AT_decl_line(0x71) .dwattr $C$DW$1, DW_AT_decl_column(0x16) $C$DW$2 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$2, DW_AT_type(*$C$DW$T$3) $C$DW$3 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$3, DW_AT_type(*$C$DW$T$10) $C$DW$4 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$4, DW_AT_type(*$C$DW$T$573) .dwendtag $C$DW$1 $C$DW$5 .dwtag DW_TAG_subprogram .dwattr $C$DW$5, DW_AT_name("sl_FsOpen") .dwattr $C$DW$5, DW_AT_TI_symbol_name("sl_FsOpen") .dwattr $C$DW$5, DW_AT_type(*$C$DW$T$12) .dwattr $C$DW$5, DW_AT_declaration .dwattr $C$DW$5, DW_AT_external .dwattr $C$DW$5, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$5, DW_AT_decl_line(0x167) .dwattr $C$DW$5, DW_AT_decl_column(0x06) $C$DW$6 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$6, DW_AT_type(*$C$DW$T$592) $C$DW$7 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$7, DW_AT_type(*$C$DW$T$600) $C$DW$8 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$8, DW_AT_type(*$C$DW$T$630) .dwendtag $C$DW$5 $C$DW$9 .dwtag DW_TAG_subprogram .dwattr $C$DW$9, DW_AT_name("sl_FsClose") .dwattr $C$DW$9, DW_AT_TI_symbol_name("sl_FsClose") .dwattr $C$DW$9, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$9, DW_AT_declaration .dwattr $C$DW$9, DW_AT_external .dwattr $C$DW$9, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$9, DW_AT_decl_line(0x18a) .dwattr $C$DW$9, DW_AT_decl_column(0x06) $C$DW$10 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$10, DW_AT_type(*$C$DW$T$599) $C$DW$11 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$11, DW_AT_type(*$C$DW$T$592) $C$DW$12 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$12, DW_AT_type(*$C$DW$T$592) $C$DW$13 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$13, DW_AT_type(*$C$DW$T$600) .dwendtag $C$DW$9 $C$DW$14 .dwtag DW_TAG_subprogram .dwattr $C$DW$14, DW_AT_name("sl_FsWrite") .dwattr $C$DW$14, DW_AT_TI_symbol_name("sl_FsWrite") .dwattr $C$DW$14, DW_AT_type(*$C$DW$T$12) .dwattr $C$DW$14, DW_AT_declaration .dwattr $C$DW$14, DW_AT_external .dwattr $C$DW$14, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$14, DW_AT_decl_line(0x1ba) .dwattr $C$DW$14, DW_AT_decl_column(0x06) $C$DW$15 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$15, DW_AT_type(*$C$DW$T$599) $C$DW$16 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$16, DW_AT_type(*$C$DW$T$13) $C$DW$17 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$17, DW_AT_type(*$C$DW$T$84) $C$DW$18 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$18, DW_AT_type(*$C$DW$T$13) .dwendtag $C$DW$14 $C$DW$19 .dwtag DW_TAG_subprogram .dwattr $C$DW$19, DW_AT_name("sl_Socket") .dwattr $C$DW$19, DW_AT_TI_symbol_name("sl_Socket") .dwattr $C$DW$19, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$19, DW_AT_declaration .dwattr $C$DW$19, DW_AT_external .dwattr $C$DW$19, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$19, DW_AT_decl_line(0x1e7) .dwattr $C$DW$19, DW_AT_decl_column(0x06) $C$DW$20 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$20, DW_AT_type(*$C$DW$T$8) $C$DW$21 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$21, DW_AT_type(*$C$DW$T$8) $C$DW$22 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$22, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$19 $C$DW$23 .dwtag DW_TAG_subprogram .dwattr $C$DW$23, DW_AT_name("sl_Close") .dwattr $C$DW$23, DW_AT_TI_symbol_name("sl_Close") .dwattr $C$DW$23, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$23, DW_AT_declaration .dwattr $C$DW$23, DW_AT_external .dwattr $C$DW$23, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$23, DW_AT_decl_line(0x1f9) .dwattr $C$DW$23, DW_AT_decl_column(0x06) $C$DW$24 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$24, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$23 $C$DW$25 .dwtag DW_TAG_subprogram .dwattr $C$DW$25, DW_AT_name("sl_Accept") .dwattr $C$DW$25, DW_AT_TI_symbol_name("sl_Accept") .dwattr $C$DW$25, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$25, DW_AT_declaration .dwattr $C$DW$25, DW_AT_external .dwattr $C$DW$25, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$25, DW_AT_decl_line(0x22f) .dwattr $C$DW$25, DW_AT_decl_column(0x06) $C$DW$26 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$26, DW_AT_type(*$C$DW$T$8) $C$DW$27 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$27, DW_AT_type(*$C$DW$T$567) $C$DW$28 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$28, DW_AT_type(*$C$DW$T$608) .dwendtag $C$DW$25 $C$DW$29 .dwtag DW_TAG_subprogram .dwattr $C$DW$29, DW_AT_name("sl_Bind") .dwattr $C$DW$29, DW_AT_TI_symbol_name("sl_Bind") .dwattr $C$DW$29, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$29, DW_AT_declaration .dwattr $C$DW$29, DW_AT_external .dwattr $C$DW$29, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$29, DW_AT_decl_line(0x24d) .dwattr $C$DW$29, DW_AT_decl_column(0x06) $C$DW$30 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$30, DW_AT_type(*$C$DW$T$8) $C$DW$31 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$31, DW_AT_type(*$C$DW$T$566) $C$DW$32 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$32, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$29 $C$DW$33 .dwtag DW_TAG_subprogram .dwattr $C$DW$33, DW_AT_name("sl_Listen") .dwattr $C$DW$33, DW_AT_TI_symbol_name("sl_Listen") .dwattr $C$DW$33, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$33, DW_AT_declaration .dwattr $C$DW$33, DW_AT_external .dwattr $C$DW$33, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$33, DW_AT_decl_line(0x264) .dwattr $C$DW$33, DW_AT_decl_column(0x06) $C$DW$34 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$34, DW_AT_type(*$C$DW$T$8) $C$DW$35 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$35, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$33 $C$DW$36 .dwtag DW_TAG_subprogram .dwattr $C$DW$36, DW_AT_name("sl_Connect") .dwattr $C$DW$36, DW_AT_TI_symbol_name("sl_Connect") .dwattr $C$DW$36, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$36, DW_AT_declaration .dwattr $C$DW$36, DW_AT_external .dwattr $C$DW$36, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$36, DW_AT_decl_line(0x28e) .dwattr $C$DW$36, DW_AT_decl_column(0x06) $C$DW$37 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$37, DW_AT_type(*$C$DW$T$8) $C$DW$38 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$38, DW_AT_type(*$C$DW$T$566) $C$DW$39 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$39, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$36 $C$DW$40 .dwtag DW_TAG_subprogram .dwattr $C$DW$40, DW_AT_name("sl_Select") .dwattr $C$DW$40, DW_AT_TI_symbol_name("sl_Select") .dwattr $C$DW$40, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$40, DW_AT_declaration .dwattr $C$DW$40, DW_AT_external .dwattr $C$DW$40, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$40, DW_AT_decl_line(0x2cb) .dwattr $C$DW$40, DW_AT_decl_column(0x06) $C$DW$41 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$41, DW_AT_type(*$C$DW$T$8) $C$DW$42 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$42, DW_AT_type(*$C$DW$T$547) $C$DW$43 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$43, DW_AT_type(*$C$DW$T$547) $C$DW$44 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$44, DW_AT_type(*$C$DW$T$547) $C$DW$45 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$45, DW_AT_type(*$C$DW$T$569) .dwendtag $C$DW$40 $C$DW$46 .dwtag DW_TAG_subprogram .dwattr $C$DW$46, DW_AT_name("sl_SetSockOpt") .dwattr $C$DW$46, DW_AT_TI_symbol_name("sl_SetSockOpt") .dwattr $C$DW$46, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$46, DW_AT_declaration .dwattr $C$DW$46, DW_AT_external .dwattr $C$DW$46, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$46, DW_AT_decl_line(0x477) .dwattr $C$DW$46, DW_AT_decl_column(0x06) $C$DW$47 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$47, DW_AT_type(*$C$DW$T$8) $C$DW$48 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$48, DW_AT_type(*$C$DW$T$8) $C$DW$49 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$49, DW_AT_type(*$C$DW$T$8) $C$DW$50 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$50, DW_AT_type(*$C$DW$T$323) $C$DW$51 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$51, DW_AT_type(*$C$DW$T$607) .dwendtag $C$DW$46 $C$DW$52 .dwtag DW_TAG_subprogram .dwattr $C$DW$52, DW_AT_name("sl_GetSockOpt") .dwattr $C$DW$52, DW_AT_TI_symbol_name("sl_GetSockOpt") .dwattr $C$DW$52, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$52, DW_AT_declaration .dwattr $C$DW$52, DW_AT_external .dwattr $C$DW$52, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$52, DW_AT_decl_line(0x4a2) .dwattr $C$DW$52, DW_AT_decl_column(0x06) $C$DW$53 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$53, DW_AT_type(*$C$DW$T$8) $C$DW$54 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$54, DW_AT_type(*$C$DW$T$8) $C$DW$55 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$55, DW_AT_type(*$C$DW$T$8) $C$DW$56 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$56, DW_AT_type(*$C$DW$T$3) $C$DW$57 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$57, DW_AT_type(*$C$DW$T$608) .dwendtag $C$DW$52 $C$DW$58 .dwtag DW_TAG_subprogram .dwattr $C$DW$58, DW_AT_name("sl_Recv") .dwattr $C$DW$58, DW_AT_TI_symbol_name("sl_Recv") .dwattr $C$DW$58, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$58, DW_AT_declaration .dwattr $C$DW$58, DW_AT_external .dwattr $C$DW$58, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$58, DW_AT_decl_line(0x4e8) .dwattr $C$DW$58, DW_AT_decl_column(0x06) $C$DW$59 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$59, DW_AT_type(*$C$DW$T$8) $C$DW$60 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$60, DW_AT_type(*$C$DW$T$3) $C$DW$61 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$61, DW_AT_type(*$C$DW$T$8) $C$DW$62 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$62, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$58 $C$DW$63 .dwtag DW_TAG_subprogram .dwattr $C$DW$63, DW_AT_name("sl_RecvFrom") .dwattr $C$DW$63, DW_AT_TI_symbol_name("sl_RecvFrom") .dwattr $C$DW$63, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$63, DW_AT_declaration .dwattr $C$DW$63, DW_AT_external .dwattr $C$DW$63, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$63, DW_AT_decl_line(0x524) .dwattr $C$DW$63, DW_AT_decl_column(0x06) $C$DW$64 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$64, DW_AT_type(*$C$DW$T$8) $C$DW$65 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$65, DW_AT_type(*$C$DW$T$3) $C$DW$66 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$66, DW_AT_type(*$C$DW$T$8) $C$DW$67 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$67, DW_AT_type(*$C$DW$T$8) $C$DW$68 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$68, DW_AT_type(*$C$DW$T$567) $C$DW$69 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$69, DW_AT_type(*$C$DW$T$608) .dwendtag $C$DW$63 $C$DW$70 .dwtag DW_TAG_subprogram .dwattr $C$DW$70, DW_AT_name("sl_Send") .dwattr $C$DW$70, DW_AT_TI_symbol_name("sl_Send") .dwattr $C$DW$70, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$70, DW_AT_declaration .dwattr $C$DW$70, DW_AT_external .dwattr $C$DW$70, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$70, DW_AT_decl_line(0x555) .dwattr $C$DW$70, DW_AT_decl_column(0x06) $C$DW$71 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$71, DW_AT_type(*$C$DW$T$8) $C$DW$72 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$72, DW_AT_type(*$C$DW$T$323) $C$DW$73 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$73, DW_AT_type(*$C$DW$T$8) $C$DW$74 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$74, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$70 $C$DW$75 .dwtag DW_TAG_subprogram .dwattr $C$DW$75, DW_AT_name("sl_SendTo") .dwattr $C$DW$75, DW_AT_TI_symbol_name("sl_SendTo") .dwattr $C$DW$75, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$75, DW_AT_declaration .dwattr $C$DW$75, DW_AT_external .dwattr $C$DW$75, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$75, DW_AT_decl_line(0x58a) .dwattr $C$DW$75, DW_AT_decl_column(0x06) $C$DW$76 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$76, DW_AT_type(*$C$DW$T$8) $C$DW$77 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$77, DW_AT_type(*$C$DW$T$323) $C$DW$78 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$78, DW_AT_type(*$C$DW$T$8) $C$DW$79 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$79, DW_AT_type(*$C$DW$T$8) $C$DW$80 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$80, DW_AT_type(*$C$DW$T$566) $C$DW$81 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$81, DW_AT_type(*$C$DW$T$607) .dwendtag $C$DW$75 $C$DW$82 .dwtag DW_TAG_subprogram .dwattr $C$DW$82, DW_AT_name("sl_StartTLS") .dwattr $C$DW$82, DW_AT_TI_symbol_name("sl_StartTLS") .dwattr $C$DW$82, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$82, DW_AT_declaration .dwattr $C$DW$82, DW_AT_external .dwattr $C$DW$82, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$82, DW_AT_decl_line(0x59d) .dwattr $C$DW$82, DW_AT_decl_column(0x06) $C$DW$83 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$83, DW_AT_type(*$C$DW$T$8) .dwendtag $C$DW$82 $C$DW$84 .dwtag DW_TAG_subprogram .dwattr $C$DW$84, DW_AT_name("sl_NetAppDnsGetHostByName") .dwattr $C$DW$84, DW_AT_TI_symbol_name("sl_NetAppDnsGetHostByName") .dwattr $C$DW$84, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$84, DW_AT_declaration .dwattr $C$DW$84, DW_AT_external .dwattr $C$DW$84, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$84, DW_AT_decl_line(0x29a) .dwattr $C$DW$84, DW_AT_decl_column(0x06) $C$DW$85 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$85, DW_AT_type(*$C$DW$T$130) $C$DW$86 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$86, DW_AT_type(*$C$DW$T$629) $C$DW$87 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$87, DW_AT_type(*$C$DW$T$630) $C$DW$88 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$88, DW_AT_type(*$C$DW$T$591) .dwendtag $C$DW$84 $C$DW$89 .dwtag DW_TAG_subprogram .dwattr $C$DW$89, DW_AT_name("sl_WlanGet") .dwattr $C$DW$89, DW_AT_TI_symbol_name("sl_WlanGet") .dwattr $C$DW$89, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$89, DW_AT_declaration .dwattr $C$DW$89, DW_AT_external .dwattr $C$DW$89, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$89, DW_AT_decl_line(0x8a2) .dwattr $C$DW$89, DW_AT_decl_column(0x06) $C$DW$90 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$90, DW_AT_type(*$C$DW$T$629) $C$DW$91 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$91, DW_AT_type(*$C$DW$T$633) $C$DW$92 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$92, DW_AT_type(*$C$DW$T$633) $C$DW$93 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$93, DW_AT_type(*$C$DW$T$84) .dwendtag $C$DW$89 $C$DW$94 .dwtag DW_TAG_subprogram .dwattr $C$DW$94, DW_AT_name("sl_NetCfgGet") .dwattr $C$DW$94, DW_AT_TI_symbol_name("sl_NetCfgGet") .dwattr $C$DW$94, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$94, DW_AT_declaration .dwattr $C$DW$94, DW_AT_external .dwattr $C$DW$94, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$94, DW_AT_decl_line(0x283) .dwattr $C$DW$94, DW_AT_decl_column(0x06) $C$DW$95 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$95, DW_AT_type(*$C$DW$T$629) $C$DW$96 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$96, DW_AT_type(*$C$DW$T$633) $C$DW$97 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$97, DW_AT_type(*$C$DW$T$633) $C$DW$98 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$98, DW_AT_type(*$C$DW$T$84) .dwendtag $C$DW$94 .global SlNetIfConfigWifi .sect ".data:SlNetIfConfigWifi", RW .clink .align 4 .elfsym SlNetIfConfigWifi,SYM_SIZE(88) SlNetIfConfigWifi: .bits SlNetIfWifi_socket,32 ; SlNetIfConfigWifi.sockCreate @ 0 .bits SlNetIfWifi_close,32 ; SlNetIfConfigWifi.sockClose @ 32 .bits 0,32 ; SlNetIfConfigWifi.sockShutdown @ 64 .bits SlNetIfWifi_accept,32 ; SlNetIfConfigWifi.sockAccept @ 96 .bits SlNetIfWifi_bind,32 ; SlNetIfConfigWifi.sockBind @ 128 .bits SlNetIfWifi_listen,32 ; SlNetIfConfigWifi.sockListen @ 160 .bits SlNetIfWifi_connect,32 ; SlNetIfConfigWifi.sockConnect @ 192 .bits 0,32 ; SlNetIfConfigWifi.sockGetPeerName @ 224 .bits 0,32 ; SlNetIfConfigWifi.sockGetLocalName @ 256 .bits SlNetIfWifi_select,32 ; SlNetIfConfigWifi.sockSelect @ 288 .bits SlNetIfWifi_setSockOpt,32 ; SlNetIfConfigWifi.sockSetOpt @ 320 .bits SlNetIfWifi_getSockOpt,32 ; SlNetIfConfigWifi.sockGetOpt @ 352 .bits SlNetIfWifi_recv,32 ; SlNetIfConfigWifi.sockRecv @ 384 .bits SlNetIfWifi_recvFrom,32 ; SlNetIfConfigWifi.sockRecvFrom @ 416 .bits SlNetIfWifi_send,32 ; SlNetIfConfigWifi.sockSend @ 448 .bits SlNetIfWifi_sendTo,32 ; SlNetIfConfigWifi.sockSendTo @ 480 .bits SlNetIfWifi_sockstartSec,32 ; SlNetIfConfigWifi.sockstartSec @ 512 .bits SlNetIfWifi_getHostByName,32 ; SlNetIfConfigWifi.utilGetHostByName @ 544 .bits SlNetIfWifi_getIPAddr,32 ; SlNetIfConfigWifi.ifGetIPAddr @ 576 .bits SlNetIfWifi_getConnectionStatus,32 ; SlNetIfConfigWifi.ifGetConnectionStatus @ 608 .bits SlNetIfWifi_loadSecObj,32 ; SlNetIfConfigWifi.ifLoadSecObj @ 640 .bits 0,32 ; SlNetIfConfigWifi.ifCreateContext @ 672 $C$DW$99 .dwtag DW_TAG_variable .dwattr $C$DW$99, DW_AT_name("SlNetIfConfigWifi") .dwattr $C$DW$99, DW_AT_TI_symbol_name("SlNetIfConfigWifi") .dwattr $C$DW$99, DW_AT_location[DW_OP_addr SlNetIfConfigWifi] .dwattr $C$DW$99, DW_AT_type(*$C$DW$T$355) .dwattr $C$DW$99, DW_AT_external .dwattr $C$DW$99, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$99, DW_AT_decl_line(0x40) .dwattr $C$DW$99, DW_AT_decl_column(0x12) .sect ".const:StartSecOptName" .clink .align 2 .elfsym StartSecOptName,SYM_SIZE(20) StartSecOptName: .bits 30,16 ; StartSecOptName[0] @ 0 .bits 31,16 ; StartSecOptName[1] @ 16 .bits 32,16 ; StartSecOptName[2] @ 32 .bits 33,16 ; StartSecOptName[3] @ 48 .bits 25,16 ; StartSecOptName[4] @ 64 .bits 26,16 ; StartSecOptName[5] @ 80 .bits 40,16 ; StartSecOptName[6] @ 96 .bits 41,16 ; StartSecOptName[7] @ 112 .bits 42,16 ; StartSecOptName[8] @ 128 .bits 38,16 ; StartSecOptName[9] @ 144 $C$DW$100 .dwtag DW_TAG_variable .dwattr $C$DW$100, DW_AT_name("StartSecOptName") .dwattr $C$DW$100, DW_AT_TI_symbol_name("StartSecOptName") .dwattr $C$DW$100, DW_AT_type(*$C$DW$T$637) .dwattr $C$DW$100, DW_AT_location[DW_OP_addr StartSecOptName] .dwattr $C$DW$100, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$100, DW_AT_decl_line(0x5a) .dwattr $C$DW$100, DW_AT_decl_column(0x16) .sect ".const:socketType" .clink .align 2 .elfsym socketType,SYM_SIZE(16) socketType: .bits 1,16 ; socketType[0] @ 0 .bits 2,16 ; socketType[1] @ 16 .bits 3,16 ; socketType[2] @ 32 .bits 4,16 ; socketType[3] @ 48 .bits 2,16 ; socketType[4] @ 64 .bits 3,16 ; socketType[5] @ 80 .bits 7,16 ; socketType[6] @ 96 .bits 8,16 ; socketType[7] @ 112 $C$DW$101 .dwtag DW_TAG_variable .dwattr $C$DW$101, DW_AT_name("socketType") .dwattr $C$DW$101, DW_AT_TI_symbol_name("socketType") .dwattr $C$DW$101, DW_AT_type(*$C$DW$T$638) .dwattr $C$DW$101, DW_AT_location[DW_OP_addr socketType] .dwattr $C$DW$101, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$101, DW_AT_decl_line(0x68) .dwattr $C$DW$101, DW_AT_decl_column(0x16) ; /opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/bin/armacpia -@/tmp/TI7JczJdM7L .sect ".text:SlNetIfWifi_socket" .clink .thumbfunc SlNetIfWifi_socket .thumb .global SlNetIfWifi_socket $C$DW$102 .dwtag DW_TAG_subprogram .dwattr $C$DW$102, DW_AT_name("SlNetIfWifi_socket") .dwattr $C$DW$102, DW_AT_low_pc(SlNetIfWifi_socket) .dwattr $C$DW$102, DW_AT_high_pc(0x00) .dwattr $C$DW$102, DW_AT_TI_symbol_name("SlNetIfWifi_socket") .dwattr $C$DW$102, DW_AT_external .dwattr $C$DW$102, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$102, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$102, DW_AT_TI_begin_line(0x7d) .dwattr $C$DW$102, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$102, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$102, DW_AT_decl_line(0x7d) .dwattr $C$DW$102, DW_AT_decl_column(0x09) .dwattr $C$DW$102, DW_AT_TI_max_frame_size(0x10) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 126,column 1,is_stmt,address SlNetIfWifi_socket,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_socket $C$DW$103 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$103, DW_AT_name("ifContext") .dwattr $C$DW$103, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$103, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$103, DW_AT_location[DW_OP_reg0] $C$DW$104 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$104, DW_AT_name("Domain") .dwattr $C$DW$104, DW_AT_TI_symbol_name("Domain") .dwattr $C$DW$104, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$104, DW_AT_location[DW_OP_reg1] $C$DW$105 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$105, DW_AT_name("Type") .dwattr $C$DW$105, DW_AT_TI_symbol_name("Type") .dwattr $C$DW$105, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$105, DW_AT_location[DW_OP_reg2] $C$DW$106 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$106, DW_AT_name("Protocol") .dwattr $C$DW$106, DW_AT_TI_symbol_name("Protocol") .dwattr $C$DW$106, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$106, DW_AT_location[DW_OP_reg3] $C$DW$107 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$107, DW_AT_name("sdContext") .dwattr $C$DW$107, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$107, DW_AT_type(*$C$DW$T$286) .dwattr $C$DW$107, DW_AT_location[DW_OP_breg13 16] ;---------------------------------------------------------------------- ; 125 | int16_t SlNetIfWifi_socket(void *ifContext, int16_t Domain, int16_t Typ ; | e, int16_t Protocol, void **sdContext) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_socket * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 12 Auto + 4 Save = 16 byte * ;***************************************************************************** SlNetIfWifi_socket: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A2, A3, A4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 16 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 3, -8 .dwcfi save_reg_to_mem, 2, -12 .dwcfi save_reg_to_mem, 1, -16 $C$DW$108 .dwtag DW_TAG_variable .dwattr $C$DW$108, DW_AT_name("ifContext") .dwattr $C$DW$108, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$108, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$108, DW_AT_location[DW_OP_breg13 0] $C$DW$109 .dwtag DW_TAG_variable .dwattr $C$DW$109, DW_AT_name("Domain") .dwattr $C$DW$109, DW_AT_TI_symbol_name("Domain") .dwattr $C$DW$109, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$109, DW_AT_location[DW_OP_breg13 4] $C$DW$110 .dwtag DW_TAG_variable .dwattr $C$DW$110, DW_AT_name("Type") .dwattr $C$DW$110, DW_AT_TI_symbol_name("Type") .dwattr $C$DW$110, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$110, DW_AT_location[DW_OP_breg13 6] $C$DW$111 .dwtag DW_TAG_variable .dwattr $C$DW$111, DW_AT_name("Protocol") .dwattr $C$DW$111, DW_AT_TI_symbol_name("Protocol") .dwattr $C$DW$111, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$111, DW_AT_location[DW_OP_breg13 8] $C$DW$112 .dwtag DW_TAG_variable .dwattr $C$DW$112, DW_AT_name("mappedSocketType") .dwattr $C$DW$112, DW_AT_TI_symbol_name("mappedSocketType") .dwattr $C$DW$112, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$112, DW_AT_location[DW_OP_breg13 10] STRH A4, [SP, #8] ; [DPU_3_PIPE] |126| STRH A3, [SP, #6] ; [DPU_3_PIPE] |126| STRH A2, [SP, #4] ; [DPU_3_PIPE] |126| STR A1, [SP, #0] ; [DPU_3_PIPE] |126| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 128,column 30,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 128 | int16_t mappedSocketType = socketType[Type - 1]; ;---------------------------------------------------------------------- LDR A2, $C$CON1 ; [DPU_3_PIPE] |128| LDRSH A1, [SP, #6] ; [DPU_3_PIPE] |128| LSLS A1, A1, #1 ; [DPU_3_PIPE] |128| SUBS A1, A1, #2 ; [DPU_3_PIPE] |128| LDRH A1, [A2, +A1] ; [DPU_3_PIPE] |128| STRH A1, [SP, #10] ; [DPU_3_PIPE] |128| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 129,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 129 | return (sl_Socket(Domain, mappedSocketType, Protocol)); ;---------------------------------------------------------------------- LDRSH A3, [SP, #8] ; [DPU_3_PIPE] |129| LDRSH A1, [SP, #4] ; [DPU_3_PIPE] |129| LDRSH A2, [SP, #10] ; [DPU_3_PIPE] |129| $C$DW$113 .dwtag DW_TAG_TI_branch .dwattr $C$DW$113, DW_AT_low_pc(0x00) .dwattr $C$DW$113, DW_AT_name("sl_Socket") .dwattr $C$DW$113, DW_AT_TI_call BL sl_Socket ; [DPU_3_PIPE] |129| ; CALL OCCURS {sl_Socket } ; [] |129| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 130,column 1,is_stmt,isa 1 $C$DW$114 .dwtag DW_TAG_TI_branch .dwattr $C$DW$114, DW_AT_low_pc(0x00) .dwattr $C$DW$114, DW_AT_TI_return POP {A2, A3, A4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 ; BRANCH OCCURS ; [] .dwattr $C$DW$102, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$102, DW_AT_TI_end_line(0x82) .dwattr $C$DW$102, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$102 .sect ".text:SlNetIfWifi_close" .clink .thumbfunc SlNetIfWifi_close .thumb .global SlNetIfWifi_close $C$DW$115 .dwtag DW_TAG_subprogram .dwattr $C$DW$115, DW_AT_name("SlNetIfWifi_close") .dwattr $C$DW$115, DW_AT_low_pc(SlNetIfWifi_close) .dwattr $C$DW$115, DW_AT_high_pc(0x00) .dwattr $C$DW$115, DW_AT_TI_symbol_name("SlNetIfWifi_close") .dwattr $C$DW$115, DW_AT_external .dwattr $C$DW$115, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$115, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$115, DW_AT_TI_begin_line(0x8a) .dwattr $C$DW$115, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$115, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$115, DW_AT_decl_line(0x8a) .dwattr $C$DW$115, DW_AT_decl_column(0x09) .dwattr $C$DW$115, DW_AT_TI_max_frame_size(0x10) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 139,column 1,is_stmt,address SlNetIfWifi_close,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_close $C$DW$116 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$116, DW_AT_name("sd") .dwattr $C$DW$116, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$116, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$116, DW_AT_location[DW_OP_reg0] $C$DW$117 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$117, DW_AT_name("sdContext") .dwattr $C$DW$117, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$117, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$117, DW_AT_location[DW_OP_reg1] ;---------------------------------------------------------------------- ; 138 | int32_t SlNetIfWifi_close(int16_t sd, void *sdContext) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_close * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 8 Auto + 4 Save = 12 byte * ;***************************************************************************** SlNetIfWifi_close: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A2, A3, A4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 16 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 3, -8 .dwcfi save_reg_to_mem, 2, -12 .dwcfi save_reg_to_mem, 1, -16 $C$DW$118 .dwtag DW_TAG_variable .dwattr $C$DW$118, DW_AT_name("sdContext") .dwattr $C$DW$118, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$118, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$118, DW_AT_location[DW_OP_breg13 0] $C$DW$119 .dwtag DW_TAG_variable .dwattr $C$DW$119, DW_AT_name("sd") .dwattr $C$DW$119, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$119, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$119, DW_AT_location[DW_OP_breg13 4] STR A2, [SP, #0] ; [DPU_3_PIPE] |139| STRH A1, [SP, #4] ; [DPU_3_PIPE] |139| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 141,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 141 | return sl_Close(sd); ;---------------------------------------------------------------------- LDRSH A1, [SP, #4] ; [DPU_3_PIPE] |141| $C$DW$120 .dwtag DW_TAG_TI_branch .dwattr $C$DW$120, DW_AT_low_pc(0x00) .dwattr $C$DW$120, DW_AT_name("sl_Close") .dwattr $C$DW$120, DW_AT_TI_call BL sl_Close ; [DPU_3_PIPE] |141| ; CALL OCCURS {sl_Close } ; [] |141| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 142,column 1,is_stmt,isa 1 $C$DW$121 .dwtag DW_TAG_TI_branch .dwattr $C$DW$121, DW_AT_low_pc(0x00) .dwattr $C$DW$121, DW_AT_TI_return POP {A2, A3, A4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 ; BRANCH OCCURS ; [] .dwattr $C$DW$115, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$115, DW_AT_TI_end_line(0x8e) .dwattr $C$DW$115, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$115 .sect ".text:SlNetIfWifi_accept" .clink .thumbfunc SlNetIfWifi_accept .thumb .global SlNetIfWifi_accept $C$DW$122 .dwtag DW_TAG_subprogram .dwattr $C$DW$122, DW_AT_name("SlNetIfWifi_accept") .dwattr $C$DW$122, DW_AT_low_pc(SlNetIfWifi_accept) .dwattr $C$DW$122, DW_AT_high_pc(0x00) .dwattr $C$DW$122, DW_AT_TI_symbol_name("SlNetIfWifi_accept") .dwattr $C$DW$122, DW_AT_external .dwattr $C$DW$122, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$122, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$122, DW_AT_TI_begin_line(0x96) .dwattr $C$DW$122, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$122, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$122, DW_AT_decl_line(0x96) .dwattr $C$DW$122, DW_AT_decl_column(0x09) .dwattr $C$DW$122, DW_AT_TI_max_frame_size(0x18) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 151,column 1,is_stmt,address SlNetIfWifi_accept,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_accept $C$DW$123 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$123, DW_AT_name("sd") .dwattr $C$DW$123, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$123, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$123, DW_AT_location[DW_OP_reg0] $C$DW$124 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$124, DW_AT_name("sdContext") .dwattr $C$DW$124, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$124, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$124, DW_AT_location[DW_OP_reg1] $C$DW$125 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$125, DW_AT_name("addr") .dwattr $C$DW$125, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$125, DW_AT_type(*$C$DW$T$295) .dwattr $C$DW$125, DW_AT_location[DW_OP_reg2] $C$DW$126 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$126, DW_AT_name("addrlen") .dwattr $C$DW$126, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$126, DW_AT_type(*$C$DW$T$297) .dwattr $C$DW$126, DW_AT_location[DW_OP_reg3] $C$DW$127 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$127, DW_AT_name("flags") .dwattr $C$DW$127, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$127, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$127, DW_AT_location[DW_OP_breg13 24] $C$DW$128 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$128, DW_AT_name("acceptedSdContext") .dwattr $C$DW$128, DW_AT_TI_symbol_name("acceptedSdContext") .dwattr $C$DW$128, DW_AT_type(*$C$DW$T$286) .dwattr $C$DW$128, DW_AT_location[DW_OP_breg13 28] ;---------------------------------------------------------------------- ; 150 | int16_t SlNetIfWifi_accept(int16_t sd, void *sdContext, SlNetSock_Addr_ ; | t *addr, SlNetSocklen_t *addrlen, uint8_t flags, void **acceptedSdConte ; | xt) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_accept * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 16 Auto + 4 Save = 20 byte * ;***************************************************************************** SlNetIfWifi_accept: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 .dwcfi save_reg_to_mem, 14, -4 SUB SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 24 $C$DW$129 .dwtag DW_TAG_variable .dwattr $C$DW$129, DW_AT_name("sdContext") .dwattr $C$DW$129, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$129, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$129, DW_AT_location[DW_OP_breg13 0] $C$DW$130 .dwtag DW_TAG_variable .dwattr $C$DW$130, DW_AT_name("addr") .dwattr $C$DW$130, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$130, DW_AT_type(*$C$DW$T$295) .dwattr $C$DW$130, DW_AT_location[DW_OP_breg13 4] $C$DW$131 .dwtag DW_TAG_variable .dwattr $C$DW$131, DW_AT_name("addrlen") .dwattr $C$DW$131, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$131, DW_AT_type(*$C$DW$T$297) .dwattr $C$DW$131, DW_AT_location[DW_OP_breg13 8] $C$DW$132 .dwtag DW_TAG_variable .dwattr $C$DW$132, DW_AT_name("sd") .dwattr $C$DW$132, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$132, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$132, DW_AT_location[DW_OP_breg13 12] STR A4, [SP, #8] ; [DPU_3_PIPE] |151| STR A3, [SP, #4] ; [DPU_3_PIPE] |151| STR A2, [SP, #0] ; [DPU_3_PIPE] |151| STRH A1, [SP, #12] ; [DPU_3_PIPE] |151| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 152,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 152 | return sl_Accept(sd, (SlSockAddr_t *)addr, addrlen); ;---------------------------------------------------------------------- LDRSH A1, [SP, #12] ; [DPU_3_PIPE] |152| LDR A2, [SP, #4] ; [DPU_3_PIPE] |152| LDR A3, [SP, #8] ; [DPU_3_PIPE] |152| $C$DW$133 .dwtag DW_TAG_TI_branch .dwattr $C$DW$133, DW_AT_low_pc(0x00) .dwattr $C$DW$133, DW_AT_name("sl_Accept") .dwattr $C$DW$133, DW_AT_TI_call BL sl_Accept ; [DPU_3_PIPE] |152| ; CALL OCCURS {sl_Accept } ; [] |152| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 153,column 1,is_stmt,isa 1 ADD SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 $C$DW$134 .dwtag DW_TAG_TI_branch .dwattr $C$DW$134, DW_AT_low_pc(0x00) .dwattr $C$DW$134, DW_AT_TI_return POP {PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$122, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$122, DW_AT_TI_end_line(0x99) .dwattr $C$DW$122, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$122 .sect ".text:SlNetIfWifi_bind" .clink .thumbfunc SlNetIfWifi_bind .thumb .global SlNetIfWifi_bind $C$DW$135 .dwtag DW_TAG_subprogram .dwattr $C$DW$135, DW_AT_name("SlNetIfWifi_bind") .dwattr $C$DW$135, DW_AT_low_pc(SlNetIfWifi_bind) .dwattr $C$DW$135, DW_AT_high_pc(0x00) .dwattr $C$DW$135, DW_AT_TI_symbol_name("SlNetIfWifi_bind") .dwattr $C$DW$135, DW_AT_external .dwattr $C$DW$135, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$135, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$135, DW_AT_TI_begin_line(0xa1) .dwattr $C$DW$135, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$135, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$135, DW_AT_decl_line(0xa1) .dwattr $C$DW$135, DW_AT_decl_column(0x09) .dwattr $C$DW$135, DW_AT_TI_max_frame_size(0x10) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 162,column 1,is_stmt,address SlNetIfWifi_bind,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_bind $C$DW$136 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$136, DW_AT_name("sd") .dwattr $C$DW$136, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$136, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$136, DW_AT_location[DW_OP_reg0] $C$DW$137 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$137, DW_AT_name("sdContext") .dwattr $C$DW$137, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$137, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$137, DW_AT_location[DW_OP_reg1] $C$DW$138 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$138, DW_AT_name("addr") .dwattr $C$DW$138, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$138, DW_AT_type(*$C$DW$T$301) .dwattr $C$DW$138, DW_AT_location[DW_OP_reg2] $C$DW$139 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$139, DW_AT_name("addrlen") .dwattr $C$DW$139, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$139, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$139, DW_AT_location[DW_OP_reg3] ;---------------------------------------------------------------------- ; 161 | int32_t SlNetIfWifi_bind(int16_t sd, void *sdContext, const SlNetSock_A ; | ddr_t *addr, int16_t addrlen) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_bind * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 12 Auto + 4 Save = 16 byte * ;***************************************************************************** SlNetIfWifi_bind: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A2, A3, A4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 16 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 3, -8 .dwcfi save_reg_to_mem, 2, -12 .dwcfi save_reg_to_mem, 1, -16 $C$DW$140 .dwtag DW_TAG_variable .dwattr $C$DW$140, DW_AT_name("sdContext") .dwattr $C$DW$140, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$140, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$140, DW_AT_location[DW_OP_breg13 0] $C$DW$141 .dwtag DW_TAG_variable .dwattr $C$DW$141, DW_AT_name("addr") .dwattr $C$DW$141, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$141, DW_AT_type(*$C$DW$T$301) .dwattr $C$DW$141, DW_AT_location[DW_OP_breg13 4] $C$DW$142 .dwtag DW_TAG_variable .dwattr $C$DW$142, DW_AT_name("sd") .dwattr $C$DW$142, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$142, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$142, DW_AT_location[DW_OP_breg13 8] $C$DW$143 .dwtag DW_TAG_variable .dwattr $C$DW$143, DW_AT_name("addrlen") .dwattr $C$DW$143, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$143, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$143, DW_AT_location[DW_OP_breg13 10] STRH A4, [SP, #10] ; [DPU_3_PIPE] |162| STR A3, [SP, #4] ; [DPU_3_PIPE] |162| STR A2, [SP, #0] ; [DPU_3_PIPE] |162| STRH A1, [SP, #8] ; [DPU_3_PIPE] |162| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 163,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 163 | return sl_Bind(sd, (const SlSockAddr_t *)addr, addrlen); ;---------------------------------------------------------------------- LDRSH A1, [SP, #8] ; [DPU_3_PIPE] |163| LDRSH A3, [SP, #10] ; [DPU_3_PIPE] |163| LDR A2, [SP, #4] ; [DPU_3_PIPE] |163| $C$DW$144 .dwtag DW_TAG_TI_branch .dwattr $C$DW$144, DW_AT_low_pc(0x00) .dwattr $C$DW$144, DW_AT_name("sl_Bind") .dwattr $C$DW$144, DW_AT_TI_call BL sl_Bind ; [DPU_3_PIPE] |163| ; CALL OCCURS {sl_Bind } ; [] |163| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 164,column 1,is_stmt,isa 1 $C$DW$145 .dwtag DW_TAG_TI_branch .dwattr $C$DW$145, DW_AT_low_pc(0x00) .dwattr $C$DW$145, DW_AT_TI_return POP {A2, A3, A4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 ; BRANCH OCCURS ; [] .dwattr $C$DW$135, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$135, DW_AT_TI_end_line(0xa4) .dwattr $C$DW$135, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$135 .sect ".text:SlNetIfWifi_listen" .clink .thumbfunc SlNetIfWifi_listen .thumb .global SlNetIfWifi_listen $C$DW$146 .dwtag DW_TAG_subprogram .dwattr $C$DW$146, DW_AT_name("SlNetIfWifi_listen") .dwattr $C$DW$146, DW_AT_low_pc(SlNetIfWifi_listen) .dwattr $C$DW$146, DW_AT_high_pc(0x00) .dwattr $C$DW$146, DW_AT_TI_symbol_name("SlNetIfWifi_listen") .dwattr $C$DW$146, DW_AT_external .dwattr $C$DW$146, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$146, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$146, DW_AT_TI_begin_line(0xac) .dwattr $C$DW$146, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$146, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$146, DW_AT_decl_line(0xac) .dwattr $C$DW$146, DW_AT_decl_column(0x09) .dwattr $C$DW$146, DW_AT_TI_max_frame_size(0x10) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 173,column 1,is_stmt,address SlNetIfWifi_listen,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_listen $C$DW$147 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$147, DW_AT_name("sd") .dwattr $C$DW$147, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$147, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$147, DW_AT_location[DW_OP_reg0] $C$DW$148 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$148, DW_AT_name("sdContext") .dwattr $C$DW$148, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$148, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$148, DW_AT_location[DW_OP_reg1] $C$DW$149 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$149, DW_AT_name("backlog") .dwattr $C$DW$149, DW_AT_TI_symbol_name("backlog") .dwattr $C$DW$149, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$149, DW_AT_location[DW_OP_reg2] ;---------------------------------------------------------------------- ; 172 | int32_t SlNetIfWifi_listen(int16_t sd, void *sdContext, int16_t backlog ; | ) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_listen * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 8 Auto + 4 Save = 12 byte * ;***************************************************************************** SlNetIfWifi_listen: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A2, A3, A4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 16 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 3, -8 .dwcfi save_reg_to_mem, 2, -12 .dwcfi save_reg_to_mem, 1, -16 $C$DW$150 .dwtag DW_TAG_variable .dwattr $C$DW$150, DW_AT_name("sdContext") .dwattr $C$DW$150, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$150, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$150, DW_AT_location[DW_OP_breg13 0] $C$DW$151 .dwtag DW_TAG_variable .dwattr $C$DW$151, DW_AT_name("sd") .dwattr $C$DW$151, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$151, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$151, DW_AT_location[DW_OP_breg13 4] $C$DW$152 .dwtag DW_TAG_variable .dwattr $C$DW$152, DW_AT_name("backlog") .dwattr $C$DW$152, DW_AT_TI_symbol_name("backlog") .dwattr $C$DW$152, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$152, DW_AT_location[DW_OP_breg13 6] STRH A3, [SP, #6] ; [DPU_3_PIPE] |173| STR A2, [SP, #0] ; [DPU_3_PIPE] |173| STRH A1, [SP, #4] ; [DPU_3_PIPE] |173| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 174,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 174 | return sl_Listen(sd, backlog); ;---------------------------------------------------------------------- LDRSH A1, [SP, #4] ; [DPU_3_PIPE] |174| LDRSH A2, [SP, #6] ; [DPU_3_PIPE] |174| $C$DW$153 .dwtag DW_TAG_TI_branch .dwattr $C$DW$153, DW_AT_low_pc(0x00) .dwattr $C$DW$153, DW_AT_name("sl_Listen") .dwattr $C$DW$153, DW_AT_TI_call BL sl_Listen ; [DPU_3_PIPE] |174| ; CALL OCCURS {sl_Listen } ; [] |174| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 175,column 1,is_stmt,isa 1 $C$DW$154 .dwtag DW_TAG_TI_branch .dwattr $C$DW$154, DW_AT_low_pc(0x00) .dwattr $C$DW$154, DW_AT_TI_return POP {A2, A3, A4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 ; BRANCH OCCURS ; [] .dwattr $C$DW$146, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$146, DW_AT_TI_end_line(0xaf) .dwattr $C$DW$146, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$146 .sect ".text:SlNetIfWifi_connect" .clink .thumbfunc SlNetIfWifi_connect .thumb .global SlNetIfWifi_connect $C$DW$155 .dwtag DW_TAG_subprogram .dwattr $C$DW$155, DW_AT_name("SlNetIfWifi_connect") .dwattr $C$DW$155, DW_AT_low_pc(SlNetIfWifi_connect) .dwattr $C$DW$155, DW_AT_high_pc(0x00) .dwattr $C$DW$155, DW_AT_TI_symbol_name("SlNetIfWifi_connect") .dwattr $C$DW$155, DW_AT_external .dwattr $C$DW$155, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$155, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$155, DW_AT_TI_begin_line(0xb7) .dwattr $C$DW$155, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$155, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$155, DW_AT_decl_line(0xb7) .dwattr $C$DW$155, DW_AT_decl_column(0x09) .dwattr $C$DW$155, DW_AT_TI_max_frame_size(0x10) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 184,column 1,is_stmt,address SlNetIfWifi_connect,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_connect $C$DW$156 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$156, DW_AT_name("sd") .dwattr $C$DW$156, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$156, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$156, DW_AT_location[DW_OP_reg0] $C$DW$157 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$157, DW_AT_name("sdContext") .dwattr $C$DW$157, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$157, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$157, DW_AT_location[DW_OP_reg1] $C$DW$158 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$158, DW_AT_name("addr") .dwattr $C$DW$158, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$158, DW_AT_type(*$C$DW$T$301) .dwattr $C$DW$158, DW_AT_location[DW_OP_reg2] $C$DW$159 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$159, DW_AT_name("addrlen") .dwattr $C$DW$159, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$159, DW_AT_type(*$C$DW$T$296) .dwattr $C$DW$159, DW_AT_location[DW_OP_reg3] $C$DW$160 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$160, DW_AT_name("flags") .dwattr $C$DW$160, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$160, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$160, DW_AT_location[DW_OP_breg13 16] ;---------------------------------------------------------------------- ; 183 | int32_t SlNetIfWifi_connect(int16_t sd, void *sdContext, const SlNetSoc ; | k_Addr_t *addr, SlNetSocklen_t addrlen, uint8_t flags) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_connect * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 12 Auto + 4 Save = 16 byte * ;***************************************************************************** SlNetIfWifi_connect: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A2, A3, A4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 16 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 3, -8 .dwcfi save_reg_to_mem, 2, -12 .dwcfi save_reg_to_mem, 1, -16 $C$DW$161 .dwtag DW_TAG_variable .dwattr $C$DW$161, DW_AT_name("sdContext") .dwattr $C$DW$161, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$161, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$161, DW_AT_location[DW_OP_breg13 0] $C$DW$162 .dwtag DW_TAG_variable .dwattr $C$DW$162, DW_AT_name("addr") .dwattr $C$DW$162, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$162, DW_AT_type(*$C$DW$T$301) .dwattr $C$DW$162, DW_AT_location[DW_OP_breg13 4] $C$DW$163 .dwtag DW_TAG_variable .dwattr $C$DW$163, DW_AT_name("sd") .dwattr $C$DW$163, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$163, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$163, DW_AT_location[DW_OP_breg13 8] $C$DW$164 .dwtag DW_TAG_variable .dwattr $C$DW$164, DW_AT_name("addrlen") .dwattr $C$DW$164, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$164, DW_AT_type(*$C$DW$T$296) .dwattr $C$DW$164, DW_AT_location[DW_OP_breg13 10] STRH A4, [SP, #10] ; [DPU_3_PIPE] |184| STR A3, [SP, #4] ; [DPU_3_PIPE] |184| STR A2, [SP, #0] ; [DPU_3_PIPE] |184| STRH A1, [SP, #8] ; [DPU_3_PIPE] |184| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 185,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 185 | return sl_Connect(sd, (const SlSockAddr_t *)addr, addrlen); ;---------------------------------------------------------------------- LDRSH A1, [SP, #8] ; [DPU_3_PIPE] |185| LDRSH A3, [SP, #10] ; [DPU_3_PIPE] |185| LDR A2, [SP, #4] ; [DPU_3_PIPE] |185| $C$DW$165 .dwtag DW_TAG_TI_branch .dwattr $C$DW$165, DW_AT_low_pc(0x00) .dwattr $C$DW$165, DW_AT_name("sl_Connect") .dwattr $C$DW$165, DW_AT_TI_call BL sl_Connect ; [DPU_3_PIPE] |185| ; CALL OCCURS {sl_Connect } ; [] |185| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 186,column 1,is_stmt,isa 1 $C$DW$166 .dwtag DW_TAG_TI_branch .dwattr $C$DW$166, DW_AT_low_pc(0x00) .dwattr $C$DW$166, DW_AT_TI_return POP {A2, A3, A4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 ; BRANCH OCCURS ; [] .dwattr $C$DW$155, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$155, DW_AT_TI_end_line(0xba) .dwattr $C$DW$155, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$155 .sect ".text:SlNetIfWifi_getSockName" .clink .thumbfunc SlNetIfWifi_getSockName .thumb .global SlNetIfWifi_getSockName $C$DW$167 .dwtag DW_TAG_subprogram .dwattr $C$DW$167, DW_AT_name("SlNetIfWifi_getSockName") .dwattr $C$DW$167, DW_AT_low_pc(SlNetIfWifi_getSockName) .dwattr $C$DW$167, DW_AT_high_pc(0x00) .dwattr $C$DW$167, DW_AT_TI_symbol_name("SlNetIfWifi_getSockName") .dwattr $C$DW$167, DW_AT_external .dwattr $C$DW$167, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$167, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$167, DW_AT_TI_begin_line(0xc3) .dwattr $C$DW$167, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$167, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$167, DW_AT_decl_line(0xc3) .dwattr $C$DW$167, DW_AT_decl_column(0x09) .dwattr $C$DW$167, DW_AT_TI_max_frame_size(0x10) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 196,column 1,is_stmt,address SlNetIfWifi_getSockName,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_getSockName $C$DW$168 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$168, DW_AT_name("sd") .dwattr $C$DW$168, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$168, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$168, DW_AT_location[DW_OP_reg0] $C$DW$169 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$169, DW_AT_name("sdContext") .dwattr $C$DW$169, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$169, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$169, DW_AT_location[DW_OP_reg1] $C$DW$170 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$170, DW_AT_name("addr") .dwattr $C$DW$170, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$170, DW_AT_type(*$C$DW$T$295) .dwattr $C$DW$170, DW_AT_location[DW_OP_reg2] $C$DW$171 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$171, DW_AT_name("addrlen") .dwattr $C$DW$171, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$171, DW_AT_type(*$C$DW$T$297) .dwattr $C$DW$171, DW_AT_location[DW_OP_reg3] ;---------------------------------------------------------------------- ; 195 | int32_t SlNetIfWifi_getSockName(int16_t sd, void *sdContext, SlNetSock_ ; | Addr_t *addr, SlNetSocklen_t *addrlen) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_getSockName * ;* * ;* Regs Modified : A1,SP * ;* Regs Used : A1,A2,A3,A4,SP,LR * ;* Local Frame Size : 0 Args + 16 Auto + 0 Save = 16 byte * ;***************************************************************************** SlNetIfWifi_getSockName: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 SUB SP, SP, #16 ; [DPU_3_PIPE] .dwcfi cfa_offset, 16 $C$DW$172 .dwtag DW_TAG_variable .dwattr $C$DW$172, DW_AT_name("sdContext") .dwattr $C$DW$172, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$172, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$172, DW_AT_location[DW_OP_breg13 0] $C$DW$173 .dwtag DW_TAG_variable .dwattr $C$DW$173, DW_AT_name("addr") .dwattr $C$DW$173, DW_AT_TI_symbol_name("addr") .dwattr $C$DW$173, DW_AT_type(*$C$DW$T$295) .dwattr $C$DW$173, DW_AT_location[DW_OP_breg13 4] $C$DW$174 .dwtag DW_TAG_variable .dwattr $C$DW$174, DW_AT_name("addrlen") .dwattr $C$DW$174, DW_AT_TI_symbol_name("addrlen") .dwattr $C$DW$174, DW_AT_type(*$C$DW$T$297) .dwattr $C$DW$174, DW_AT_location[DW_OP_breg13 8] $C$DW$175 .dwtag DW_TAG_variable .dwattr $C$DW$175, DW_AT_name("sd") .dwattr $C$DW$175, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$175, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$175, DW_AT_location[DW_OP_breg13 12] ;---------------------------------------------------------------------- ; 197 | // Not implemented in NWP ;---------------------------------------------------------------------- STR A4, [SP, #8] ; [DPU_3_PIPE] |196| STR A3, [SP, #4] ; [DPU_3_PIPE] |196| STR A2, [SP, #0] ; [DPU_3_PIPE] |196| STRH A1, [SP, #12] ; [DPU_3_PIPE] |196| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 198,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 198 | return SLNETERR_INVALPARAM; ;---------------------------------------------------------------------- LDR A1, $C$CON2 ; [DPU_3_PIPE] |198| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 199,column 1,is_stmt,isa 1 ADD SP, SP, #16 ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 $C$DW$176 .dwtag DW_TAG_TI_branch .dwattr $C$DW$176, DW_AT_low_pc(0x00) .dwattr $C$DW$176, DW_AT_TI_return BX LR ; [DPU_3_PIPE] ; BRANCH OCCURS ; [] .dwattr $C$DW$167, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$167, DW_AT_TI_end_line(0xc7) .dwattr $C$DW$167, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$167 .sect ".text:SlNetIfWifi_select" .clink .thumbfunc SlNetIfWifi_select .thumb .global SlNetIfWifi_select $C$DW$177 .dwtag DW_TAG_subprogram .dwattr $C$DW$177, DW_AT_name("SlNetIfWifi_select") .dwattr $C$DW$177, DW_AT_low_pc(SlNetIfWifi_select) .dwattr $C$DW$177, DW_AT_high_pc(0x00) .dwattr $C$DW$177, DW_AT_TI_symbol_name("SlNetIfWifi_select") .dwattr $C$DW$177, DW_AT_external .dwattr $C$DW$177, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$177, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$177, DW_AT_TI_begin_line(0xcf) .dwattr $C$DW$177, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$177, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$177, DW_AT_decl_line(0xcf) .dwattr $C$DW$177, DW_AT_decl_column(0x09) .dwattr $C$DW$177, DW_AT_TI_max_frame_size(0x18) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 208,column 1,is_stmt,address SlNetIfWifi_select,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_select $C$DW$178 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$178, DW_AT_name("ifContext") .dwattr $C$DW$178, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$178, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$178, DW_AT_location[DW_OP_reg0] $C$DW$179 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$179, DW_AT_name("nfds") .dwattr $C$DW$179, DW_AT_TI_symbol_name("nfds") .dwattr $C$DW$179, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$179, DW_AT_location[DW_OP_reg1] $C$DW$180 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$180, DW_AT_name("readsds") .dwattr $C$DW$180, DW_AT_TI_symbol_name("readsds") .dwattr $C$DW$180, DW_AT_type(*$C$DW$T$309) .dwattr $C$DW$180, DW_AT_location[DW_OP_reg2] $C$DW$181 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$181, DW_AT_name("writesds") .dwattr $C$DW$181, DW_AT_TI_symbol_name("writesds") .dwattr $C$DW$181, DW_AT_type(*$C$DW$T$309) .dwattr $C$DW$181, DW_AT_location[DW_OP_reg3] $C$DW$182 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$182, DW_AT_name("exceptsds") .dwattr $C$DW$182, DW_AT_TI_symbol_name("exceptsds") .dwattr $C$DW$182, DW_AT_type(*$C$DW$T$309) .dwattr $C$DW$182, DW_AT_location[DW_OP_breg13 24] $C$DW$183 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$183, DW_AT_name("timeout") .dwattr $C$DW$183, DW_AT_TI_symbol_name("timeout") .dwattr $C$DW$183, DW_AT_type(*$C$DW$T$311) .dwattr $C$DW$183, DW_AT_location[DW_OP_breg13 28] ;---------------------------------------------------------------------- ; 207 | int32_t SlNetIfWifi_select(void *ifContext, int16_t nfds, SlNetSock_SdS ; | et_t *readsds, SlNetSock_SdSet_t *writesds, SlNetSock_SdSet_t *exceptsd ; | s, SlNetSock_Timeval_t *timeout) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_select * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 4 Args + 16 Auto + 4 Save = 24 byte * ;***************************************************************************** SlNetIfWifi_select: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 .dwcfi save_reg_to_mem, 14, -4 SUB SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 24 $C$DW$184 .dwtag DW_TAG_variable .dwattr $C$DW$184, DW_AT_name("ifContext") .dwattr $C$DW$184, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$184, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$184, DW_AT_location[DW_OP_breg13 4] $C$DW$185 .dwtag DW_TAG_variable .dwattr $C$DW$185, DW_AT_name("readsds") .dwattr $C$DW$185, DW_AT_TI_symbol_name("readsds") .dwattr $C$DW$185, DW_AT_type(*$C$DW$T$309) .dwattr $C$DW$185, DW_AT_location[DW_OP_breg13 8] $C$DW$186 .dwtag DW_TAG_variable .dwattr $C$DW$186, DW_AT_name("writesds") .dwattr $C$DW$186, DW_AT_TI_symbol_name("writesds") .dwattr $C$DW$186, DW_AT_type(*$C$DW$T$309) .dwattr $C$DW$186, DW_AT_location[DW_OP_breg13 12] $C$DW$187 .dwtag DW_TAG_variable .dwattr $C$DW$187, DW_AT_name("nfds") .dwattr $C$DW$187, DW_AT_TI_symbol_name("nfds") .dwattr $C$DW$187, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$187, DW_AT_location[DW_OP_breg13 16] STR A4, [SP, #12] ; [DPU_3_PIPE] |208| STR A3, [SP, #8] ; [DPU_3_PIPE] |208| STRH A2, [SP, #16] ; [DPU_3_PIPE] |208| STR A1, [SP, #4] ; [DPU_3_PIPE] |208| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 209,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 209 | return sl_Select(nfds, (SlFdSet_t *)readsds, (SlFdSet_t *)writesds, (Sl ; | FdSet_t *)exceptsds, (struct SlTimeval_t *)timeout); ;---------------------------------------------------------------------- LDR A1, [SP, #28] ; [DPU_3_PIPE] |209| STR A1, [SP, #0] ; [DPU_3_PIPE] |209| LDR A4, [SP, #24] ; [DPU_3_PIPE] |209| LDR A2, [SP, #8] ; [DPU_3_PIPE] |209| LDR A3, [SP, #12] ; [DPU_3_PIPE] |209| LDRSH A1, [SP, #16] ; [DPU_3_PIPE] |209| $C$DW$188 .dwtag DW_TAG_TI_branch .dwattr $C$DW$188, DW_AT_low_pc(0x00) .dwattr $C$DW$188, DW_AT_name("sl_Select") .dwattr $C$DW$188, DW_AT_TI_call BL sl_Select ; [DPU_3_PIPE] |209| ; CALL OCCURS {sl_Select } ; [] |209| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 210,column 1,is_stmt,isa 1 ADD SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 $C$DW$189 .dwtag DW_TAG_TI_branch .dwattr $C$DW$189, DW_AT_low_pc(0x00) .dwattr $C$DW$189, DW_AT_TI_return POP {PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$177, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$177, DW_AT_TI_end_line(0xd2) .dwattr $C$DW$177, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$177 .sect ".text:SlNetIfWifi_setSockOpt" .clink .thumbfunc SlNetIfWifi_setSockOpt .thumb .global SlNetIfWifi_setSockOpt $C$DW$190 .dwtag DW_TAG_subprogram .dwattr $C$DW$190, DW_AT_name("SlNetIfWifi_setSockOpt") .dwattr $C$DW$190, DW_AT_low_pc(SlNetIfWifi_setSockOpt) .dwattr $C$DW$190, DW_AT_high_pc(0x00) .dwattr $C$DW$190, DW_AT_TI_symbol_name("SlNetIfWifi_setSockOpt") .dwattr $C$DW$190, DW_AT_external .dwattr $C$DW$190, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$190, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$190, DW_AT_TI_begin_line(0xda) .dwattr $C$DW$190, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$190, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$190, DW_AT_decl_line(0xda) .dwattr $C$DW$190, DW_AT_decl_column(0x09) .dwattr $C$DW$190, DW_AT_TI_max_frame_size(0x18) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 219,column 1,is_stmt,address SlNetIfWifi_setSockOpt,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_setSockOpt $C$DW$191 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$191, DW_AT_name("sd") .dwattr $C$DW$191, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$191, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$191, DW_AT_location[DW_OP_reg0] $C$DW$192 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$192, DW_AT_name("sdContext") .dwattr $C$DW$192, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$192, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$192, DW_AT_location[DW_OP_reg1] $C$DW$193 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$193, DW_AT_name("level") .dwattr $C$DW$193, DW_AT_TI_symbol_name("level") .dwattr $C$DW$193, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$193, DW_AT_location[DW_OP_reg2] $C$DW$194 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$194, DW_AT_name("optname") .dwattr $C$DW$194, DW_AT_TI_symbol_name("optname") .dwattr $C$DW$194, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$194, DW_AT_location[DW_OP_reg3] $C$DW$195 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$195, DW_AT_name("optval") .dwattr $C$DW$195, DW_AT_TI_symbol_name("optval") .dwattr $C$DW$195, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$195, DW_AT_location[DW_OP_breg13 24] $C$DW$196 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$196, DW_AT_name("optlen") .dwattr $C$DW$196, DW_AT_TI_symbol_name("optlen") .dwattr $C$DW$196, DW_AT_type(*$C$DW$T$296) .dwattr $C$DW$196, DW_AT_location[DW_OP_breg13 28] ;---------------------------------------------------------------------- ; 218 | int32_t SlNetIfWifi_setSockOpt(int16_t sd, void *sdContext, int16_t lev ; | el, int16_t optname, void *optval, SlNetSocklen_t optlen) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_setSockOpt * ;* * ;* Regs Modified : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Local Frame Size : 4 Args + 12 Auto + 8 Save = 24 byte * ;***************************************************************************** SlNetIfWifi_setSockOpt: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A1, A2, A3, A4, V4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 24 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 7, -8 .dwcfi save_reg_to_mem, 3, -12 .dwcfi save_reg_to_mem, 2, -16 .dwcfi save_reg_to_mem, 1, -20 .dwcfi save_reg_to_mem, 0, -24 ADD V4, SP, #24 ; [DPU_3_PIPE] $C$DW$197 .dwtag DW_TAG_variable .dwattr $C$DW$197, DW_AT_name("sdContext") .dwattr $C$DW$197, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$197, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$197, DW_AT_location[DW_OP_breg13 4] $C$DW$198 .dwtag DW_TAG_variable .dwattr $C$DW$198, DW_AT_name("sd") .dwattr $C$DW$198, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$198, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$198, DW_AT_location[DW_OP_breg13 8] $C$DW$199 .dwtag DW_TAG_variable .dwattr $C$DW$199, DW_AT_name("level") .dwattr $C$DW$199, DW_AT_TI_symbol_name("level") .dwattr $C$DW$199, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$199, DW_AT_location[DW_OP_breg13 10] $C$DW$200 .dwtag DW_TAG_variable .dwattr $C$DW$200, DW_AT_name("optname") .dwattr $C$DW$200, DW_AT_TI_symbol_name("optname") .dwattr $C$DW$200, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$200, DW_AT_location[DW_OP_breg13 12] STRH A4, [SP, #12] ; [DPU_3_PIPE] |219| STRH A3, [SP, #10] ; [DPU_3_PIPE] |219| STR A2, [SP, #4] ; [DPU_3_PIPE] |219| STRH A1, [SP, #8] ; [DPU_3_PIPE] |219| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 220,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 220 | return sl_SetSockOpt(sd, level, optname, optval, optlen); ;---------------------------------------------------------------------- LDRH A1, [V4, #4] ; [DPU_3_PIPE] |220| STR A1, [SP, #0] ; [DPU_3_PIPE] |220| LDR A4, [V4, #0] ; [DPU_3_PIPE] |220| LDRSH A2, [SP, #10] ; [DPU_3_PIPE] |220| LDRSH A3, [SP, #12] ; [DPU_3_PIPE] |220| LDRSH A1, [SP, #8] ; [DPU_3_PIPE] |220| $C$DW$201 .dwtag DW_TAG_TI_branch .dwattr $C$DW$201, DW_AT_low_pc(0x00) .dwattr $C$DW$201, DW_AT_name("sl_SetSockOpt") .dwattr $C$DW$201, DW_AT_TI_call BL sl_SetSockOpt ; [DPU_3_PIPE] |220| ; CALL OCCURS {sl_SetSockOpt } ; [] |220| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 221,column 1,is_stmt,isa 1 STR A1, [SP, #0] ; [DPU_3_PIPE] $C$DW$202 .dwtag DW_TAG_TI_branch .dwattr $C$DW$202, DW_AT_low_pc(0x00) .dwattr $C$DW$202, DW_AT_TI_return POP {A1, A2, A3, A4, V4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 7 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 .dwcfi restore_reg, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$190, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$190, DW_AT_TI_end_line(0xdd) .dwattr $C$DW$190, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$190 .sect ".text:SlNetIfWifi_getSockOpt" .clink .thumbfunc SlNetIfWifi_getSockOpt .thumb .global SlNetIfWifi_getSockOpt $C$DW$203 .dwtag DW_TAG_subprogram .dwattr $C$DW$203, DW_AT_name("SlNetIfWifi_getSockOpt") .dwattr $C$DW$203, DW_AT_low_pc(SlNetIfWifi_getSockOpt) .dwattr $C$DW$203, DW_AT_high_pc(0x00) .dwattr $C$DW$203, DW_AT_TI_symbol_name("SlNetIfWifi_getSockOpt") .dwattr $C$DW$203, DW_AT_external .dwattr $C$DW$203, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$203, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$203, DW_AT_TI_begin_line(0xe5) .dwattr $C$DW$203, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$203, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$203, DW_AT_decl_line(0xe5) .dwattr $C$DW$203, DW_AT_decl_column(0x09) .dwattr $C$DW$203, DW_AT_TI_max_frame_size(0x18) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 230,column 1,is_stmt,address SlNetIfWifi_getSockOpt,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_getSockOpt $C$DW$204 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$204, DW_AT_name("sd") .dwattr $C$DW$204, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$204, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$204, DW_AT_location[DW_OP_reg0] $C$DW$205 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$205, DW_AT_name("sdContext") .dwattr $C$DW$205, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$205, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$205, DW_AT_location[DW_OP_reg1] $C$DW$206 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$206, DW_AT_name("level") .dwattr $C$DW$206, DW_AT_TI_symbol_name("level") .dwattr $C$DW$206, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$206, DW_AT_location[DW_OP_reg2] $C$DW$207 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$207, DW_AT_name("optname") .dwattr $C$DW$207, DW_AT_TI_symbol_name("optname") .dwattr $C$DW$207, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$207, DW_AT_location[DW_OP_reg3] $C$DW$208 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$208, DW_AT_name("optval") .dwattr $C$DW$208, DW_AT_TI_symbol_name("optval") .dwattr $C$DW$208, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$208, DW_AT_location[DW_OP_breg13 24] $C$DW$209 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$209, DW_AT_name("optlen") .dwattr $C$DW$209, DW_AT_TI_symbol_name("optlen") .dwattr $C$DW$209, DW_AT_type(*$C$DW$T$297) .dwattr $C$DW$209, DW_AT_location[DW_OP_breg13 28] ;---------------------------------------------------------------------- ; 229 | int32_t SlNetIfWifi_getSockOpt(int16_t sd, void *sdContext, int16_t lev ; | el, int16_t optname, void *optval, SlNetSocklen_t *optlen) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_getSockOpt * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 4 Args + 12 Auto + 4 Save = 20 byte * ;***************************************************************************** SlNetIfWifi_getSockOpt: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 .dwcfi save_reg_to_mem, 14, -4 SUB SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 24 $C$DW$210 .dwtag DW_TAG_variable .dwattr $C$DW$210, DW_AT_name("sdContext") .dwattr $C$DW$210, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$210, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$210, DW_AT_location[DW_OP_breg13 4] $C$DW$211 .dwtag DW_TAG_variable .dwattr $C$DW$211, DW_AT_name("sd") .dwattr $C$DW$211, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$211, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$211, DW_AT_location[DW_OP_breg13 8] $C$DW$212 .dwtag DW_TAG_variable .dwattr $C$DW$212, DW_AT_name("level") .dwattr $C$DW$212, DW_AT_TI_symbol_name("level") .dwattr $C$DW$212, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$212, DW_AT_location[DW_OP_breg13 10] $C$DW$213 .dwtag DW_TAG_variable .dwattr $C$DW$213, DW_AT_name("optname") .dwattr $C$DW$213, DW_AT_TI_symbol_name("optname") .dwattr $C$DW$213, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$213, DW_AT_location[DW_OP_breg13 12] STRH A4, [SP, #12] ; [DPU_3_PIPE] |230| STRH A3, [SP, #10] ; [DPU_3_PIPE] |230| STR A2, [SP, #4] ; [DPU_3_PIPE] |230| STRH A1, [SP, #8] ; [DPU_3_PIPE] |230| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 231,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 231 | return sl_GetSockOpt(sd, level, optname, optval, optlen); ;---------------------------------------------------------------------- LDR A1, [SP, #28] ; [DPU_3_PIPE] |231| STR A1, [SP, #0] ; [DPU_3_PIPE] |231| LDR A4, [SP, #24] ; [DPU_3_PIPE] |231| LDRSH A2, [SP, #10] ; [DPU_3_PIPE] |231| LDRSH A3, [SP, #12] ; [DPU_3_PIPE] |231| LDRSH A1, [SP, #8] ; [DPU_3_PIPE] |231| $C$DW$214 .dwtag DW_TAG_TI_branch .dwattr $C$DW$214, DW_AT_low_pc(0x00) .dwattr $C$DW$214, DW_AT_name("sl_GetSockOpt") .dwattr $C$DW$214, DW_AT_TI_call BL sl_GetSockOpt ; [DPU_3_PIPE] |231| ; CALL OCCURS {sl_GetSockOpt } ; [] |231| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 232,column 1,is_stmt,isa 1 ADD SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 $C$DW$215 .dwtag DW_TAG_TI_branch .dwattr $C$DW$215, DW_AT_low_pc(0x00) .dwattr $C$DW$215, DW_AT_TI_return POP {PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$203, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$203, DW_AT_TI_end_line(0xe8) .dwattr $C$DW$203, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$203 .sect ".text:SlNetIfWifi_recv" .clink .thumbfunc SlNetIfWifi_recv .thumb .global SlNetIfWifi_recv $C$DW$216 .dwtag DW_TAG_subprogram .dwattr $C$DW$216, DW_AT_name("SlNetIfWifi_recv") .dwattr $C$DW$216, DW_AT_low_pc(SlNetIfWifi_recv) .dwattr $C$DW$216, DW_AT_high_pc(0x00) .dwattr $C$DW$216, DW_AT_TI_symbol_name("SlNetIfWifi_recv") .dwattr $C$DW$216, DW_AT_external .dwattr $C$DW$216, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$216, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$216, DW_AT_TI_begin_line(0xf0) .dwattr $C$DW$216, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$216, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$216, DW_AT_decl_line(0xf0) .dwattr $C$DW$216, DW_AT_decl_column(0x09) .dwattr $C$DW$216, DW_AT_TI_max_frame_size(0x18) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 241,column 1,is_stmt,address SlNetIfWifi_recv,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_recv $C$DW$217 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$217, DW_AT_name("sd") .dwattr $C$DW$217, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$217, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$217, DW_AT_location[DW_OP_reg0] $C$DW$218 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$218, DW_AT_name("sdContext") .dwattr $C$DW$218, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$218, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$218, DW_AT_location[DW_OP_reg1] $C$DW$219 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$219, DW_AT_name("buf") .dwattr $C$DW$219, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$219, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$219, DW_AT_location[DW_OP_reg2] $C$DW$220 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$220, DW_AT_name("len") .dwattr $C$DW$220, DW_AT_TI_symbol_name("len") .dwattr $C$DW$220, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$220, DW_AT_location[DW_OP_reg3] $C$DW$221 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$221, DW_AT_name("flags") .dwattr $C$DW$221, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$221, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$221, DW_AT_location[DW_OP_breg13 24] ;---------------------------------------------------------------------- ; 240 | int32_t SlNetIfWifi_recv(int16_t sd, void *sdContext, void *buf, uint32 ; | _t len, uint32_t flags) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_recv * ;* * ;* Regs Modified : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 16 Auto + 8 Save = 24 byte * ;***************************************************************************** SlNetIfWifi_recv: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A1, A2, A3, A4, V4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 24 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 7, -8 .dwcfi save_reg_to_mem, 3, -12 .dwcfi save_reg_to_mem, 2, -16 .dwcfi save_reg_to_mem, 1, -20 .dwcfi save_reg_to_mem, 0, -24 ADD V4, SP, #24 ; [DPU_3_PIPE] $C$DW$222 .dwtag DW_TAG_variable .dwattr $C$DW$222, DW_AT_name("sdContext") .dwattr $C$DW$222, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$222, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$222, DW_AT_location[DW_OP_breg13 0] $C$DW$223 .dwtag DW_TAG_variable .dwattr $C$DW$223, DW_AT_name("buf") .dwattr $C$DW$223, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$223, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$223, DW_AT_location[DW_OP_breg13 4] $C$DW$224 .dwtag DW_TAG_variable .dwattr $C$DW$224, DW_AT_name("len") .dwattr $C$DW$224, DW_AT_TI_symbol_name("len") .dwattr $C$DW$224, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$224, DW_AT_location[DW_OP_breg13 8] $C$DW$225 .dwtag DW_TAG_variable .dwattr $C$DW$225, DW_AT_name("sd") .dwattr $C$DW$225, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$225, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$225, DW_AT_location[DW_OP_breg13 12] STR A4, [SP, #8] ; [DPU_3_PIPE] |241| STR A3, [SP, #4] ; [DPU_3_PIPE] |241| STR A2, [SP, #0] ; [DPU_3_PIPE] |241| STRH A1, [SP, #12] ; [DPU_3_PIPE] |241| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 242,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 242 | DISABLE_SEC_BITS_FROM_INPUT_FLAGS(flags); ;---------------------------------------------------------------------- LDR A1, [V4, #0] ; [DPU_3_PIPE] |242| BIC A1, A1, #-16777216 ; [DPU_3_PIPE] |242| STR A1, [V4, #0] ; [DPU_3_PIPE] |242| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 243,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 243 | return sl_Recv(sd, buf, len, flags); ;---------------------------------------------------------------------- LDRSH A1, [SP, #12] ; [DPU_3_PIPE] |243| LDRSH A3, [SP, #8] ; [DPU_3_PIPE] |243| LDRSH A4, [V4, #0] ; [DPU_3_PIPE] |243| LDR A2, [SP, #4] ; [DPU_3_PIPE] |243| $C$DW$226 .dwtag DW_TAG_TI_branch .dwattr $C$DW$226, DW_AT_low_pc(0x00) .dwattr $C$DW$226, DW_AT_name("sl_Recv") .dwattr $C$DW$226, DW_AT_TI_call BL sl_Recv ; [DPU_3_PIPE] |243| ; CALL OCCURS {sl_Recv } ; [] |243| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 244,column 1,is_stmt,isa 1 STR A1, [SP, #0] ; [DPU_3_PIPE] $C$DW$227 .dwtag DW_TAG_TI_branch .dwattr $C$DW$227, DW_AT_low_pc(0x00) .dwattr $C$DW$227, DW_AT_TI_return POP {A1, A2, A3, A4, V4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 7 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 .dwcfi restore_reg, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$216, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$216, DW_AT_TI_end_line(0xf4) .dwattr $C$DW$216, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$216 .sect ".text:SlNetIfWifi_recvFrom" .clink .thumbfunc SlNetIfWifi_recvFrom .thumb .global SlNetIfWifi_recvFrom $C$DW$228 .dwtag DW_TAG_subprogram .dwattr $C$DW$228, DW_AT_name("SlNetIfWifi_recvFrom") .dwattr $C$DW$228, DW_AT_low_pc(SlNetIfWifi_recvFrom) .dwattr $C$DW$228, DW_AT_high_pc(0x00) .dwattr $C$DW$228, DW_AT_TI_symbol_name("SlNetIfWifi_recvFrom") .dwattr $C$DW$228, DW_AT_external .dwattr $C$DW$228, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$228, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$228, DW_AT_TI_begin_line(0xfc) .dwattr $C$DW$228, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$228, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$228, DW_AT_decl_line(0xfc) .dwattr $C$DW$228, DW_AT_decl_column(0x09) .dwattr $C$DW$228, DW_AT_TI_max_frame_size(0x20) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 253,column 1,is_stmt,address SlNetIfWifi_recvFrom,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_recvFrom $C$DW$229 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$229, DW_AT_name("sd") .dwattr $C$DW$229, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$229, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$229, DW_AT_location[DW_OP_reg0] $C$DW$230 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$230, DW_AT_name("sdContext") .dwattr $C$DW$230, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$230, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$230, DW_AT_location[DW_OP_reg1] $C$DW$231 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$231, DW_AT_name("buf") .dwattr $C$DW$231, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$231, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$231, DW_AT_location[DW_OP_reg2] $C$DW$232 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$232, DW_AT_name("len") .dwattr $C$DW$232, DW_AT_TI_symbol_name("len") .dwattr $C$DW$232, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$232, DW_AT_location[DW_OP_reg3] $C$DW$233 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$233, DW_AT_name("flags") .dwattr $C$DW$233, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$233, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$233, DW_AT_location[DW_OP_breg13 32] $C$DW$234 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$234, DW_AT_name("from") .dwattr $C$DW$234, DW_AT_TI_symbol_name("from") .dwattr $C$DW$234, DW_AT_type(*$C$DW$T$295) .dwattr $C$DW$234, DW_AT_location[DW_OP_breg13 36] $C$DW$235 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$235, DW_AT_name("fromlen") .dwattr $C$DW$235, DW_AT_TI_symbol_name("fromlen") .dwattr $C$DW$235, DW_AT_type(*$C$DW$T$297) .dwattr $C$DW$235, DW_AT_location[DW_OP_breg13 40] ;---------------------------------------------------------------------- ; 252 | int32_t SlNetIfWifi_recvFrom(int16_t sd, void *sdContext, void *buf, ui ; | nt32_t len, uint32_t flags, SlNetSock_Addr_t *from, SlNetSocklen_t *fro ; | mlen) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_recvFrom * ;* * ;* Regs Modified : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Local Frame Size : 8 Args + 16 Auto + 8 Save = 32 byte * ;***************************************************************************** SlNetIfWifi_recvFrom: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {V4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 7, -8 ADD V4, SP, #8 ; [DPU_3_PIPE] SUB SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 32 $C$DW$236 .dwtag DW_TAG_variable .dwattr $C$DW$236, DW_AT_name("sdContext") .dwattr $C$DW$236, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$236, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$236, DW_AT_location[DW_OP_breg13 8] $C$DW$237 .dwtag DW_TAG_variable .dwattr $C$DW$237, DW_AT_name("buf") .dwattr $C$DW$237, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$237, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$237, DW_AT_location[DW_OP_breg13 12] $C$DW$238 .dwtag DW_TAG_variable .dwattr $C$DW$238, DW_AT_name("len") .dwattr $C$DW$238, DW_AT_TI_symbol_name("len") .dwattr $C$DW$238, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$238, DW_AT_location[DW_OP_breg13 16] $C$DW$239 .dwtag DW_TAG_variable .dwattr $C$DW$239, DW_AT_name("sd") .dwattr $C$DW$239, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$239, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$239, DW_AT_location[DW_OP_breg13 20] STR A4, [SP, #16] ; [DPU_3_PIPE] |253| STR A3, [SP, #12] ; [DPU_3_PIPE] |253| STR A2, [SP, #8] ; [DPU_3_PIPE] |253| STRH A1, [SP, #20] ; [DPU_3_PIPE] |253| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 254,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 254 | DISABLE_SEC_BITS_FROM_INPUT_FLAGS(flags); ;---------------------------------------------------------------------- LDR A1, [V4, #0] ; [DPU_3_PIPE] |254| BIC A1, A1, #-16777216 ; [DPU_3_PIPE] |254| STR A1, [V4, #0] ; [DPU_3_PIPE] |254| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 255,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 255 | return sl_RecvFrom(sd, buf, len, flags, (SlSockAddr_t *)from, fromlen); ;---------------------------------------------------------------------- LDR A1, [V4, #4] ; [DPU_3_PIPE] |255| STR A1, [SP, #0] ; [DPU_3_PIPE] |255| LDR A1, [V4, #8] ; [DPU_3_PIPE] |255| STR A1, [SP, #4] ; [DPU_3_PIPE] |255| LDRSH A3, [SP, #16] ; [DPU_3_PIPE] |255| LDRSH A4, [V4, #0] ; [DPU_3_PIPE] |255| LDR A2, [SP, #12] ; [DPU_3_PIPE] |255| LDRSH A1, [SP, #20] ; [DPU_3_PIPE] |255| $C$DW$240 .dwtag DW_TAG_TI_branch .dwattr $C$DW$240, DW_AT_low_pc(0x00) .dwattr $C$DW$240, DW_AT_name("sl_RecvFrom") .dwattr $C$DW$240, DW_AT_TI_call BL sl_RecvFrom ; [DPU_3_PIPE] |255| ; CALL OCCURS {sl_RecvFrom } ; [] |255| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 256,column 1,is_stmt,isa 1 ADD SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 $C$DW$241 .dwtag DW_TAG_TI_branch .dwattr $C$DW$241, DW_AT_low_pc(0x00) .dwattr $C$DW$241, DW_AT_TI_return POP {V4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 7 ; BRANCH OCCURS ; [] .dwattr $C$DW$228, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$228, DW_AT_TI_end_line(0x100) .dwattr $C$DW$228, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$228 .sect ".text:SlNetIfWifi_send" .clink .thumbfunc SlNetIfWifi_send .thumb .global SlNetIfWifi_send $C$DW$242 .dwtag DW_TAG_subprogram .dwattr $C$DW$242, DW_AT_name("SlNetIfWifi_send") .dwattr $C$DW$242, DW_AT_low_pc(SlNetIfWifi_send) .dwattr $C$DW$242, DW_AT_high_pc(0x00) .dwattr $C$DW$242, DW_AT_TI_symbol_name("SlNetIfWifi_send") .dwattr $C$DW$242, DW_AT_external .dwattr $C$DW$242, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$242, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$242, DW_AT_TI_begin_line(0x108) .dwattr $C$DW$242, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$242, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$242, DW_AT_decl_line(0x108) .dwattr $C$DW$242, DW_AT_decl_column(0x09) .dwattr $C$DW$242, DW_AT_TI_max_frame_size(0x18) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 265,column 1,is_stmt,address SlNetIfWifi_send,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_send $C$DW$243 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$243, DW_AT_name("sd") .dwattr $C$DW$243, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$243, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$243, DW_AT_location[DW_OP_reg0] $C$DW$244 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$244, DW_AT_name("sdContext") .dwattr $C$DW$244, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$244, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$244, DW_AT_location[DW_OP_reg1] $C$DW$245 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$245, DW_AT_name("buf") .dwattr $C$DW$245, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$245, DW_AT_type(*$C$DW$T$323) .dwattr $C$DW$245, DW_AT_location[DW_OP_reg2] $C$DW$246 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$246, DW_AT_name("len") .dwattr $C$DW$246, DW_AT_TI_symbol_name("len") .dwattr $C$DW$246, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$246, DW_AT_location[DW_OP_reg3] $C$DW$247 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$247, DW_AT_name("flags") .dwattr $C$DW$247, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$247, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$247, DW_AT_location[DW_OP_breg13 24] ;---------------------------------------------------------------------- ; 264 | int32_t SlNetIfWifi_send(int16_t sd, void *sdContext, const void *buf, ; | uint32_t len, uint32_t flags) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_send * ;* * ;* Regs Modified : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 16 Auto + 8 Save = 24 byte * ;***************************************************************************** SlNetIfWifi_send: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {A1, A2, A3, A4, V4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 24 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 7, -8 .dwcfi save_reg_to_mem, 3, -12 .dwcfi save_reg_to_mem, 2, -16 .dwcfi save_reg_to_mem, 1, -20 .dwcfi save_reg_to_mem, 0, -24 ADD V4, SP, #24 ; [DPU_3_PIPE] $C$DW$248 .dwtag DW_TAG_variable .dwattr $C$DW$248, DW_AT_name("sdContext") .dwattr $C$DW$248, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$248, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$248, DW_AT_location[DW_OP_breg13 0] $C$DW$249 .dwtag DW_TAG_variable .dwattr $C$DW$249, DW_AT_name("buf") .dwattr $C$DW$249, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$249, DW_AT_type(*$C$DW$T$323) .dwattr $C$DW$249, DW_AT_location[DW_OP_breg13 4] $C$DW$250 .dwtag DW_TAG_variable .dwattr $C$DW$250, DW_AT_name("len") .dwattr $C$DW$250, DW_AT_TI_symbol_name("len") .dwattr $C$DW$250, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$250, DW_AT_location[DW_OP_breg13 8] $C$DW$251 .dwtag DW_TAG_variable .dwattr $C$DW$251, DW_AT_name("sd") .dwattr $C$DW$251, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$251, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$251, DW_AT_location[DW_OP_breg13 12] STR A4, [SP, #8] ; [DPU_3_PIPE] |265| STR A3, [SP, #4] ; [DPU_3_PIPE] |265| STR A2, [SP, #0] ; [DPU_3_PIPE] |265| STRH A1, [SP, #12] ; [DPU_3_PIPE] |265| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 266,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 266 | DISABLE_SEC_BITS_FROM_INPUT_FLAGS(flags); ;---------------------------------------------------------------------- LDR A1, [V4, #0] ; [DPU_3_PIPE] |266| BIC A1, A1, #-16777216 ; [DPU_3_PIPE] |266| STR A1, [V4, #0] ; [DPU_3_PIPE] |266| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 267,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 267 | return sl_Send(sd, buf, len, flags); ;---------------------------------------------------------------------- LDRSH A1, [SP, #12] ; [DPU_3_PIPE] |267| LDRSH A3, [SP, #8] ; [DPU_3_PIPE] |267| LDRSH A4, [V4, #0] ; [DPU_3_PIPE] |267| LDR A2, [SP, #4] ; [DPU_3_PIPE] |267| $C$DW$252 .dwtag DW_TAG_TI_branch .dwattr $C$DW$252, DW_AT_low_pc(0x00) .dwattr $C$DW$252, DW_AT_name("sl_Send") .dwattr $C$DW$252, DW_AT_TI_call BL sl_Send ; [DPU_3_PIPE] |267| ; CALL OCCURS {sl_Send } ; [] |267| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 268,column 1,is_stmt,isa 1 STR A1, [SP, #0] ; [DPU_3_PIPE] $C$DW$253 .dwtag DW_TAG_TI_branch .dwattr $C$DW$253, DW_AT_low_pc(0x00) .dwattr $C$DW$253, DW_AT_TI_return POP {A1, A2, A3, A4, V4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 7 .dwcfi restore_reg, 3 .dwcfi restore_reg, 2 .dwcfi restore_reg, 1 .dwcfi restore_reg, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$242, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$242, DW_AT_TI_end_line(0x10c) .dwattr $C$DW$242, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$242 .sect ".text:SlNetIfWifi_sendTo" .clink .thumbfunc SlNetIfWifi_sendTo .thumb .global SlNetIfWifi_sendTo $C$DW$254 .dwtag DW_TAG_subprogram .dwattr $C$DW$254, DW_AT_name("SlNetIfWifi_sendTo") .dwattr $C$DW$254, DW_AT_low_pc(SlNetIfWifi_sendTo) .dwattr $C$DW$254, DW_AT_high_pc(0x00) .dwattr $C$DW$254, DW_AT_TI_symbol_name("SlNetIfWifi_sendTo") .dwattr $C$DW$254, DW_AT_external .dwattr $C$DW$254, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$254, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$254, DW_AT_TI_begin_line(0x114) .dwattr $C$DW$254, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$254, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$254, DW_AT_decl_line(0x114) .dwattr $C$DW$254, DW_AT_decl_column(0x09) .dwattr $C$DW$254, DW_AT_TI_max_frame_size(0x20) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 277,column 1,is_stmt,address SlNetIfWifi_sendTo,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_sendTo $C$DW$255 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$255, DW_AT_name("sd") .dwattr $C$DW$255, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$255, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$255, DW_AT_location[DW_OP_reg0] $C$DW$256 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$256, DW_AT_name("sdContext") .dwattr $C$DW$256, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$256, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$256, DW_AT_location[DW_OP_reg1] $C$DW$257 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$257, DW_AT_name("buf") .dwattr $C$DW$257, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$257, DW_AT_type(*$C$DW$T$323) .dwattr $C$DW$257, DW_AT_location[DW_OP_reg2] $C$DW$258 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$258, DW_AT_name("len") .dwattr $C$DW$258, DW_AT_TI_symbol_name("len") .dwattr $C$DW$258, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$258, DW_AT_location[DW_OP_reg3] $C$DW$259 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$259, DW_AT_name("flags") .dwattr $C$DW$259, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$259, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$259, DW_AT_location[DW_OP_breg13 32] $C$DW$260 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$260, DW_AT_name("to") .dwattr $C$DW$260, DW_AT_TI_symbol_name("to") .dwattr $C$DW$260, DW_AT_type(*$C$DW$T$301) .dwattr $C$DW$260, DW_AT_location[DW_OP_breg13 36] $C$DW$261 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$261, DW_AT_name("tolen") .dwattr $C$DW$261, DW_AT_TI_symbol_name("tolen") .dwattr $C$DW$261, DW_AT_type(*$C$DW$T$296) .dwattr $C$DW$261, DW_AT_location[DW_OP_breg13 40] ;---------------------------------------------------------------------- ; 276 | int32_t SlNetIfWifi_sendTo(int16_t sd, void *sdContext, const void *buf ; | , uint32_t len, uint32_t flags, const SlNetSock_Addr_t *to, SlNetSockle ; | n_t tolen) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_sendTo * ;* * ;* Regs Modified : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Local Frame Size : 8 Args + 16 Auto + 8 Save = 32 byte * ;***************************************************************************** SlNetIfWifi_sendTo: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {V4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 7, -8 ADD V4, SP, #8 ; [DPU_3_PIPE] SUB SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 32 $C$DW$262 .dwtag DW_TAG_variable .dwattr $C$DW$262, DW_AT_name("sdContext") .dwattr $C$DW$262, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$262, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$262, DW_AT_location[DW_OP_breg13 8] $C$DW$263 .dwtag DW_TAG_variable .dwattr $C$DW$263, DW_AT_name("buf") .dwattr $C$DW$263, DW_AT_TI_symbol_name("buf") .dwattr $C$DW$263, DW_AT_type(*$C$DW$T$323) .dwattr $C$DW$263, DW_AT_location[DW_OP_breg13 12] $C$DW$264 .dwtag DW_TAG_variable .dwattr $C$DW$264, DW_AT_name("len") .dwattr $C$DW$264, DW_AT_TI_symbol_name("len") .dwattr $C$DW$264, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$264, DW_AT_location[DW_OP_breg13 16] $C$DW$265 .dwtag DW_TAG_variable .dwattr $C$DW$265, DW_AT_name("sd") .dwattr $C$DW$265, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$265, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$265, DW_AT_location[DW_OP_breg13 20] STR A4, [SP, #16] ; [DPU_3_PIPE] |277| STR A3, [SP, #12] ; [DPU_3_PIPE] |277| STR A2, [SP, #8] ; [DPU_3_PIPE] |277| STRH A1, [SP, #20] ; [DPU_3_PIPE] |277| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 278,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 278 | DISABLE_SEC_BITS_FROM_INPUT_FLAGS(flags); ;---------------------------------------------------------------------- LDR A1, [V4, #0] ; [DPU_3_PIPE] |278| BIC A1, A1, #-16777216 ; [DPU_3_PIPE] |278| STR A1, [V4, #0] ; [DPU_3_PIPE] |278| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 279,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 279 | return sl_SendTo(sd, buf, len, flags, (const SlSockAddr_t *)to, tolen); ;---------------------------------------------------------------------- LDR A1, [V4, #4] ; [DPU_3_PIPE] |279| STR A1, [SP, #0] ; [DPU_3_PIPE] |279| LDRH A1, [V4, #8] ; [DPU_3_PIPE] |279| STR A1, [SP, #4] ; [DPU_3_PIPE] |279| LDRSH A3, [SP, #16] ; [DPU_3_PIPE] |279| LDRSH A4, [V4, #0] ; [DPU_3_PIPE] |279| LDR A2, [SP, #12] ; [DPU_3_PIPE] |279| LDRSH A1, [SP, #20] ; [DPU_3_PIPE] |279| $C$DW$266 .dwtag DW_TAG_TI_branch .dwattr $C$DW$266, DW_AT_low_pc(0x00) .dwattr $C$DW$266, DW_AT_name("sl_SendTo") .dwattr $C$DW$266, DW_AT_TI_call BL sl_SendTo ; [DPU_3_PIPE] |279| ; CALL OCCURS {sl_SendTo } ; [] |279| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 280,column 1,is_stmt,isa 1 ADD SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 $C$DW$267 .dwtag DW_TAG_TI_branch .dwattr $C$DW$267, DW_AT_low_pc(0x00) .dwattr $C$DW$267, DW_AT_TI_return POP {V4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 7 ; BRANCH OCCURS ; [] .dwattr $C$DW$254, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$254, DW_AT_TI_end_line(0x118) .dwattr $C$DW$254, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$254 .sect ".text:SlNetIfWifi_sockstartSec" .clink .thumbfunc SlNetIfWifi_sockstartSec .thumb .global SlNetIfWifi_sockstartSec $C$DW$268 .dwtag DW_TAG_subprogram .dwattr $C$DW$268, DW_AT_name("SlNetIfWifi_sockstartSec") .dwattr $C$DW$268, DW_AT_low_pc(SlNetIfWifi_sockstartSec) .dwattr $C$DW$268, DW_AT_high_pc(0x00) .dwattr $C$DW$268, DW_AT_TI_symbol_name("SlNetIfWifi_sockstartSec") .dwattr $C$DW$268, DW_AT_external .dwattr $C$DW$268, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$268, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$268, DW_AT_TI_begin_line(0x120) .dwattr $C$DW$268, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$268, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$268, DW_AT_decl_line(0x120) .dwattr $C$DW$268, DW_AT_decl_column(0x09) .dwattr $C$DW$268, DW_AT_TI_max_frame_size(0x20) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 289,column 1,is_stmt,address SlNetIfWifi_sockstartSec,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_sockstartSec $C$DW$269 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$269, DW_AT_name("sd") .dwattr $C$DW$269, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$269, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$269, DW_AT_location[DW_OP_reg0] $C$DW$270 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$270, DW_AT_name("sdContext") .dwattr $C$DW$270, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$270, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$270, DW_AT_location[DW_OP_reg1] $C$DW$271 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$271, DW_AT_name("secAttrib") .dwattr $C$DW$271, DW_AT_TI_symbol_name("secAttrib") .dwattr $C$DW$271, DW_AT_type(*$C$DW$T$331) .dwattr $C$DW$271, DW_AT_location[DW_OP_reg2] $C$DW$272 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$272, DW_AT_name("flags") .dwattr $C$DW$272, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$272, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$272, DW_AT_location[DW_OP_reg3] ;---------------------------------------------------------------------- ; 288 | int32_t SlNetIfWifi_sockstartSec(int16_t sd, void *sdContext, SlNetSock ; | SecAttrib_t *secAttrib, uint8_t flags) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_sockstartSec * ;* * ;* Regs Modified : A1,A2,A3,A4,V1,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V1,V9,SP,LR,SR * ;* Local Frame Size : 4 Args + 20 Auto + 8 Save = 32 byte * ;***************************************************************************** SlNetIfWifi_sockstartSec: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {V1, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 4, -8 SUB SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 32 $C$DW$273 .dwtag DW_TAG_variable .dwattr $C$DW$273, DW_AT_name("sdContext") .dwattr $C$DW$273, DW_AT_TI_symbol_name("sdContext") .dwattr $C$DW$273, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$273, DW_AT_location[DW_OP_breg13 4] $C$DW$274 .dwtag DW_TAG_variable .dwattr $C$DW$274, DW_AT_name("secAttrib") .dwattr $C$DW$274, DW_AT_TI_symbol_name("secAttrib") .dwattr $C$DW$274, DW_AT_type(*$C$DW$T$331) .dwattr $C$DW$274, DW_AT_location[DW_OP_breg13 8] $C$DW$275 .dwtag DW_TAG_variable .dwattr $C$DW$275, DW_AT_name("tempSecAttrib") .dwattr $C$DW$275, DW_AT_TI_symbol_name("tempSecAttrib") .dwattr $C$DW$275, DW_AT_type(*$C$DW$T$329) .dwattr $C$DW$275, DW_AT_location[DW_OP_breg13 12] $C$DW$276 .dwtag DW_TAG_variable .dwattr $C$DW$276, DW_AT_name("retVal") .dwattr $C$DW$276, DW_AT_TI_symbol_name("retVal") .dwattr $C$DW$276, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$276, DW_AT_location[DW_OP_breg13 16] $C$DW$277 .dwtag DW_TAG_variable .dwattr $C$DW$277, DW_AT_name("sd") .dwattr $C$DW$277, DW_AT_TI_symbol_name("sd") .dwattr $C$DW$277, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$277, DW_AT_location[DW_OP_breg13 20] $C$DW$278 .dwtag DW_TAG_variable .dwattr $C$DW$278, DW_AT_name("flags") .dwattr $C$DW$278, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$278, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$278, DW_AT_location[DW_OP_breg13 22] STRB A4, [SP, #22] ; [DPU_3_PIPE] |289| STR A3, [SP, #8] ; [DPU_3_PIPE] |289| STR A2, [SP, #4] ; [DPU_3_PIPE] |289| STRH A1, [SP, #20] ; [DPU_3_PIPE] |289| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 290,column 46,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 290 | SlNetSock_SecAttribNode_t *tempSecAttrib = *secAttrib; ;---------------------------------------------------------------------- LDR A1, [SP, #8] ; [DPU_3_PIPE] |290| LDR A1, [A1, #0] ; [DPU_3_PIPE] |290| STR A1, [SP, #12] ; [DPU_3_PIPE] |290| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 291,column 46,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 291 | int32_t retVal = SLNETERR_RET_CODE_OK; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |291| STR A1, [SP, #16] ; [DPU_3_PIPE] |291| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 293,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 293 | if ( 0 != (flags & SLNETSOCK_SEC_BIND_CONTEXT_ONLY) ) ;---------------------------------------------------------------------- LDRB A1, [SP, #22] ; [DPU_3_PIPE] |293| LSRS A1, A1, #2 ; [DPU_3_PIPE] |293| BCC ||$C$L4|| ; [DPU_3_PIPE] |293| ; BRANCHCC OCCURS {||$C$L4||} ; [] |293| ;* --------------------------------------------------------------------------* .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 296,column 16,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 296 | while (NULL != tempSecAttrib) ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |296| CBZ A1, ||$C$L4|| ; [] ; BRANCHCC OCCURS {||$C$L4||} ; [] |296| ;* --------------------------------------------------------------------------* ;* BEGIN LOOP ||$C$L1|| ;* ;* Loop source line : 296 ;* Loop closing brace source line : 307 ;* Known Minimum Trip Count : 1 ;* Known Maximum Trip Count : 4294967295 ;* Known Max Trip Count Factor : 1 ;* --------------------------------------------------------------------------* ||$C$L1||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 298,column 13,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 298 | if ( tempSecAttrib->attribName <= SLNETSOCK_SEC_ATTRIB_DISABLE_CERT_STO ; | RE) ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |298| LDRB A1, [A1, #0] ; [DPU_3_PIPE] |298| CMP A1, #9 ; [DPU_3_PIPE] |298| BGT ||$C$L2|| ; [DPU_3_PIPE] |298| ; BRANCHCC OCCURS {||$C$L2||} ; [] |298| ;* --------------------------------------------------------------------------* .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 300,column 17,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 300 | retVal = sl_SetSockOpt(sd, SL_SOL_SOCKET, StartSecOptName[tempSecAttrib ; | ->attribName], tempSecAttrib->attribBuff, tempSecAttrib->attribBuffLen) ; | ; ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |300| LDRH A1, [A1, #8] ; [DPU_3_PIPE] |300| STR A1, [SP, #0] ; [DPU_3_PIPE] |300| LDR A2, [SP, #12] ; [DPU_3_PIPE] |300| LDR A1, [SP, #12] ; [DPU_3_PIPE] |300| LDR V1, $C$CON3 ; [DPU_3_PIPE] |300| LDRB A3, [A1, #0] ; [DPU_3_PIPE] |300| LDR A4, [A2, #4] ; [DPU_3_PIPE] |300| LDRSH A1, [SP, #20] ; [DPU_3_PIPE] |300| LDRSH A3, [V1, +A3, LSL #1] ; [DPU_3_PIPE] |300| MOVS A2, #1 ; [DPU_3_PIPE] |300| $C$DW$279 .dwtag DW_TAG_TI_branch .dwattr $C$DW$279, DW_AT_low_pc(0x00) .dwattr $C$DW$279, DW_AT_name("sl_SetSockOpt") .dwattr $C$DW$279, DW_AT_TI_call BL sl_SetSockOpt ; [DPU_3_PIPE] |300| ; CALL OCCURS {sl_SetSockOpt } ; [] |300| STR A1, [SP, #16] ; [DPU_3_PIPE] |300| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 301,column 13,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 302 | else ;---------------------------------------------------------------------- B ||$C$L3|| ; [DPU_3_PIPE] |301| ; BRANCH OCCURS {||$C$L3||} ; [] |301| ;* --------------------------------------------------------------------------* ||$C$L2||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 304,column 17,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 304 | return SLNETERR_RET_CODE_INVALID_INPUT; ;---------------------------------------------------------------------- LDR A1, $C$CON4 ; [DPU_3_PIPE] |304| B ||$C$L6|| ; [DPU_3_PIPE] |304| ; BRANCH OCCURS {||$C$L6||} ; [] |304| ;* --------------------------------------------------------------------------* ||$C$L3||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 306,column 13,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 306 | tempSecAttrib = tempSecAttrib->next; ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |306| LDR A1, [A1, #12] ; [DPU_3_PIPE] |306| STR A1, [SP, #12] ; [DPU_3_PIPE] |306| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 296,column 16,is_stmt,isa 1 LDR A1, [SP, #12] ; [DPU_3_PIPE] |296| CMP A1, #0 ; [DPU_3_PIPE] |296| BNE ||$C$L1|| ; [DPU_3_PIPE] |296| ; BRANCHCC OCCURS {||$C$L1||} ; [] |296| ;* --------------------------------------------------------------------------* ||$C$L4||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 310,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 310 | if ( 0 != (flags & SLNETSOCK_SEC_START_SECURITY_SESSION_ONLY) ) ;---------------------------------------------------------------------- LDRB A1, [SP, #22] ; [DPU_3_PIPE] |310| LSRS A1, A1, #1 ; [DPU_3_PIPE] |310| BCC ||$C$L5|| ; [DPU_3_PIPE] |310| ; BRANCHCC OCCURS {||$C$L5||} ; [] |310| ;* --------------------------------------------------------------------------* .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 313,column 9,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 313 | retVal = sl_StartTLS(sd); ;---------------------------------------------------------------------- LDRSH A1, [SP, #20] ; [DPU_3_PIPE] |313| $C$DW$280 .dwtag DW_TAG_TI_branch .dwattr $C$DW$280, DW_AT_low_pc(0x00) .dwattr $C$DW$280, DW_AT_name("sl_StartTLS") .dwattr $C$DW$280, DW_AT_TI_call BL sl_StartTLS ; [DPU_3_PIPE] |313| ; CALL OCCURS {sl_StartTLS } ; [] |313| STR A1, [SP, #16] ; [DPU_3_PIPE] |313| ;* --------------------------------------------------------------------------* ||$C$L5||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 316,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 316 | return retVal; ;---------------------------------------------------------------------- LDR A1, [SP, #16] ; [DPU_3_PIPE] |316| ;* --------------------------------------------------------------------------* ||$C$L6||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 317,column 1,is_stmt,isa 1 ADD SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 $C$DW$281 .dwtag DW_TAG_TI_branch .dwattr $C$DW$281, DW_AT_low_pc(0x00) .dwattr $C$DW$281, DW_AT_TI_return POP {V1, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 4 ; BRANCH OCCURS ; [] .dwattr $C$DW$268, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$268, DW_AT_TI_end_line(0x13d) .dwattr $C$DW$268, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$268 .sect ".text:SlNetIfWifi_getHostByName" .clink .thumbfunc SlNetIfWifi_getHostByName .thumb .global SlNetIfWifi_getHostByName $C$DW$282 .dwtag DW_TAG_subprogram .dwattr $C$DW$282, DW_AT_name("SlNetIfWifi_getHostByName") .dwattr $C$DW$282, DW_AT_low_pc(SlNetIfWifi_getHostByName) .dwattr $C$DW$282, DW_AT_high_pc(0x00) .dwattr $C$DW$282, DW_AT_TI_symbol_name("SlNetIfWifi_getHostByName") .dwattr $C$DW$282, DW_AT_external .dwattr $C$DW$282, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$282, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$282, DW_AT_TI_begin_line(0x146) .dwattr $C$DW$282, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$282, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$282, DW_AT_decl_line(0x146) .dwattr $C$DW$282, DW_AT_decl_column(0x09) .dwattr $C$DW$282, DW_AT_TI_max_frame_size(0x20) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 327,column 1,is_stmt,address SlNetIfWifi_getHostByName,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_getHostByName $C$DW$283 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$283, DW_AT_name("ifContext") .dwattr $C$DW$283, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$283, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$283, DW_AT_location[DW_OP_reg0] $C$DW$284 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$284, DW_AT_name("name") .dwattr $C$DW$284, DW_AT_TI_symbol_name("name") .dwattr $C$DW$284, DW_AT_type(*$C$DW$T$334) .dwattr $C$DW$284, DW_AT_location[DW_OP_reg1] $C$DW$285 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$285, DW_AT_name("nameLen") .dwattr $C$DW$285, DW_AT_TI_symbol_name("nameLen") .dwattr $C$DW$285, DW_AT_type(*$C$DW$T$335) .dwattr $C$DW$285, DW_AT_location[DW_OP_reg2] $C$DW$286 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$286, DW_AT_name("ipAddr") .dwattr $C$DW$286, DW_AT_TI_symbol_name("ipAddr") .dwattr $C$DW$286, DW_AT_type(*$C$DW$T$336) .dwattr $C$DW$286, DW_AT_location[DW_OP_reg3] $C$DW$287 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$287, DW_AT_name("ipAddrLen") .dwattr $C$DW$287, DW_AT_TI_symbol_name("ipAddrLen") .dwattr $C$DW$287, DW_AT_type(*$C$DW$T$337) .dwattr $C$DW$287, DW_AT_location[DW_OP_breg13 32] $C$DW$288 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$288, DW_AT_name("family") .dwattr $C$DW$288, DW_AT_TI_symbol_name("family") .dwattr $C$DW$288, DW_AT_type(*$C$DW$T$338) .dwattr $C$DW$288, DW_AT_location[DW_OP_breg13 36] ;---------------------------------------------------------------------- ; 326 | int32_t SlNetIfWifi_getHostByName(void *ifContext, char *name, const ui ; | nt16_t nameLen, uint32_t *ipAddr, uint16_t *ipAddrLen, const uint8_t fa ; | mily) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_getHostByName * ;* * ;* Regs Modified : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 20 Auto + 8 Save = 28 byte * ;***************************************************************************** SlNetIfWifi_getHostByName: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {V4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 7, -8 ADD V4, SP, #8 ; [DPU_3_PIPE] SUB SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 32 $C$DW$289 .dwtag DW_TAG_variable .dwattr $C$DW$289, DW_AT_name("ifContext") .dwattr $C$DW$289, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$289, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$289, DW_AT_location[DW_OP_breg13 0] $C$DW$290 .dwtag DW_TAG_variable .dwattr $C$DW$290, DW_AT_name("name") .dwattr $C$DW$290, DW_AT_TI_symbol_name("name") .dwattr $C$DW$290, DW_AT_type(*$C$DW$T$334) .dwattr $C$DW$290, DW_AT_location[DW_OP_breg13 4] $C$DW$291 .dwtag DW_TAG_variable .dwattr $C$DW$291, DW_AT_name("ipAddr") .dwattr $C$DW$291, DW_AT_TI_symbol_name("ipAddr") .dwattr $C$DW$291, DW_AT_type(*$C$DW$T$336) .dwattr $C$DW$291, DW_AT_location[DW_OP_breg13 8] $C$DW$292 .dwtag DW_TAG_variable .dwattr $C$DW$292, DW_AT_name("retVal") .dwattr $C$DW$292, DW_AT_TI_symbol_name("retVal") .dwattr $C$DW$292, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$292, DW_AT_location[DW_OP_breg13 12] $C$DW$293 .dwtag DW_TAG_variable .dwattr $C$DW$293, DW_AT_name("nameLen") .dwattr $C$DW$293, DW_AT_TI_symbol_name("nameLen") .dwattr $C$DW$293, DW_AT_type(*$C$DW$T$335) .dwattr $C$DW$293, DW_AT_location[DW_OP_breg13 16] STR A4, [SP, #8] ; [DPU_3_PIPE] |327| STRH A3, [SP, #16] ; [DPU_3_PIPE] |327| STR A2, [SP, #4] ; [DPU_3_PIPE] |327| STR A1, [SP, #0] ; [DPU_3_PIPE] |327| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 328,column 21,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 328 | int32_t retVal = SLNETERR_RET_CODE_OK; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |328| STR A1, [SP, #12] ; [DPU_3_PIPE] |328| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 333,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 333 | retVal = sl_NetAppDnsGetHostByName((signed char *)name, nameLen, (_u32 ; | *)ipAddr, family); ;---------------------------------------------------------------------- LDRB A4, [V4, #4] ; [DPU_3_PIPE] |333| LDRH A2, [SP, #16] ; [DPU_3_PIPE] |333| LDR A3, [SP, #8] ; [DPU_3_PIPE] |333| LDR A1, [SP, #4] ; [DPU_3_PIPE] |333| $C$DW$294 .dwtag DW_TAG_TI_branch .dwattr $C$DW$294, DW_AT_low_pc(0x00) .dwattr $C$DW$294, DW_AT_name("sl_NetAppDnsGetHostByName") .dwattr $C$DW$294, DW_AT_TI_call BL sl_NetAppDnsGetHostByName ; [DPU_3_PIPE] |333| ; CALL OCCURS {sl_NetAppDnsGetHostByName } ; [] |333| STR A1, [SP, #12] ; [DPU_3_PIPE] |333| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 335,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 335 | if (retVal == SLNETERR_RET_CODE_OK) ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |335| CBNZ A1, ||$C$L7|| ; [] ; BRANCHCC OCCURS {||$C$L7||} ; [] |335| ;* --------------------------------------------------------------------------* .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 337,column 9,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 337 | *ipAddrLen = 1; ;---------------------------------------------------------------------- LDR A1, [V4, #0] ; [DPU_3_PIPE] |337| MOVS A2, #1 ; [DPU_3_PIPE] |337| STRH A2, [A1, #0] ; [DPU_3_PIPE] |337| ;* --------------------------------------------------------------------------* ||$C$L7||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 340,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 340 | return retVal; ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |340| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 343,column 1,is_stmt,isa 1 ADD SP, SP, #24 ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 $C$DW$295 .dwtag DW_TAG_TI_branch .dwattr $C$DW$295, DW_AT_low_pc(0x00) .dwattr $C$DW$295, DW_AT_TI_return POP {V4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 7 ; BRANCH OCCURS ; [] .dwattr $C$DW$282, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$282, DW_AT_TI_end_line(0x157) .dwattr $C$DW$282, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$282 .sect ".text:SlNetIfWifi_getIPAddr" .clink .thumbfunc SlNetIfWifi_getIPAddr .thumb .global SlNetIfWifi_getIPAddr $C$DW$296 .dwtag DW_TAG_subprogram .dwattr $C$DW$296, DW_AT_name("SlNetIfWifi_getIPAddr") .dwattr $C$DW$296, DW_AT_low_pc(SlNetIfWifi_getIPAddr) .dwattr $C$DW$296, DW_AT_high_pc(0x00) .dwattr $C$DW$296, DW_AT_TI_symbol_name("SlNetIfWifi_getIPAddr") .dwattr $C$DW$296, DW_AT_external .dwattr $C$DW$296, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$296, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$296, DW_AT_TI_begin_line(0x15f) .dwattr $C$DW$296, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$296, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$296, DW_AT_decl_line(0x15f) .dwattr $C$DW$296, DW_AT_decl_column(0x09) .dwattr $C$DW$296, DW_AT_TI_max_frame_size(0x18) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 352,column 1,is_stmt,address SlNetIfWifi_getIPAddr,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_getIPAddr $C$DW$297 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$297, DW_AT_name("ifContext") .dwattr $C$DW$297, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$297, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$297, DW_AT_location[DW_OP_reg0] $C$DW$298 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$298, DW_AT_name("addrType") .dwattr $C$DW$298, DW_AT_TI_symbol_name("addrType") .dwattr $C$DW$298, DW_AT_type(*$C$DW$T$342) .dwattr $C$DW$298, DW_AT_location[DW_OP_reg1] $C$DW$299 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$299, DW_AT_name("addrConfig") .dwattr $C$DW$299, DW_AT_TI_symbol_name("addrConfig") .dwattr $C$DW$299, DW_AT_type(*$C$DW$T$337) .dwattr $C$DW$299, DW_AT_location[DW_OP_reg2] $C$DW$300 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$300, DW_AT_name("ipAddr") .dwattr $C$DW$300, DW_AT_TI_symbol_name("ipAddr") .dwattr $C$DW$300, DW_AT_type(*$C$DW$T$336) .dwattr $C$DW$300, DW_AT_location[DW_OP_reg3] ;---------------------------------------------------------------------- ; 351 | int32_t SlNetIfWifi_getIPAddr(void *ifContext, SlNetIfAddressType_e add ; | rType, uint16_t *addrConfig, uint32_t *ipAddr) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_getIPAddr * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 16 Auto + 4 Save = 20 byte * ;***************************************************************************** SlNetIfWifi_getIPAddr: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 .dwcfi save_reg_to_mem, 14, -4 SUB SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 24 $C$DW$301 .dwtag DW_TAG_variable .dwattr $C$DW$301, DW_AT_name("ifContext") .dwattr $C$DW$301, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$301, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$301, DW_AT_location[DW_OP_breg13 0] $C$DW$302 .dwtag DW_TAG_variable .dwattr $C$DW$302, DW_AT_name("addrConfig") .dwattr $C$DW$302, DW_AT_TI_symbol_name("addrConfig") .dwattr $C$DW$302, DW_AT_type(*$C$DW$T$337) .dwattr $C$DW$302, DW_AT_location[DW_OP_breg13 4] $C$DW$303 .dwtag DW_TAG_variable .dwattr $C$DW$303, DW_AT_name("ipAddr") .dwattr $C$DW$303, DW_AT_TI_symbol_name("ipAddr") .dwattr $C$DW$303, DW_AT_type(*$C$DW$T$336) .dwattr $C$DW$303, DW_AT_location[DW_OP_breg13 8] $C$DW$304 .dwtag DW_TAG_variable .dwattr $C$DW$304, DW_AT_name("ipAddrLen") .dwattr $C$DW$304, DW_AT_TI_symbol_name("ipAddrLen") .dwattr $C$DW$304, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$304, DW_AT_location[DW_OP_breg13 12] $C$DW$305 .dwtag DW_TAG_variable .dwattr $C$DW$305, DW_AT_name("addrType") .dwattr $C$DW$305, DW_AT_TI_symbol_name("addrType") .dwattr $C$DW$305, DW_AT_type(*$C$DW$T$342) .dwattr $C$DW$305, DW_AT_location[DW_OP_breg13 14] STR A4, [SP, #8] ; [DPU_3_PIPE] |352| STR A3, [SP, #4] ; [DPU_3_PIPE] |352| STRB A2, [SP, #14] ; [DPU_3_PIPE] |352| STR A1, [SP, #0] ; [DPU_3_PIPE] |352| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 353,column 24,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 353 | uint16_t ipAddrLen = sizeof(ipAddr); ;---------------------------------------------------------------------- MOVS A1, #4 ; [DPU_3_PIPE] |353| STRH A1, [SP, #12] ; [DPU_3_PIPE] |353| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 354,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 354 | return sl_NetCfgGet(addrType, addrConfig, &ipAddrLen, (unsigned char *) ; | ipAddr); ;---------------------------------------------------------------------- LDR A2, [SP, #4] ; [DPU_3_PIPE] |354| LDR A4, [SP, #8] ; [DPU_3_PIPE] |354| LDRB A1, [SP, #14] ; [DPU_3_PIPE] |354| ADD A3, SP, #12 ; [DPU_3_PIPE] |354| $C$DW$306 .dwtag DW_TAG_TI_branch .dwattr $C$DW$306, DW_AT_low_pc(0x00) .dwattr $C$DW$306, DW_AT_name("sl_NetCfgGet") .dwattr $C$DW$306, DW_AT_TI_call BL sl_NetCfgGet ; [DPU_3_PIPE] |354| ; CALL OCCURS {sl_NetCfgGet } ; [] |354| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 355,column 1,is_stmt,isa 1 ADD SP, SP, #20 ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 $C$DW$307 .dwtag DW_TAG_TI_branch .dwattr $C$DW$307, DW_AT_low_pc(0x00) .dwattr $C$DW$307, DW_AT_TI_return POP {PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$296, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$296, DW_AT_TI_end_line(0x163) .dwattr $C$DW$296, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$296 .sect ".text:SlNetIfWifi_getConnectionStatus" .clink .thumbfunc SlNetIfWifi_getConnectionStatus .thumb .global SlNetIfWifi_getConnectionStatus $C$DW$308 .dwtag DW_TAG_subprogram .dwattr $C$DW$308, DW_AT_name("SlNetIfWifi_getConnectionStatus") .dwattr $C$DW$308, DW_AT_low_pc(SlNetIfWifi_getConnectionStatus) .dwattr $C$DW$308, DW_AT_high_pc(0x00) .dwattr $C$DW$308, DW_AT_TI_symbol_name("SlNetIfWifi_getConnectionStatus") .dwattr $C$DW$308, DW_AT_external .dwattr $C$DW$308, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$308, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$308, DW_AT_TI_begin_line(0x16b) .dwattr $C$DW$308, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$308, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$308, DW_AT_decl_line(0x16b) .dwattr $C$DW$308, DW_AT_decl_column(0x09) .dwattr $C$DW$308, DW_AT_TI_max_frame_size(0x60) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 364,column 1,is_stmt,address SlNetIfWifi_getConnectionStatus,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_getConnectionStatus $C$DW$309 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$309, DW_AT_name("ifContext") .dwattr $C$DW$309, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$309, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$309, DW_AT_location[DW_OP_reg0] ;---------------------------------------------------------------------- ; 363 | int32_t SlNetIfWifi_getConnectionStatus(void *ifContext) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_getConnectionStatus * ;* * ;* Regs Modified : A1,A2,A3,A4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 92 Auto + 4 Save = 96 byte * ;***************************************************************************** SlNetIfWifi_getConnectionStatus: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 .dwcfi save_reg_to_mem, 14, -4 SUB SP, SP, #92 ; [DPU_3_PIPE] .dwcfi cfa_offset, 96 $C$DW$310 .dwtag DW_TAG_variable .dwattr $C$DW$310, DW_AT_name("ifContext") .dwattr $C$DW$310, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$310, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$310, DW_AT_location[DW_OP_breg13 0] $C$DW$311 .dwtag DW_TAG_variable .dwattr $C$DW$311, DW_AT_name("retVal") .dwattr $C$DW$311, DW_AT_TI_symbol_name("retVal") .dwattr $C$DW$311, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$311, DW_AT_location[DW_OP_breg13 4] $C$DW$312 .dwtag DW_TAG_variable .dwattr $C$DW$312, DW_AT_name("Opt") .dwattr $C$DW$312, DW_AT_TI_symbol_name("Opt") .dwattr $C$DW$312, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$312, DW_AT_location[DW_OP_breg13 8] $C$DW$313 .dwtag DW_TAG_variable .dwattr $C$DW$313, DW_AT_name("Size") .dwattr $C$DW$313, DW_AT_TI_symbol_name("Size") .dwattr $C$DW$313, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$313, DW_AT_location[DW_OP_breg13 10] $C$DW$314 .dwtag DW_TAG_variable .dwattr $C$DW$314, DW_AT_name("connectionParams") .dwattr $C$DW$314, DW_AT_TI_symbol_name("connectionParams") .dwattr $C$DW$314, DW_AT_type(*$C$DW$T$449) .dwattr $C$DW$314, DW_AT_location[DW_OP_breg13 12] ;---------------------------------------------------------------------- ; 365 | SlWlanConnStatusParam_t connectionParams; ;---------------------------------------------------------------------- STR A1, [SP, #0] ; [DPU_3_PIPE] |364| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 366,column 36,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 366 | uint16_t Opt = 0; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |366| STRH A1, [SP, #8] ; [DPU_3_PIPE] |366| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 367,column 36,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 367 | int32_t retVal = 0; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |367| STR A1, [SP, #4] ; [DPU_3_PIPE] |367| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 368,column 36,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 368 | uint16_t Size = 0; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |368| STRH A1, [SP, #10] ; [DPU_3_PIPE] |368| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 370,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 370 | memset(&connectionParams, 0, sizeof(SlWlanConnStatusParam_t)); ;---------------------------------------------------------------------- MOVS A2, #0 ; [DPU_3_PIPE] |370| MOVS A3, #80 ; [DPU_3_PIPE] |370| ADD A1, SP, #12 ; [DPU_3_PIPE] |370| $C$DW$315 .dwtag DW_TAG_TI_branch .dwattr $C$DW$315, DW_AT_low_pc(0x00) .dwattr $C$DW$315, DW_AT_name("memset") .dwattr $C$DW$315, DW_AT_TI_call BL memset ; [DPU_3_PIPE] |370| ; CALL OCCURS {memset } ; [] |370| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 372,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 372 | retVal = sl_WlanGet(SL_WLAN_CONNECTION_INFO, &Opt, &Size, (uint8_t *)&c ; | onnectionParams); ;---------------------------------------------------------------------- MOVS A1, #5 ; [DPU_3_PIPE] |372| ADD A2, SP, #8 ; [DPU_3_PIPE] |372| ADD A3, SP, #10 ; [DPU_3_PIPE] |372| ADD A4, SP, #12 ; [DPU_3_PIPE] |372| $C$DW$316 .dwtag DW_TAG_TI_branch .dwattr $C$DW$316, DW_AT_low_pc(0x00) .dwattr $C$DW$316, DW_AT_name("sl_WlanGet") .dwattr $C$DW$316, DW_AT_TI_call BL sl_WlanGet ; [DPU_3_PIPE] |372| ; CALL OCCURS {sl_WlanGet } ; [] |372| STR A1, [SP, #4] ; [DPU_3_PIPE] |372| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 375,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 375 | if (retVal < SLNETERR_RET_CODE_OK) ;---------------------------------------------------------------------- LDR A1, [SP, #4] ; [DPU_3_PIPE] |375| CMP A1, #0 ; [DPU_3_PIPE] |375| BPL ||$C$L8|| ; [DPU_3_PIPE] |375| ; BRANCHCC OCCURS {||$C$L8||} ; [] |375| ;* --------------------------------------------------------------------------* .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 378,column 9,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 378 | return retVal; ;---------------------------------------------------------------------- LDR A1, [SP, #4] ; [DPU_3_PIPE] |378| B ||$C$L9|| ; [DPU_3_PIPE] |378| ; BRANCH OCCURS {||$C$L9||} ; [] |378| ;* --------------------------------------------------------------------------* ||$C$L8||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 380,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 380 | return connectionParams.ConnStatus; ;---------------------------------------------------------------------- LDRB A1, [SP, #13] ; [DPU_3_PIPE] |380| ;* --------------------------------------------------------------------------* ||$C$L9||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 381,column 1,is_stmt,isa 1 ADD SP, SP, #92 ; [DPU_3_PIPE] .dwcfi cfa_offset, 4 $C$DW$317 .dwtag DW_TAG_TI_branch .dwattr $C$DW$317, DW_AT_low_pc(0x00) .dwattr $C$DW$317, DW_AT_TI_return POP {PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 ; BRANCH OCCURS ; [] .dwattr $C$DW$308, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$308, DW_AT_TI_end_line(0x17d) .dwattr $C$DW$308, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$308 .sect ".text:SlNetIfWifi_loadSecObj" .clink .thumbfunc SlNetIfWifi_loadSecObj .thumb .global SlNetIfWifi_loadSecObj $C$DW$318 .dwtag DW_TAG_subprogram .dwattr $C$DW$318, DW_AT_name("SlNetIfWifi_loadSecObj") .dwattr $C$DW$318, DW_AT_low_pc(SlNetIfWifi_loadSecObj) .dwattr $C$DW$318, DW_AT_high_pc(0x00) .dwattr $C$DW$318, DW_AT_TI_symbol_name("SlNetIfWifi_loadSecObj") .dwattr $C$DW$318, DW_AT_external .dwattr $C$DW$318, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$318, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$318, DW_AT_TI_begin_line(0x185) .dwattr $C$DW$318, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$318, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$318, DW_AT_decl_line(0x185) .dwattr $C$DW$318, DW_AT_decl_column(0x09) .dwattr $C$DW$318, DW_AT_TI_max_frame_size(0x30) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 390,column 1,is_stmt,address SlNetIfWifi_loadSecObj,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_loadSecObj $C$DW$319 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$319, DW_AT_name("ifContext") .dwattr $C$DW$319, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$319, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$319, DW_AT_location[DW_OP_reg0] $C$DW$320 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$320, DW_AT_name("objType") .dwattr $C$DW$320, DW_AT_TI_symbol_name("objType") .dwattr $C$DW$320, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$320, DW_AT_location[DW_OP_reg1] $C$DW$321 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$321, DW_AT_name("objName") .dwattr $C$DW$321, DW_AT_TI_symbol_name("objName") .dwattr $C$DW$321, DW_AT_type(*$C$DW$T$334) .dwattr $C$DW$321, DW_AT_location[DW_OP_reg2] $C$DW$322 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$322, DW_AT_name("objNameLen") .dwattr $C$DW$322, DW_AT_TI_symbol_name("objNameLen") .dwattr $C$DW$322, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$322, DW_AT_location[DW_OP_reg3] $C$DW$323 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$323, DW_AT_name("objBuff") .dwattr $C$DW$323, DW_AT_TI_symbol_name("objBuff") .dwattr $C$DW$323, DW_AT_type(*$C$DW$T$347) .dwattr $C$DW$323, DW_AT_location[DW_OP_breg13 48] $C$DW$324 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$324, DW_AT_name("objBuffLen") .dwattr $C$DW$324, DW_AT_TI_symbol_name("objBuffLen") .dwattr $C$DW$324, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$324, DW_AT_location[DW_OP_breg13 52] ;---------------------------------------------------------------------- ; 389 | int32_t SlNetIfWifi_loadSecObj(void *ifContext, uint16_t objType, char ; | *objName, int16_t objNameLen, uint8_t *objBuff, int16_t objBuffLen) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_loadSecObj * ;* * ;* Regs Modified : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Regs Used : A1,A2,A3,A4,V4,V9,SP,LR,SR * ;* Local Frame Size : 0 Args + 36 Auto + 8 Save = 44 byte * ;***************************************************************************** SlNetIfWifi_loadSecObj: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 PUSH {V4, LR} ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 .dwcfi save_reg_to_mem, 14, -4 .dwcfi save_reg_to_mem, 7, -8 ADD V4, SP, #8 ; [DPU_3_PIPE] SUB SP, SP, #40 ; [DPU_3_PIPE] .dwcfi cfa_offset, 48 $C$DW$325 .dwtag DW_TAG_variable .dwattr $C$DW$325, DW_AT_name("ifContext") .dwattr $C$DW$325, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$325, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$325, DW_AT_location[DW_OP_breg13 0] $C$DW$326 .dwtag DW_TAG_variable .dwattr $C$DW$326, DW_AT_name("objName") .dwattr $C$DW$326, DW_AT_TI_symbol_name("objName") .dwattr $C$DW$326, DW_AT_type(*$C$DW$T$334) .dwattr $C$DW$326, DW_AT_location[DW_OP_breg13 4] $C$DW$327 .dwtag DW_TAG_variable .dwattr $C$DW$327, DW_AT_name("deviceFileName") .dwattr $C$DW$327, DW_AT_TI_symbol_name("deviceFileName") .dwattr $C$DW$327, DW_AT_type(*$C$DW$T$334) .dwattr $C$DW$327, DW_AT_location[DW_OP_breg13 8] $C$DW$328 .dwtag DW_TAG_variable .dwattr $C$DW$328, DW_AT_name("DeviceFileHandle") .dwattr $C$DW$328, DW_AT_TI_symbol_name("DeviceFileHandle") .dwattr $C$DW$328, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$328, DW_AT_location[DW_OP_breg13 12] $C$DW$329 .dwtag DW_TAG_variable .dwattr $C$DW$329, DW_AT_name("retVal") .dwattr $C$DW$329, DW_AT_TI_symbol_name("retVal") .dwattr $C$DW$329, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$329, DW_AT_location[DW_OP_breg13 16] $C$DW$330 .dwtag DW_TAG_variable .dwattr $C$DW$330, DW_AT_name("Offset") .dwattr $C$DW$330, DW_AT_TI_symbol_name("Offset") .dwattr $C$DW$330, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$330, DW_AT_location[DW_OP_breg13 20] $C$DW$331 .dwtag DW_TAG_variable .dwattr $C$DW$331, DW_AT_name("MasterToken") .dwattr $C$DW$331, DW_AT_TI_symbol_name("MasterToken") .dwattr $C$DW$331, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$331, DW_AT_location[DW_OP_breg13 24] $C$DW$332 .dwtag DW_TAG_variable .dwattr $C$DW$332, DW_AT_name("OpenFlags") .dwattr $C$DW$332, DW_AT_TI_symbol_name("OpenFlags") .dwattr $C$DW$332, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$332, DW_AT_location[DW_OP_breg13 28] $C$DW$333 .dwtag DW_TAG_variable .dwattr $C$DW$333, DW_AT_name("objType") .dwattr $C$DW$333, DW_AT_TI_symbol_name("objType") .dwattr $C$DW$333, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$333, DW_AT_location[DW_OP_breg13 32] $C$DW$334 .dwtag DW_TAG_variable .dwattr $C$DW$334, DW_AT_name("objNameLen") .dwattr $C$DW$334, DW_AT_TI_symbol_name("objNameLen") .dwattr $C$DW$334, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$334, DW_AT_location[DW_OP_breg13 34] STRH A4, [SP, #34] ; [DPU_3_PIPE] |390| STR A3, [SP, #4] ; [DPU_3_PIPE] |390| STRH A2, [SP, #32] ; [DPU_3_PIPE] |390| STR A1, [SP, #0] ; [DPU_3_PIPE] |390| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 391,column 32,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 391 | char *deviceFileName = objName; ;---------------------------------------------------------------------- LDR A1, [SP, #4] ; [DPU_3_PIPE] |391| STR A1, [SP, #8] ; [DPU_3_PIPE] |391| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 392,column 32,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 392 | int32_t DeviceFileHandle = -1; ; 393 | int32_t retVal; //negative retVal is an error ;---------------------------------------------------------------------- MOV A1, #-1 ; [DPU_3_PIPE] |392| STR A1, [SP, #12] ; [DPU_3_PIPE] |392| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 394,column 32,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 394 | uint32_t Offset = 0; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |394| STR A1, [SP, #20] ; [DPU_3_PIPE] |394| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 395,column 32,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 395 | uint32_t MasterToken = 0; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |395| STR A1, [SP, #24] ; [DPU_3_PIPE] |395| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 396,column 32,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 396 | int32_t OpenFlags = 0; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |396| STR A1, [SP, #28] ; [DPU_3_PIPE] |396| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 399,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 399 | if ( (NULL == objName) || (NULL == objBuff) ) ;---------------------------------------------------------------------- LDR A1, [SP, #4] ; [DPU_3_PIPE] |399| CBZ A1, ||$C$L10|| ; [] ; BRANCHCC OCCURS {||$C$L10||} ; [] |399| ;* --------------------------------------------------------------------------* LDR A1, [V4, #0] ; [DPU_3_PIPE] |399| CBNZ A1, ||$C$L11|| ; [] ; BRANCHCC OCCURS {||$C$L11||} ; [] |399| ;* --------------------------------------------------------------------------* ||$C$L10||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 402,column 9,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 402 | return SLNETERR_RET_CODE_INVALID_INPUT; ;---------------------------------------------------------------------- LDR A1, $C$CON5 ; [DPU_3_PIPE] |402| B ||$C$L13|| ; [DPU_3_PIPE] |402| ; BRANCH OCCURS {||$C$L13||} ; [] |402| ;* --------------------------------------------------------------------------* ||$C$L11||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 407,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 407 | OpenFlags = SL_FS_CREATE; ;---------------------------------------------------------------------- MOV A1, #134217728 ; [DPU_3_PIPE] |407| STR A1, [SP, #28] ; [DPU_3_PIPE] |407| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 408,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 408 | OpenFlags |= SL_FS_OVERWRITE; ;---------------------------------------------------------------------- LDR A1, [SP, #28] ; [DPU_3_PIPE] |408| ORR A1, A1, #536870912 ; [DPU_3_PIPE] |408| STR A1, [SP, #28] ; [DPU_3_PIPE] |408| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 409,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 409 | OpenFlags |= SL_FS_CREATE_SECURE; ;---------------------------------------------------------------------- LDR A1, [SP, #28] ; [DPU_3_PIPE] |409| ORR A1, A1, #262144 ; [DPU_3_PIPE] |409| STR A1, [SP, #28] ; [DPU_3_PIPE] |409| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 410,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 410 | OpenFlags |= SL_FS_CREATE_NOSIGNATURE; ;---------------------------------------------------------------------- LDR A1, [SP, #28] ; [DPU_3_PIPE] |410| ORR A1, A1, #524288 ; [DPU_3_PIPE] |410| STR A1, [SP, #28] ; [DPU_3_PIPE] |410| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 411,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 411 | OpenFlags |= SL_FS_CREATE_FAILSAFE; ;---------------------------------------------------------------------- LDR A1, [SP, #28] ; [DPU_3_PIPE] |411| ORR A1, A1, #131072 ; [DPU_3_PIPE] |411| STR A1, [SP, #28] ; [DPU_3_PIPE] |411| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 414,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 414 | DeviceFileHandle = sl_FsOpen((unsigned char *)deviceFileName, OpenFlag ; | s | SL_FS_CREATE_MAX_SIZE( objBuffLen ), (unsigned long *)&MasterToken) ; | ; ;---------------------------------------------------------------------- LDRSH A1, [V4, #4] ; [DPU_3_PIPE] |414| ADDS A1, A1, #255 ; [DPU_3_PIPE] |414| UBFX A2, A1, #8, #17 ; [DPU_3_PIPE] |414| LDR A3, [SP, #28] ; [DPU_3_PIPE] |414| LDR A1, [SP, #8] ; [DPU_3_PIPE] |414| ORRS A2, A2, A3 ; [DPU_3_PIPE] |414| ADD A3, SP, #24 ; [DPU_3_PIPE] |414| $C$DW$335 .dwtag DW_TAG_TI_branch .dwattr $C$DW$335, DW_AT_low_pc(0x00) .dwattr $C$DW$335, DW_AT_name("sl_FsOpen") .dwattr $C$DW$335, DW_AT_TI_call BL sl_FsOpen ; [DPU_3_PIPE] |414| ; CALL OCCURS {sl_FsOpen } ; [] |414| STR A1, [SP, #12] ; [DPU_3_PIPE] |414| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 417,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 417 | if ( DeviceFileHandle < SLNETERR_RET_CODE_OK ) ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |417| CMP A1, #0 ; [DPU_3_PIPE] |417| BPL ||$C$L12|| ; [DPU_3_PIPE] |417| ; BRANCHCC OCCURS {||$C$L12||} ; [] |417| ;* --------------------------------------------------------------------------* .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 419,column 9,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 419 | return DeviceFileHandle; ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |419| B ||$C$L13|| ; [DPU_3_PIPE] |419| ; BRANCH OCCURS {||$C$L13||} ; [] |419| ;* --------------------------------------------------------------------------* ||$C$L12||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 422,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 422 | Offset = 0; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |422| STR A1, [SP, #20] ; [DPU_3_PIPE] |422| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 424,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 424 | retVal = sl_FsWrite(DeviceFileHandle, Offset, (unsigned char *)objBuff, ; | objBuffLen); ;---------------------------------------------------------------------- LDRSH A4, [V4, #4] ; [DPU_3_PIPE] |424| LDR A3, [V4, #0] ; [DPU_3_PIPE] |424| LDR A1, [SP, #12] ; [DPU_3_PIPE] |424| LDR A2, [SP, #20] ; [DPU_3_PIPE] |424| $C$DW$336 .dwtag DW_TAG_TI_branch .dwattr $C$DW$336, DW_AT_low_pc(0x00) .dwattr $C$DW$336, DW_AT_name("sl_FsWrite") .dwattr $C$DW$336, DW_AT_TI_call BL sl_FsWrite ; [DPU_3_PIPE] |424| ; CALL OCCURS {sl_FsWrite } ; [] |424| STR A1, [SP, #16] ; [DPU_3_PIPE] |424| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 427,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 427 | retVal = sl_FsClose(DeviceFileHandle, NULL, NULL , 0); ;---------------------------------------------------------------------- LDR A1, [SP, #12] ; [DPU_3_PIPE] |427| MOVS A2, #0 ; [DPU_3_PIPE] |427| MOVS A3, #0 ; [DPU_3_PIPE] |427| MOVS A4, #0 ; [DPU_3_PIPE] |427| $C$DW$337 .dwtag DW_TAG_TI_branch .dwattr $C$DW$337, DW_AT_low_pc(0x00) .dwattr $C$DW$337, DW_AT_name("sl_FsClose") .dwattr $C$DW$337, DW_AT_TI_call BL sl_FsClose ; [DPU_3_PIPE] |427| ; CALL OCCURS {sl_FsClose } ; [] |427| STR A1, [SP, #16] ; [DPU_3_PIPE] |427| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 429,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 429 | return retVal; ;---------------------------------------------------------------------- LDR A1, [SP, #16] ; [DPU_3_PIPE] |429| ;* --------------------------------------------------------------------------* ||$C$L13||: .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 430,column 1,is_stmt,isa 1 ADD SP, SP, #40 ; [DPU_3_PIPE] .dwcfi cfa_offset, 8 $C$DW$338 .dwtag DW_TAG_TI_branch .dwattr $C$DW$338, DW_AT_low_pc(0x00) .dwattr $C$DW$338, DW_AT_TI_return POP {V4, PC} ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 .dwcfi restore_reg, 7 ; BRANCH OCCURS ; [] .dwattr $C$DW$318, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$318, DW_AT_TI_end_line(0x1ae) .dwattr $C$DW$318, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$318 .sect ".text:SlNetIfWifi_CreateContext" .clink .thumbfunc SlNetIfWifi_CreateContext .thumb .global SlNetIfWifi_CreateContext $C$DW$339 .dwtag DW_TAG_subprogram .dwattr $C$DW$339, DW_AT_name("SlNetIfWifi_CreateContext") .dwattr $C$DW$339, DW_AT_low_pc(SlNetIfWifi_CreateContext) .dwattr $C$DW$339, DW_AT_high_pc(0x00) .dwattr $C$DW$339, DW_AT_TI_symbol_name("SlNetIfWifi_CreateContext") .dwattr $C$DW$339, DW_AT_external .dwattr $C$DW$339, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$339, DW_AT_TI_begin_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$339, DW_AT_TI_begin_line(0x1b5) .dwattr $C$DW$339, DW_AT_TI_begin_column(0x09) .dwattr $C$DW$339, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$339, DW_AT_decl_line(0x1b5) .dwattr $C$DW$339, DW_AT_decl_column(0x09) .dwattr $C$DW$339, DW_AT_TI_max_frame_size(0x10) .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 438,column 1,is_stmt,address SlNetIfWifi_CreateContext,isa 1 .dwfde $C$DW$CIE, SlNetIfWifi_CreateContext $C$DW$340 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$340, DW_AT_name("ifID") .dwattr $C$DW$340, DW_AT_TI_symbol_name("ifID") .dwattr $C$DW$340, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$340, DW_AT_location[DW_OP_reg0] $C$DW$341 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$341, DW_AT_name("ifName") .dwattr $C$DW$341, DW_AT_TI_symbol_name("ifName") .dwattr $C$DW$341, DW_AT_type(*$C$DW$T$351) .dwattr $C$DW$341, DW_AT_location[DW_OP_reg1] $C$DW$342 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$342, DW_AT_name("context") .dwattr $C$DW$342, DW_AT_TI_symbol_name("context") .dwattr $C$DW$342, DW_AT_type(*$C$DW$T$286) .dwattr $C$DW$342, DW_AT_location[DW_OP_reg2] ;---------------------------------------------------------------------- ; 437 | int32_t SlNetIfWifi_CreateContext(uint16_t ifID, const char *ifName, vo ; | id **context) ;---------------------------------------------------------------------- ;***************************************************************************** ;* FUNCTION NAME: SlNetIfWifi_CreateContext * ;* * ;* Regs Modified : A1,SP,SR * ;* Regs Used : A1,A2,A3,SP,LR,SR * ;* Local Frame Size : 0 Args + 12 Auto + 0 Save = 12 byte * ;***************************************************************************** SlNetIfWifi_CreateContext: ;* --------------------------------------------------------------------------* .dwcfi cfa_offset, 0 SUB SP, SP, #16 ; [DPU_3_PIPE] .dwcfi cfa_offset, 16 $C$DW$343 .dwtag DW_TAG_variable .dwattr $C$DW$343, DW_AT_name("ifName") .dwattr $C$DW$343, DW_AT_TI_symbol_name("ifName") .dwattr $C$DW$343, DW_AT_type(*$C$DW$T$351) .dwattr $C$DW$343, DW_AT_location[DW_OP_breg13 0] $C$DW$344 .dwtag DW_TAG_variable .dwattr $C$DW$344, DW_AT_name("context") .dwattr $C$DW$344, DW_AT_TI_symbol_name("context") .dwattr $C$DW$344, DW_AT_type(*$C$DW$T$286) .dwattr $C$DW$344, DW_AT_location[DW_OP_breg13 4] $C$DW$345 .dwtag DW_TAG_variable .dwattr $C$DW$345, DW_AT_name("ifID") .dwattr $C$DW$345, DW_AT_TI_symbol_name("ifID") .dwattr $C$DW$345, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$345, DW_AT_location[DW_OP_breg13 8] STR A3, [SP, #4] ; [DPU_3_PIPE] |438| STR A2, [SP, #0] ; [DPU_3_PIPE] |438| STRH A1, [SP, #8] ; [DPU_3_PIPE] |438| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 439,column 5,is_stmt,isa 1 ;---------------------------------------------------------------------- ; 439 | return SLNETERR_RET_CODE_OK; ;---------------------------------------------------------------------- MOVS A1, #0 ; [DPU_3_PIPE] |439| .dwpsn file "/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c",line 440,column 1,is_stmt,isa 1 ADD SP, SP, #16 ; [DPU_3_PIPE] .dwcfi cfa_offset, 0 $C$DW$346 .dwtag DW_TAG_TI_branch .dwattr $C$DW$346, DW_AT_low_pc(0x00) .dwattr $C$DW$346, DW_AT_TI_return BX LR ; [DPU_3_PIPE] ; BRANCH OCCURS ; [] .dwattr $C$DW$339, DW_AT_TI_end_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/slnetif/slnetifwifi.c") .dwattr $C$DW$339, DW_AT_TI_end_line(0x1b8) .dwattr $C$DW$339, DW_AT_TI_end_column(0x01) .dwendentry .dwendtag $C$DW$339 ;****************************************************************************** ;* CONSTANT TABLE * ;****************************************************************************** .sect ".text:SlNetIfWifi_socket" .align 4 ||$C$CON1||: .bits socketType,32 ;****************************************************************************** ;* CONSTANT TABLE * ;****************************************************************************** .sect ".text:SlNetIfWifi_getSockName" .align 4 ||$C$CON2||: .bits -2003,32 ;****************************************************************************** ;* CONSTANT TABLE * ;****************************************************************************** .sect ".text:SlNetIfWifi_sockstartSec" .align 4 ||$C$CON3||: .bits StartSecOptName,32 .align 4 ||$C$CON4||: .bits -2006,32 ;****************************************************************************** ;* CONSTANT TABLE * ;****************************************************************************** .sect ".text:SlNetIfWifi_loadSecObj" .align 4 ||$C$CON5||: .bits -2006,32 ;***************************************************************************** ;* UNDEFINED EXTERNAL REFERENCES * ;***************************************************************************** .global memset .global sl_FsOpen .global sl_FsClose .global sl_FsWrite .global sl_Socket .global sl_Close .global sl_Accept .global sl_Bind .global sl_Listen .global sl_Connect .global sl_Select .global sl_SetSockOpt .global sl_GetSockOpt .global sl_Recv .global sl_RecvFrom .global sl_Send .global sl_SendTo .global sl_StartTLS .global sl_NetAppDnsGetHostByName .global sl_WlanGet .global sl_NetCfgGet ;****************************************************************************** ;* BUILD ATTRIBUTES * ;****************************************************************************** .battr "aeabi", Tag_File, 1, Tag_ABI_PCS_wchar_t(2) .battr "aeabi", Tag_File, 1, Tag_ABI_FP_rounding(0) .battr "aeabi", Tag_File, 1, Tag_ABI_FP_denormal(0) .battr "aeabi", Tag_File, 1, Tag_ABI_FP_exceptions(0) .battr "aeabi", Tag_File, 1, Tag_ABI_FP_number_model(1) .battr "aeabi", Tag_File, 1, Tag_ABI_enum_size(1) .battr "aeabi", Tag_File, 1, Tag_ABI_optimization_goals(5) .battr "aeabi", Tag_File, 1, Tag_ABI_FP_optimization_goals(0) .battr "TI", Tag_File, 1, Tag_Bitfield_layout(2) .battr "aeabi", Tag_File, 1, Tag_ABI_VFP_args(3) .battr "TI", Tag_File, 1, Tag_FP_interface(1) ;****************************************************************************** ;* TYPE INFORMATION * ;****************************************************************************** $C$DW$T$168 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$168, DW_AT_byte_size(0x01) $C$DW$347 .dwtag DW_TAG_enumerator .dwattr $C$DW$347, DW_AT_name("SL_DEVICE_SOURCE_OTHER") .dwattr $C$DW$347, DW_AT_const_value(0x00) .dwattr $C$DW$347, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$347, DW_AT_decl_line(0x5f) .dwattr $C$DW$347, DW_AT_decl_column(0x05) $C$DW$348 .dwtag DW_TAG_enumerator .dwattr $C$DW$348, DW_AT_name("SL_DEVICE_SOURCE_WLAN") .dwattr $C$DW$348, DW_AT_const_value(0x01) .dwattr $C$DW$348, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$348, DW_AT_decl_line(0x60) .dwattr $C$DW$348, DW_AT_decl_column(0x05) $C$DW$349 .dwtag DW_TAG_enumerator .dwattr $C$DW$349, DW_AT_name("SL_DEVICE_SOURCE_NETCFG") .dwattr $C$DW$349, DW_AT_const_value(0x02) .dwattr $C$DW$349, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$349, DW_AT_decl_line(0x61) .dwattr $C$DW$349, DW_AT_decl_column(0x05) $C$DW$350 .dwtag DW_TAG_enumerator .dwattr $C$DW$350, DW_AT_name("SL_DEVICE_SOURCE_NETAPP") .dwattr $C$DW$350, DW_AT_const_value(0x03) .dwattr $C$DW$350, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$350, DW_AT_decl_line(0x62) .dwattr $C$DW$350, DW_AT_decl_column(0x05) $C$DW$351 .dwtag DW_TAG_enumerator .dwattr $C$DW$351, DW_AT_name("SL_DEVICE_SOURCE_SECURITY") .dwattr $C$DW$351, DW_AT_const_value(0x04) .dwattr $C$DW$351, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$351, DW_AT_decl_line(0x63) .dwattr $C$DW$351, DW_AT_decl_column(0x05) $C$DW$352 .dwtag DW_TAG_enumerator .dwattr $C$DW$352, DW_AT_name("SL_DEVICE_SOURCE_LAST") .dwattr $C$DW$352, DW_AT_const_value(0xff) .dwattr $C$DW$352, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$352, DW_AT_decl_line(0x65) .dwattr $C$DW$352, DW_AT_decl_column(0x05) .dwattr $C$DW$T$168, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$168, DW_AT_decl_line(0x5e) .dwattr $C$DW$T$168, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$168 $C$DW$T$169 .dwtag DW_TAG_typedef .dwattr $C$DW$T$169, DW_AT_name("SlDeviceSource_e") .dwattr $C$DW$T$169, DW_AT_type(*$C$DW$T$168) .dwattr $C$DW$T$169, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$169, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$169, DW_AT_decl_line(0x66) .dwattr $C$DW$T$169, DW_AT_decl_column(0x02) $C$DW$T$341 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$341, DW_AT_byte_size(0x01) $C$DW$353 .dwtag DW_TAG_enumerator .dwattr $C$DW$353, DW_AT_name("SLNETIF_IPV4_ADDR") .dwattr $C$DW$353, DW_AT_const_value(0x00) .dwattr $C$DW$353, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$353, DW_AT_decl_line(0x6f) .dwattr $C$DW$353, DW_AT_decl_column(0x05) $C$DW$354 .dwtag DW_TAG_enumerator .dwattr $C$DW$354, DW_AT_name("SLNETIF_IPV6_ADDR_LOCAL") .dwattr $C$DW$354, DW_AT_const_value(0x01) .dwattr $C$DW$354, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$354, DW_AT_decl_line(0x70) .dwattr $C$DW$354, DW_AT_decl_column(0x05) $C$DW$355 .dwtag DW_TAG_enumerator .dwattr $C$DW$355, DW_AT_name("SLNETIF_IPV6_ADDR_GLOBAL") .dwattr $C$DW$355, DW_AT_const_value(0x02) .dwattr $C$DW$355, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$355, DW_AT_decl_line(0x71) .dwattr $C$DW$355, DW_AT_decl_column(0x05) .dwattr $C$DW$T$341, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$341, DW_AT_decl_line(0x6e) .dwattr $C$DW$T$341, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$341 $C$DW$T$342 .dwtag DW_TAG_typedef .dwattr $C$DW$T$342, DW_AT_name("SlNetIfAddressType_e") .dwattr $C$DW$T$342, DW_AT_type(*$C$DW$T$341) .dwattr $C$DW$T$342, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$342, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$342, DW_AT_decl_line(0x72) .dwattr $C$DW$T$342, DW_AT_decl_column(0x03) $C$DW$T$375 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$375, DW_AT_byte_size(0x01) $C$DW$356 .dwtag DW_TAG_enumerator .dwattr $C$DW$356, DW_AT_name("SLNETSOCK_SEC_ATTRIB_PRIVATE_KEY") .dwattr $C$DW$356, DW_AT_const_value(0x00) .dwattr $C$DW$356, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$356, DW_AT_decl_line(0x139) .dwattr $C$DW$356, DW_AT_decl_column(0x06) $C$DW$357 .dwtag DW_TAG_enumerator .dwattr $C$DW$357, DW_AT_name("SLNETSOCK_SEC_ATTRIB_LOCAL_CERT") .dwattr $C$DW$357, DW_AT_const_value(0x01) .dwattr $C$DW$357, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$357, DW_AT_decl_line(0x13a) .dwattr $C$DW$357, DW_AT_decl_column(0x06) $C$DW$358 .dwtag DW_TAG_enumerator .dwattr $C$DW$358, DW_AT_name("SLNETSOCK_SEC_ATTRIB_PEER_ROOT_CA") .dwattr $C$DW$358, DW_AT_const_value(0x02) .dwattr $C$DW$358, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$358, DW_AT_decl_line(0x13b) .dwattr $C$DW$358, DW_AT_decl_column(0x06) $C$DW$359 .dwtag DW_TAG_enumerator .dwattr $C$DW$359, DW_AT_name("SLNETSOCK_SEC_ATTRIB_DH_KEY") .dwattr $C$DW$359, DW_AT_const_value(0x03) .dwattr $C$DW$359, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$359, DW_AT_decl_line(0x13c) .dwattr $C$DW$359, DW_AT_decl_column(0x06) $C$DW$360 .dwtag DW_TAG_enumerator .dwattr $C$DW$360, DW_AT_name("SLNETSOCK_SEC_ATTRIB_METHOD") .dwattr $C$DW$360, DW_AT_const_value(0x04) .dwattr $C$DW$360, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$360, DW_AT_decl_line(0x13d) .dwattr $C$DW$360, DW_AT_decl_column(0x06) $C$DW$361 .dwtag DW_TAG_enumerator .dwattr $C$DW$361, DW_AT_name("SLNETSOCK_SEC_ATTRIB_CIPHERS") .dwattr $C$DW$361, DW_AT_const_value(0x05) .dwattr $C$DW$361, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$361, DW_AT_decl_line(0x13e) .dwattr $C$DW$361, DW_AT_decl_column(0x06) $C$DW$362 .dwtag DW_TAG_enumerator .dwattr $C$DW$362, DW_AT_name("SLNETSOCK_SEC_ATTRIB_ALPN") .dwattr $C$DW$362, DW_AT_const_value(0x06) .dwattr $C$DW$362, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$362, DW_AT_decl_line(0x13f) .dwattr $C$DW$362, DW_AT_decl_column(0x06) $C$DW$363 .dwtag DW_TAG_enumerator .dwattr $C$DW$363, DW_AT_name("SLNETSOCK_SEC_ATTRIB_EXT_CLIENT_CHLNG_RESP") .dwattr $C$DW$363, DW_AT_const_value(0x07) .dwattr $C$DW$363, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$363, DW_AT_decl_line(0x140) .dwattr $C$DW$363, DW_AT_decl_column(0x06) $C$DW$364 .dwtag DW_TAG_enumerator .dwattr $C$DW$364, DW_AT_name("SLNETSOCK_SEC_ATTRIB_DOMAIN_NAME") .dwattr $C$DW$364, DW_AT_const_value(0x08) .dwattr $C$DW$364, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$364, DW_AT_decl_line(0x141) .dwattr $C$DW$364, DW_AT_decl_column(0x06) $C$DW$365 .dwtag DW_TAG_enumerator .dwattr $C$DW$365, DW_AT_name("SLNETSOCK_SEC_ATTRIB_DISABLE_CERT_STORE") .dwattr $C$DW$365, DW_AT_const_value(0x09) .dwattr $C$DW$365, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$365, DW_AT_decl_line(0x153) .dwattr $C$DW$365, DW_AT_decl_column(0x06) .dwattr $C$DW$T$375, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$375, DW_AT_decl_line(0x138) .dwattr $C$DW$T$375, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$375 $C$DW$T$376 .dwtag DW_TAG_typedef .dwattr $C$DW$T$376, DW_AT_name("SlNetSockSecAttrib_e") .dwattr $C$DW$T$376, DW_AT_type(*$C$DW$T$375) .dwattr $C$DW$T$376, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$376, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$376, DW_AT_decl_line(0x154) .dwattr $C$DW$T$376, DW_AT_decl_column(0x03) $C$DW$T$395 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$395, DW_AT_byte_size(0x01) $C$DW$366 .dwtag DW_TAG_enumerator .dwattr $C$DW$366, DW_AT_name("SLNETSOCK_TX_INHIBIT_THRESHOLD_MIN") .dwattr $C$DW$366, DW_AT_const_value(0x01) .dwattr $C$DW$366, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$366, DW_AT_decl_line(0x129) .dwattr $C$DW$366, DW_AT_decl_column(0x05) $C$DW$367 .dwtag DW_TAG_enumerator .dwattr $C$DW$367, DW_AT_name("SLNETSOCK_TX_INHIBIT_THRESHOLD_LOW") .dwattr $C$DW$367, DW_AT_const_value(0x02) .dwattr $C$DW$367, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$367, DW_AT_decl_line(0x12a) .dwattr $C$DW$367, DW_AT_decl_column(0x05) $C$DW$368 .dwtag DW_TAG_enumerator .dwattr $C$DW$368, DW_AT_name("SLNETSOCK_TX_INHIBIT_THRESHOLD_DEFAULT") .dwattr $C$DW$368, DW_AT_const_value(0x03) .dwattr $C$DW$368, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$368, DW_AT_decl_line(0x12b) .dwattr $C$DW$368, DW_AT_decl_column(0x05) $C$DW$369 .dwtag DW_TAG_enumerator .dwattr $C$DW$369, DW_AT_name("SLNETSOCK_TX_INHIBIT_THRESHOLD_MED") .dwattr $C$DW$369, DW_AT_const_value(0x04) .dwattr $C$DW$369, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$369, DW_AT_decl_line(0x12c) .dwattr $C$DW$369, DW_AT_decl_column(0x05) $C$DW$370 .dwtag DW_TAG_enumerator .dwattr $C$DW$370, DW_AT_name("SLNETSOCK_TX_INHIBIT_THRESHOLD_HIGH") .dwattr $C$DW$370, DW_AT_const_value(0x05) .dwattr $C$DW$370, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$370, DW_AT_decl_line(0x12d) .dwattr $C$DW$370, DW_AT_decl_column(0x05) $C$DW$371 .dwtag DW_TAG_enumerator .dwattr $C$DW$371, DW_AT_name("SLNETSOCK_TX_INHIBIT_THRESHOLD_MAX") .dwattr $C$DW$371, DW_AT_const_value(0x06) .dwattr $C$DW$371, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$371, DW_AT_decl_line(0x12e) .dwattr $C$DW$371, DW_AT_decl_column(0x05) .dwattr $C$DW$T$395, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$395, DW_AT_decl_line(0x128) .dwattr $C$DW$T$395, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$395 $C$DW$T$396 .dwtag DW_TAG_typedef .dwattr $C$DW$T$396, DW_AT_name("SlNetSockTxInhibitThreshold_e") .dwattr $C$DW$T$396, DW_AT_type(*$C$DW$T$395) .dwattr $C$DW$T$396, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$396, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$396, DW_AT_decl_line(0x12f) .dwattr $C$DW$T$396, DW_AT_decl_column(0x03) $C$DW$T$397 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$397, DW_AT_byte_size(0x01) $C$DW$372 .dwtag DW_TAG_enumerator .dwattr $C$DW$372, DW_AT_name("SLNETIF_STATE_DISABLE") .dwattr $C$DW$372, DW_AT_const_value(0x00) .dwattr $C$DW$372, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$372, DW_AT_decl_line(0x66) .dwattr $C$DW$372, DW_AT_decl_column(0x05) $C$DW$373 .dwtag DW_TAG_enumerator .dwattr $C$DW$373, DW_AT_name("SLNETIF_STATE_ENABLE") .dwattr $C$DW$373, DW_AT_const_value(0x01) .dwattr $C$DW$373, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$373, DW_AT_decl_line(0x67) .dwattr $C$DW$373, DW_AT_decl_column(0x05) .dwattr $C$DW$T$397, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$397, DW_AT_decl_line(0x65) .dwattr $C$DW$T$397, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$397 $C$DW$T$398 .dwtag DW_TAG_typedef .dwattr $C$DW$T$398, DW_AT_name("SlNetIfState_e") .dwattr $C$DW$T$398, DW_AT_type(*$C$DW$T$397) .dwattr $C$DW$T$398, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$398, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$398, DW_AT_decl_line(0x68) .dwattr $C$DW$T$398, DW_AT_decl_column(0x03) $C$DW$T$399 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$399, DW_AT_byte_size(0x01) $C$DW$374 .dwtag DW_TAG_enumerator .dwattr $C$DW$374, DW_AT_name("EVENT_PROPAGATION_BLOCK") .dwattr $C$DW$374, DW_AT_const_value(0x00) .dwattr $C$DW$374, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$374, DW_AT_decl_line(0x188) .dwattr $C$DW$374, DW_AT_decl_column(0x05) $C$DW$375 .dwtag DW_TAG_enumerator .dwattr $C$DW$375, DW_AT_name("EVENT_PROPAGATION_CONTINUE") .dwattr $C$DW$375, DW_AT_const_value(0x01) .dwattr $C$DW$375, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$375, DW_AT_decl_line(0x189) .dwattr $C$DW$375, DW_AT_decl_column(0x05) .dwattr $C$DW$T$399, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$T$399, DW_AT_decl_line(0x187) .dwattr $C$DW$T$399, DW_AT_decl_column(0x0f) .dwendtag $C$DW$T$399 $C$DW$T$400 .dwtag DW_TAG_typedef .dwattr $C$DW$T$400, DW_AT_name("_SlEventPropogationStatus_e") .dwattr $C$DW$T$400, DW_AT_type(*$C$DW$T$399) .dwattr $C$DW$T$400, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$400, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$T$400, DW_AT_decl_line(0x18a) .dwattr $C$DW$T$400, DW_AT_decl_column(0x04) $C$DW$T$401 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$401, DW_AT_byte_size(0x01) $C$DW$376 .dwtag DW_TAG_enumerator .dwattr $C$DW$376, DW_AT_name("SL_FS_TOKEN_MASTER") .dwattr $C$DW$376, DW_AT_const_value(0x00) .dwattr $C$DW$376, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$376, DW_AT_decl_line(0x88) .dwattr $C$DW$376, DW_AT_decl_column(0x05) $C$DW$377 .dwtag DW_TAG_enumerator .dwattr $C$DW$377, DW_AT_name("SL_FS_TOKEN_WRITE_READ") .dwattr $C$DW$377, DW_AT_const_value(0x01) .dwattr $C$DW$377, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$377, DW_AT_decl_line(0x89) .dwattr $C$DW$377, DW_AT_decl_column(0x05) $C$DW$378 .dwtag DW_TAG_enumerator .dwattr $C$DW$378, DW_AT_name("SL_FS_TOKEN_WRITE_ONLY") .dwattr $C$DW$378, DW_AT_const_value(0x02) .dwattr $C$DW$378, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$378, DW_AT_decl_line(0x8a) .dwattr $C$DW$378, DW_AT_decl_column(0x05) $C$DW$379 .dwtag DW_TAG_enumerator .dwattr $C$DW$379, DW_AT_name("SL_FS_TOKEN_READ_ONLY") .dwattr $C$DW$379, DW_AT_const_value(0x03) .dwattr $C$DW$379, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$379, DW_AT_decl_line(0x8b) .dwattr $C$DW$379, DW_AT_decl_column(0x05) .dwattr $C$DW$T$401, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$401, DW_AT_decl_line(0x87) .dwattr $C$DW$T$401, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$401 $C$DW$T$402 .dwtag DW_TAG_typedef .dwattr $C$DW$T$402, DW_AT_name("SlFsTokenId_e") .dwattr $C$DW$T$402, DW_AT_type(*$C$DW$T$401) .dwattr $C$DW$T$402, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$402, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$402, DW_AT_decl_line(0x8c) .dwattr $C$DW$T$402, DW_AT_decl_column(0x02) $C$DW$T$403 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$403, DW_AT_byte_size(0x01) $C$DW$380 .dwtag DW_TAG_enumerator .dwattr $C$DW$380, DW_AT_name("SL_FS_CTL_RESTORE") .dwattr $C$DW$380, DW_AT_const_value(0x00) .dwattr $C$DW$380, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$380, DW_AT_decl_line(0x9f) .dwattr $C$DW$380, DW_AT_decl_column(0x03) $C$DW$381 .dwtag DW_TAG_enumerator .dwattr $C$DW$381, DW_AT_name("SL_FS_CTL_ROLLBACK") .dwattr $C$DW$381, DW_AT_const_value(0x01) .dwattr $C$DW$381, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$381, DW_AT_decl_line(0xa0) .dwattr $C$DW$381, DW_AT_decl_column(0x03) $C$DW$382 .dwtag DW_TAG_enumerator .dwattr $C$DW$382, DW_AT_name("SL_FS_CTL_COMMIT") .dwattr $C$DW$382, DW_AT_const_value(0x02) .dwattr $C$DW$382, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$382, DW_AT_decl_line(0xa1) .dwattr $C$DW$382, DW_AT_decl_column(0x03) $C$DW$383 .dwtag DW_TAG_enumerator .dwattr $C$DW$383, DW_AT_name("SL_FS_CTL_RENAME") .dwattr $C$DW$383, DW_AT_const_value(0x03) .dwattr $C$DW$383, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$383, DW_AT_decl_line(0xa2) .dwattr $C$DW$383, DW_AT_decl_column(0x03) $C$DW$384 .dwtag DW_TAG_enumerator .dwattr $C$DW$384, DW_AT_name("SL_FS_CTL_GET_STORAGE_INFO") .dwattr $C$DW$384, DW_AT_const_value(0x05) .dwattr $C$DW$384, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$384, DW_AT_decl_line(0xa3) .dwattr $C$DW$384, DW_AT_decl_column(0x03) $C$DW$385 .dwtag DW_TAG_enumerator .dwattr $C$DW$385, DW_AT_name("SL_FS_CTL_BUNDLE_ROLLBACK") .dwattr $C$DW$385, DW_AT_const_value(0x06) .dwattr $C$DW$385, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$385, DW_AT_decl_line(0xa4) .dwattr $C$DW$385, DW_AT_decl_column(0x03) $C$DW$386 .dwtag DW_TAG_enumerator .dwattr $C$DW$386, DW_AT_name("SL_FS_CTL_BUNDLE_COMMIT") .dwattr $C$DW$386, DW_AT_const_value(0x07) .dwattr $C$DW$386, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$386, DW_AT_decl_line(0xa5) .dwattr $C$DW$386, DW_AT_decl_column(0x03) .dwattr $C$DW$T$403, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$403, DW_AT_decl_line(0x9e) .dwattr $C$DW$T$403, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$403 $C$DW$T$404 .dwtag DW_TAG_typedef .dwattr $C$DW$T$404, DW_AT_name("SlFsCtl_e") .dwattr $C$DW$T$404, DW_AT_type(*$C$DW$T$403) .dwattr $C$DW$T$404, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$404, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$404, DW_AT_decl_line(0xa6) .dwattr $C$DW$T$404, DW_AT_decl_column(0x02) $C$DW$T$405 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$405, DW_AT_byte_size(0x01) $C$DW$387 .dwtag DW_TAG_enumerator .dwattr $C$DW$387, DW_AT_name("SL_FS_BUNDLE_STATE_STOPPED") .dwattr $C$DW$387, DW_AT_const_value(0x00) .dwattr $C$DW$387, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$387, DW_AT_decl_line(0xaa) .dwattr $C$DW$387, DW_AT_decl_column(0x03) $C$DW$388 .dwtag DW_TAG_enumerator .dwattr $C$DW$388, DW_AT_name("SL_FS_BUNDLE_STATE_STARTED") .dwattr $C$DW$388, DW_AT_const_value(0x01) .dwattr $C$DW$388, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$388, DW_AT_decl_line(0xab) .dwattr $C$DW$388, DW_AT_decl_column(0x03) $C$DW$389 .dwtag DW_TAG_enumerator .dwattr $C$DW$389, DW_AT_name("SL_FS_BUNDLE_STATE_PENDING_COMMIT") .dwattr $C$DW$389, DW_AT_const_value(0x03) .dwattr $C$DW$389, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$389, DW_AT_decl_line(0xac) .dwattr $C$DW$389, DW_AT_decl_column(0x03) .dwattr $C$DW$T$405, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$405, DW_AT_decl_line(0xa9) .dwattr $C$DW$T$405, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$405 $C$DW$T$406 .dwtag DW_TAG_typedef .dwattr $C$DW$T$406, DW_AT_name("SlFsBundleState_e") .dwattr $C$DW$T$406, DW_AT_type(*$C$DW$T$405) .dwattr $C$DW$T$406, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$406, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$406, DW_AT_decl_line(0xad) .dwattr $C$DW$T$406, DW_AT_decl_column(0x02) $C$DW$T$407 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$407, DW_AT_byte_size(0x01) $C$DW$390 .dwtag DW_TAG_enumerator .dwattr $C$DW$390, DW_AT_name("SL_FS_FACTORY_RET_TO_IMAGE") .dwattr $C$DW$390, DW_AT_const_value(0x00) .dwattr $C$DW$390, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$390, DW_AT_decl_line(0xc4) .dwattr $C$DW$390, DW_AT_decl_column(0x03) $C$DW$391 .dwtag DW_TAG_enumerator .dwattr $C$DW$391, DW_AT_name("SL_FS_FACTORY_RET_TO_DEFAULT") .dwattr $C$DW$391, DW_AT_const_value(0x02) .dwattr $C$DW$391, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$391, DW_AT_decl_line(0xc5) .dwattr $C$DW$391, DW_AT_decl_column(0x03) .dwattr $C$DW$T$407, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$407, DW_AT_decl_line(0xc3) .dwattr $C$DW$T$407, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$407 $C$DW$T$408 .dwtag DW_TAG_typedef .dwattr $C$DW$T$408, DW_AT_name("SlFsRetToFactoryOper_e") .dwattr $C$DW$T$408, DW_AT_type(*$C$DW$T$407) .dwattr $C$DW$T$408, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$408, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$408, DW_AT_decl_line(0xc6) .dwattr $C$DW$T$408, DW_AT_decl_column(0x02) $C$DW$T$409 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$409, DW_AT_byte_size(0x01) $C$DW$392 .dwtag DW_TAG_enumerator .dwattr $C$DW$392, DW_AT_name("SL_FS_GET_FILE_ATTRIBUTES") .dwattr $C$DW$392, DW_AT_const_value(0x01) .dwattr $C$DW$392, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$392, DW_AT_decl_line(0x109) .dwattr $C$DW$392, DW_AT_decl_column(0x05) .dwattr $C$DW$T$409, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$409, DW_AT_decl_line(0x108) .dwattr $C$DW$T$409, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$409 $C$DW$T$410 .dwtag DW_TAG_typedef .dwattr $C$DW$T$410, DW_AT_name("SlFileListFlags_t") .dwattr $C$DW$T$410, DW_AT_type(*$C$DW$T$409) .dwattr $C$DW$T$410, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$410, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$410, DW_AT_decl_line(0x10a) .dwattr $C$DW$T$410, DW_AT_decl_column(0x02) $C$DW$T$411 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$411, DW_AT_byte_size(0x01) $C$DW$393 .dwtag DW_TAG_enumerator .dwattr $C$DW$393, DW_AT_name("SL_TX_INHIBIT_THRESHOLD_MIN") .dwattr $C$DW$393, DW_AT_const_value(0x01) .dwattr $C$DW$393, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$393, DW_AT_decl_line(0x95) .dwattr $C$DW$393, DW_AT_decl_column(0x05) $C$DW$394 .dwtag DW_TAG_enumerator .dwattr $C$DW$394, DW_AT_name("SL_TX_INHIBIT_THRESHOLD_LOW") .dwattr $C$DW$394, DW_AT_const_value(0x02) .dwattr $C$DW$394, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$394, DW_AT_decl_line(0x96) .dwattr $C$DW$394, DW_AT_decl_column(0x05) $C$DW$395 .dwtag DW_TAG_enumerator .dwattr $C$DW$395, DW_AT_name("SL_TX_INHIBIT_THRESHOLD_DEFAULT") .dwattr $C$DW$395, DW_AT_const_value(0x03) .dwattr $C$DW$395, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$395, DW_AT_decl_line(0x97) .dwattr $C$DW$395, DW_AT_decl_column(0x05) $C$DW$396 .dwtag DW_TAG_enumerator .dwattr $C$DW$396, DW_AT_name("SL_TX_INHIBIT_THRESHOLD_MED") .dwattr $C$DW$396, DW_AT_const_value(0x04) .dwattr $C$DW$396, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$396, DW_AT_decl_line(0x98) .dwattr $C$DW$396, DW_AT_decl_column(0x05) $C$DW$397 .dwtag DW_TAG_enumerator .dwattr $C$DW$397, DW_AT_name("SL_TX_INHIBIT_THRESHOLD_HIGH") .dwattr $C$DW$397, DW_AT_const_value(0x05) .dwattr $C$DW$397, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$397, DW_AT_decl_line(0x99) .dwattr $C$DW$397, DW_AT_decl_column(0x05) $C$DW$398 .dwtag DW_TAG_enumerator .dwattr $C$DW$398, DW_AT_name("SL_TX_INHIBIT_THRESHOLD_MAX") .dwattr $C$DW$398, DW_AT_const_value(0x06) .dwattr $C$DW$398, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$398, DW_AT_decl_line(0x9a) .dwattr $C$DW$398, DW_AT_decl_column(0x05) .dwattr $C$DW$T$411, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$411, DW_AT_decl_line(0x94) .dwattr $C$DW$T$411, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$411 $C$DW$T$412 .dwtag DW_TAG_typedef .dwattr $C$DW$T$412, DW_AT_name("SlTxInhibitThreshold_e") .dwattr $C$DW$T$412, DW_AT_type(*$C$DW$T$411) .dwattr $C$DW$T$412, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$412, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$412, DW_AT_decl_line(0x9b) .dwattr $C$DW$T$412, DW_AT_decl_column(0x03) $C$DW$T$413 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$413, DW_AT_byte_size(0x01) $C$DW$399 .dwtag DW_TAG_enumerator .dwattr $C$DW$399, DW_AT_name("SL_BSD_SECURED_PRIVATE_KEY_IDX") .dwattr $C$DW$399, DW_AT_const_value(0x00) .dwattr $C$DW$399, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$399, DW_AT_decl_line(0x15f) .dwattr $C$DW$399, DW_AT_decl_column(0x03) $C$DW$400 .dwtag DW_TAG_enumerator .dwattr $C$DW$400, DW_AT_name("SL_BSD_SECURED_CERTIFICATE_IDX") .dwattr $C$DW$400, DW_AT_const_value(0x01) .dwattr $C$DW$400, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$400, DW_AT_decl_line(0x160) .dwattr $C$DW$400, DW_AT_decl_column(0x03) $C$DW$401 .dwtag DW_TAG_enumerator .dwattr $C$DW$401, DW_AT_name("SL_BSD_SECURED_CA_IDX") .dwattr $C$DW$401, DW_AT_const_value(0x02) .dwattr $C$DW$401, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$401, DW_AT_decl_line(0x161) .dwattr $C$DW$401, DW_AT_decl_column(0x03) $C$DW$402 .dwtag DW_TAG_enumerator .dwattr $C$DW$402, DW_AT_name("SL_BSD_SECURED_DH_IDX") .dwattr $C$DW$402, DW_AT_const_value(0x03) .dwattr $C$DW$402, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$402, DW_AT_decl_line(0x162) .dwattr $C$DW$402, DW_AT_decl_column(0x03) .dwattr $C$DW$T$413, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$413, DW_AT_decl_line(0x15e) .dwattr $C$DW$T$413, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$413 $C$DW$T$414 .dwtag DW_TAG_typedef .dwattr $C$DW$T$414, DW_AT_name("SlSockSecureSocketFilesIndex_e") .dwattr $C$DW$T$414, DW_AT_type(*$C$DW$T$413) .dwattr $C$DW$T$414, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$414, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$414, DW_AT_decl_line(0x163) .dwattr $C$DW$T$414, DW_AT_decl_column(0x02) $C$DW$T$415 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$415, DW_AT_byte_size(0x01) $C$DW$403 .dwtag DW_TAG_enumerator .dwattr $C$DW$403, DW_AT_name("SL_NETAPP_EVENT_IPV4_ACQUIRED") .dwattr $C$DW$403, DW_AT_const_value(0x01) .dwattr $C$DW$403, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$403, DW_AT_decl_line(0x4a) .dwattr $C$DW$403, DW_AT_decl_column(0x05) $C$DW$404 .dwtag DW_TAG_enumerator .dwattr $C$DW$404, DW_AT_name("SL_NETAPP_EVENT_IPV6_ACQUIRED") .dwattr $C$DW$404, DW_AT_const_value(0x02) .dwattr $C$DW$404, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$404, DW_AT_decl_line(0x4b) .dwattr $C$DW$404, DW_AT_decl_column(0x05) $C$DW$405 .dwtag DW_TAG_enumerator .dwattr $C$DW$405, DW_AT_name("SL_NETAPP_EVENT_IP_COLLISION") .dwattr $C$DW$405, DW_AT_const_value(0x03) .dwattr $C$DW$405, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$405, DW_AT_decl_line(0x4c) .dwattr $C$DW$405, DW_AT_decl_column(0x05) $C$DW$406 .dwtag DW_TAG_enumerator .dwattr $C$DW$406, DW_AT_name("SL_NETAPP_EVENT_DHCPV4_LEASED") .dwattr $C$DW$406, DW_AT_const_value(0x04) .dwattr $C$DW$406, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$406, DW_AT_decl_line(0x4d) .dwattr $C$DW$406, DW_AT_decl_column(0x05) $C$DW$407 .dwtag DW_TAG_enumerator .dwattr $C$DW$407, DW_AT_name("SL_NETAPP_EVENT_DHCPV4_RELEASED") .dwattr $C$DW$407, DW_AT_const_value(0x05) .dwattr $C$DW$407, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$407, DW_AT_decl_line(0x4e) .dwattr $C$DW$407, DW_AT_decl_column(0x05) $C$DW$408 .dwtag DW_TAG_enumerator .dwattr $C$DW$408, DW_AT_name("SL_NETAPP_EVENT_HTTP_TOKEN_GET") .dwattr $C$DW$408, DW_AT_const_value(0x06) .dwattr $C$DW$408, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$408, DW_AT_decl_line(0x4f) .dwattr $C$DW$408, DW_AT_decl_column(0x05) $C$DW$409 .dwtag DW_TAG_enumerator .dwattr $C$DW$409, DW_AT_name("SL_NETAPP_EVENT_HTTP_TOKEN_POST") .dwattr $C$DW$409, DW_AT_const_value(0x07) .dwattr $C$DW$409, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$409, DW_AT_decl_line(0x50) .dwattr $C$DW$409, DW_AT_decl_column(0x05) $C$DW$410 .dwtag DW_TAG_enumerator .dwattr $C$DW$410, DW_AT_name("SL_NETAPP_EVENT_IPV4_LOST") .dwattr $C$DW$410, DW_AT_const_value(0x08) .dwattr $C$DW$410, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$410, DW_AT_decl_line(0x51) .dwattr $C$DW$410, DW_AT_decl_column(0x05) $C$DW$411 .dwtag DW_TAG_enumerator .dwattr $C$DW$411, DW_AT_name("SL_NETAPP_EVENT_DHCP_IPV4_ACQUIRE_TIMEOUT") .dwattr $C$DW$411, DW_AT_const_value(0x09) .dwattr $C$DW$411, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$411, DW_AT_decl_line(0x52) .dwattr $C$DW$411, DW_AT_decl_column(0x05) $C$DW$412 .dwtag DW_TAG_enumerator .dwattr $C$DW$412, DW_AT_name("SL_NETAPP_EVENT_IPV6_LOST") .dwattr $C$DW$412, DW_AT_const_value(0x0a) .dwattr $C$DW$412, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$412, DW_AT_decl_line(0x53) .dwattr $C$DW$412, DW_AT_decl_column(0x05) $C$DW$413 .dwtag DW_TAG_enumerator .dwattr $C$DW$413, DW_AT_name("SL_NETAPP_EVENT_MAX") .dwattr $C$DW$413, DW_AT_const_value(0x0b) .dwattr $C$DW$413, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$413, DW_AT_decl_line(0x54) .dwattr $C$DW$413, DW_AT_decl_column(0x05) .dwattr $C$DW$T$415, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$415, DW_AT_decl_line(0x49) .dwattr $C$DW$T$415, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$415 $C$DW$T$416 .dwtag DW_TAG_typedef .dwattr $C$DW$T$416, DW_AT_name("SlNetAppEventId_e") .dwattr $C$DW$T$416, DW_AT_type(*$C$DW$T$415) .dwattr $C$DW$T$416, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$416, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$416, DW_AT_decl_line(0x55) .dwattr $C$DW$T$416, DW_AT_decl_column(0x03) $C$DW$T$417 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$417, DW_AT_byte_size(0x01) $C$DW$414 .dwtag DW_TAG_enumerator .dwattr $C$DW$414, DW_AT_name("SL_BSD_IPV6_ACQUIRED_TYPE_LOCAL") .dwattr $C$DW$414, DW_AT_const_value(0x01) .dwattr $C$DW$414, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$414, DW_AT_decl_line(0xd9) .dwattr $C$DW$414, DW_AT_decl_column(0x05) $C$DW$415 .dwtag DW_TAG_enumerator .dwattr $C$DW$415, DW_AT_name("SL_BSD_IPV6_ACQUIRED_TYPE_GLOBAL") .dwattr $C$DW$415, DW_AT_const_value(0x02) .dwattr $C$DW$415, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$415, DW_AT_decl_line(0xda) .dwattr $C$DW$415, DW_AT_decl_column(0x05) .dwattr $C$DW$T$417, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$417, DW_AT_decl_line(0xd8) .dwattr $C$DW$T$417, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$417 $C$DW$T$418 .dwtag DW_TAG_typedef .dwattr $C$DW$T$418, DW_AT_name("SlIpV6AcquiredAsyncType_e") .dwattr $C$DW$T$418, DW_AT_type(*$C$DW$T$417) .dwattr $C$DW$T$418, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$418, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$418, DW_AT_decl_line(0xdb) .dwattr $C$DW$T$418, DW_AT_decl_column(0x02) $C$DW$T$419 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$419, DW_AT_byte_size(0x01) $C$DW$416 .dwtag DW_TAG_enumerator .dwattr $C$DW$416, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_STATUS") .dwattr $C$DW$416, DW_AT_const_value(0x00) .dwattr $C$DW$416, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$416, DW_AT_decl_line(0x170) .dwattr $C$DW$416, DW_AT_decl_column(0x05) $C$DW$417 .dwtag DW_TAG_enumerator .dwattr $C$DW$417, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_VERSION") .dwattr $C$DW$417, DW_AT_const_value(0x01) .dwattr $C$DW$417, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$417, DW_AT_decl_line(0x171) .dwattr $C$DW$417, DW_AT_decl_column(0x05) $C$DW$418 .dwtag DW_TAG_enumerator .dwattr $C$DW$418, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_REQUEST_URI") .dwattr $C$DW$418, DW_AT_const_value(0x02) .dwattr $C$DW$418, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$418, DW_AT_decl_line(0x172) .dwattr $C$DW$418, DW_AT_decl_column(0x05) $C$DW$419 .dwtag DW_TAG_enumerator .dwattr $C$DW$419, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_QUERY_STRING") .dwattr $C$DW$419, DW_AT_const_value(0x03) .dwattr $C$DW$419, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$419, DW_AT_decl_line(0x173) .dwattr $C$DW$419, DW_AT_decl_column(0x05) $C$DW$420 .dwtag DW_TAG_enumerator .dwattr $C$DW$420, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_CONTENT_LEN") .dwattr $C$DW$420, DW_AT_const_value(0x04) .dwattr $C$DW$420, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$420, DW_AT_decl_line(0x174) .dwattr $C$DW$420, DW_AT_decl_column(0x05) $C$DW$421 .dwtag DW_TAG_enumerator .dwattr $C$DW$421, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_CONTENT_TYPE") .dwattr $C$DW$421, DW_AT_const_value(0x05) .dwattr $C$DW$421, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$421, DW_AT_decl_line(0x175) .dwattr $C$DW$421, DW_AT_decl_column(0x05) $C$DW$422 .dwtag DW_TAG_enumerator .dwattr $C$DW$422, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_LOCATION") .dwattr $C$DW$422, DW_AT_const_value(0x06) .dwattr $C$DW$422, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$422, DW_AT_decl_line(0x176) .dwattr $C$DW$422, DW_AT_decl_column(0x05) $C$DW$423 .dwtag DW_TAG_enumerator .dwattr $C$DW$423, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_SERVER") .dwattr $C$DW$423, DW_AT_const_value(0x07) .dwattr $C$DW$423, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$423, DW_AT_decl_line(0x177) .dwattr $C$DW$423, DW_AT_decl_column(0x05) $C$DW$424 .dwtag DW_TAG_enumerator .dwattr $C$DW$424, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_USER_AGENT") .dwattr $C$DW$424, DW_AT_const_value(0x08) .dwattr $C$DW$424, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$424, DW_AT_decl_line(0x178) .dwattr $C$DW$424, DW_AT_decl_column(0x05) $C$DW$425 .dwtag DW_TAG_enumerator .dwattr $C$DW$425, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_COOKIE") .dwattr $C$DW$425, DW_AT_const_value(0x09) .dwattr $C$DW$425, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$425, DW_AT_decl_line(0x179) .dwattr $C$DW$425, DW_AT_decl_column(0x05) $C$DW$426 .dwtag DW_TAG_enumerator .dwattr $C$DW$426, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_SET_COOKIE") .dwattr $C$DW$426, DW_AT_const_value(0x0a) .dwattr $C$DW$426, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$426, DW_AT_decl_line(0x17a) .dwattr $C$DW$426, DW_AT_decl_column(0x05) $C$DW$427 .dwtag DW_TAG_enumerator .dwattr $C$DW$427, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_UPGRADE") .dwattr $C$DW$427, DW_AT_const_value(0x0b) .dwattr $C$DW$427, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$427, DW_AT_decl_line(0x17b) .dwattr $C$DW$427, DW_AT_decl_column(0x05) $C$DW$428 .dwtag DW_TAG_enumerator .dwattr $C$DW$428, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_REFERER") .dwattr $C$DW$428, DW_AT_const_value(0x0c) .dwattr $C$DW$428, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$428, DW_AT_decl_line(0x17c) .dwattr $C$DW$428, DW_AT_decl_column(0x05) $C$DW$429 .dwtag DW_TAG_enumerator .dwattr $C$DW$429, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_ACCEPT") .dwattr $C$DW$429, DW_AT_const_value(0x0d) .dwattr $C$DW$429, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$429, DW_AT_decl_line(0x17d) .dwattr $C$DW$429, DW_AT_decl_column(0x05) $C$DW$430 .dwtag DW_TAG_enumerator .dwattr $C$DW$430, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_CONTENT_ENCODING") .dwattr $C$DW$430, DW_AT_const_value(0x0e) .dwattr $C$DW$430, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$430, DW_AT_decl_line(0x17e) .dwattr $C$DW$430, DW_AT_decl_column(0x05) $C$DW$431 .dwtag DW_TAG_enumerator .dwattr $C$DW$431, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_CONTENT_DISPOSITION") .dwattr $C$DW$431, DW_AT_const_value(0x0f) .dwattr $C$DW$431, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$431, DW_AT_decl_line(0x17f) .dwattr $C$DW$431, DW_AT_decl_column(0x05) $C$DW$432 .dwtag DW_TAG_enumerator .dwattr $C$DW$432, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_CONNECTION") .dwattr $C$DW$432, DW_AT_const_value(0x10) .dwattr $C$DW$432, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$432, DW_AT_decl_line(0x180) .dwattr $C$DW$432, DW_AT_decl_column(0x05) $C$DW$433 .dwtag DW_TAG_enumerator .dwattr $C$DW$433, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_ETAG") .dwattr $C$DW$433, DW_AT_const_value(0x11) .dwattr $C$DW$433, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$433, DW_AT_decl_line(0x181) .dwattr $C$DW$433, DW_AT_decl_column(0x05) $C$DW$434 .dwtag DW_TAG_enumerator .dwattr $C$DW$434, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_DATE") .dwattr $C$DW$434, DW_AT_const_value(0x12) .dwattr $C$DW$434, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$434, DW_AT_decl_line(0x182) .dwattr $C$DW$434, DW_AT_decl_column(0x05) $C$DW$435 .dwtag DW_TAG_enumerator .dwattr $C$DW$435, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HEADER_HOST") .dwattr $C$DW$435, DW_AT_const_value(0x13) .dwattr $C$DW$435, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$435, DW_AT_decl_line(0x183) .dwattr $C$DW$435, DW_AT_decl_column(0x05) $C$DW$436 .dwtag DW_TAG_enumerator .dwattr $C$DW$436, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_ACCEPT_ENCODING") .dwattr $C$DW$436, DW_AT_const_value(0x14) .dwattr $C$DW$436, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$436, DW_AT_decl_line(0x184) .dwattr $C$DW$436, DW_AT_decl_column(0x05) $C$DW$437 .dwtag DW_TAG_enumerator .dwattr $C$DW$437, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_ACCEPT_LANGUAGE") .dwattr $C$DW$437, DW_AT_const_value(0x15) .dwattr $C$DW$437, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$437, DW_AT_decl_line(0x185) .dwattr $C$DW$437, DW_AT_decl_column(0x05) $C$DW$438 .dwtag DW_TAG_enumerator .dwattr $C$DW$438, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_CONTENT_LANGUAGE") .dwattr $C$DW$438, DW_AT_const_value(0x16) .dwattr $C$DW$438, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$438, DW_AT_decl_line(0x186) .dwattr $C$DW$438, DW_AT_decl_column(0x05) $C$DW$439 .dwtag DW_TAG_enumerator .dwattr $C$DW$439, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_ORIGIN") .dwattr $C$DW$439, DW_AT_const_value(0x17) .dwattr $C$DW$439, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$439, DW_AT_decl_line(0x187) .dwattr $C$DW$439, DW_AT_decl_column(0x05) $C$DW$440 .dwtag DW_TAG_enumerator .dwattr $C$DW$440, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_ORIGIN_CONTROL_ACCESS") .dwattr $C$DW$440, DW_AT_const_value(0x18) .dwattr $C$DW$440, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$440, DW_AT_decl_line(0x188) .dwattr $C$DW$440, DW_AT_decl_column(0x05) $C$DW$441 .dwtag DW_TAG_enumerator .dwattr $C$DW$441, DW_AT_name("SL_NETAPP_REQUEST_METADATA_TYPE_HTTP_NONE") .dwattr $C$DW$441, DW_AT_const_value(0x19) .dwattr $C$DW$441, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$441, DW_AT_decl_line(0x189) .dwattr $C$DW$441, DW_AT_decl_column(0x05) .dwattr $C$DW$T$419, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$419, DW_AT_decl_line(0x16f) .dwattr $C$DW$T$419, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$419 $C$DW$T$420 .dwtag DW_TAG_typedef .dwattr $C$DW$T$420, DW_AT_name("SlNetAppMetadataHTTPTypes_e") .dwattr $C$DW$T$420, DW_AT_type(*$C$DW$T$419) .dwattr $C$DW$T$420, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$420, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$420, DW_AT_decl_line(0x18a) .dwattr $C$DW$T$420, DW_AT_decl_column(0x03) $C$DW$T$421 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$421, DW_AT_byte_size(0x02) $C$DW$442 .dwtag DW_TAG_enumerator .dwattr $C$DW$442, DW_AT_name("SL_NETAPP_RESPONSE_NONE") .dwattr $C$DW$442, DW_AT_const_value(0x00) .dwattr $C$DW$442, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$442, DW_AT_decl_line(0x18e) .dwattr $C$DW$442, DW_AT_decl_column(0x05) $C$DW$443 .dwtag DW_TAG_enumerator .dwattr $C$DW$443, DW_AT_name("SL_NETAPP_RESPONSE_PENDING") .dwattr $C$DW$443, DW_AT_const_value(0x01) .dwattr $C$DW$443, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$443, DW_AT_decl_line(0x18f) .dwattr $C$DW$443, DW_AT_decl_column(0x05) $C$DW$444 .dwtag DW_TAG_enumerator .dwattr $C$DW$444, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_101_SWITCHING_PROTOCOLS") .dwattr $C$DW$444, DW_AT_const_value(0x65) .dwattr $C$DW$444, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$444, DW_AT_decl_line(0x191) .dwattr $C$DW$444, DW_AT_decl_column(0x05) $C$DW$445 .dwtag DW_TAG_enumerator .dwattr $C$DW$445, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_200_OK") .dwattr $C$DW$445, DW_AT_const_value(0xc8) .dwattr $C$DW$445, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$445, DW_AT_decl_line(0x192) .dwattr $C$DW$445, DW_AT_decl_column(0x05) $C$DW$446 .dwtag DW_TAG_enumerator .dwattr $C$DW$446, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_201_CREATED") .dwattr $C$DW$446, DW_AT_const_value(0xc9) .dwattr $C$DW$446, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$446, DW_AT_decl_line(0x193) .dwattr $C$DW$446, DW_AT_decl_column(0x05) $C$DW$447 .dwtag DW_TAG_enumerator .dwattr $C$DW$447, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_202_ACCEPTED") .dwattr $C$DW$447, DW_AT_const_value(0xca) .dwattr $C$DW$447, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$447, DW_AT_decl_line(0x194) .dwattr $C$DW$447, DW_AT_decl_column(0x05) $C$DW$448 .dwtag DW_TAG_enumerator .dwattr $C$DW$448, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_204_OK_NO_CONTENT") .dwattr $C$DW$448, DW_AT_const_value(0xcc) .dwattr $C$DW$448, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$448, DW_AT_decl_line(0x195) .dwattr $C$DW$448, DW_AT_decl_column(0x05) $C$DW$449 .dwtag DW_TAG_enumerator .dwattr $C$DW$449, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_301_MOVED_PERMANENTLY") .dwattr $C$DW$449, DW_AT_const_value(0x12d) .dwattr $C$DW$449, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$449, DW_AT_decl_line(0x196) .dwattr $C$DW$449, DW_AT_decl_column(0x05) $C$DW$450 .dwtag DW_TAG_enumerator .dwattr $C$DW$450, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_302_MOVED_TEMPORARILY") .dwattr $C$DW$450, DW_AT_const_value(0x12e) .dwattr $C$DW$450, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$450, DW_AT_decl_line(0x197) .dwattr $C$DW$450, DW_AT_decl_column(0x05) $C$DW$451 .dwtag DW_TAG_enumerator .dwattr $C$DW$451, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_303_SEE_OTHER") .dwattr $C$DW$451, DW_AT_const_value(0x12f) .dwattr $C$DW$451, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$451, DW_AT_decl_line(0x198) .dwattr $C$DW$451, DW_AT_decl_column(0x05) $C$DW$452 .dwtag DW_TAG_enumerator .dwattr $C$DW$452, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_304_NOT_MODIFIED") .dwattr $C$DW$452, DW_AT_const_value(0x130) .dwattr $C$DW$452, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$452, DW_AT_decl_line(0x199) .dwattr $C$DW$452, DW_AT_decl_column(0x05) $C$DW$453 .dwtag DW_TAG_enumerator .dwattr $C$DW$453, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_400_BAD_REQUEST") .dwattr $C$DW$453, DW_AT_const_value(0x190) .dwattr $C$DW$453, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$453, DW_AT_decl_line(0x19a) .dwattr $C$DW$453, DW_AT_decl_column(0x05) $C$DW$454 .dwtag DW_TAG_enumerator .dwattr $C$DW$454, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_403_FORBIDDEN") .dwattr $C$DW$454, DW_AT_const_value(0x193) .dwattr $C$DW$454, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$454, DW_AT_decl_line(0x19b) .dwattr $C$DW$454, DW_AT_decl_column(0x05) $C$DW$455 .dwtag DW_TAG_enumerator .dwattr $C$DW$455, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_404_NOT_FOUND") .dwattr $C$DW$455, DW_AT_const_value(0x194) .dwattr $C$DW$455, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$455, DW_AT_decl_line(0x19c) .dwattr $C$DW$455, DW_AT_decl_column(0x05) $C$DW$456 .dwtag DW_TAG_enumerator .dwattr $C$DW$456, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_405_METHOD_NOT_ALLOWED") .dwattr $C$DW$456, DW_AT_const_value(0x195) .dwattr $C$DW$456, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$456, DW_AT_decl_line(0x19d) .dwattr $C$DW$456, DW_AT_decl_column(0x05) $C$DW$457 .dwtag DW_TAG_enumerator .dwattr $C$DW$457, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_500_INTERNAL_SERVER_ERROR") .dwattr $C$DW$457, DW_AT_const_value(0x1f4) .dwattr $C$DW$457, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$457, DW_AT_decl_line(0x19e) .dwattr $C$DW$457, DW_AT_decl_column(0x05) $C$DW$458 .dwtag DW_TAG_enumerator .dwattr $C$DW$458, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_503_SERVICE_UNAVAILABLE") .dwattr $C$DW$458, DW_AT_const_value(0x1f7) .dwattr $C$DW$458, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$458, DW_AT_decl_line(0x19f) .dwattr $C$DW$458, DW_AT_decl_column(0x05) $C$DW$459 .dwtag DW_TAG_enumerator .dwattr $C$DW$459, DW_AT_name("SL_NETAPP_HTTP_RESPONSE_504_GATEWAY_TIMEOUT") .dwattr $C$DW$459, DW_AT_const_value(0x1f8) .dwattr $C$DW$459, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$459, DW_AT_decl_line(0x1a0) .dwattr $C$DW$459, DW_AT_decl_column(0x05) .dwattr $C$DW$T$421, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$421, DW_AT_decl_line(0x18d) .dwattr $C$DW$T$421, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$421 $C$DW$T$422 .dwtag DW_TAG_typedef .dwattr $C$DW$T$422, DW_AT_name("SlNetAppResponseCode_e") .dwattr $C$DW$T$422, DW_AT_type(*$C$DW$T$421) .dwattr $C$DW$T$422, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$422, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$422, DW_AT_decl_line(0x1a1) .dwattr $C$DW$T$422, DW_AT_decl_column(0x03) $C$DW$T$423 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$423, DW_AT_byte_size(0x01) $C$DW$460 .dwtag DW_TAG_enumerator .dwattr $C$DW$460, DW_AT_name("SL_NETAPP_FULL_SERVICE_WITH_TEXT_IPV4_TYPE") .dwattr $C$DW$460, DW_AT_const_value(0x01) .dwattr $C$DW$460, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$460, DW_AT_decl_line(0x1ca) .dwattr $C$DW$460, DW_AT_decl_column(0x05) $C$DW$461 .dwtag DW_TAG_enumerator .dwattr $C$DW$461, DW_AT_name("SL_NETAPP_FULL_SERVICE_IPV4_TYPE") .dwattr $C$DW$461, DW_AT_const_value(0x02) .dwattr $C$DW$461, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$461, DW_AT_decl_line(0x1cb) .dwattr $C$DW$461, DW_AT_decl_column(0x05) $C$DW$462 .dwtag DW_TAG_enumerator .dwattr $C$DW$462, DW_AT_name("SL_NETAPP_SHORT_SERVICE_IPV4_TYPE") .dwattr $C$DW$462, DW_AT_const_value(0x03) .dwattr $C$DW$462, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$462, DW_AT_decl_line(0x1cc) .dwattr $C$DW$462, DW_AT_decl_column(0x05) $C$DW$463 .dwtag DW_TAG_enumerator .dwattr $C$DW$463, DW_AT_name("SL_NETAPP_FULL_SERVICE_WITH_TEXT_IPV6_TYPE") .dwattr $C$DW$463, DW_AT_const_value(0x04) .dwattr $C$DW$463, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$463, DW_AT_decl_line(0x1cd) .dwattr $C$DW$463, DW_AT_decl_column(0x05) $C$DW$464 .dwtag DW_TAG_enumerator .dwattr $C$DW$464, DW_AT_name("SL_NETAPP_FULL_SERVICE_IPV6_TYPE") .dwattr $C$DW$464, DW_AT_const_value(0x05) .dwattr $C$DW$464, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$464, DW_AT_decl_line(0x1ce) .dwattr $C$DW$464, DW_AT_decl_column(0x05) $C$DW$465 .dwtag DW_TAG_enumerator .dwattr $C$DW$465, DW_AT_name("SL_NETAPP_SHORT_SERVICE_IPV6_TYPE") .dwattr $C$DW$465, DW_AT_const_value(0x06) .dwattr $C$DW$465, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$465, DW_AT_decl_line(0x1cf) .dwattr $C$DW$465, DW_AT_decl_column(0x05) .dwattr $C$DW$T$423, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$423, DW_AT_decl_line(0x1c9) .dwattr $C$DW$T$423, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$423 $C$DW$T$424 .dwtag DW_TAG_typedef .dwattr $C$DW$T$424, DW_AT_name("SlNetAppGetServiceListType_e") .dwattr $C$DW$T$424, DW_AT_type(*$C$DW$T$423) .dwattr $C$DW$T$424, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$424, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$424, DW_AT_decl_line(0x1d0) .dwattr $C$DW$T$424, DW_AT_decl_column(0x03) $C$DW$T$425 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$425, DW_AT_byte_size(0x01) $C$DW$466 .dwtag DW_TAG_enumerator .dwattr $C$DW$466, DW_AT_name("SL_WLAN_P2P_WPS_METHOD_DEFAULT") .dwattr $C$DW$466, DW_AT_const_value(0x00) .dwattr $C$DW$466, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$466, DW_AT_decl_line(0x55) .dwattr $C$DW$466, DW_AT_decl_column(0x05) $C$DW$467 .dwtag DW_TAG_enumerator .dwattr $C$DW$467, DW_AT_name("SL_WLAN_P2P_WPS_METHOD_PIN_USER") .dwattr $C$DW$467, DW_AT_const_value(0x01) .dwattr $C$DW$467, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$467, DW_AT_decl_line(0x56) .dwattr $C$DW$467, DW_AT_decl_column(0x05) $C$DW$468 .dwtag DW_TAG_enumerator .dwattr $C$DW$468, DW_AT_name("SL_WLAN_P2P_WPS_METHOD_PIN_MACHINE") .dwattr $C$DW$468, DW_AT_const_value(0x02) .dwattr $C$DW$468, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$468, DW_AT_decl_line(0x57) .dwattr $C$DW$468, DW_AT_decl_column(0x05) $C$DW$469 .dwtag DW_TAG_enumerator .dwattr $C$DW$469, DW_AT_name("SL_WLAN_P2P_WPS_METHOD_REKEY") .dwattr $C$DW$469, DW_AT_const_value(0x03) .dwattr $C$DW$469, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$469, DW_AT_decl_line(0x58) .dwattr $C$DW$469, DW_AT_decl_column(0x05) $C$DW$470 .dwtag DW_TAG_enumerator .dwattr $C$DW$470, DW_AT_name("SL_WLAN_P2P_WPS_METHOD_PBC") .dwattr $C$DW$470, DW_AT_const_value(0x04) .dwattr $C$DW$470, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$470, DW_AT_decl_line(0x59) .dwattr $C$DW$470, DW_AT_decl_column(0x05) $C$DW$471 .dwtag DW_TAG_enumerator .dwattr $C$DW$471, DW_AT_name("SL_WLAN_P2P_WPS_METHOD_REGISTRAR") .dwattr $C$DW$471, DW_AT_const_value(0x05) .dwattr $C$DW$471, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$471, DW_AT_decl_line(0x5a) .dwattr $C$DW$471, DW_AT_decl_column(0x05) .dwattr $C$DW$T$425, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$425, DW_AT_decl_line(0x54) .dwattr $C$DW$T$425, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$425 $C$DW$T$426 .dwtag DW_TAG_typedef .dwattr $C$DW$T$426, DW_AT_name("SlWlanP2PWpsMethod_e") .dwattr $C$DW$T$426, DW_AT_type(*$C$DW$T$425) .dwattr $C$DW$T$426, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$426, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$426, DW_AT_decl_line(0x5b) .dwattr $C$DW$T$426, DW_AT_decl_column(0x03) $C$DW$T$427 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$427, DW_AT_byte_size(0x01) $C$DW$472 .dwtag DW_TAG_enumerator .dwattr $C$DW$472, DW_AT_name("SL_WLAN_EVENT_CONNECT") .dwattr $C$DW$472, DW_AT_const_value(0x01) .dwattr $C$DW$472, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$472, DW_AT_decl_line(0x60) .dwattr $C$DW$472, DW_AT_decl_column(0x05) $C$DW$473 .dwtag DW_TAG_enumerator .dwattr $C$DW$473, DW_AT_name("SL_WLAN_EVENT_DISCONNECT") .dwattr $C$DW$473, DW_AT_const_value(0x02) .dwattr $C$DW$473, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$473, DW_AT_decl_line(0x61) .dwattr $C$DW$473, DW_AT_decl_column(0x05) $C$DW$474 .dwtag DW_TAG_enumerator .dwattr $C$DW$474, DW_AT_name("SL_WLAN_EVENT_STA_ADDED") .dwattr $C$DW$474, DW_AT_const_value(0x03) .dwattr $C$DW$474, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$474, DW_AT_decl_line(0x62) .dwattr $C$DW$474, DW_AT_decl_column(0x05) $C$DW$475 .dwtag DW_TAG_enumerator .dwattr $C$DW$475, DW_AT_name("SL_WLAN_EVENT_STA_REMOVED") .dwattr $C$DW$475, DW_AT_const_value(0x04) .dwattr $C$DW$475, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$475, DW_AT_decl_line(0x63) .dwattr $C$DW$475, DW_AT_decl_column(0x05) $C$DW$476 .dwtag DW_TAG_enumerator .dwattr $C$DW$476, DW_AT_name("SL_WLAN_EVENT_P2P_CONNECT") .dwattr $C$DW$476, DW_AT_const_value(0x05) .dwattr $C$DW$476, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$476, DW_AT_decl_line(0x65) .dwattr $C$DW$476, DW_AT_decl_column(0x05) $C$DW$477 .dwtag DW_TAG_enumerator .dwattr $C$DW$477, DW_AT_name("SL_WLAN_EVENT_P2P_DISCONNECT") .dwattr $C$DW$477, DW_AT_const_value(0x06) .dwattr $C$DW$477, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$477, DW_AT_decl_line(0x66) .dwattr $C$DW$477, DW_AT_decl_column(0x05) $C$DW$478 .dwtag DW_TAG_enumerator .dwattr $C$DW$478, DW_AT_name("SL_WLAN_EVENT_P2P_CLIENT_ADDED") .dwattr $C$DW$478, DW_AT_const_value(0x07) .dwattr $C$DW$478, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$478, DW_AT_decl_line(0x67) .dwattr $C$DW$478, DW_AT_decl_column(0x05) $C$DW$479 .dwtag DW_TAG_enumerator .dwattr $C$DW$479, DW_AT_name("SL_WLAN_EVENT_P2P_CLIENT_REMOVED") .dwattr $C$DW$479, DW_AT_const_value(0x08) .dwattr $C$DW$479, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$479, DW_AT_decl_line(0x68) .dwattr $C$DW$479, DW_AT_decl_column(0x05) $C$DW$480 .dwtag DW_TAG_enumerator .dwattr $C$DW$480, DW_AT_name("SL_WLAN_EVENT_P2P_DEVFOUND") .dwattr $C$DW$480, DW_AT_const_value(0x09) .dwattr $C$DW$480, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$480, DW_AT_decl_line(0x69) .dwattr $C$DW$480, DW_AT_decl_column(0x05) $C$DW$481 .dwtag DW_TAG_enumerator .dwattr $C$DW$481, DW_AT_name("SL_WLAN_EVENT_P2P_REQUEST") .dwattr $C$DW$481, DW_AT_const_value(0x0a) .dwattr $C$DW$481, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$481, DW_AT_decl_line(0x6a) .dwattr $C$DW$481, DW_AT_decl_column(0x05) $C$DW$482 .dwtag DW_TAG_enumerator .dwattr $C$DW$482, DW_AT_name("SL_WLAN_EVENT_P2P_CONNECTFAIL") .dwattr $C$DW$482, DW_AT_const_value(0x0b) .dwattr $C$DW$482, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$482, DW_AT_decl_line(0x6b) .dwattr $C$DW$482, DW_AT_decl_column(0x05) $C$DW$483 .dwtag DW_TAG_enumerator .dwattr $C$DW$483, DW_AT_name("SL_WLAN_EVENT_RXFILTER") .dwattr $C$DW$483, DW_AT_const_value(0x0c) .dwattr $C$DW$483, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$483, DW_AT_decl_line(0x6d) .dwattr $C$DW$483, DW_AT_decl_column(0x05) $C$DW$484 .dwtag DW_TAG_enumerator .dwattr $C$DW$484, DW_AT_name("SL_WLAN_EVENT_PROVISIONING_STATUS") .dwattr $C$DW$484, DW_AT_const_value(0x0d) .dwattr $C$DW$484, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$484, DW_AT_decl_line(0x6e) .dwattr $C$DW$484, DW_AT_decl_column(0x05) $C$DW$485 .dwtag DW_TAG_enumerator .dwattr $C$DW$485, DW_AT_name("SL_WLAN_EVENT_PROVISIONING_PROFILE_ADDED") .dwattr $C$DW$485, DW_AT_const_value(0x0e) .dwattr $C$DW$485, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$485, DW_AT_decl_line(0x6f) .dwattr $C$DW$485, DW_AT_decl_column(0x05) $C$DW$486 .dwtag DW_TAG_enumerator .dwattr $C$DW$486, DW_AT_name("SL_WLAN_EVENT_MAX") .dwattr $C$DW$486, DW_AT_const_value(0x0f) .dwattr $C$DW$486, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$486, DW_AT_decl_line(0x70) .dwattr $C$DW$486, DW_AT_decl_column(0x05) .dwattr $C$DW$T$427, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$427, DW_AT_decl_line(0x5f) .dwattr $C$DW$T$427, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$427 $C$DW$T$428 .dwtag DW_TAG_typedef .dwattr $C$DW$T$428, DW_AT_name("SlWlanEventId_e") .dwattr $C$DW$T$428, DW_AT_type(*$C$DW$T$427) .dwattr $C$DW$T$428, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$428, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$428, DW_AT_decl_line(0x72) .dwattr $C$DW$T$428, DW_AT_decl_column(0x03) $C$DW$T$429 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$429, DW_AT_byte_size(0x01) $C$DW$487 .dwtag DW_TAG_enumerator .dwattr $C$DW$487, DW_AT_name("SL_WLAN_RATE_1M") .dwattr $C$DW$487, DW_AT_const_value(0x01) .dwattr $C$DW$487, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$487, DW_AT_decl_line(0x1a6) .dwattr $C$DW$487, DW_AT_decl_column(0x05) $C$DW$488 .dwtag DW_TAG_enumerator .dwattr $C$DW$488, DW_AT_name("SL_WLAN_RATE_2M") .dwattr $C$DW$488, DW_AT_const_value(0x02) .dwattr $C$DW$488, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$488, DW_AT_decl_line(0x1a7) .dwattr $C$DW$488, DW_AT_decl_column(0x05) $C$DW$489 .dwtag DW_TAG_enumerator .dwattr $C$DW$489, DW_AT_name("SL_WLAN_RATE_5_5M") .dwattr $C$DW$489, DW_AT_const_value(0x03) .dwattr $C$DW$489, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$489, DW_AT_decl_line(0x1a8) .dwattr $C$DW$489, DW_AT_decl_column(0x05) $C$DW$490 .dwtag DW_TAG_enumerator .dwattr $C$DW$490, DW_AT_name("SL_WLAN_RATE_11M") .dwattr $C$DW$490, DW_AT_const_value(0x04) .dwattr $C$DW$490, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$490, DW_AT_decl_line(0x1a9) .dwattr $C$DW$490, DW_AT_decl_column(0x05) $C$DW$491 .dwtag DW_TAG_enumerator .dwattr $C$DW$491, DW_AT_name("SL_WLAN_RATE_6M") .dwattr $C$DW$491, DW_AT_const_value(0x06) .dwattr $C$DW$491, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$491, DW_AT_decl_line(0x1aa) .dwattr $C$DW$491, DW_AT_decl_column(0x05) $C$DW$492 .dwtag DW_TAG_enumerator .dwattr $C$DW$492, DW_AT_name("SL_WLAN_RATE_9M") .dwattr $C$DW$492, DW_AT_const_value(0x07) .dwattr $C$DW$492, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$492, DW_AT_decl_line(0x1ab) .dwattr $C$DW$492, DW_AT_decl_column(0x05) $C$DW$493 .dwtag DW_TAG_enumerator .dwattr $C$DW$493, DW_AT_name("SL_WLAN_RATE_12M") .dwattr $C$DW$493, DW_AT_const_value(0x08) .dwattr $C$DW$493, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$493, DW_AT_decl_line(0x1ac) .dwattr $C$DW$493, DW_AT_decl_column(0x05) $C$DW$494 .dwtag DW_TAG_enumerator .dwattr $C$DW$494, DW_AT_name("SL_WLAN_RATE_18M") .dwattr $C$DW$494, DW_AT_const_value(0x09) .dwattr $C$DW$494, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$494, DW_AT_decl_line(0x1ad) .dwattr $C$DW$494, DW_AT_decl_column(0x05) $C$DW$495 .dwtag DW_TAG_enumerator .dwattr $C$DW$495, DW_AT_name("SL_WLAN_RATE_24M") .dwattr $C$DW$495, DW_AT_const_value(0x0a) .dwattr $C$DW$495, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$495, DW_AT_decl_line(0x1ae) .dwattr $C$DW$495, DW_AT_decl_column(0x05) $C$DW$496 .dwtag DW_TAG_enumerator .dwattr $C$DW$496, DW_AT_name("SL_WLAN_RATE_36M") .dwattr $C$DW$496, DW_AT_const_value(0x0b) .dwattr $C$DW$496, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$496, DW_AT_decl_line(0x1af) .dwattr $C$DW$496, DW_AT_decl_column(0x05) $C$DW$497 .dwtag DW_TAG_enumerator .dwattr $C$DW$497, DW_AT_name("SL_WLAN_RATE_48M") .dwattr $C$DW$497, DW_AT_const_value(0x0c) .dwattr $C$DW$497, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$497, DW_AT_decl_line(0x1b0) .dwattr $C$DW$497, DW_AT_decl_column(0x05) $C$DW$498 .dwtag DW_TAG_enumerator .dwattr $C$DW$498, DW_AT_name("SL_WLAN_RATE_54M") .dwattr $C$DW$498, DW_AT_const_value(0x0d) .dwattr $C$DW$498, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$498, DW_AT_decl_line(0x1b1) .dwattr $C$DW$498, DW_AT_decl_column(0x05) $C$DW$499 .dwtag DW_TAG_enumerator .dwattr $C$DW$499, DW_AT_name("SL_WLAN_RATE_MCS_0") .dwattr $C$DW$499, DW_AT_const_value(0x0e) .dwattr $C$DW$499, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$499, DW_AT_decl_line(0x1b2) .dwattr $C$DW$499, DW_AT_decl_column(0x05) $C$DW$500 .dwtag DW_TAG_enumerator .dwattr $C$DW$500, DW_AT_name("SL_WLAN_RATE_MCS_1") .dwattr $C$DW$500, DW_AT_const_value(0x0f) .dwattr $C$DW$500, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$500, DW_AT_decl_line(0x1b3) .dwattr $C$DW$500, DW_AT_decl_column(0x05) $C$DW$501 .dwtag DW_TAG_enumerator .dwattr $C$DW$501, DW_AT_name("SL_WLAN_RATE_MCS_2") .dwattr $C$DW$501, DW_AT_const_value(0x10) .dwattr $C$DW$501, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$501, DW_AT_decl_line(0x1b4) .dwattr $C$DW$501, DW_AT_decl_column(0x05) $C$DW$502 .dwtag DW_TAG_enumerator .dwattr $C$DW$502, DW_AT_name("SL_WLAN_RATE_MCS_3") .dwattr $C$DW$502, DW_AT_const_value(0x11) .dwattr $C$DW$502, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$502, DW_AT_decl_line(0x1b5) .dwattr $C$DW$502, DW_AT_decl_column(0x05) $C$DW$503 .dwtag DW_TAG_enumerator .dwattr $C$DW$503, DW_AT_name("SL_WLAN_RATE_MCS_4") .dwattr $C$DW$503, DW_AT_const_value(0x12) .dwattr $C$DW$503, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$503, DW_AT_decl_line(0x1b6) .dwattr $C$DW$503, DW_AT_decl_column(0x05) $C$DW$504 .dwtag DW_TAG_enumerator .dwattr $C$DW$504, DW_AT_name("SL_WLAN_RATE_MCS_5") .dwattr $C$DW$504, DW_AT_const_value(0x13) .dwattr $C$DW$504, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$504, DW_AT_decl_line(0x1b7) .dwattr $C$DW$504, DW_AT_decl_column(0x05) $C$DW$505 .dwtag DW_TAG_enumerator .dwattr $C$DW$505, DW_AT_name("SL_WLAN_RATE_MCS_6") .dwattr $C$DW$505, DW_AT_const_value(0x14) .dwattr $C$DW$505, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$505, DW_AT_decl_line(0x1b8) .dwattr $C$DW$505, DW_AT_decl_column(0x05) $C$DW$506 .dwtag DW_TAG_enumerator .dwattr $C$DW$506, DW_AT_name("SL_WLAN_RATE_MCS_7") .dwattr $C$DW$506, DW_AT_const_value(0x15) .dwattr $C$DW$506, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$506, DW_AT_decl_line(0x1b9) .dwattr $C$DW$506, DW_AT_decl_column(0x05) $C$DW$507 .dwtag DW_TAG_enumerator .dwattr $C$DW$507, DW_AT_name("SL_WLAN_MAX_NUM_RATES") .dwattr $C$DW$507, DW_AT_const_value(0xff) .dwattr $C$DW$507, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$507, DW_AT_decl_line(0x1ba) .dwattr $C$DW$507, DW_AT_decl_column(0x05) .dwattr $C$DW$T$429, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$429, DW_AT_decl_line(0x1a5) .dwattr $C$DW$T$429, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$429 $C$DW$T$430 .dwtag DW_TAG_typedef .dwattr $C$DW$T$430, DW_AT_name("SlWlanRateIndex_e") .dwattr $C$DW$T$430, DW_AT_type(*$C$DW$T$429) .dwattr $C$DW$T$430, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$430, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$430, DW_AT_decl_line(0x1bb) .dwattr $C$DW$T$430, DW_AT_decl_column(0x02) $C$DW$T$431 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$431, DW_AT_byte_size(0x01) $C$DW$508 .dwtag DW_TAG_enumerator .dwattr $C$DW$508, DW_AT_name("SL_WLAN_DEV_PW_DEFAULT") .dwattr $C$DW$508, DW_AT_const_value(0x00) .dwattr $C$DW$508, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$508, DW_AT_decl_line(0x1bf) .dwattr $C$DW$508, DW_AT_decl_column(0x05) $C$DW$509 .dwtag DW_TAG_enumerator .dwattr $C$DW$509, DW_AT_name("SL_WLAN_DEV_PW_PIN_KEYPAD") .dwattr $C$DW$509, DW_AT_const_value(0x01) .dwattr $C$DW$509, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$509, DW_AT_decl_line(0x1c0) .dwattr $C$DW$509, DW_AT_decl_column(0x05) $C$DW$510 .dwtag DW_TAG_enumerator .dwattr $C$DW$510, DW_AT_name("SL_WLAN_DEV_PW_PUSH_BUTTON") .dwattr $C$DW$510, DW_AT_const_value(0x04) .dwattr $C$DW$510, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$510, DW_AT_decl_line(0x1c1) .dwattr $C$DW$510, DW_AT_decl_column(0x05) $C$DW$511 .dwtag DW_TAG_enumerator .dwattr $C$DW$511, DW_AT_name("SL_WLAN_DEV_PW_PIN_DISPLAY") .dwattr $C$DW$511, DW_AT_const_value(0x05) .dwattr $C$DW$511, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$511, DW_AT_decl_line(0x1c2) .dwattr $C$DW$511, DW_AT_decl_column(0x05) .dwattr $C$DW$T$431, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$431, DW_AT_decl_line(0x1be) .dwattr $C$DW$T$431, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$431 $C$DW$T$432 .dwtag DW_TAG_typedef .dwattr $C$DW$T$432, DW_AT_name("SlWlanP2pDevPwdMethod_e") .dwattr $C$DW$T$432, DW_AT_type(*$C$DW$T$431) .dwattr $C$DW$T$432, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$432, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$432, DW_AT_decl_line(0x1c3) .dwattr $C$DW$T$432, DW_AT_decl_column(0x03) $C$DW$T$433 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$433, DW_AT_byte_size(0x01) $C$DW$512 .dwtag DW_TAG_enumerator .dwattr $C$DW$512, DW_AT_name("ROLE_STA") .dwattr $C$DW$512, DW_AT_const_value(0x00) .dwattr $C$DW$512, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$512, DW_AT_decl_line(0x1f5) .dwattr $C$DW$512, DW_AT_decl_column(0x05) $C$DW$513 .dwtag DW_TAG_enumerator .dwattr $C$DW$513, DW_AT_name("ROLE_RESERVED") .dwattr $C$DW$513, DW_AT_const_value(0x01) .dwattr $C$DW$513, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$513, DW_AT_decl_line(0x1f6) .dwattr $C$DW$513, DW_AT_decl_column(0x05) $C$DW$514 .dwtag DW_TAG_enumerator .dwattr $C$DW$514, DW_AT_name("ROLE_AP") .dwattr $C$DW$514, DW_AT_const_value(0x02) .dwattr $C$DW$514, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$514, DW_AT_decl_line(0x1f7) .dwattr $C$DW$514, DW_AT_decl_column(0x05) $C$DW$515 .dwtag DW_TAG_enumerator .dwattr $C$DW$515, DW_AT_name("ROLE_P2P") .dwattr $C$DW$515, DW_AT_const_value(0x03) .dwattr $C$DW$515, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$515, DW_AT_decl_line(0x1f8) .dwattr $C$DW$515, DW_AT_decl_column(0x05) .dwattr $C$DW$T$433, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$433, DW_AT_decl_line(0x1f4) .dwattr $C$DW$T$433, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$433 $C$DW$T$434 .dwtag DW_TAG_typedef .dwattr $C$DW$T$434, DW_AT_name("SlWlanMode_e") .dwattr $C$DW$T$434, DW_AT_type(*$C$DW$T$433) .dwattr $C$DW$T$434, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$434, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$434, DW_AT_decl_line(0x1f9) .dwattr $C$DW$T$434, DW_AT_decl_column(0x02) $C$DW$T$435 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$435, DW_AT_byte_size(0x01) $C$DW$516 .dwtag DW_TAG_enumerator .dwattr $C$DW$516, DW_AT_name("SL_WLAN_DISCONNECTED") .dwattr $C$DW$516, DW_AT_const_value(0x00) .dwattr $C$DW$516, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$516, DW_AT_decl_line(0x2aa) .dwattr $C$DW$516, DW_AT_decl_column(0x05) $C$DW$517 .dwtag DW_TAG_enumerator .dwattr $C$DW$517, DW_AT_name("SL_WLAN_CONNECTED_STA") .dwattr $C$DW$517, DW_AT_const_value(0x01) .dwattr $C$DW$517, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$517, DW_AT_decl_line(0x2ab) .dwattr $C$DW$517, DW_AT_decl_column(0x05) $C$DW$518 .dwtag DW_TAG_enumerator .dwattr $C$DW$518, DW_AT_name("SL_WLAN_CONNECTED_P2PCL") .dwattr $C$DW$518, DW_AT_const_value(0x02) .dwattr $C$DW$518, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$518, DW_AT_decl_line(0x2ac) .dwattr $C$DW$518, DW_AT_decl_column(0x05) $C$DW$519 .dwtag DW_TAG_enumerator .dwattr $C$DW$519, DW_AT_name("SL_WLAN_CONNECTED_P2PGO") .dwattr $C$DW$519, DW_AT_const_value(0x03) .dwattr $C$DW$519, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$519, DW_AT_decl_line(0x2ad) .dwattr $C$DW$519, DW_AT_decl_column(0x05) $C$DW$520 .dwtag DW_TAG_enumerator .dwattr $C$DW$520, DW_AT_name("SL_WLAN_AP_CONNECTED_STATIONS") .dwattr $C$DW$520, DW_AT_const_value(0x04) .dwattr $C$DW$520, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$520, DW_AT_decl_line(0x2ae) .dwattr $C$DW$520, DW_AT_decl_column(0x05) .dwattr $C$DW$T$435, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$435, DW_AT_decl_line(0x2a9) .dwattr $C$DW$T$435, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$435 $C$DW$T$436 .dwtag DW_TAG_typedef .dwattr $C$DW$T$436, DW_AT_name("SlWlanConnStatusFlags_e") .dwattr $C$DW$T$436, DW_AT_type(*$C$DW$T$435) .dwattr $C$DW$T$436, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$436, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$436, DW_AT_decl_line(0x2af) .dwattr $C$DW$T$436, DW_AT_decl_column(0x02) $C$DW$T$437 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$437, DW_AT_byte_size(0x01) $C$DW$521 .dwtag DW_TAG_enumerator .dwattr $C$DW$521, DW_AT_name("SL_DEVICE_EVENT_FATAL_DEVICE_ABORT") .dwattr $C$DW$521, DW_AT_const_value(0x01) .dwattr $C$DW$521, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$521, DW_AT_decl_line(0x4c) .dwattr $C$DW$521, DW_AT_decl_column(0x05) $C$DW$522 .dwtag DW_TAG_enumerator .dwattr $C$DW$522, DW_AT_name("SL_DEVICE_EVENT_FATAL_DRIVER_ABORT") .dwattr $C$DW$522, DW_AT_const_value(0x02) .dwattr $C$DW$522, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$522, DW_AT_decl_line(0x4d) .dwattr $C$DW$522, DW_AT_decl_column(0x05) $C$DW$523 .dwtag DW_TAG_enumerator .dwattr $C$DW$523, DW_AT_name("SL_DEVICE_EVENT_FATAL_SYNC_LOSS") .dwattr $C$DW$523, DW_AT_const_value(0x03) .dwattr $C$DW$523, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$523, DW_AT_decl_line(0x4e) .dwattr $C$DW$523, DW_AT_decl_column(0x05) $C$DW$524 .dwtag DW_TAG_enumerator .dwattr $C$DW$524, DW_AT_name("SL_DEVICE_EVENT_FATAL_NO_CMD_ACK") .dwattr $C$DW$524, DW_AT_const_value(0x04) .dwattr $C$DW$524, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$524, DW_AT_decl_line(0x4f) .dwattr $C$DW$524, DW_AT_decl_column(0x05) $C$DW$525 .dwtag DW_TAG_enumerator .dwattr $C$DW$525, DW_AT_name("SL_DEVICE_EVENT_FATAL_CMD_TIMEOUT") .dwattr $C$DW$525, DW_AT_const_value(0x05) .dwattr $C$DW$525, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$525, DW_AT_decl_line(0x50) .dwattr $C$DW$525, DW_AT_decl_column(0x05) $C$DW$526 .dwtag DW_TAG_enumerator .dwattr $C$DW$526, DW_AT_name("SL_DEVICE_EVENT_RESET_REQUEST") .dwattr $C$DW$526, DW_AT_const_value(0x06) .dwattr $C$DW$526, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$526, DW_AT_decl_line(0x51) .dwattr $C$DW$526, DW_AT_decl_column(0x05) $C$DW$527 .dwtag DW_TAG_enumerator .dwattr $C$DW$527, DW_AT_name("SL_DEVICE_EVENT_ERROR") .dwattr $C$DW$527, DW_AT_const_value(0x07) .dwattr $C$DW$527, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$527, DW_AT_decl_line(0x52) .dwattr $C$DW$527, DW_AT_decl_column(0x05) $C$DW$528 .dwtag DW_TAG_enumerator .dwattr $C$DW$528, DW_AT_name("SL_DEVICE_EVENT_MAX") .dwattr $C$DW$528, DW_AT_const_value(0x08) .dwattr $C$DW$528, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$528, DW_AT_decl_line(0x53) .dwattr $C$DW$528, DW_AT_decl_column(0x05) .dwattr $C$DW$T$437, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$437, DW_AT_decl_line(0x4b) .dwattr $C$DW$T$437, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$437 $C$DW$T$438 .dwtag DW_TAG_typedef .dwattr $C$DW$T$438, DW_AT_name("SlDeviceEventId_e") .dwattr $C$DW$T$438, DW_AT_type(*$C$DW$T$437) .dwattr $C$DW$T$438, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$438, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$438, DW_AT_decl_line(0x55) .dwattr $C$DW$T$438, DW_AT_decl_column(0x03) $C$DW$T$439 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$439, DW_AT_byte_size(0x01) $C$DW$529 .dwtag DW_TAG_enumerator .dwattr $C$DW$529, DW_AT_name("SL_DEVICE_RESET_REQUEST_CALLER_PROVISIONING") .dwattr $C$DW$529, DW_AT_const_value(0x00) .dwattr $C$DW$529, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$529, DW_AT_decl_line(0x78) .dwattr $C$DW$529, DW_AT_decl_column(0x05) $C$DW$530 .dwtag DW_TAG_enumerator .dwattr $C$DW$530, DW_AT_name("SL_DEVICE_RESET_REQUEST_CALLER_PROVISIONING_EXTERNAL_CONFIGURATION") .dwattr $C$DW$530, DW_AT_const_value(0x01) .dwattr $C$DW$530, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$530, DW_AT_decl_line(0x79) .dwattr $C$DW$530, DW_AT_decl_column(0x05) $C$DW$531 .dwtag DW_TAG_enumerator .dwattr $C$DW$531, DW_AT_name("SL_DEVICE_RESET_REQUEST_NUM_OF_CALLERS") .dwattr $C$DW$531, DW_AT_const_value(0x02) .dwattr $C$DW$531, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$531, DW_AT_decl_line(0x7a) .dwattr $C$DW$531, DW_AT_decl_column(0x05) .dwattr $C$DW$T$439, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$439, DW_AT_decl_line(0x77) .dwattr $C$DW$T$439, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$439 $C$DW$T$440 .dwtag DW_TAG_typedef .dwattr $C$DW$T$440, DW_AT_name("SlDeviceResetRequestCaller_e") .dwattr $C$DW$T$440, DW_AT_type(*$C$DW$T$439) .dwattr $C$DW$T$440, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$440, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$440, DW_AT_decl_line(0x7b) .dwattr $C$DW$T$440, DW_AT_decl_column(0x02) $C$DW$T$441 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$441, DW_AT_byte_size(0x01) $C$DW$532 .dwtag DW_TAG_enumerator .dwattr $C$DW$532, DW_AT_name("SL_NETCFG_MAC_ADDRESS_SET") .dwattr $C$DW$532, DW_AT_const_value(0x01) .dwattr $C$DW$532, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$532, DW_AT_decl_line(0x6f) .dwattr $C$DW$532, DW_AT_decl_column(0x05) $C$DW$533 .dwtag DW_TAG_enumerator .dwattr $C$DW$533, DW_AT_name("SL_NETCFG_MAC_ADDRESS_GET") .dwattr $C$DW$533, DW_AT_const_value(0x02) .dwattr $C$DW$533, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$533, DW_AT_decl_line(0x70) .dwattr $C$DW$533, DW_AT_decl_column(0x05) $C$DW$534 .dwtag DW_TAG_enumerator .dwattr $C$DW$534, DW_AT_name("SL_NETCFG_AP_STATIONS_NUM_CONNECTED") .dwattr $C$DW$534, DW_AT_const_value(0x03) .dwattr $C$DW$534, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$534, DW_AT_decl_line(0x71) .dwattr $C$DW$534, DW_AT_decl_column(0x05) $C$DW$535 .dwtag DW_TAG_enumerator .dwattr $C$DW$535, DW_AT_name("SL_NETCFG_AP_STATIONS_INFO_LIST") .dwattr $C$DW$535, DW_AT_const_value(0x04) .dwattr $C$DW$535, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$535, DW_AT_decl_line(0x72) .dwattr $C$DW$535, DW_AT_decl_column(0x05) $C$DW$536 .dwtag DW_TAG_enumerator .dwattr $C$DW$536, DW_AT_name("SL_NETCFG_AP_STATION_DISCONNECT") .dwattr $C$DW$536, DW_AT_const_value(0x05) .dwattr $C$DW$536, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$536, DW_AT_decl_line(0x73) .dwattr $C$DW$536, DW_AT_decl_column(0x05) $C$DW$537 .dwtag DW_TAG_enumerator .dwattr $C$DW$537, DW_AT_name("SL_NETCFG_IF") .dwattr $C$DW$537, DW_AT_const_value(0x06) .dwattr $C$DW$537, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$537, DW_AT_decl_line(0x74) .dwattr $C$DW$537, DW_AT_decl_column(0x05) $C$DW$538 .dwtag DW_TAG_enumerator .dwattr $C$DW$538, DW_AT_name("SL_NETCFG_IPV4_STA_ADDR_MODE") .dwattr $C$DW$538, DW_AT_const_value(0x07) .dwattr $C$DW$538, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$538, DW_AT_decl_line(0x75) .dwattr $C$DW$538, DW_AT_decl_column(0x05) $C$DW$539 .dwtag DW_TAG_enumerator .dwattr $C$DW$539, DW_AT_name("SL_NETCFG_IPV4_AP_ADDR_MODE") .dwattr $C$DW$539, DW_AT_const_value(0x08) .dwattr $C$DW$539, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$539, DW_AT_decl_line(0x76) .dwattr $C$DW$539, DW_AT_decl_column(0x05) $C$DW$540 .dwtag DW_TAG_enumerator .dwattr $C$DW$540, DW_AT_name("SL_NETCFG_IPV6_ADDR_LOCAL") .dwattr $C$DW$540, DW_AT_const_value(0x09) .dwattr $C$DW$540, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$540, DW_AT_decl_line(0x77) .dwattr $C$DW$540, DW_AT_decl_column(0x05) $C$DW$541 .dwtag DW_TAG_enumerator .dwattr $C$DW$541, DW_AT_name("SL_NETCFG_IPV6_ADDR_GLOBAL") .dwattr $C$DW$541, DW_AT_const_value(0x0a) .dwattr $C$DW$541, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$541, DW_AT_decl_line(0x78) .dwattr $C$DW$541, DW_AT_decl_column(0x05) $C$DW$542 .dwtag DW_TAG_enumerator .dwattr $C$DW$542, DW_AT_name("SL_NETCFG_IPV4_DHCP_CLIENT") .dwattr $C$DW$542, DW_AT_const_value(0x0b) .dwattr $C$DW$542, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$542, DW_AT_decl_line(0x79) .dwattr $C$DW$542, DW_AT_decl_column(0x05) $C$DW$543 .dwtag DW_TAG_enumerator .dwattr $C$DW$543, DW_AT_name("SL_NETCFG_IPV4_DNS_CLIENT") .dwattr $C$DW$543, DW_AT_const_value(0x0c) .dwattr $C$DW$543, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$543, DW_AT_decl_line(0x7a) .dwattr $C$DW$543, DW_AT_decl_column(0x05) $C$DW$544 .dwtag DW_TAG_enumerator .dwattr $C$DW$544, DW_AT_name("MAX_SETTINGS") .dwattr $C$DW$544, DW_AT_const_value(0xff) .dwattr $C$DW$544, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$544, DW_AT_decl_line(0x7b) .dwattr $C$DW$544, DW_AT_decl_column(0x05) .dwattr $C$DW$T$441, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$441, DW_AT_decl_line(0x6e) .dwattr $C$DW$T$441, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$441 $C$DW$T$442 .dwtag DW_TAG_typedef .dwattr $C$DW$T$442, DW_AT_name("SlNetCfg_e") .dwattr $C$DW$T$442, DW_AT_type(*$C$DW$T$441) .dwattr $C$DW$T$442, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$442, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$442, DW_AT_decl_line(0x7c) .dwattr $C$DW$T$442, DW_AT_decl_column(0x02) $C$DW$T$443 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$443, DW_AT_byte_size(0x01) $C$DW$545 .dwtag DW_TAG_enumerator .dwattr $C$DW$545, DW_AT_name("SL_NETCFG_DHCP_CLIENT_UNKNOWN") .dwattr $C$DW$545, DW_AT_const_value(0x00) .dwattr $C$DW$545, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$545, DW_AT_decl_line(0x93) .dwattr $C$DW$545, DW_AT_decl_column(0x05) $C$DW$546 .dwtag DW_TAG_enumerator .dwattr $C$DW$546, DW_AT_name("SL_NETCFG_DHCP_CLIENT_DISABLED") .dwattr $C$DW$546, DW_AT_const_value(0x01) .dwattr $C$DW$546, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$546, DW_AT_decl_line(0x94) .dwattr $C$DW$546, DW_AT_decl_column(0x05) $C$DW$547 .dwtag DW_TAG_enumerator .dwattr $C$DW$547, DW_AT_name("SL_NETCFG_DHCP_CLIENT_ENABLED") .dwattr $C$DW$547, DW_AT_const_value(0x02) .dwattr $C$DW$547, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$547, DW_AT_decl_line(0x95) .dwattr $C$DW$547, DW_AT_decl_column(0x05) $C$DW$548 .dwtag DW_TAG_enumerator .dwattr $C$DW$548, DW_AT_name("SL_NETCFG_DHCP_CLIENT_BOUND") .dwattr $C$DW$548, DW_AT_const_value(0x03) .dwattr $C$DW$548, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$548, DW_AT_decl_line(0x96) .dwattr $C$DW$548, DW_AT_decl_column(0x05) $C$DW$549 .dwtag DW_TAG_enumerator .dwattr $C$DW$549, DW_AT_name("SL_NETCFG_DHCP_CLIENT_RENEW") .dwattr $C$DW$549, DW_AT_const_value(0x04) .dwattr $C$DW$549, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$549, DW_AT_decl_line(0x97) .dwattr $C$DW$549, DW_AT_decl_column(0x05) $C$DW$550 .dwtag DW_TAG_enumerator .dwattr $C$DW$550, DW_AT_name("SL_NETCFG_DHCP_CLIENT_REBIND") .dwattr $C$DW$550, DW_AT_const_value(0x05) .dwattr $C$DW$550, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$550, DW_AT_decl_line(0x98) .dwattr $C$DW$550, DW_AT_decl_column(0x05) .dwattr $C$DW$T$443, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$443, DW_AT_decl_line(0x92) .dwattr $C$DW$T$443, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$443 $C$DW$T$444 .dwtag DW_TAG_typedef .dwattr $C$DW$T$444, DW_AT_name("SlNetCfgIpv4DhcpClientState_e") .dwattr $C$DW$T$444, DW_AT_type(*$C$DW$T$443) .dwattr $C$DW$T$444, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$444, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$444, DW_AT_decl_line(0x99) .dwattr $C$DW$T$444, DW_AT_decl_column(0x02) $C$DW$T$445 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$445, DW_AT_byte_size(0x01) $C$DW$551 .dwtag DW_TAG_enumerator .dwattr $C$DW$551, DW_AT_name("SL_NETCFG_DHCP_OPT_DISABLE_LLA") .dwattr $C$DW$551, DW_AT_const_value(0x02) .dwattr $C$DW$551, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$551, DW_AT_decl_line(0x9e) .dwattr $C$DW$551, DW_AT_decl_column(0x05) $C$DW$552 .dwtag DW_TAG_enumerator .dwattr $C$DW$552, DW_AT_name("SL_NETCFG_DHCP_OPT_RELEASE_IP_BEFORE_DISCONNECT") .dwattr $C$DW$552, DW_AT_const_value(0x04) .dwattr $C$DW$552, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$552, DW_AT_decl_line(0x9f) .dwattr $C$DW$552, DW_AT_decl_column(0x05) $C$DW$553 .dwtag DW_TAG_enumerator .dwattr $C$DW$553, DW_AT_name("MAX_SL_NETCFG_DHCP_OPT") .dwattr $C$DW$553, DW_AT_const_value(0xff) .dwattr $C$DW$553, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$553, DW_AT_decl_line(0xa0) .dwattr $C$DW$553, DW_AT_decl_column(0x05) .dwattr $C$DW$T$445, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$445, DW_AT_decl_line(0x9d) .dwattr $C$DW$T$445, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$445 $C$DW$T$446 .dwtag DW_TAG_typedef .dwattr $C$DW$T$446, DW_AT_name("SlNetCfgDhcpOption_e") .dwattr $C$DW$T$446, DW_AT_type(*$C$DW$T$445) .dwattr $C$DW$T$446, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$446, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$446, DW_AT_decl_line(0xa1) .dwattr $C$DW$T$446, DW_AT_decl_column(0x03) $C$DW$T$447 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$447, DW_AT_byte_size(0x01) $C$DW$554 .dwtag DW_TAG_enumerator .dwattr $C$DW$554, DW_AT_name("SL_EVENT_HDL_FATAL_ERROR") .dwattr $C$DW$554, DW_AT_const_value(0x00) .dwattr $C$DW$554, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$554, DW_AT_decl_line(0x3b) .dwattr $C$DW$554, DW_AT_decl_column(0x05) $C$DW$555 .dwtag DW_TAG_enumerator .dwattr $C$DW$555, DW_AT_name("SL_EVENT_HDL_DEVICE_GENERAL") .dwattr $C$DW$555, DW_AT_const_value(0x01) .dwattr $C$DW$555, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$555, DW_AT_decl_line(0x3c) .dwattr $C$DW$555, DW_AT_decl_column(0x05) $C$DW$556 .dwtag DW_TAG_enumerator .dwattr $C$DW$556, DW_AT_name("SL_EVENT_HDL_WLAN") .dwattr $C$DW$556, DW_AT_const_value(0x02) .dwattr $C$DW$556, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$556, DW_AT_decl_line(0x3d) .dwattr $C$DW$556, DW_AT_decl_column(0x05) $C$DW$557 .dwtag DW_TAG_enumerator .dwattr $C$DW$557, DW_AT_name("SL_EVENT_HDL_NETAPP") .dwattr $C$DW$557, DW_AT_const_value(0x03) .dwattr $C$DW$557, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$557, DW_AT_decl_line(0x3e) .dwattr $C$DW$557, DW_AT_decl_column(0x05) $C$DW$558 .dwtag DW_TAG_enumerator .dwattr $C$DW$558, DW_AT_name("SL_EVENT_HDL_SOCKET") .dwattr $C$DW$558, DW_AT_const_value(0x04) .dwattr $C$DW$558, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$558, DW_AT_decl_line(0x3f) .dwattr $C$DW$558, DW_AT_decl_column(0x05) $C$DW$559 .dwtag DW_TAG_enumerator .dwattr $C$DW$559, DW_AT_name("SL_EVENT_HDL_HTTP_SERVER") .dwattr $C$DW$559, DW_AT_const_value(0x05) .dwattr $C$DW$559, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$559, DW_AT_decl_line(0x40) .dwattr $C$DW$559, DW_AT_decl_column(0x05) $C$DW$560 .dwtag DW_TAG_enumerator .dwattr $C$DW$560, DW_AT_name("SL_EVENT_HDL_NETAPP_REQUEST") .dwattr $C$DW$560, DW_AT_const_value(0x06) .dwattr $C$DW$560, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$560, DW_AT_decl_line(0x41) .dwattr $C$DW$560, DW_AT_decl_column(0x05) $C$DW$561 .dwtag DW_TAG_enumerator .dwattr $C$DW$561, DW_AT_name("SL_EVENT_HDL_MEM_FREE") .dwattr $C$DW$561, DW_AT_const_value(0x07) .dwattr $C$DW$561, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$561, DW_AT_decl_line(0x42) .dwattr $C$DW$561, DW_AT_decl_column(0x05) $C$DW$562 .dwtag DW_TAG_enumerator .dwattr $C$DW$562, DW_AT_name("SL_EVENT_HDL_SOCKET_TRIGGER") .dwattr $C$DW$562, DW_AT_const_value(0x08) .dwattr $C$DW$562, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$562, DW_AT_decl_line(0x43) .dwattr $C$DW$562, DW_AT_decl_column(0x05) $C$DW$563 .dwtag DW_TAG_enumerator .dwattr $C$DW$563, DW_AT_name("SL_NUM_OF_EVENT_TYPES") .dwattr $C$DW$563, DW_AT_const_value(0x09) .dwattr $C$DW$563, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$563, DW_AT_decl_line(0x44) .dwattr $C$DW$563, DW_AT_decl_column(0x05) .dwattr $C$DW$T$447, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$T$447, DW_AT_decl_line(0x3a) .dwattr $C$DW$T$447, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$447 $C$DW$T$448 .dwtag DW_TAG_typedef .dwattr $C$DW$T$448, DW_AT_name("SlEventHandler_e") .dwattr $C$DW$T$448, DW_AT_type(*$C$DW$T$447) .dwattr $C$DW$T$448, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$448, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$T$448, DW_AT_decl_line(0x45) .dwattr $C$DW$T$448, DW_AT_decl_column(0x02) $C$DW$T$21 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$21, DW_AT_byte_size(0x28) $C$DW$564 .dwtag DW_TAG_member .dwattr $C$DW$564, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$564, DW_AT_name("SsidLen") .dwattr $C$DW$564, DW_AT_TI_symbol_name("SsidLen") .dwattr $C$DW$564, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$564, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$564, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$564, DW_AT_decl_line(0x1fd) .dwattr $C$DW$564, DW_AT_decl_column(0x0d) $C$DW$565 .dwtag DW_TAG_member .dwattr $C$DW$565, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$565, DW_AT_name("SsidName") .dwattr $C$DW$565, DW_AT_TI_symbol_name("SsidName") .dwattr $C$DW$565, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$565, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$565, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$565, DW_AT_decl_line(0x1fe) .dwattr $C$DW$565, DW_AT_decl_column(0x0d) $C$DW$566 .dwtag DW_TAG_member .dwattr $C$DW$566, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$566, DW_AT_name("Bssid") .dwattr $C$DW$566, DW_AT_TI_symbol_name("Bssid") .dwattr $C$DW$566, DW_AT_data_member_location[DW_OP_plus_uconst 0x21] .dwattr $C$DW$566, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$566, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$566, DW_AT_decl_line(0x1ff) .dwattr $C$DW$566, DW_AT_decl_column(0x0d) $C$DW$567 .dwtag DW_TAG_member .dwattr $C$DW$567, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$567, DW_AT_name("Padding") .dwattr $C$DW$567, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$567, DW_AT_data_member_location[DW_OP_plus_uconst 0x27] .dwattr $C$DW$567, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$567, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$567, DW_AT_decl_line(0x200) .dwattr $C$DW$567, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$21, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$21, DW_AT_decl_line(0x1fc) .dwattr $C$DW$T$21, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$21 $C$DW$T$197 .dwtag DW_TAG_typedef .dwattr $C$DW$T$197, DW_AT_name("SlWlanEventConnect_t") .dwattr $C$DW$T$197, DW_AT_type(*$C$DW$T$21) .dwattr $C$DW$T$197, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$197, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$197, DW_AT_decl_line(0x201) .dwattr $C$DW$T$197, DW_AT_decl_column(0x03) $C$DW$T$23 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$23, DW_AT_byte_size(0x4c) $C$DW$568 .dwtag DW_TAG_member .dwattr $C$DW$568, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$568, DW_AT_name("SsidLen") .dwattr $C$DW$568, DW_AT_TI_symbol_name("SsidLen") .dwattr $C$DW$568, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$568, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$568, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$568, DW_AT_decl_line(0x214) .dwattr $C$DW$568, DW_AT_decl_column(0x0d) $C$DW$569 .dwtag DW_TAG_member .dwattr $C$DW$569, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$569, DW_AT_name("SsidName") .dwattr $C$DW$569, DW_AT_TI_symbol_name("SsidName") .dwattr $C$DW$569, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$569, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$569, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$569, DW_AT_decl_line(0x215) .dwattr $C$DW$569, DW_AT_decl_column(0x0d) $C$DW$570 .dwtag DW_TAG_member .dwattr $C$DW$570, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$570, DW_AT_name("Bssid") .dwattr $C$DW$570, DW_AT_TI_symbol_name("Bssid") .dwattr $C$DW$570, DW_AT_data_member_location[DW_OP_plus_uconst 0x21] .dwattr $C$DW$570, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$570, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$570, DW_AT_decl_line(0x216) .dwattr $C$DW$570, DW_AT_decl_column(0x0d) $C$DW$571 .dwtag DW_TAG_member .dwattr $C$DW$571, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$571, DW_AT_name("Reserved") .dwattr $C$DW$571, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$571, DW_AT_data_member_location[DW_OP_plus_uconst 0x27] .dwattr $C$DW$571, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$571, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$571, DW_AT_decl_line(0x217) .dwattr $C$DW$571, DW_AT_decl_column(0x0d) $C$DW$572 .dwtag DW_TAG_member .dwattr $C$DW$572, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$572, DW_AT_name("GoDeviceNameLen") .dwattr $C$DW$572, DW_AT_TI_symbol_name("GoDeviceNameLen") .dwattr $C$DW$572, DW_AT_data_member_location[DW_OP_plus_uconst 0x28] .dwattr $C$DW$572, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$572, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$572, DW_AT_decl_line(0x218) .dwattr $C$DW$572, DW_AT_decl_column(0x0d) $C$DW$573 .dwtag DW_TAG_member .dwattr $C$DW$573, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$573, DW_AT_name("GoDeviceName") .dwattr $C$DW$573, DW_AT_TI_symbol_name("GoDeviceName") .dwattr $C$DW$573, DW_AT_data_member_location[DW_OP_plus_uconst 0x29] .dwattr $C$DW$573, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$573, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$573, DW_AT_decl_line(0x219) .dwattr $C$DW$573, DW_AT_decl_column(0x0d) $C$DW$574 .dwtag DW_TAG_member .dwattr $C$DW$574, DW_AT_type(*$C$DW$T$22) .dwattr $C$DW$574, DW_AT_name("Padding") .dwattr $C$DW$574, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$574, DW_AT_data_member_location[DW_OP_plus_uconst 0x49] .dwattr $C$DW$574, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$574, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$574, DW_AT_decl_line(0x21a) .dwattr $C$DW$574, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$23, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$23, DW_AT_decl_line(0x213) .dwattr $C$DW$T$23, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$23 $C$DW$T$198 .dwtag DW_TAG_typedef .dwattr $C$DW$T$198, DW_AT_name("SlWlanEventP2PConnect_t") .dwattr $C$DW$T$198, DW_AT_type(*$C$DW$T$23) .dwattr $C$DW$T$198, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$198, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$198, DW_AT_decl_line(0x21b) .dwattr $C$DW$T$198, DW_AT_decl_column(0x03) $C$DW$T$25 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$25, DW_AT_byte_size(0x50) $C$DW$575 .dwtag DW_TAG_member .dwattr $C$DW$575, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$575, DW_AT_name("Mode") .dwattr $C$DW$575, DW_AT_TI_symbol_name("Mode") .dwattr $C$DW$575, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$575, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$575, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$575, DW_AT_decl_line(0x2b3) .dwattr $C$DW$575, DW_AT_decl_column(0x09) $C$DW$576 .dwtag DW_TAG_member .dwattr $C$DW$576, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$576, DW_AT_name("ConnStatus") .dwattr $C$DW$576, DW_AT_TI_symbol_name("ConnStatus") .dwattr $C$DW$576, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$576, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$576, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$576, DW_AT_decl_line(0x2b4) .dwattr $C$DW$576, DW_AT_decl_column(0x09) $C$DW$577 .dwtag DW_TAG_member .dwattr $C$DW$577, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$577, DW_AT_name("SecType") .dwattr $C$DW$577, DW_AT_TI_symbol_name("SecType") .dwattr $C$DW$577, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$577, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$577, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$577, DW_AT_decl_line(0x2b5) .dwattr $C$DW$577, DW_AT_decl_column(0x09) $C$DW$578 .dwtag DW_TAG_member .dwattr $C$DW$578, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$578, DW_AT_name("Reserved") .dwattr $C$DW$578, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$578, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$578, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$578, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$578, DW_AT_decl_line(0x2b6) .dwattr $C$DW$578, DW_AT_decl_column(0x09) $C$DW$579 .dwtag DW_TAG_member .dwattr $C$DW$579, DW_AT_type(*$C$DW$T$24) .dwattr $C$DW$579, DW_AT_name("ConnectionInfo") .dwattr $C$DW$579, DW_AT_TI_symbol_name("ConnectionInfo") .dwattr $C$DW$579, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$579, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$579, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$579, DW_AT_decl_line(0x2b7) .dwattr $C$DW$579, DW_AT_decl_column(0x1c) .dwattr $C$DW$T$25, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$25, DW_AT_decl_line(0x2b2) .dwattr $C$DW$T$25, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$25 $C$DW$T$449 .dwtag DW_TAG_typedef .dwattr $C$DW$T$449, DW_AT_name("SlWlanConnStatusParam_t") .dwattr $C$DW$T$449, DW_AT_type(*$C$DW$T$25) .dwattr $C$DW$T$449, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$449, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$449, DW_AT_decl_line(0x2b8) .dwattr $C$DW$T$449, DW_AT_decl_column(0x02) $C$DW$T$29 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$29, DW_AT_byte_size(0x08) $C$DW$580 .dwtag DW_TAG_member .dwattr $C$DW$580, DW_AT_type(*$C$DW$T$28) .dwattr $C$DW$580, DW_AT_name("pEntry") .dwattr $C$DW$580, DW_AT_TI_symbol_name("pEntry") .dwattr $C$DW$580, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$580, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$580, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/cc_pal.h") .dwattr $C$DW$580, DW_AT_decl_line(0x64) .dwattr $C$DW$580, DW_AT_decl_column(0x13) $C$DW$581 .dwtag DW_TAG_member .dwattr $C$DW$581, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$581, DW_AT_name("pValue") .dwattr $C$DW$581, DW_AT_TI_symbol_name("pValue") .dwattr $C$DW$581, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$581, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$581, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/cc_pal.h") .dwattr $C$DW$581, DW_AT_decl_line(0x65) .dwattr $C$DW$581, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$29, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/cc_pal.h") .dwattr $C$DW$T$29, DW_AT_decl_line(0x63) .dwattr $C$DW$T$29, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$29 $C$DW$T$451 .dwtag DW_TAG_typedef .dwattr $C$DW$T$451, DW_AT_name("tSimpleLinkSpawnMsg") .dwattr $C$DW$T$451, DW_AT_type(*$C$DW$T$29) .dwattr $C$DW$T$451, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$451, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/cc_pal.h") .dwattr $C$DW$T$451, DW_AT_decl_line(0x66) .dwattr $C$DW$T$451, DW_AT_decl_column(0x02) $C$DW$T$31 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$31, DW_AT_byte_size(0x24) $C$DW$582 .dwtag DW_TAG_member .dwattr $C$DW$582, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$582, DW_AT_name("Flags") .dwattr $C$DW$582, DW_AT_TI_symbol_name("Flags") .dwattr $C$DW$582, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$582, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$582, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$582, DW_AT_decl_line(0x90) .dwattr $C$DW$582, DW_AT_decl_column(0x0b) $C$DW$583 .dwtag DW_TAG_member .dwattr $C$DW$583, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$583, DW_AT_name("Len") .dwattr $C$DW$583, DW_AT_TI_symbol_name("Len") .dwattr $C$DW$583, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$583, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$583, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$583, DW_AT_decl_line(0x91) .dwattr $C$DW$583, DW_AT_decl_column(0x0b) $C$DW$584 .dwtag DW_TAG_member .dwattr $C$DW$584, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$584, DW_AT_name("MaxSize") .dwattr $C$DW$584, DW_AT_TI_symbol_name("MaxSize") .dwattr $C$DW$584, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$584, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$584, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$584, DW_AT_decl_line(0x92) .dwattr $C$DW$584, DW_AT_decl_column(0x0b) $C$DW$585 .dwtag DW_TAG_member .dwattr $C$DW$585, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$585, DW_AT_name("Token") .dwattr $C$DW$585, DW_AT_TI_symbol_name("Token") .dwattr $C$DW$585, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$585, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$585, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$585, DW_AT_decl_line(0x93) .dwattr $C$DW$585, DW_AT_decl_column(0x0b) $C$DW$586 .dwtag DW_TAG_member .dwattr $C$DW$586, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$586, DW_AT_name("StorageSize") .dwattr $C$DW$586, DW_AT_TI_symbol_name("StorageSize") .dwattr $C$DW$586, DW_AT_data_member_location[DW_OP_plus_uconst 0x1c] .dwattr $C$DW$586, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$586, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$586, DW_AT_decl_line(0x94) .dwattr $C$DW$586, DW_AT_decl_column(0x0b) $C$DW$587 .dwtag DW_TAG_member .dwattr $C$DW$587, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$587, DW_AT_name("WriteCounter") .dwattr $C$DW$587, DW_AT_TI_symbol_name("WriteCounter") .dwattr $C$DW$587, DW_AT_data_member_location[DW_OP_plus_uconst 0x20] .dwattr $C$DW$587, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$587, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$587, DW_AT_decl_line(0x95) .dwattr $C$DW$587, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$31, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$31, DW_AT_decl_line(0x8f) .dwattr $C$DW$T$31, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$31 $C$DW$T$452 .dwtag DW_TAG_typedef .dwattr $C$DW$T$452, DW_AT_name("SlFsFileInfo_t") .dwattr $C$DW$T$452, DW_AT_type(*$C$DW$T$31) .dwattr $C$DW$T$452, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$452, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$452, DW_AT_decl_line(0x96) .dwattr $C$DW$T$452, DW_AT_decl_column(0x02) $C$DW$T$32 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$32, DW_AT_byte_size(0x10) $C$DW$588 .dwtag DW_TAG_member .dwattr $C$DW$588, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$588, DW_AT_name("Key") .dwattr $C$DW$588, DW_AT_TI_symbol_name("Key") .dwattr $C$DW$588, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$588, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$588, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$588, DW_AT_decl_line(0xb1) .dwattr $C$DW$588, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$32, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$32, DW_AT_decl_line(0xb0) .dwattr $C$DW$T$32, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$32 $C$DW$T$453 .dwtag DW_TAG_typedef .dwattr $C$DW$T$453, DW_AT_name("SlFsKey_t") .dwattr $C$DW$T$453, DW_AT_type(*$C$DW$T$32) .dwattr $C$DW$T$453, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$453, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$453, DW_AT_decl_line(0xb2) .dwattr $C$DW$T$453, DW_AT_decl_column(0x02) $C$DW$T$33 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$33, DW_AT_byte_size(0x01) $C$DW$589 .dwtag DW_TAG_member .dwattr $C$DW$589, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$589, DW_AT_name("Index") .dwattr $C$DW$589, DW_AT_TI_symbol_name("Index") .dwattr $C$DW$589, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$589, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$589, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$589, DW_AT_decl_line(0xb6) .dwattr $C$DW$589, DW_AT_decl_column(0x09) .dwattr $C$DW$T$33, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$33, DW_AT_decl_line(0xb5) .dwattr $C$DW$T$33, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$33 $C$DW$T$207 .dwtag DW_TAG_typedef .dwattr $C$DW$T$207, DW_AT_name("SlFsFileNameIndex_t") .dwattr $C$DW$T$207, DW_AT_type(*$C$DW$T$33) .dwattr $C$DW$T$207, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$207, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$207, DW_AT_decl_line(0xb7) .dwattr $C$DW$T$207, DW_AT_decl_column(0x02) $C$DW$T$34 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$34, DW_AT_byte_size(0x04) $C$DW$590 .dwtag DW_TAG_member .dwattr $C$DW$590, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$590, DW_AT_name("Operation") .dwattr $C$DW$590, DW_AT_TI_symbol_name("Operation") .dwattr $C$DW$590, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$590, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$590, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$590, DW_AT_decl_line(0xca) .dwattr $C$DW$590, DW_AT_decl_column(0x08) .dwattr $C$DW$T$34, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$34, DW_AT_decl_line(0xc9) .dwattr $C$DW$T$34, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$34 $C$DW$T$454 .dwtag DW_TAG_typedef .dwattr $C$DW$T$454, DW_AT_name("SlFsRetToFactoryCommand_t") .dwattr $C$DW$T$454, DW_AT_type(*$C$DW$T$34) .dwattr $C$DW$T$454, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$454, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$454, DW_AT_decl_line(0xcb) .dwattr $C$DW$T$454, DW_AT_decl_column(0x02) $C$DW$T$35 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$35, DW_AT_byte_size(0x04) $C$DW$591 .dwtag DW_TAG_member .dwattr $C$DW$591, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$591, DW_AT_name("IncludeFilters") .dwattr $C$DW$591, DW_AT_TI_symbol_name("IncludeFilters") .dwattr $C$DW$591, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$591, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$591, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$591, DW_AT_decl_line(0xd1) .dwattr $C$DW$591, DW_AT_decl_column(0x12) .dwattr $C$DW$T$35, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$35, DW_AT_decl_line(0xd0) .dwattr $C$DW$T$35, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$35 $C$DW$T$455 .dwtag DW_TAG_typedef .dwattr $C$DW$T$455, DW_AT_name("SlFsControl_t") .dwattr $C$DW$T$455, DW_AT_type(*$C$DW$T$35) .dwattr $C$DW$T$455, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$455, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$455, DW_AT_decl_line(0xd3) .dwattr $C$DW$T$455, DW_AT_decl_column(0x02) $C$DW$T$37 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$37, DW_AT_byte_size(0x10) $C$DW$592 .dwtag DW_TAG_member .dwattr $C$DW$592, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$592, DW_AT_name("DeviceBlockSize") .dwattr $C$DW$592, DW_AT_TI_symbol_name("DeviceBlockSize") .dwattr $C$DW$592, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$592, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$592, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$592, DW_AT_decl_line(0xd7) .dwattr $C$DW$592, DW_AT_decl_column(0x08) $C$DW$593 .dwtag DW_TAG_member .dwattr $C$DW$593, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$593, DW_AT_name("DeviceBlocksCapacity") .dwattr $C$DW$593, DW_AT_TI_symbol_name("DeviceBlocksCapacity") .dwattr $C$DW$593, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$593, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$593, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$593, DW_AT_decl_line(0xd8) .dwattr $C$DW$593, DW_AT_decl_column(0x08) $C$DW$594 .dwtag DW_TAG_member .dwattr $C$DW$594, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$594, DW_AT_name("NumOfAllocatedBlocks") .dwattr $C$DW$594, DW_AT_TI_symbol_name("NumOfAllocatedBlocks") .dwattr $C$DW$594, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$594, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$594, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$594, DW_AT_decl_line(0xd9) .dwattr $C$DW$594, DW_AT_decl_column(0x08) $C$DW$595 .dwtag DW_TAG_member .dwattr $C$DW$595, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$595, DW_AT_name("NumOfReservedBlocks") .dwattr $C$DW$595, DW_AT_TI_symbol_name("NumOfReservedBlocks") .dwattr $C$DW$595, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$595, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$595, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$595, DW_AT_decl_line(0xda) .dwattr $C$DW$595, DW_AT_decl_column(0x08) $C$DW$596 .dwtag DW_TAG_member .dwattr $C$DW$596, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$596, DW_AT_name("NumOfReservedBlocksForSystemfiles") .dwattr $C$DW$596, DW_AT_TI_symbol_name("NumOfReservedBlocksForSystemfiles") .dwattr $C$DW$596, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$596, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$596, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$596, DW_AT_decl_line(0xdb) .dwattr $C$DW$596, DW_AT_decl_column(0x08) $C$DW$597 .dwtag DW_TAG_member .dwattr $C$DW$597, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$597, DW_AT_name("LargestAllocatedGapInBlocks") .dwattr $C$DW$597, DW_AT_TI_symbol_name("LargestAllocatedGapInBlocks") .dwattr $C$DW$597, DW_AT_data_member_location[DW_OP_plus_uconst 0xa] .dwattr $C$DW$597, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$597, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$597, DW_AT_decl_line(0xdc) .dwattr $C$DW$597, DW_AT_decl_column(0x08) $C$DW$598 .dwtag DW_TAG_member .dwattr $C$DW$598, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$598, DW_AT_name("NumOfAvailableBlocksForUserFiles") .dwattr $C$DW$598, DW_AT_TI_symbol_name("NumOfAvailableBlocksForUserFiles") .dwattr $C$DW$598, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$598, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$598, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$598, DW_AT_decl_line(0xdd) .dwattr $C$DW$598, DW_AT_decl_column(0x08) $C$DW$599 .dwtag DW_TAG_member .dwattr $C$DW$599, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$599, DW_AT_name("Padding") .dwattr $C$DW$599, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$599, DW_AT_data_member_location[DW_OP_plus_uconst 0xe] .dwattr $C$DW$599, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$599, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$599, DW_AT_decl_line(0xde) .dwattr $C$DW$599, DW_AT_decl_column(0x08) .dwattr $C$DW$T$37, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$37, DW_AT_decl_line(0xd6) .dwattr $C$DW$T$37, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$37 $C$DW$T$39 .dwtag DW_TAG_typedef .dwattr $C$DW$T$39, DW_AT_name("SlFsControlDeviceUsage_t") .dwattr $C$DW$T$39, DW_AT_type(*$C$DW$T$37) .dwattr $C$DW$T$39, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$39, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$39, DW_AT_decl_line(0xdf) .dwattr $C$DW$T$39, DW_AT_decl_column(0x03) $C$DW$T$38 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$38, DW_AT_byte_size(0x14) $C$DW$600 .dwtag DW_TAG_member .dwattr $C$DW$600, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$600, DW_AT_name("MaxFsFiles") .dwattr $C$DW$600, DW_AT_TI_symbol_name("MaxFsFiles") .dwattr $C$DW$600, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$600, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$600, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$600, DW_AT_decl_line(0xe3) .dwattr $C$DW$600, DW_AT_decl_column(0x08) $C$DW$601 .dwtag DW_TAG_member .dwattr $C$DW$601, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$601, DW_AT_name("IsDevlopmentFormatType") .dwattr $C$DW$601, DW_AT_TI_symbol_name("IsDevlopmentFormatType") .dwattr $C$DW$601, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$601, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$601, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$601, DW_AT_decl_line(0xe4) .dwattr $C$DW$601, DW_AT_decl_column(0x08) $C$DW$602 .dwtag DW_TAG_member .dwattr $C$DW$602, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$602, DW_AT_name("Bundlestate") .dwattr $C$DW$602, DW_AT_TI_symbol_name("Bundlestate") .dwattr $C$DW$602, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$602, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$602, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$602, DW_AT_decl_line(0xe5) .dwattr $C$DW$602, DW_AT_decl_column(0x08) $C$DW$603 .dwtag DW_TAG_member .dwattr $C$DW$603, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$603, DW_AT_name("Reserved") .dwattr $C$DW$603, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$603, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$603, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$603, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$603, DW_AT_decl_line(0xe6) .dwattr $C$DW$603, DW_AT_decl_column(0x08) $C$DW$604 .dwtag DW_TAG_member .dwattr $C$DW$604, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$604, DW_AT_name("MaxFsFilesReservedForSysFiles") .dwattr $C$DW$604, DW_AT_TI_symbol_name("MaxFsFilesReservedForSysFiles") .dwattr $C$DW$604, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$604, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$604, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$604, DW_AT_decl_line(0xe7) .dwattr $C$DW$604, DW_AT_decl_column(0x08) $C$DW$605 .dwtag DW_TAG_member .dwattr $C$DW$605, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$605, DW_AT_name("ActualNumOfUserFiles") .dwattr $C$DW$605, DW_AT_TI_symbol_name("ActualNumOfUserFiles") .dwattr $C$DW$605, DW_AT_data_member_location[DW_OP_plus_uconst 0x5] .dwattr $C$DW$605, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$605, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$605, DW_AT_decl_line(0xe8) .dwattr $C$DW$605, DW_AT_decl_column(0x08) $C$DW$606 .dwtag DW_TAG_member .dwattr $C$DW$606, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$606, DW_AT_name("ActualNumOfSysFiles") .dwattr $C$DW$606, DW_AT_TI_symbol_name("ActualNumOfSysFiles") .dwattr $C$DW$606, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$606, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$606, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$606, DW_AT_decl_line(0xe9) .dwattr $C$DW$606, DW_AT_decl_column(0x08) $C$DW$607 .dwtag DW_TAG_member .dwattr $C$DW$607, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$607, DW_AT_name("Padding") .dwattr $C$DW$607, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$607, DW_AT_data_member_location[DW_OP_plus_uconst 0x7] .dwattr $C$DW$607, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$607, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$607, DW_AT_decl_line(0xea) .dwattr $C$DW$607, DW_AT_decl_column(0x08) $C$DW$608 .dwtag DW_TAG_member .dwattr $C$DW$608, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$608, DW_AT_name("NumOfAlerts") .dwattr $C$DW$608, DW_AT_TI_symbol_name("NumOfAlerts") .dwattr $C$DW$608, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$608, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$608, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$608, DW_AT_decl_line(0xeb) .dwattr $C$DW$608, DW_AT_decl_column(0x08) $C$DW$609 .dwtag DW_TAG_member .dwattr $C$DW$609, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$609, DW_AT_name("NumOfAlertsThreshold") .dwattr $C$DW$609, DW_AT_TI_symbol_name("NumOfAlertsThreshold") .dwattr $C$DW$609, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$609, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$609, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$609, DW_AT_decl_line(0xec) .dwattr $C$DW$609, DW_AT_decl_column(0x08) $C$DW$610 .dwtag DW_TAG_member .dwattr $C$DW$610, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$610, DW_AT_name("FATWriteCounter") .dwattr $C$DW$610, DW_AT_TI_symbol_name("FATWriteCounter") .dwattr $C$DW$610, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$610, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$610, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$610, DW_AT_decl_line(0xed) .dwattr $C$DW$610, DW_AT_decl_column(0x08) $C$DW$611 .dwtag DW_TAG_member .dwattr $C$DW$611, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$611, DW_AT_name("Padding2") .dwattr $C$DW$611, DW_AT_TI_symbol_name("Padding2") .dwattr $C$DW$611, DW_AT_data_member_location[DW_OP_plus_uconst 0x12] .dwattr $C$DW$611, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$611, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$611, DW_AT_decl_line(0xee) .dwattr $C$DW$611, DW_AT_decl_column(0x08) .dwattr $C$DW$T$38, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$38, DW_AT_decl_line(0xe2) .dwattr $C$DW$T$38, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$38 $C$DW$T$40 .dwtag DW_TAG_typedef .dwattr $C$DW$T$40, DW_AT_name("SlFsControlFilesUsage_t") .dwattr $C$DW$T$40, DW_AT_type(*$C$DW$T$38) .dwattr $C$DW$T$40, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$40, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$40, DW_AT_decl_line(0xef) .dwattr $C$DW$T$40, DW_AT_decl_column(0x02) $C$DW$T$41 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$41, DW_AT_byte_size(0x24) $C$DW$612 .dwtag DW_TAG_member .dwattr $C$DW$612, DW_AT_type(*$C$DW$T$39) .dwattr $C$DW$612, DW_AT_name("DeviceUsage") .dwattr $C$DW$612, DW_AT_TI_symbol_name("DeviceUsage") .dwattr $C$DW$612, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$612, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$612, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$612, DW_AT_decl_line(0xf4) .dwattr $C$DW$612, DW_AT_decl_column(0x1e) $C$DW$613 .dwtag DW_TAG_member .dwattr $C$DW$613, DW_AT_type(*$C$DW$T$40) .dwattr $C$DW$613, DW_AT_name("FilesUsage") .dwattr $C$DW$613, DW_AT_TI_symbol_name("FilesUsage") .dwattr $C$DW$613, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$613, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$613, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$613, DW_AT_decl_line(0xf5) .dwattr $C$DW$613, DW_AT_decl_column(0x1e) .dwattr $C$DW$T$41, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$41, DW_AT_decl_line(0xf3) .dwattr $C$DW$T$41, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$41 $C$DW$T$456 .dwtag DW_TAG_typedef .dwattr $C$DW$T$456, DW_AT_name("SlFsControlGetStorageInfoResponse_t") .dwattr $C$DW$T$456, DW_AT_type(*$C$DW$T$41) .dwattr $C$DW$T$456, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$456, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$456, DW_AT_decl_line(0xf6) .dwattr $C$DW$T$456, DW_AT_decl_column(0x03) $C$DW$T$42 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$42, DW_AT_byte_size(0x0c) $C$DW$614 .dwtag DW_TAG_member .dwattr $C$DW$614, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$614, DW_AT_name("IncludeFilters") .dwattr $C$DW$614, DW_AT_TI_symbol_name("IncludeFilters") .dwattr $C$DW$614, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$614, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$614, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$614, DW_AT_decl_line(0xfa) .dwattr $C$DW$614, DW_AT_decl_column(0x0b) $C$DW$615 .dwtag DW_TAG_member .dwattr $C$DW$615, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$615, DW_AT_name("OpenedForWriteCnt") .dwattr $C$DW$615, DW_AT_TI_symbol_name("OpenedForWriteCnt") .dwattr $C$DW$615, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$615, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$615, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$615, DW_AT_decl_line(0xfb) .dwattr $C$DW$615, DW_AT_decl_column(0x0b) $C$DW$616 .dwtag DW_TAG_member .dwattr $C$DW$616, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$616, DW_AT_name("OpeneForReadCnt") .dwattr $C$DW$616, DW_AT_TI_symbol_name("OpeneForReadCnt") .dwattr $C$DW$616, DW_AT_data_member_location[DW_OP_plus_uconst 0x5] .dwattr $C$DW$616, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$616, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$616, DW_AT_decl_line(0xfc) .dwattr $C$DW$616, DW_AT_decl_column(0x0b) $C$DW$617 .dwtag DW_TAG_member .dwattr $C$DW$617, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$617, DW_AT_name("ClosedFilesCnt") .dwattr $C$DW$617, DW_AT_TI_symbol_name("ClosedFilesCnt") .dwattr $C$DW$617, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$617, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$617, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$617, DW_AT_decl_line(0xfd) .dwattr $C$DW$617, DW_AT_decl_column(0x0b) $C$DW$618 .dwtag DW_TAG_member .dwattr $C$DW$618, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$618, DW_AT_name("OpenedForWriteCntWithValidFailSafeImage") .dwattr $C$DW$618, DW_AT_TI_symbol_name("OpenedForWriteCntWithValidFailSafeImage") .dwattr $C$DW$618, DW_AT_data_member_location[DW_OP_plus_uconst 0x7] .dwattr $C$DW$618, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$618, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$618, DW_AT_decl_line(0xfe) .dwattr $C$DW$618, DW_AT_decl_column(0x0b) $C$DW$619 .dwtag DW_TAG_member .dwattr $C$DW$619, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$619, DW_AT_name("OpeneForReadCntWithValidFailSafeImage") .dwattr $C$DW$619, DW_AT_TI_symbol_name("OpeneForReadCntWithValidFailSafeImage") .dwattr $C$DW$619, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$619, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$619, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$619, DW_AT_decl_line(0xff) .dwattr $C$DW$619, DW_AT_decl_column(0x0b) $C$DW$620 .dwtag DW_TAG_member .dwattr $C$DW$620, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$620, DW_AT_name("ClosedFilesCntWithValidFailSafeImage") .dwattr $C$DW$620, DW_AT_TI_symbol_name("ClosedFilesCntWithValidFailSafeImage") .dwattr $C$DW$620, DW_AT_data_member_location[DW_OP_plus_uconst 0x9] .dwattr $C$DW$620, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$620, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$620, DW_AT_decl_line(0x100) .dwattr $C$DW$620, DW_AT_decl_column(0x0b) $C$DW$621 .dwtag DW_TAG_member .dwattr $C$DW$621, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$621, DW_AT_name("padding") .dwattr $C$DW$621, DW_AT_TI_symbol_name("padding") .dwattr $C$DW$621, DW_AT_data_member_location[DW_OP_plus_uconst 0xa] .dwattr $C$DW$621, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$621, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$621, DW_AT_decl_line(0x101) .dwattr $C$DW$621, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$42, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$42, DW_AT_decl_line(0xf9) .dwattr $C$DW$T$42, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$42 $C$DW$T$457 .dwtag DW_TAG_typedef .dwattr $C$DW$T$457, DW_AT_name("SlFsControlGetCountersResponse_t") .dwattr $C$DW$T$457, DW_AT_type(*$C$DW$T$42) .dwattr $C$DW$T$457, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$457, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$457, DW_AT_decl_line(0x102) .dwattr $C$DW$T$457, DW_AT_decl_column(0x03) $C$DW$T$43 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$43, DW_AT_byte_size(0x0c) $C$DW$622 .dwtag DW_TAG_member .dwattr $C$DW$622, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$622, DW_AT_name("FileMaxSize") .dwattr $C$DW$622, DW_AT_TI_symbol_name("FileMaxSize") .dwattr $C$DW$622, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$622, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$622, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$622, DW_AT_decl_line(0x111) .dwattr $C$DW$622, DW_AT_decl_column(0x0a) $C$DW$623 .dwtag DW_TAG_member .dwattr $C$DW$623, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$623, DW_AT_name("Properties") .dwattr $C$DW$623, DW_AT_TI_symbol_name("Properties") .dwattr $C$DW$623, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$623, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$623, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$623, DW_AT_decl_line(0x112) .dwattr $C$DW$623, DW_AT_decl_column(0x0a) $C$DW$624 .dwtag DW_TAG_member .dwattr $C$DW$624, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$624, DW_AT_name("FileAllocatedBlocks") .dwattr $C$DW$624, DW_AT_TI_symbol_name("FileAllocatedBlocks") .dwattr $C$DW$624, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$624, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$624, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$624, DW_AT_decl_line(0x113) .dwattr $C$DW$624, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$43, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$43, DW_AT_decl_line(0x110) .dwattr $C$DW$T$43, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$43 $C$DW$T$458 .dwtag DW_TAG_typedef .dwattr $C$DW$T$458, DW_AT_name("SlFileAttributes_t") .dwattr $C$DW$T$458, DW_AT_type(*$C$DW$T$43) .dwattr $C$DW$T$458, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$458, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$458, DW_AT_decl_line(0x114) .dwattr $C$DW$T$458, DW_AT_decl_column(0x02) $C$DW$T$44 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$44, DW_AT_byte_size(0x04) $C$DW$625 .dwtag DW_TAG_member .dwattr $C$DW$625, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$625, DW_AT_name("KeepaliveEnabled") .dwattr $C$DW$625, DW_AT_TI_symbol_name("KeepaliveEnabled") .dwattr $C$DW$625, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$625, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$625, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$625, DW_AT_decl_line(0xf6) .dwattr $C$DW$625, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$44, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$44, DW_AT_decl_line(0xf5) .dwattr $C$DW$T$44, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$44 $C$DW$T$459 .dwtag DW_TAG_typedef .dwattr $C$DW$T$459, DW_AT_name("SlSockKeepalive_t") .dwattr $C$DW$T$459, DW_AT_type(*$C$DW$T$44) .dwattr $C$DW$T$459, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$459, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$459, DW_AT_decl_line(0xf7) .dwattr $C$DW$T$459, DW_AT_decl_column(0x02) $C$DW$T$45 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$45, DW_AT_byte_size(0x04) $C$DW$626 .dwtag DW_TAG_member .dwattr $C$DW$626, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$626, DW_AT_name("ReuseaddrEnabled") .dwattr $C$DW$626, DW_AT_TI_symbol_name("ReuseaddrEnabled") .dwattr $C$DW$626, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$626, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$626, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$626, DW_AT_decl_line(0xfb) .dwattr $C$DW$626, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$45, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$45, DW_AT_decl_line(0xfa) .dwattr $C$DW$T$45, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$45 $C$DW$T$460 .dwtag DW_TAG_typedef .dwattr $C$DW$T$460, DW_AT_name("SlSockReuseaddr_t") .dwattr $C$DW$T$460, DW_AT_type(*$C$DW$T$45) .dwattr $C$DW$T$460, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$460, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$460, DW_AT_decl_line(0xfc) .dwattr $C$DW$T$460, DW_AT_decl_column(0x02) $C$DW$T$46 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$46, DW_AT_byte_size(0x04) $C$DW$627 .dwtag DW_TAG_member .dwattr $C$DW$627, DW_AT_type(*$C$DW$T$12) .dwattr $C$DW$627, DW_AT_name("RxIpNoBoundaryEnabled") .dwattr $C$DW$627, DW_AT_TI_symbol_name("RxIpNoBoundaryEnabled") .dwattr $C$DW$627, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$627, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$627, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$627, DW_AT_decl_line(0x100) .dwattr $C$DW$627, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$46, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$46, DW_AT_decl_line(0xff) .dwattr $C$DW$T$46, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$46 $C$DW$T$461 .dwtag DW_TAG_typedef .dwattr $C$DW$T$461, DW_AT_name("SlSockRxNoIpBoundary_t") .dwattr $C$DW$T$461, DW_AT_type(*$C$DW$T$46) .dwattr $C$DW$T$461, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$461, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$461, DW_AT_decl_line(0x101) .dwattr $C$DW$T$461, DW_AT_decl_column(0x03) $C$DW$T$47 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$47, DW_AT_byte_size(0x04) $C$DW$628 .dwtag DW_TAG_member .dwattr $C$DW$628, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$628, DW_AT_name("WinSize") .dwattr $C$DW$628, DW_AT_TI_symbol_name("WinSize") .dwattr $C$DW$628, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$628, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$628, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$628, DW_AT_decl_line(0x105) .dwattr $C$DW$628, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$47, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$47, DW_AT_decl_line(0x104) .dwattr $C$DW$T$47, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$47 $C$DW$T$462 .dwtag DW_TAG_typedef .dwattr $C$DW$T$462, DW_AT_name("SlSockWinsize_t") .dwattr $C$DW$T$462, DW_AT_type(*$C$DW$T$47) .dwattr $C$DW$T$462, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$462, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$462, DW_AT_decl_line(0x106) .dwattr $C$DW$T$462, DW_AT_decl_column(0x02) $C$DW$T$48 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$48, DW_AT_byte_size(0x04) $C$DW$629 .dwtag DW_TAG_member .dwattr $C$DW$629, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$629, DW_AT_name("NonBlockingEnabled") .dwattr $C$DW$629, DW_AT_TI_symbol_name("NonBlockingEnabled") .dwattr $C$DW$629, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$629, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$629, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$629, DW_AT_decl_line(0x10a) .dwattr $C$DW$629, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$48, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$48, DW_AT_decl_line(0x109) .dwattr $C$DW$T$48, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$48 $C$DW$T$463 .dwtag DW_TAG_typedef .dwattr $C$DW$T$463, DW_AT_name("SlSockNonblocking_t") .dwattr $C$DW$T$463, DW_AT_type(*$C$DW$T$48) .dwattr $C$DW$T$463, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$463, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$463, DW_AT_decl_line(0x10b) .dwattr $C$DW$T$463, DW_AT_decl_column(0x02) $C$DW$T$50 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$50, DW_AT_byte_size(0x84) $C$DW$630 .dwtag DW_TAG_member .dwattr $C$DW$630, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$630, DW_AT_name("Sd") .dwattr $C$DW$630, DW_AT_TI_symbol_name("Sd") .dwattr $C$DW$630, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$630, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$630, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$630, DW_AT_decl_line(0x10f) .dwattr $C$DW$630, DW_AT_decl_column(0x0b) $C$DW$631 .dwtag DW_TAG_member .dwattr $C$DW$631, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$631, DW_AT_name("Type") .dwattr $C$DW$631, DW_AT_TI_symbol_name("Type") .dwattr $C$DW$631, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$631, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$631, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$631, DW_AT_decl_line(0x110) .dwattr $C$DW$631, DW_AT_decl_column(0x0b) $C$DW$632 .dwtag DW_TAG_member .dwattr $C$DW$632, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$632, DW_AT_name("Val") .dwattr $C$DW$632, DW_AT_TI_symbol_name("Val") .dwattr $C$DW$632, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$632, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$632, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$632, DW_AT_decl_line(0x111) .dwattr $C$DW$632, DW_AT_decl_column(0x0b) $C$DW$633 .dwtag DW_TAG_member .dwattr $C$DW$633, DW_AT_type(*$C$DW$T$49) .dwattr $C$DW$633, DW_AT_name("pExtraInfo") .dwattr $C$DW$633, DW_AT_TI_symbol_name("pExtraInfo") .dwattr $C$DW$633, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$633, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$633, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$633, DW_AT_decl_line(0x112) .dwattr $C$DW$633, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$50, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$50, DW_AT_decl_line(0x10e) .dwattr $C$DW$T$50, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$50 $C$DW$T$211 .dwtag DW_TAG_typedef .dwattr $C$DW$T$211, DW_AT_name("SlSocketAsyncEvent_t") .dwattr $C$DW$T$211, DW_AT_type(*$C$DW$T$50) .dwattr $C$DW$T$211, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$211, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$211, DW_AT_decl_line(0x113) .dwattr $C$DW$T$211, DW_AT_decl_column(0x03) $C$DW$T$51 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$51, DW_AT_byte_size(0x04) $C$DW$634 .dwtag DW_TAG_member .dwattr $C$DW$634, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$634, DW_AT_name("Status") .dwattr $C$DW$634, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$634, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$634, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$634, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$634, DW_AT_decl_line(0x117) .dwattr $C$DW$634, DW_AT_decl_column(0x10) $C$DW$635 .dwtag DW_TAG_member .dwattr $C$DW$635, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$635, DW_AT_name("Sd") .dwattr $C$DW$635, DW_AT_TI_symbol_name("Sd") .dwattr $C$DW$635, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$635, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$635, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$635, DW_AT_decl_line(0x118) .dwattr $C$DW$635, DW_AT_decl_column(0x10) $C$DW$636 .dwtag DW_TAG_member .dwattr $C$DW$636, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$636, DW_AT_name("Padding") .dwattr $C$DW$636, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$636, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$636, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$636, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$636, DW_AT_decl_line(0x119) .dwattr $C$DW$636, DW_AT_decl_column(0x10) .dwattr $C$DW$T$51, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$51, DW_AT_decl_line(0x116) .dwattr $C$DW$T$51, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$51 $C$DW$T$210 .dwtag DW_TAG_typedef .dwattr $C$DW$T$210, DW_AT_name("SlSockTxFailEventData_t") .dwattr $C$DW$T$210, DW_AT_type(*$C$DW$T$51) .dwattr $C$DW$T$210, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$210, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$210, DW_AT_decl_line(0x11a) .dwattr $C$DW$T$210, DW_AT_decl_column(0x03) $C$DW$T$53 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$53, DW_AT_byte_size(0x88) $C$DW$637 .dwtag DW_TAG_member .dwattr $C$DW$637, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$637, DW_AT_name("Event") .dwattr $C$DW$637, DW_AT_TI_symbol_name("Event") .dwattr $C$DW$637, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$637, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$637, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$637, DW_AT_decl_line(0x126) .dwattr $C$DW$637, DW_AT_decl_column(0x1c) $C$DW$638 .dwtag DW_TAG_member .dwattr $C$DW$638, DW_AT_type(*$C$DW$T$52) .dwattr $C$DW$638, DW_AT_name("SocketAsyncEvent") .dwattr $C$DW$638, DW_AT_TI_symbol_name("SocketAsyncEvent") .dwattr $C$DW$638, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$638, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$638, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$638, DW_AT_decl_line(0x127) .dwattr $C$DW$638, DW_AT_decl_column(0x1c) .dwattr $C$DW$T$53, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$53, DW_AT_decl_line(0x125) .dwattr $C$DW$T$53, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$53 $C$DW$T$464 .dwtag DW_TAG_typedef .dwattr $C$DW$T$464, DW_AT_name("SlSockEvent_t") .dwattr $C$DW$T$464, DW_AT_type(*$C$DW$T$53) .dwattr $C$DW$T$464, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$464, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$464, DW_AT_decl_line(0x128) .dwattr $C$DW$T$464, DW_AT_decl_column(0x03) $C$DW$T$54 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$54, DW_AT_byte_size(0x08) $C$DW$639 .dwtag DW_TAG_member .dwattr $C$DW$639, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$639, DW_AT_name("Event") .dwattr $C$DW$639, DW_AT_TI_symbol_name("Event") .dwattr $C$DW$639, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$639, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$639, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$639, DW_AT_decl_line(0x12c) .dwattr $C$DW$639, DW_AT_decl_column(0x11) $C$DW$640 .dwtag DW_TAG_member .dwattr $C$DW$640, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$640, DW_AT_name("EventData") .dwattr $C$DW$640, DW_AT_TI_symbol_name("EventData") .dwattr $C$DW$640, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$640, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$640, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$640, DW_AT_decl_line(0x12d) .dwattr $C$DW$640, DW_AT_decl_column(0x11) .dwattr $C$DW$T$54, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$54, DW_AT_decl_line(0x12b) .dwattr $C$DW$T$54, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$54 $C$DW$T$465 .dwtag DW_TAG_typedef .dwattr $C$DW$T$465, DW_AT_name("SlSockTriggerEvent_t") .dwattr $C$DW$T$465, DW_AT_type(*$C$DW$T$54) .dwattr $C$DW$T$465, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$465, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$465, DW_AT_decl_line(0x12e) .dwattr $C$DW$T$465, DW_AT_decl_column(0x03) $C$DW$T$55 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$55, DW_AT_byte_size(0x04) $C$DW$641 .dwtag DW_TAG_member .dwattr $C$DW$641, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$641, DW_AT_name("SecureALPN") .dwattr $C$DW$641, DW_AT_TI_symbol_name("SecureALPN") .dwattr $C$DW$641, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$641, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$641, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$641, DW_AT_decl_line(0x133) .dwattr $C$DW$641, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$55, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$55, DW_AT_decl_line(0x132) .dwattr $C$DW$T$55, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$55 $C$DW$T$466 .dwtag DW_TAG_typedef .dwattr $C$DW$T$466, DW_AT_name("SlSockSecureALPN_t") .dwattr $C$DW$T$466, DW_AT_type(*$C$DW$T$55) .dwattr $C$DW$T$466, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$466, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$466, DW_AT_decl_line(0x134) .dwattr $C$DW$T$466, DW_AT_decl_column(0x03) $C$DW$T$56 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$56, DW_AT_byte_size(0x04) $C$DW$642 .dwtag DW_TAG_member .dwattr $C$DW$642, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$642, DW_AT_name("SecureMask") .dwattr $C$DW$642, DW_AT_TI_symbol_name("SecureMask") .dwattr $C$DW$642, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$642, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$642, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$642, DW_AT_decl_line(0x138) .dwattr $C$DW$642, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$56, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$56, DW_AT_decl_line(0x137) .dwattr $C$DW$T$56, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$56 $C$DW$T$467 .dwtag DW_TAG_typedef .dwattr $C$DW$T$467, DW_AT_name("SlSockSecureMask_t") .dwattr $C$DW$T$467, DW_AT_type(*$C$DW$T$56) .dwattr $C$DW$T$467, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$467, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$467, DW_AT_decl_line(0x139) .dwattr $C$DW$T$467, DW_AT_decl_column(0x03) $C$DW$T$57 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$57, DW_AT_byte_size(0x01) $C$DW$643 .dwtag DW_TAG_member .dwattr $C$DW$643, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$643, DW_AT_name("SecureMethod") .dwattr $C$DW$643, DW_AT_TI_symbol_name("SecureMethod") .dwattr $C$DW$643, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$643, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$643, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$643, DW_AT_decl_line(0x13d) .dwattr $C$DW$643, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$57, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$57, DW_AT_decl_line(0x13c) .dwattr $C$DW$T$57, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$57 $C$DW$T$468 .dwtag DW_TAG_typedef .dwattr $C$DW$T$468, DW_AT_name("SlSockSecureMethod_t") .dwattr $C$DW$T$468, DW_AT_type(*$C$DW$T$57) .dwattr $C$DW$T$468, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$468, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$468, DW_AT_decl_line(0x13e) .dwattr $C$DW$T$468, DW_AT_decl_column(0x03) $C$DW$T$61 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$61, DW_AT_byte_size(0x38) $C$DW$644 .dwtag DW_TAG_member .dwattr $C$DW$644, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$644, DW_AT_name("SubjectNameXoredSha1") .dwattr $C$DW$644, DW_AT_TI_symbol_name("SubjectNameXoredSha1") .dwattr $C$DW$644, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$644, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$644, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$644, DW_AT_decl_line(0x142) .dwattr $C$DW$644, DW_AT_decl_column(0x0a) $C$DW$645 .dwtag DW_TAG_member .dwattr $C$DW$645, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$645, DW_AT_name("IssuerNameXoredSha1") .dwattr $C$DW$645, DW_AT_TI_symbol_name("IssuerNameXoredSha1") .dwattr $C$DW$645, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$645, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$645, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$645, DW_AT_decl_line(0x143) .dwattr $C$DW$645, DW_AT_decl_column(0x0a) $C$DW$646 .dwtag DW_TAG_member .dwattr $C$DW$646, DW_AT_type(*$C$DW$T$58) .dwattr $C$DW$646, DW_AT_name("FromDate") .dwattr $C$DW$646, DW_AT_TI_symbol_name("FromDate") .dwattr $C$DW$646, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$646, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$646, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$646, DW_AT_decl_line(0x144) .dwattr $C$DW$646, DW_AT_decl_column(0x0a) $C$DW$647 .dwtag DW_TAG_member .dwattr $C$DW$647, DW_AT_type(*$C$DW$T$58) .dwattr $C$DW$647, DW_AT_name("ToDate") .dwattr $C$DW$647, DW_AT_TI_symbol_name("ToDate") .dwattr $C$DW$647, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$647, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$647, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$647, DW_AT_decl_line(0x145) .dwattr $C$DW$647, DW_AT_decl_column(0x0a) $C$DW$648 .dwtag DW_TAG_member .dwattr $C$DW$648, DW_AT_type(*$C$DW$T$59) .dwattr $C$DW$648, DW_AT_name("SubjectName") .dwattr $C$DW$648, DW_AT_TI_symbol_name("SubjectName") .dwattr $C$DW$648, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$648, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$648, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$648, DW_AT_decl_line(0x146) .dwattr $C$DW$648, DW_AT_decl_column(0x0a) $C$DW$649 .dwtag DW_TAG_member .dwattr $C$DW$649, DW_AT_type(*$C$DW$T$59) .dwattr $C$DW$649, DW_AT_name("IssuerName") .dwattr $C$DW$649, DW_AT_TI_symbol_name("IssuerName") .dwattr $C$DW$649, DW_AT_data_member_location[DW_OP_plus_uconst 0x24] .dwattr $C$DW$649, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$649, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$649, DW_AT_decl_line(0x147) .dwattr $C$DW$649, DW_AT_decl_column(0x0a) $C$DW$650 .dwtag DW_TAG_member .dwattr $C$DW$650, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$650, DW_AT_name("SubjectNameLen") .dwattr $C$DW$650, DW_AT_TI_symbol_name("SubjectNameLen") .dwattr $C$DW$650, DW_AT_data_member_location[DW_OP_plus_uconst 0x34] .dwattr $C$DW$650, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$650, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$650, DW_AT_decl_line(0x148) .dwattr $C$DW$650, DW_AT_decl_column(0x0a) $C$DW$651 .dwtag DW_TAG_member .dwattr $C$DW$651, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$651, DW_AT_name("IssuerNameLen") .dwattr $C$DW$651, DW_AT_TI_symbol_name("IssuerNameLen") .dwattr $C$DW$651, DW_AT_data_member_location[DW_OP_plus_uconst 0x35] .dwattr $C$DW$651, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$651, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$651, DW_AT_decl_line(0x149) .dwattr $C$DW$651, DW_AT_decl_column(0x0a) $C$DW$652 .dwtag DW_TAG_member .dwattr $C$DW$652, DW_AT_type(*$C$DW$T$60) .dwattr $C$DW$652, DW_AT_name("Padding") .dwattr $C$DW$652, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$652, DW_AT_data_member_location[DW_OP_plus_uconst 0x36] .dwattr $C$DW$652, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$652, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$652, DW_AT_decl_line(0x14a) .dwattr $C$DW$652, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$61, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$61, DW_AT_decl_line(0x141) .dwattr $C$DW$T$61, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$61 $C$DW$T$62 .dwtag DW_TAG_typedef .dwattr $C$DW$T$62, DW_AT_name("SlSockSSLCertInfo_t") .dwattr $C$DW$T$62, DW_AT_type(*$C$DW$T$61) .dwattr $C$DW$T$62, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$62, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$62, DW_AT_decl_line(0x14b) .dwattr $C$DW$T$62, DW_AT_decl_column(0x03) $C$DW$T$63 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$63, DW_AT_byte_size(0x48) $C$DW$653 .dwtag DW_TAG_member .dwattr $C$DW$653, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$653, DW_AT_name("SecureVersion") .dwattr $C$DW$653, DW_AT_TI_symbol_name("SecureVersion") .dwattr $C$DW$653, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$653, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$653, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$653, DW_AT_decl_line(0x150) .dwattr $C$DW$653, DW_AT_decl_column(0x0e) $C$DW$654 .dwtag DW_TAG_member .dwattr $C$DW$654, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$654, DW_AT_name("SecureCipherSuit") .dwattr $C$DW$654, DW_AT_TI_symbol_name("SecureCipherSuit") .dwattr $C$DW$654, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$654, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$654, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$654, DW_AT_decl_line(0x151) .dwattr $C$DW$654, DW_AT_decl_column(0x0e) $C$DW$655 .dwtag DW_TAG_member .dwattr $C$DW$655, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$655, DW_AT_name("SecureIsPeerValidated") .dwattr $C$DW$655, DW_AT_TI_symbol_name("SecureIsPeerValidated") .dwattr $C$DW$655, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$655, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$655, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$655, DW_AT_decl_line(0x152) .dwattr $C$DW$655, DW_AT_decl_column(0x0e) $C$DW$656 .dwtag DW_TAG_member .dwattr $C$DW$656, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$656, DW_AT_name("SecureALPNChosenProtocol") .dwattr $C$DW$656, DW_AT_TI_symbol_name("SecureALPNChosenProtocol") .dwattr $C$DW$656, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$656, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$656, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$656, DW_AT_decl_line(0x153) .dwattr $C$DW$656, DW_AT_decl_column(0x0e) $C$DW$657 .dwtag DW_TAG_member .dwattr $C$DW$657, DW_AT_type(*$C$DW$T$62) .dwattr $C$DW$657, DW_AT_name("SecurePeerCertinfo") .dwattr $C$DW$657, DW_AT_TI_symbol_name("SecurePeerCertinfo") .dwattr $C$DW$657, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$657, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$657, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$657, DW_AT_decl_line(0x15a) .dwattr $C$DW$657, DW_AT_decl_column(0x19) .dwattr $C$DW$T$63, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$63, DW_AT_decl_line(0x14f) .dwattr $C$DW$T$63, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$63 $C$DW$T$469 .dwtag DW_TAG_typedef .dwattr $C$DW$T$469, DW_AT_name("SlSockSSLConnectionParams_t") .dwattr $C$DW$T$469, DW_AT_type(*$C$DW$T$63) .dwattr $C$DW$T$469, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$469, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$469, DW_AT_decl_line(0x15b) .dwattr $C$DW$T$469, DW_AT_decl_column(0x03) $C$DW$T$65 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$65, DW_AT_byte_size(0x08) $C$DW$658 .dwtag DW_TAG_member .dwattr $C$DW$658, DW_AT_type(*$C$DW$T$64) .dwattr $C$DW$658, DW_AT_name("imr_multiaddr") .dwattr $C$DW$658, DW_AT_TI_symbol_name("imr_multiaddr") .dwattr $C$DW$658, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$658, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$658, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$658, DW_AT_decl_line(0x167) .dwattr $C$DW$658, DW_AT_decl_column(0x12) $C$DW$659 .dwtag DW_TAG_member .dwattr $C$DW$659, DW_AT_type(*$C$DW$T$64) .dwattr $C$DW$659, DW_AT_name("imr_interface") .dwattr $C$DW$659, DW_AT_TI_symbol_name("imr_interface") .dwattr $C$DW$659, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$659, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$659, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$659, DW_AT_decl_line(0x168) .dwattr $C$DW$659, DW_AT_decl_column(0x12) .dwattr $C$DW$T$65, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$65, DW_AT_decl_line(0x166) .dwattr $C$DW$T$65, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$65 $C$DW$T$470 .dwtag DW_TAG_typedef .dwattr $C$DW$T$470, DW_AT_name("SlSockIpMreq_t") .dwattr $C$DW$T$470, DW_AT_type(*$C$DW$T$65) .dwattr $C$DW$T$470, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$470, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$470, DW_AT_decl_line(0x169) .dwattr $C$DW$T$470, DW_AT_decl_column(0x02) $C$DW$T$67 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$67, DW_AT_byte_size(0x14) $C$DW$660 .dwtag DW_TAG_member .dwattr $C$DW$660, DW_AT_type(*$C$DW$T$66) .dwattr $C$DW$660, DW_AT_name("ipv6mr_multiaddr") .dwattr $C$DW$660, DW_AT_TI_symbol_name("ipv6mr_multiaddr") .dwattr $C$DW$660, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$660, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$660, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$660, DW_AT_decl_line(0x16c) .dwattr $C$DW$660, DW_AT_decl_column(0x11) $C$DW$661 .dwtag DW_TAG_member .dwattr $C$DW$661, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$661, DW_AT_name("ipv6mr_interface") .dwattr $C$DW$661, DW_AT_TI_symbol_name("ipv6mr_interface") .dwattr $C$DW$661, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$661, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$661, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$661, DW_AT_decl_line(0x16d) .dwattr $C$DW$661, DW_AT_decl_column(0x11) .dwattr $C$DW$T$67, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$67, DW_AT_decl_line(0x16b) .dwattr $C$DW$T$67, DW_AT_decl_column(0x0f) .dwendtag $C$DW$T$67 $C$DW$T$471 .dwtag DW_TAG_typedef .dwattr $C$DW$T$471, DW_AT_name("SlSockIpV6Mreq_t") .dwattr $C$DW$T$471, DW_AT_type(*$C$DW$T$67) .dwattr $C$DW$T$471, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$471, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$471, DW_AT_decl_line(0x16e) .dwattr $C$DW$T$471, DW_AT_decl_column(0x02) $C$DW$T$68 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$68, DW_AT_byte_size(0x08) $C$DW$662 .dwtag DW_TAG_member .dwattr $C$DW$662, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$662, DW_AT_name("l_onoff") .dwattr $C$DW$662, DW_AT_TI_symbol_name("l_onoff") .dwattr $C$DW$662, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$662, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$662, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$662, DW_AT_decl_line(0x172) .dwattr $C$DW$662, DW_AT_decl_column(0x0a) $C$DW$663 .dwtag DW_TAG_member .dwattr $C$DW$663, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$663, DW_AT_name("l_linger") .dwattr $C$DW$663, DW_AT_TI_symbol_name("l_linger") .dwattr $C$DW$663, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$663, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$663, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$663, DW_AT_decl_line(0x173) .dwattr $C$DW$663, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$68, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$68, DW_AT_decl_line(0x171) .dwattr $C$DW$T$68, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$68 $C$DW$T$472 .dwtag DW_TAG_typedef .dwattr $C$DW$T$472, DW_AT_name("SlSocklinger_t") .dwattr $C$DW$T$472, DW_AT_type(*$C$DW$T$68) .dwattr $C$DW$T$472, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$472, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$472, DW_AT_decl_line(0x174) .dwattr $C$DW$T$472, DW_AT_decl_column(0x02) $C$DW$T$70 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$70, DW_AT_byte_size(0x04) $C$DW$664 .dwtag DW_TAG_member .dwattr $C$DW$664, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$664, DW_AT_name("SecureFiles") .dwattr $C$DW$664, DW_AT_TI_symbol_name("SecureFiles") .dwattr $C$DW$664, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$664, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$664, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$664, DW_AT_decl_line(0x19e) .dwattr $C$DW$664, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$70, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$70, DW_AT_decl_line(0x19d) .dwattr $C$DW$T$70, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$70 $C$DW$T$473 .dwtag DW_TAG_typedef .dwattr $C$DW$T$473, DW_AT_name("SlSockSecureFiles_t") .dwattr $C$DW$T$473, DW_AT_type(*$C$DW$T$70) .dwattr $C$DW$T$473, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$473, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$473, DW_AT_decl_line(0x19f) .dwattr $C$DW$T$473, DW_AT_decl_column(0x02) $C$DW$T$71 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$71, DW_AT_byte_size(0x08) $C$DW$665 .dwtag DW_TAG_member .dwattr $C$DW$665, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$665, DW_AT_name("Rate") .dwattr $C$DW$665, DW_AT_TI_symbol_name("Rate") .dwattr $C$DW$665, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$665, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$665, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$665, DW_AT_decl_line(0x1a8) .dwattr $C$DW$665, DW_AT_decl_column(0x0b) $C$DW$666 .dwtag DW_TAG_member .dwattr $C$DW$666, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$666, DW_AT_name("Channel") .dwattr $C$DW$666, DW_AT_TI_symbol_name("Channel") .dwattr $C$DW$666, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$666, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$666, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$666, DW_AT_decl_line(0x1a9) .dwattr $C$DW$666, DW_AT_decl_column(0x0b) $C$DW$667 .dwtag DW_TAG_member .dwattr $C$DW$667, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$667, DW_AT_name("Rssi") .dwattr $C$DW$667, DW_AT_TI_symbol_name("Rssi") .dwattr $C$DW$667, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$667, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$667, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$667, DW_AT_decl_line(0x1aa) .dwattr $C$DW$667, DW_AT_decl_column(0x0b) $C$DW$668 .dwtag DW_TAG_member .dwattr $C$DW$668, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$668, DW_AT_name("Padding") .dwattr $C$DW$668, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$668, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$668, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$668, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$668, DW_AT_decl_line(0x1ab) .dwattr $C$DW$668, DW_AT_decl_column(0x0b) $C$DW$669 .dwtag DW_TAG_member .dwattr $C$DW$669, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$669, DW_AT_name("Timestamp") .dwattr $C$DW$669, DW_AT_TI_symbol_name("Timestamp") .dwattr $C$DW$669, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$669, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$669, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$669, DW_AT_decl_line(0x1ac) .dwattr $C$DW$669, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$71, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$71, DW_AT_decl_line(0x1a7) .dwattr $C$DW$T$71, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$71 $C$DW$T$474 .dwtag DW_TAG_typedef .dwattr $C$DW$T$474, DW_AT_name("SlTransceiverRxOverHead_t") .dwattr $C$DW$T$474, DW_AT_type(*$C$DW$T$71) .dwattr $C$DW$T$474, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$474, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$474, DW_AT_decl_line(0x1ad) .dwattr $C$DW$T$474, DW_AT_decl_column(0x02) $C$DW$T$72 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$72, DW_AT_byte_size(0x0c) $C$DW$670 .dwtag DW_TAG_member .dwattr $C$DW$670, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$670, DW_AT_name("Ip") .dwattr $C$DW$670, DW_AT_TI_symbol_name("Ip") .dwattr $C$DW$670, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$670, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$670, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$670, DW_AT_decl_line(0xd2) .dwattr $C$DW$670, DW_AT_decl_column(0x0a) $C$DW$671 .dwtag DW_TAG_member .dwattr $C$DW$671, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$671, DW_AT_name("Gateway") .dwattr $C$DW$671, DW_AT_TI_symbol_name("Gateway") .dwattr $C$DW$671, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$671, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$671, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$671, DW_AT_decl_line(0xd3) .dwattr $C$DW$671, DW_AT_decl_column(0x0a) $C$DW$672 .dwtag DW_TAG_member .dwattr $C$DW$672, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$672, DW_AT_name("Dns") .dwattr $C$DW$672, DW_AT_TI_symbol_name("Dns") .dwattr $C$DW$672, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$672, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$672, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$672, DW_AT_decl_line(0xd4) .dwattr $C$DW$672, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$72, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$72, DW_AT_decl_line(0xd1) .dwattr $C$DW$T$72, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$72 $C$DW$T$213 .dwtag DW_TAG_typedef .dwattr $C$DW$T$213, DW_AT_name("SlIpV4AcquiredAsync_t") .dwattr $C$DW$T$213, DW_AT_type(*$C$DW$T$72) .dwattr $C$DW$T$213, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$213, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$213, DW_AT_decl_line(0xd5) .dwattr $C$DW$T$213, DW_AT_decl_column(0x02) $C$DW$T$73 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$73, DW_AT_byte_size(0x20) $C$DW$673 .dwtag DW_TAG_member .dwattr $C$DW$673, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$673, DW_AT_name("Ip") .dwattr $C$DW$673, DW_AT_TI_symbol_name("Ip") .dwattr $C$DW$673, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$673, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$673, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$673, DW_AT_decl_line(0xdf) .dwattr $C$DW$673, DW_AT_decl_column(0x0a) $C$DW$674 .dwtag DW_TAG_member .dwattr $C$DW$674, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$674, DW_AT_name("Dns") .dwattr $C$DW$674, DW_AT_TI_symbol_name("Dns") .dwattr $C$DW$674, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$674, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$674, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$674, DW_AT_decl_line(0xe0) .dwattr $C$DW$674, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$73, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$73, DW_AT_decl_line(0xde) .dwattr $C$DW$T$73, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$73 $C$DW$T$214 .dwtag DW_TAG_typedef .dwattr $C$DW$T$214, DW_AT_name("SlIpV6AcquiredAsync_t") .dwattr $C$DW$T$214, DW_AT_type(*$C$DW$T$73) .dwattr $C$DW$T$214, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$214, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$214, DW_AT_decl_line(0xe1) .dwattr $C$DW$T$214, DW_AT_decl_column(0x02) $C$DW$T$74 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$74, DW_AT_byte_size(0x10) $C$DW$675 .dwtag DW_TAG_member .dwattr $C$DW$675, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$675, DW_AT_name("IpAddress") .dwattr $C$DW$675, DW_AT_TI_symbol_name("IpAddress") .dwattr $C$DW$675, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$675, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$675, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$675, DW_AT_decl_line(0xe5) .dwattr $C$DW$675, DW_AT_decl_column(0x0d) $C$DW$676 .dwtag DW_TAG_member .dwattr $C$DW$676, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$676, DW_AT_name("LeaseTime") .dwattr $C$DW$676, DW_AT_TI_symbol_name("LeaseTime") .dwattr $C$DW$676, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$676, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$676, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$676, DW_AT_decl_line(0xe6) .dwattr $C$DW$676, DW_AT_decl_column(0x0d) $C$DW$677 .dwtag DW_TAG_member .dwattr $C$DW$677, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$677, DW_AT_name("Mac") .dwattr $C$DW$677, DW_AT_TI_symbol_name("Mac") .dwattr $C$DW$677, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$677, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$677, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$677, DW_AT_decl_line(0xe7) .dwattr $C$DW$677, DW_AT_decl_column(0x0d) $C$DW$678 .dwtag DW_TAG_member .dwattr $C$DW$678, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$678, DW_AT_name("Padding") .dwattr $C$DW$678, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$678, DW_AT_data_member_location[DW_OP_plus_uconst 0xe] .dwattr $C$DW$678, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$678, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$678, DW_AT_decl_line(0xe8) .dwattr $C$DW$678, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$74, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$74, DW_AT_decl_line(0xe4) .dwattr $C$DW$T$74, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$74 $C$DW$T$215 .dwtag DW_TAG_typedef .dwattr $C$DW$T$215, DW_AT_name("SlIpLeasedAsync_t") .dwattr $C$DW$T$215, DW_AT_type(*$C$DW$T$74) .dwattr $C$DW$T$215, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$215, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$215, DW_AT_decl_line(0xe9) .dwattr $C$DW$T$215, DW_AT_decl_column(0x02) $C$DW$T$75 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$75, DW_AT_byte_size(0x0c) $C$DW$679 .dwtag DW_TAG_member .dwattr $C$DW$679, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$679, DW_AT_name("IpAddress") .dwattr $C$DW$679, DW_AT_TI_symbol_name("IpAddress") .dwattr $C$DW$679, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$679, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$679, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$679, DW_AT_decl_line(0xed) .dwattr $C$DW$679, DW_AT_decl_column(0x0d) $C$DW$680 .dwtag DW_TAG_member .dwattr $C$DW$680, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$680, DW_AT_name("Mac") .dwattr $C$DW$680, DW_AT_TI_symbol_name("Mac") .dwattr $C$DW$680, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$680, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$680, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$680, DW_AT_decl_line(0xee) .dwattr $C$DW$680, DW_AT_decl_column(0x0d) $C$DW$681 .dwtag DW_TAG_member .dwattr $C$DW$681, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$681, DW_AT_name("Reason") .dwattr $C$DW$681, DW_AT_TI_symbol_name("Reason") .dwattr $C$DW$681, DW_AT_data_member_location[DW_OP_plus_uconst 0xa] .dwattr $C$DW$681, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$681, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$681, DW_AT_decl_line(0xef) .dwattr $C$DW$681, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$75, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$75, DW_AT_decl_line(0xec) .dwattr $C$DW$T$75, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$75 $C$DW$T$216 .dwtag DW_TAG_typedef .dwattr $C$DW$T$216, DW_AT_name("SlIpReleasedAsync_t") .dwattr $C$DW$T$216, DW_AT_type(*$C$DW$T$75) .dwattr $C$DW$T$216, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$216, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$216, DW_AT_decl_line(0xf0) .dwattr $C$DW$T$216, DW_AT_decl_column(0x02) $C$DW$T$76 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$76, DW_AT_byte_size(0x10) $C$DW$682 .dwtag DW_TAG_member .dwattr $C$DW$682, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$682, DW_AT_name("IpAddress") .dwattr $C$DW$682, DW_AT_TI_symbol_name("IpAddress") .dwattr $C$DW$682, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$682, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$682, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$682, DW_AT_decl_line(0xf4) .dwattr $C$DW$682, DW_AT_decl_column(0x0d) $C$DW$683 .dwtag DW_TAG_member .dwattr $C$DW$683, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$683, DW_AT_name("DhcpMac") .dwattr $C$DW$683, DW_AT_TI_symbol_name("DhcpMac") .dwattr $C$DW$683, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$683, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$683, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$683, DW_AT_decl_line(0xf5) .dwattr $C$DW$683, DW_AT_decl_column(0x0d) $C$DW$684 .dwtag DW_TAG_member .dwattr $C$DW$684, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$684, DW_AT_name("ConflictMac") .dwattr $C$DW$684, DW_AT_TI_symbol_name("ConflictMac") .dwattr $C$DW$684, DW_AT_data_member_location[DW_OP_plus_uconst 0xa] .dwattr $C$DW$684, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$684, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$684, DW_AT_decl_line(0xf6) .dwattr $C$DW$684, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$76, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$76, DW_AT_decl_line(0xf3) .dwattr $C$DW$T$76, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$76 $C$DW$T$219 .dwtag DW_TAG_typedef .dwattr $C$DW$T$219, DW_AT_name("SlIpCollisionAsync_t") .dwattr $C$DW$T$219, DW_AT_type(*$C$DW$T$76) .dwattr $C$DW$T$219, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$219, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$219, DW_AT_decl_line(0xf7) .dwattr $C$DW$T$219, DW_AT_decl_column(0x02) $C$DW$T$77 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$77, DW_AT_byte_size(0x04) $C$DW$685 .dwtag DW_TAG_member .dwattr $C$DW$685, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$685, DW_AT_name("Status") .dwattr $C$DW$685, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$685, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$685, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$685, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$685, DW_AT_decl_line(0xfb) .dwattr $C$DW$685, DW_AT_decl_column(0x0b) $C$DW$686 .dwtag DW_TAG_member .dwattr $C$DW$686, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$686, DW_AT_name("Padding") .dwattr $C$DW$686, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$686, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$686, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$686, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$686, DW_AT_decl_line(0xfc) .dwattr $C$DW$686, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$77, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$77, DW_AT_decl_line(0xfa) .dwattr $C$DW$T$77, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$77 $C$DW$T$217 .dwtag DW_TAG_typedef .dwattr $C$DW$T$217, DW_AT_name("SlIpV4Lost_t") .dwattr $C$DW$T$217, DW_AT_type(*$C$DW$T$77) .dwattr $C$DW$T$217, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$217, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$217, DW_AT_decl_line(0xfd) .dwattr $C$DW$T$217, DW_AT_decl_column(0x02) $C$DW$T$78 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$78, DW_AT_byte_size(0x10) $C$DW$687 .dwtag DW_TAG_member .dwattr $C$DW$687, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$687, DW_AT_name("IpLost") .dwattr $C$DW$687, DW_AT_TI_symbol_name("IpLost") .dwattr $C$DW$687, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$687, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$687, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$687, DW_AT_decl_line(0x101) .dwattr $C$DW$687, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$78, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$78, DW_AT_decl_line(0x100) .dwattr $C$DW$T$78, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$78 $C$DW$T$220 .dwtag DW_TAG_typedef .dwattr $C$DW$T$220, DW_AT_name("SlIpV6Lost_t") .dwattr $C$DW$T$220, DW_AT_type(*$C$DW$T$78) .dwattr $C$DW$T$220, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$220, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$220, DW_AT_decl_line(0x102) .dwattr $C$DW$T$220, DW_AT_decl_column(0x02) $C$DW$T$79 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$79, DW_AT_byte_size(0x04) $C$DW$688 .dwtag DW_TAG_member .dwattr $C$DW$688, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$688, DW_AT_name("Status") .dwattr $C$DW$688, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$688, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$688, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$688, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$688, DW_AT_decl_line(0x106) .dwattr $C$DW$688, DW_AT_decl_column(0x0b) $C$DW$689 .dwtag DW_TAG_member .dwattr $C$DW$689, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$689, DW_AT_name("Padding") .dwattr $C$DW$689, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$689, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$689, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$689, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$689, DW_AT_decl_line(0x107) .dwattr $C$DW$689, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$79, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$79, DW_AT_decl_line(0x105) .dwattr $C$DW$T$79, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$79 $C$DW$T$218 .dwtag DW_TAG_typedef .dwattr $C$DW$T$218, DW_AT_name("SlDhcpIpAcquireTimeout_t") .dwattr $C$DW$T$218, DW_AT_type(*$C$DW$T$79) .dwattr $C$DW$T$218, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$218, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$218, DW_AT_decl_line(0x108) .dwattr $C$DW$T$218, DW_AT_decl_column(0x02) $C$DW$T$81 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$81, DW_AT_byte_size(0x24) $C$DW$690 .dwtag DW_TAG_member .dwattr $C$DW$690, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$690, DW_AT_name("Id") .dwattr $C$DW$690, DW_AT_TI_symbol_name("Id") .dwattr $C$DW$690, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$690, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$690, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$690, DW_AT_decl_line(0x119) .dwattr $C$DW$690, DW_AT_decl_column(0x1e) $C$DW$691 .dwtag DW_TAG_member .dwattr $C$DW$691, DW_AT_type(*$C$DW$T$80) .dwattr $C$DW$691, DW_AT_name("Data") .dwattr $C$DW$691, DW_AT_TI_symbol_name("Data") .dwattr $C$DW$691, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$691, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$691, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$691, DW_AT_decl_line(0x11a) .dwattr $C$DW$691, DW_AT_decl_column(0x1e) .dwattr $C$DW$T$81, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$81, DW_AT_decl_line(0x118) .dwattr $C$DW$T$81, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$81 $C$DW$T$475 .dwtag DW_TAG_typedef .dwattr $C$DW$T$475, DW_AT_name("SlNetAppEvent_t") .dwattr $C$DW$T$475, DW_AT_type(*$C$DW$T$81) .dwattr $C$DW$T$475, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$475, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$475, DW_AT_decl_line(0x11b) .dwattr $C$DW$T$475, DW_AT_decl_column(0x02) $C$DW$T$82 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$82, DW_AT_byte_size(0x14) $C$DW$692 .dwtag DW_TAG_member .dwattr $C$DW$692, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$692, DW_AT_name("PacketsSent") .dwattr $C$DW$692, DW_AT_TI_symbol_name("PacketsSent") .dwattr $C$DW$692, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$692, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$692, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$692, DW_AT_decl_line(0x11f) .dwattr $C$DW$692, DW_AT_decl_column(0x0d) $C$DW$693 .dwtag DW_TAG_member .dwattr $C$DW$693, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$693, DW_AT_name("PacketsReceived") .dwattr $C$DW$693, DW_AT_TI_symbol_name("PacketsReceived") .dwattr $C$DW$693, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$693, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$693, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$693, DW_AT_decl_line(0x120) .dwattr $C$DW$693, DW_AT_decl_column(0x0d) $C$DW$694 .dwtag DW_TAG_member .dwattr $C$DW$694, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$694, DW_AT_name("MinRoundTime") .dwattr $C$DW$694, DW_AT_TI_symbol_name("MinRoundTime") .dwattr $C$DW$694, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$694, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$694, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$694, DW_AT_decl_line(0x121) .dwattr $C$DW$694, DW_AT_decl_column(0x0d) $C$DW$695 .dwtag DW_TAG_member .dwattr $C$DW$695, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$695, DW_AT_name("MaxRoundTime") .dwattr $C$DW$695, DW_AT_TI_symbol_name("MaxRoundTime") .dwattr $C$DW$695, DW_AT_data_member_location[DW_OP_plus_uconst 0xa] .dwattr $C$DW$695, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$695, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$695, DW_AT_decl_line(0x122) .dwattr $C$DW$695, DW_AT_decl_column(0x0d) $C$DW$696 .dwtag DW_TAG_member .dwattr $C$DW$696, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$696, DW_AT_name("AvgRoundTime") .dwattr $C$DW$696, DW_AT_TI_symbol_name("AvgRoundTime") .dwattr $C$DW$696, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$696, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$696, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$696, DW_AT_decl_line(0x123) .dwattr $C$DW$696, DW_AT_decl_column(0x0d) $C$DW$697 .dwtag DW_TAG_member .dwattr $C$DW$697, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$697, DW_AT_name("TestTime") .dwattr $C$DW$697, DW_AT_TI_symbol_name("TestTime") .dwattr $C$DW$697, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$697, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$697, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$697, DW_AT_decl_line(0x124) .dwattr $C$DW$697, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$82, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$82, DW_AT_decl_line(0x11e) .dwattr $C$DW$T$82, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$82 $C$DW$T$476 .dwtag DW_TAG_typedef .dwattr $C$DW$T$476, DW_AT_name("SlNetAppPingReport_t") .dwattr $C$DW$T$476, DW_AT_type(*$C$DW$T$82) .dwattr $C$DW$T$476, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$476, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$476, DW_AT_decl_line(0x125) .dwattr $C$DW$T$476, DW_AT_decl_column(0x02) $C$DW$T$477 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$477, DW_AT_type(*$C$DW$T$476) .dwattr $C$DW$T$477, DW_AT_address_class(0x20) $C$DW$T$83 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$83, DW_AT_byte_size(0x20) $C$DW$698 .dwtag DW_TAG_member .dwattr $C$DW$698, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$698, DW_AT_name("PingIntervalTime") .dwattr $C$DW$698, DW_AT_TI_symbol_name("PingIntervalTime") .dwattr $C$DW$698, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$698, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$698, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$698, DW_AT_decl_line(0x129) .dwattr $C$DW$698, DW_AT_decl_column(0x0d) $C$DW$699 .dwtag DW_TAG_member .dwattr $C$DW$699, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$699, DW_AT_name("PingSize") .dwattr $C$DW$699, DW_AT_TI_symbol_name("PingSize") .dwattr $C$DW$699, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$699, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$699, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$699, DW_AT_decl_line(0x12a) .dwattr $C$DW$699, DW_AT_decl_column(0x0d) $C$DW$700 .dwtag DW_TAG_member .dwattr $C$DW$700, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$700, DW_AT_name("PingRequestTimeout") .dwattr $C$DW$700, DW_AT_TI_symbol_name("PingRequestTimeout") .dwattr $C$DW$700, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$700, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$700, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$700, DW_AT_decl_line(0x12b) .dwattr $C$DW$700, DW_AT_decl_column(0x0d) $C$DW$701 .dwtag DW_TAG_member .dwattr $C$DW$701, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$701, DW_AT_name("TotalNumberOfAttempts") .dwattr $C$DW$701, DW_AT_TI_symbol_name("TotalNumberOfAttempts") .dwattr $C$DW$701, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$701, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$701, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$701, DW_AT_decl_line(0x12c) .dwattr $C$DW$701, DW_AT_decl_column(0x0d) $C$DW$702 .dwtag DW_TAG_member .dwattr $C$DW$702, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$702, DW_AT_name("Flags") .dwattr $C$DW$702, DW_AT_TI_symbol_name("Flags") .dwattr $C$DW$702, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$702, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$702, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$702, DW_AT_decl_line(0x12d) .dwattr $C$DW$702, DW_AT_decl_column(0x0d) $C$DW$703 .dwtag DW_TAG_member .dwattr $C$DW$703, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$703, DW_AT_name("Ip") .dwattr $C$DW$703, DW_AT_TI_symbol_name("Ip") .dwattr $C$DW$703, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$703, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$703, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$703, DW_AT_decl_line(0x12e) .dwattr $C$DW$703, DW_AT_decl_column(0x0d) $C$DW$704 .dwtag DW_TAG_member .dwattr $C$DW$704, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$704, DW_AT_name("Ip1OrPadding") .dwattr $C$DW$704, DW_AT_TI_symbol_name("Ip1OrPadding") .dwattr $C$DW$704, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$704, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$704, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$704, DW_AT_decl_line(0x12f) .dwattr $C$DW$704, DW_AT_decl_column(0x0d) $C$DW$705 .dwtag DW_TAG_member .dwattr $C$DW$705, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$705, DW_AT_name("Ip2OrPadding") .dwattr $C$DW$705, DW_AT_TI_symbol_name("Ip2OrPadding") .dwattr $C$DW$705, DW_AT_data_member_location[DW_OP_plus_uconst 0x18] .dwattr $C$DW$705, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$705, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$705, DW_AT_decl_line(0x130) .dwattr $C$DW$705, DW_AT_decl_column(0x0d) $C$DW$706 .dwtag DW_TAG_member .dwattr $C$DW$706, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$706, DW_AT_name("Ip3OrPadding") .dwattr $C$DW$706, DW_AT_TI_symbol_name("Ip3OrPadding") .dwattr $C$DW$706, DW_AT_data_member_location[DW_OP_plus_uconst 0x1c] .dwattr $C$DW$706, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$706, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$706, DW_AT_decl_line(0x131) .dwattr $C$DW$706, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$83, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$83, DW_AT_decl_line(0x128) .dwattr $C$DW$T$83, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$83 $C$DW$T$478 .dwtag DW_TAG_typedef .dwattr $C$DW$T$478, DW_AT_name("SlNetAppPingCommand_t") .dwattr $C$DW$T$478, DW_AT_type(*$C$DW$T$83) .dwattr $C$DW$T$478, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$478, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$478, DW_AT_decl_line(0x132) .dwattr $C$DW$T$478, DW_AT_decl_column(0x02) $C$DW$T$85 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$85, DW_AT_byte_size(0x08) $C$DW$707 .dwtag DW_TAG_member .dwattr $C$DW$707, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$707, DW_AT_name("Len") .dwattr $C$DW$707, DW_AT_TI_symbol_name("Len") .dwattr $C$DW$707, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$707, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$707, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$707, DW_AT_decl_line(0x136) .dwattr $C$DW$707, DW_AT_decl_column(0x0d) $C$DW$708 .dwtag DW_TAG_member .dwattr $C$DW$708, DW_AT_type(*$C$DW$T$84) .dwattr $C$DW$708, DW_AT_name("pData") .dwattr $C$DW$708, DW_AT_TI_symbol_name("pData") .dwattr $C$DW$708, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$708, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$708, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$708, DW_AT_decl_line(0x137) .dwattr $C$DW$708, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$85, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$85, DW_AT_decl_line(0x135) .dwattr $C$DW$T$85, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$85 $C$DW$T$87 .dwtag DW_TAG_typedef .dwattr $C$DW$T$87, DW_AT_name("SlNetAppHttpServerString_t") .dwattr $C$DW$T$87, DW_AT_type(*$C$DW$T$85) .dwattr $C$DW$T$87, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$87, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$87, DW_AT_decl_line(0x138) .dwattr $C$DW$T$87, DW_AT_decl_column(0x03) $C$DW$T$86 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$86, DW_AT_byte_size(0x0c) $C$DW$709 .dwtag DW_TAG_member .dwattr $C$DW$709, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$709, DW_AT_name("ValueLen") .dwattr $C$DW$709, DW_AT_TI_symbol_name("ValueLen") .dwattr $C$DW$709, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$709, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$709, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$709, DW_AT_decl_line(0x13c) .dwattr $C$DW$709, DW_AT_decl_column(0x0d) $C$DW$710 .dwtag DW_TAG_member .dwattr $C$DW$710, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$710, DW_AT_name("NameLen") .dwattr $C$DW$710, DW_AT_TI_symbol_name("NameLen") .dwattr $C$DW$710, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$710, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$710, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$710, DW_AT_decl_line(0x13d) .dwattr $C$DW$710, DW_AT_decl_column(0x0d) $C$DW$711 .dwtag DW_TAG_member .dwattr $C$DW$711, DW_AT_type(*$C$DW$T$84) .dwattr $C$DW$711, DW_AT_name("pTokenValue") .dwattr $C$DW$711, DW_AT_TI_symbol_name("pTokenValue") .dwattr $C$DW$711, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$711, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$711, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$711, DW_AT_decl_line(0x13e) .dwattr $C$DW$711, DW_AT_decl_column(0x0e) $C$DW$712 .dwtag DW_TAG_member .dwattr $C$DW$712, DW_AT_type(*$C$DW$T$84) .dwattr $C$DW$712, DW_AT_name("pTokenName") .dwattr $C$DW$712, DW_AT_TI_symbol_name("pTokenName") .dwattr $C$DW$712, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$712, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$712, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$712, DW_AT_decl_line(0x13f) .dwattr $C$DW$712, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$86, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$86, DW_AT_decl_line(0x13b) .dwattr $C$DW$T$86, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$86 $C$DW$T$479 .dwtag DW_TAG_typedef .dwattr $C$DW$T$479, DW_AT_name("SlNetAppHttpServerData_t") .dwattr $C$DW$T$479, DW_AT_type(*$C$DW$T$86) .dwattr $C$DW$T$479, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$479, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$479, DW_AT_decl_line(0x140) .dwattr $C$DW$T$479, DW_AT_decl_column(0x03) $C$DW$T$88 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$88, DW_AT_byte_size(0x18) $C$DW$713 .dwtag DW_TAG_member .dwattr $C$DW$713, DW_AT_type(*$C$DW$T$87) .dwattr $C$DW$713, DW_AT_name("Action") .dwattr $C$DW$713, DW_AT_TI_symbol_name("Action") .dwattr $C$DW$713, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$713, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$713, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$713, DW_AT_decl_line(0x144) .dwattr $C$DW$713, DW_AT_decl_column(0x20) $C$DW$714 .dwtag DW_TAG_member .dwattr $C$DW$714, DW_AT_type(*$C$DW$T$87) .dwattr $C$DW$714, DW_AT_name("TokenName") .dwattr $C$DW$714, DW_AT_TI_symbol_name("TokenName") .dwattr $C$DW$714, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$714, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$714, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$714, DW_AT_decl_line(0x145) .dwattr $C$DW$714, DW_AT_decl_column(0x20) $C$DW$715 .dwtag DW_TAG_member .dwattr $C$DW$715, DW_AT_type(*$C$DW$T$87) .dwattr $C$DW$715, DW_AT_name("TokenValue") .dwattr $C$DW$715, DW_AT_TI_symbol_name("TokenValue") .dwattr $C$DW$715, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$715, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$715, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$715, DW_AT_decl_line(0x146) .dwattr $C$DW$715, DW_AT_decl_column(0x20) .dwattr $C$DW$T$88, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$88, DW_AT_decl_line(0x143) .dwattr $C$DW$T$88, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$88 $C$DW$T$222 .dwtag DW_TAG_typedef .dwattr $C$DW$T$222, DW_AT_name("SlNetAppHttpServerPostData_t") .dwattr $C$DW$T$222, DW_AT_type(*$C$DW$T$88) .dwattr $C$DW$T$222, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$222, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$222, DW_AT_decl_line(0x147) .dwattr $C$DW$T$222, DW_AT_decl_column(0x02) $C$DW$T$90 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$90, DW_AT_byte_size(0x1c) $C$DW$716 .dwtag DW_TAG_member .dwattr $C$DW$716, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$716, DW_AT_name("Event") .dwattr $C$DW$716, DW_AT_TI_symbol_name("Event") .dwattr $C$DW$716, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$716, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$716, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$716, DW_AT_decl_line(0x156) .dwattr $C$DW$716, DW_AT_decl_column(0x23) $C$DW$717 .dwtag DW_TAG_member .dwattr $C$DW$717, DW_AT_type(*$C$DW$T$89) .dwattr $C$DW$717, DW_AT_name("EventData") .dwattr $C$DW$717, DW_AT_TI_symbol_name("EventData") .dwattr $C$DW$717, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$717, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$717, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$717, DW_AT_decl_line(0x157) .dwattr $C$DW$717, DW_AT_decl_column(0x23) .dwattr $C$DW$T$90, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$90, DW_AT_decl_line(0x155) .dwattr $C$DW$T$90, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$90 $C$DW$T$480 .dwtag DW_TAG_typedef .dwattr $C$DW$T$480, DW_AT_name("SlNetAppHttpServerEvent_t") .dwattr $C$DW$T$480, DW_AT_type(*$C$DW$T$90) .dwattr $C$DW$T$480, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$480, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$480, DW_AT_decl_line(0x158) .dwattr $C$DW$T$480, DW_AT_decl_column(0x02) $C$DW$T$92 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$92, DW_AT_byte_size(0x0c) $C$DW$718 .dwtag DW_TAG_member .dwattr $C$DW$718, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$718, DW_AT_name("Response") .dwattr $C$DW$718, DW_AT_TI_symbol_name("Response") .dwattr $C$DW$718, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$718, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$718, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$718, DW_AT_decl_line(0x15c) .dwattr $C$DW$718, DW_AT_decl_column(0x26) $C$DW$719 .dwtag DW_TAG_member .dwattr $C$DW$719, DW_AT_type(*$C$DW$T$91) .dwattr $C$DW$719, DW_AT_name("ResponseData") .dwattr $C$DW$719, DW_AT_TI_symbol_name("ResponseData") .dwattr $C$DW$719, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$719, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$719, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$719, DW_AT_decl_line(0x15d) .dwattr $C$DW$719, DW_AT_decl_column(0x26) .dwattr $C$DW$T$92, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$92, DW_AT_decl_line(0x15b) .dwattr $C$DW$T$92, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$92 $C$DW$T$481 .dwtag DW_TAG_typedef .dwattr $C$DW$T$481, DW_AT_name("SlNetAppHttpServerResponse_t") .dwattr $C$DW$T$481, DW_AT_type(*$C$DW$T$92) .dwattr $C$DW$T$481, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$481, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$481, DW_AT_decl_line(0x15e) .dwattr $C$DW$T$481, DW_AT_decl_column(0x02) $C$DW$T$93 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$93, DW_AT_byte_size(0x14) $C$DW$720 .dwtag DW_TAG_member .dwattr $C$DW$720, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$720, DW_AT_name("MetadataLen") .dwattr $C$DW$720, DW_AT_TI_symbol_name("MetadataLen") .dwattr $C$DW$720, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$720, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$720, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$720, DW_AT_decl_line(0x1ab) .dwattr $C$DW$720, DW_AT_decl_column(0x0a) $C$DW$721 .dwtag DW_TAG_member .dwattr $C$DW$721, DW_AT_type(*$C$DW$T$84) .dwattr $C$DW$721, DW_AT_name("pMetadata") .dwattr $C$DW$721, DW_AT_TI_symbol_name("pMetadata") .dwattr $C$DW$721, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$721, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$721, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$721, DW_AT_decl_line(0x1ac) .dwattr $C$DW$721, DW_AT_decl_column(0x0a) $C$DW$722 .dwtag DW_TAG_member .dwattr $C$DW$722, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$722, DW_AT_name("PayloadLen") .dwattr $C$DW$722, DW_AT_TI_symbol_name("PayloadLen") .dwattr $C$DW$722, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$722, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$722, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$722, DW_AT_decl_line(0x1ad) .dwattr $C$DW$722, DW_AT_decl_column(0x0a) $C$DW$723 .dwtag DW_TAG_member .dwattr $C$DW$723, DW_AT_type(*$C$DW$T$84) .dwattr $C$DW$723, DW_AT_name("pPayload") .dwattr $C$DW$723, DW_AT_TI_symbol_name("pPayload") .dwattr $C$DW$723, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$723, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$723, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$723, DW_AT_decl_line(0x1ae) .dwattr $C$DW$723, DW_AT_decl_column(0x0a) $C$DW$724 .dwtag DW_TAG_member .dwattr $C$DW$724, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$724, DW_AT_name("Flags") .dwattr $C$DW$724, DW_AT_TI_symbol_name("Flags") .dwattr $C$DW$724, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$724, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$724, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$724, DW_AT_decl_line(0x1af) .dwattr $C$DW$724, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$93, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$93, DW_AT_decl_line(0x1aa) .dwattr $C$DW$T$93, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$93 $C$DW$T$94 .dwtag DW_TAG_typedef .dwattr $C$DW$T$94, DW_AT_name("SlNetAppData_t") .dwattr $C$DW$T$94, DW_AT_type(*$C$DW$T$93) .dwattr $C$DW$T$94, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$94, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$94, DW_AT_decl_line(0x1b0) .dwattr $C$DW$T$94, DW_AT_decl_column(0x03) $C$DW$T$95 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$95, DW_AT_byte_size(0x18) $C$DW$725 .dwtag DW_TAG_member .dwattr $C$DW$725, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$725, DW_AT_name("AppId") .dwattr $C$DW$725, DW_AT_TI_symbol_name("AppId") .dwattr $C$DW$725, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$725, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$725, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$725, DW_AT_decl_line(0x1b4) .dwattr $C$DW$725, DW_AT_decl_column(0x0d) $C$DW$726 .dwtag DW_TAG_member .dwattr $C$DW$726, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$726, DW_AT_name("Type") .dwattr $C$DW$726, DW_AT_TI_symbol_name("Type") .dwattr $C$DW$726, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$726, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$726, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$726, DW_AT_decl_line(0x1b5) .dwattr $C$DW$726, DW_AT_decl_column(0x0d) $C$DW$727 .dwtag DW_TAG_member .dwattr $C$DW$727, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$727, DW_AT_name("Handle") .dwattr $C$DW$727, DW_AT_TI_symbol_name("Handle") .dwattr $C$DW$727, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$727, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$727, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$727, DW_AT_decl_line(0x1b6) .dwattr $C$DW$727, DW_AT_decl_column(0x0d) $C$DW$728 .dwtag DW_TAG_member .dwattr $C$DW$728, DW_AT_type(*$C$DW$T$94) .dwattr $C$DW$728, DW_AT_name("requestData") .dwattr $C$DW$728, DW_AT_TI_symbol_name("requestData") .dwattr $C$DW$728, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$728, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$728, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$728, DW_AT_decl_line(0x1b7) .dwattr $C$DW$728, DW_AT_decl_column(0x15) .dwattr $C$DW$T$95, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$95, DW_AT_decl_line(0x1b3) .dwattr $C$DW$T$95, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$95 $C$DW$T$482 .dwtag DW_TAG_typedef .dwattr $C$DW$T$482, DW_AT_name("SlNetAppRequest_t") .dwattr $C$DW$T$482, DW_AT_type(*$C$DW$T$95) .dwattr $C$DW$T$482, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$482, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$482, DW_AT_decl_line(0x1b8) .dwattr $C$DW$T$482, DW_AT_decl_column(0x03) $C$DW$T$96 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$96, DW_AT_byte_size(0x18) $C$DW$729 .dwtag DW_TAG_member .dwattr $C$DW$729, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$729, DW_AT_name("Status") .dwattr $C$DW$729, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$729, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$729, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$729, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$729, DW_AT_decl_line(0x1bc) .dwattr $C$DW$729, DW_AT_decl_column(0x15) $C$DW$730 .dwtag DW_TAG_member .dwattr $C$DW$730, DW_AT_type(*$C$DW$T$94) .dwattr $C$DW$730, DW_AT_name("ResponseData") .dwattr $C$DW$730, DW_AT_TI_symbol_name("ResponseData") .dwattr $C$DW$730, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$730, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$730, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$730, DW_AT_decl_line(0x1bd) .dwattr $C$DW$730, DW_AT_decl_column(0x15) .dwattr $C$DW$T$96, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$96, DW_AT_decl_line(0x1bb) .dwattr $C$DW$T$96, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$96 $C$DW$T$483 .dwtag DW_TAG_typedef .dwattr $C$DW$T$483, DW_AT_name("SlNetAppResponse_t") .dwattr $C$DW$T$483, DW_AT_type(*$C$DW$T$96) .dwattr $C$DW$T$483, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$483, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$483, DW_AT_decl_line(0x1be) .dwattr $C$DW$T$483, DW_AT_decl_column(0x03) $C$DW$T$97 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$97, DW_AT_byte_size(0x0c) $C$DW$731 .dwtag DW_TAG_member .dwattr $C$DW$731, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$731, DW_AT_name("lease_time") .dwattr $C$DW$731, DW_AT_TI_symbol_name("lease_time") .dwattr $C$DW$731, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$731, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$731, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$731, DW_AT_decl_line(0x1c2) .dwattr $C$DW$731, DW_AT_decl_column(0x0c) $C$DW$732 .dwtag DW_TAG_member .dwattr $C$DW$732, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$732, DW_AT_name("ipv4_addr_start") .dwattr $C$DW$732, DW_AT_TI_symbol_name("ipv4_addr_start") .dwattr $C$DW$732, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$732, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$732, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$732, DW_AT_decl_line(0x1c3) .dwattr $C$DW$732, DW_AT_decl_column(0x0c) $C$DW$733 .dwtag DW_TAG_member .dwattr $C$DW$733, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$733, DW_AT_name("ipv4_addr_last") .dwattr $C$DW$733, DW_AT_TI_symbol_name("ipv4_addr_last") .dwattr $C$DW$733, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$733, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$733, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$733, DW_AT_decl_line(0x1c4) .dwattr $C$DW$733, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$97, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$97, DW_AT_decl_line(0x1c1) .dwattr $C$DW$T$97, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$97 $C$DW$T$484 .dwtag DW_TAG_typedef .dwattr $C$DW$T$484, DW_AT_name("SlNetAppDhcpServerBasicOpt_t") .dwattr $C$DW$T$484, DW_AT_type(*$C$DW$T$97) .dwattr $C$DW$T$484, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$484, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$484, DW_AT_decl_line(0x1c5) .dwattr $C$DW$T$484, DW_AT_decl_column(0x02) $C$DW$T$98 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$98, DW_AT_byte_size(0x08) $C$DW$734 .dwtag DW_TAG_member .dwattr $C$DW$734, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$734, DW_AT_name("service_ipv4") .dwattr $C$DW$734, DW_AT_TI_symbol_name("service_ipv4") .dwattr $C$DW$734, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$734, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$734, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$734, DW_AT_decl_line(0x1d4) .dwattr $C$DW$734, DW_AT_decl_column(0x0c) $C$DW$735 .dwtag DW_TAG_member .dwattr $C$DW$735, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$735, DW_AT_name("service_port") .dwattr $C$DW$735, DW_AT_TI_symbol_name("service_port") .dwattr $C$DW$735, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$735, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$735, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$735, DW_AT_decl_line(0x1d5) .dwattr $C$DW$735, DW_AT_decl_column(0x0c) $C$DW$736 .dwtag DW_TAG_member .dwattr $C$DW$736, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$736, DW_AT_name("Reserved") .dwattr $C$DW$736, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$736, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$736, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$736, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$736, DW_AT_decl_line(0x1d6) .dwattr $C$DW$736, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$98, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$98, DW_AT_decl_line(0x1d3) .dwattr $C$DW$T$98, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$98 $C$DW$T$485 .dwtag DW_TAG_typedef .dwattr $C$DW$T$485, DW_AT_name("SlNetAppGetShortServiceIpv4List_t") .dwattr $C$DW$T$485, DW_AT_type(*$C$DW$T$98) .dwattr $C$DW$T$485, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$485, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$485, DW_AT_decl_line(0x1d7) .dwattr $C$DW$T$485, DW_AT_decl_column(0x02) $C$DW$T$101 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$101, DW_AT_byte_size(0x84) $C$DW$737 .dwtag DW_TAG_member .dwattr $C$DW$737, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$737, DW_AT_name("service_ipv4") .dwattr $C$DW$737, DW_AT_TI_symbol_name("service_ipv4") .dwattr $C$DW$737, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$737, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$737, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$737, DW_AT_decl_line(0x1db) .dwattr $C$DW$737, DW_AT_decl_column(0x0c) $C$DW$738 .dwtag DW_TAG_member .dwattr $C$DW$738, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$738, DW_AT_name("service_port") .dwattr $C$DW$738, DW_AT_TI_symbol_name("service_port") .dwattr $C$DW$738, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$738, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$738, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$738, DW_AT_decl_line(0x1dc) .dwattr $C$DW$738, DW_AT_decl_column(0x0c) $C$DW$739 .dwtag DW_TAG_member .dwattr $C$DW$739, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$739, DW_AT_name("Reserved") .dwattr $C$DW$739, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$739, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$739, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$739, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$739, DW_AT_decl_line(0x1dd) .dwattr $C$DW$739, DW_AT_decl_column(0x0c) $C$DW$740 .dwtag DW_TAG_member .dwattr $C$DW$740, DW_AT_type(*$C$DW$T$99) .dwattr $C$DW$740, DW_AT_name("service_name") .dwattr $C$DW$740, DW_AT_TI_symbol_name("service_name") .dwattr $C$DW$740, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$740, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$740, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$740, DW_AT_decl_line(0x1de) .dwattr $C$DW$740, DW_AT_decl_column(0x0c) $C$DW$741 .dwtag DW_TAG_member .dwattr $C$DW$741, DW_AT_type(*$C$DW$T$100) .dwattr $C$DW$741, DW_AT_name("service_host") .dwattr $C$DW$741, DW_AT_TI_symbol_name("service_host") .dwattr $C$DW$741, DW_AT_data_member_location[DW_OP_plus_uconst 0x44] .dwattr $C$DW$741, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$741, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$741, DW_AT_decl_line(0x1df) .dwattr $C$DW$741, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$101, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$101, DW_AT_decl_line(0x1da) .dwattr $C$DW$T$101, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$101 $C$DW$T$486 .dwtag DW_TAG_typedef .dwattr $C$DW$T$486, DW_AT_name("SlNetAppGetFullServiceIpv4List_t") .dwattr $C$DW$T$486, DW_AT_type(*$C$DW$T$101) .dwattr $C$DW$T$486, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$486, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$486, DW_AT_decl_line(0x1e0) .dwattr $C$DW$T$486, DW_AT_decl_column(0x02) $C$DW$T$103 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$103, DW_AT_byte_size(0x184) $C$DW$742 .dwtag DW_TAG_member .dwattr $C$DW$742, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$742, DW_AT_name("service_ipv4") .dwattr $C$DW$742, DW_AT_TI_symbol_name("service_ipv4") .dwattr $C$DW$742, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$742, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$742, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$742, DW_AT_decl_line(0x1e4) .dwattr $C$DW$742, DW_AT_decl_column(0x0d) $C$DW$743 .dwtag DW_TAG_member .dwattr $C$DW$743, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$743, DW_AT_name("service_port") .dwattr $C$DW$743, DW_AT_TI_symbol_name("service_port") .dwattr $C$DW$743, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$743, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$743, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$743, DW_AT_decl_line(0x1e5) .dwattr $C$DW$743, DW_AT_decl_column(0x0d) $C$DW$744 .dwtag DW_TAG_member .dwattr $C$DW$744, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$744, DW_AT_name("Reserved") .dwattr $C$DW$744, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$744, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$744, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$744, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$744, DW_AT_decl_line(0x1e6) .dwattr $C$DW$744, DW_AT_decl_column(0x0d) $C$DW$745 .dwtag DW_TAG_member .dwattr $C$DW$745, DW_AT_type(*$C$DW$T$99) .dwattr $C$DW$745, DW_AT_name("service_name") .dwattr $C$DW$745, DW_AT_TI_symbol_name("service_name") .dwattr $C$DW$745, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$745, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$745, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$745, DW_AT_decl_line(0x1e7) .dwattr $C$DW$745, DW_AT_decl_column(0x0d) $C$DW$746 .dwtag DW_TAG_member .dwattr $C$DW$746, DW_AT_type(*$C$DW$T$100) .dwattr $C$DW$746, DW_AT_name("service_host") .dwattr $C$DW$746, DW_AT_TI_symbol_name("service_host") .dwattr $C$DW$746, DW_AT_data_member_location[DW_OP_plus_uconst 0x44] .dwattr $C$DW$746, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$746, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$746, DW_AT_decl_line(0x1e8) .dwattr $C$DW$746, DW_AT_decl_column(0x0d) $C$DW$747 .dwtag DW_TAG_member .dwattr $C$DW$747, DW_AT_type(*$C$DW$T$102) .dwattr $C$DW$747, DW_AT_name("service_text") .dwattr $C$DW$747, DW_AT_TI_symbol_name("service_text") .dwattr $C$DW$747, DW_AT_data_member_location[DW_OP_plus_uconst 0x84] .dwattr $C$DW$747, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$747, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$747, DW_AT_decl_line(0x1e9) .dwattr $C$DW$747, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$103, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$103, DW_AT_decl_line(0x1e3) .dwattr $C$DW$T$103, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$103 $C$DW$T$487 .dwtag DW_TAG_typedef .dwattr $C$DW$T$487, DW_AT_name("SlNetAppGetFullServiceWithTextIpv4List_t") .dwattr $C$DW$T$487, DW_AT_type(*$C$DW$T$103) .dwattr $C$DW$T$487, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$487, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$487, DW_AT_decl_line(0x1ea) .dwattr $C$DW$T$487, DW_AT_decl_column(0x02) $C$DW$T$104 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$104, DW_AT_byte_size(0x14) $C$DW$748 .dwtag DW_TAG_member .dwattr $C$DW$748, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$748, DW_AT_name("service_ipv6") .dwattr $C$DW$748, DW_AT_TI_symbol_name("service_ipv6") .dwattr $C$DW$748, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$748, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$748, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$748, DW_AT_decl_line(0x1ef) .dwattr $C$DW$748, DW_AT_decl_column(0x0c) $C$DW$749 .dwtag DW_TAG_member .dwattr $C$DW$749, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$749, DW_AT_name("service_port") .dwattr $C$DW$749, DW_AT_TI_symbol_name("service_port") .dwattr $C$DW$749, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$749, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$749, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$749, DW_AT_decl_line(0x1f0) .dwattr $C$DW$749, DW_AT_decl_column(0x0c) $C$DW$750 .dwtag DW_TAG_member .dwattr $C$DW$750, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$750, DW_AT_name("Reserved") .dwattr $C$DW$750, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$750, DW_AT_data_member_location[DW_OP_plus_uconst 0x12] .dwattr $C$DW$750, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$750, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$750, DW_AT_decl_line(0x1f1) .dwattr $C$DW$750, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$104, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$104, DW_AT_decl_line(0x1ee) .dwattr $C$DW$T$104, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$104 $C$DW$T$488 .dwtag DW_TAG_typedef .dwattr $C$DW$T$488, DW_AT_name("SlNetAppGetShortServiceIpv6List_t") .dwattr $C$DW$T$488, DW_AT_type(*$C$DW$T$104) .dwattr $C$DW$T$488, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$488, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$488, DW_AT_decl_line(0x1f2) .dwattr $C$DW$T$488, DW_AT_decl_column(0x02) $C$DW$T$105 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$105, DW_AT_byte_size(0x90) $C$DW$751 .dwtag DW_TAG_member .dwattr $C$DW$751, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$751, DW_AT_name("service_ipv6") .dwattr $C$DW$751, DW_AT_TI_symbol_name("service_ipv6") .dwattr $C$DW$751, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$751, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$751, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$751, DW_AT_decl_line(0x1f6) .dwattr $C$DW$751, DW_AT_decl_column(0x0c) $C$DW$752 .dwtag DW_TAG_member .dwattr $C$DW$752, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$752, DW_AT_name("service_port") .dwattr $C$DW$752, DW_AT_TI_symbol_name("service_port") .dwattr $C$DW$752, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$752, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$752, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$752, DW_AT_decl_line(0x1f7) .dwattr $C$DW$752, DW_AT_decl_column(0x0c) $C$DW$753 .dwtag DW_TAG_member .dwattr $C$DW$753, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$753, DW_AT_name("Reserved") .dwattr $C$DW$753, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$753, DW_AT_data_member_location[DW_OP_plus_uconst 0x12] .dwattr $C$DW$753, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$753, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$753, DW_AT_decl_line(0x1f8) .dwattr $C$DW$753, DW_AT_decl_column(0x0c) $C$DW$754 .dwtag DW_TAG_member .dwattr $C$DW$754, DW_AT_type(*$C$DW$T$99) .dwattr $C$DW$754, DW_AT_name("service_name") .dwattr $C$DW$754, DW_AT_TI_symbol_name("service_name") .dwattr $C$DW$754, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$754, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$754, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$754, DW_AT_decl_line(0x1f9) .dwattr $C$DW$754, DW_AT_decl_column(0x0c) $C$DW$755 .dwtag DW_TAG_member .dwattr $C$DW$755, DW_AT_type(*$C$DW$T$100) .dwattr $C$DW$755, DW_AT_name("service_host") .dwattr $C$DW$755, DW_AT_TI_symbol_name("service_host") .dwattr $C$DW$755, DW_AT_data_member_location[DW_OP_plus_uconst 0x50] .dwattr $C$DW$755, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$755, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$755, DW_AT_decl_line(0x1fa) .dwattr $C$DW$755, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$105, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$105, DW_AT_decl_line(0x1f5) .dwattr $C$DW$T$105, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$105 $C$DW$T$489 .dwtag DW_TAG_typedef .dwattr $C$DW$T$489, DW_AT_name("SlNetAppGetFullServiceIpv6List_t") .dwattr $C$DW$T$489, DW_AT_type(*$C$DW$T$105) .dwattr $C$DW$T$489, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$489, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$489, DW_AT_decl_line(0x1fb) .dwattr $C$DW$T$489, DW_AT_decl_column(0x02) $C$DW$T$106 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$106, DW_AT_byte_size(0x190) $C$DW$756 .dwtag DW_TAG_member .dwattr $C$DW$756, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$756, DW_AT_name("service_ipv6") .dwattr $C$DW$756, DW_AT_TI_symbol_name("service_ipv6") .dwattr $C$DW$756, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$756, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$756, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$756, DW_AT_decl_line(0x1ff) .dwattr $C$DW$756, DW_AT_decl_column(0x0d) $C$DW$757 .dwtag DW_TAG_member .dwattr $C$DW$757, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$757, DW_AT_name("service_port") .dwattr $C$DW$757, DW_AT_TI_symbol_name("service_port") .dwattr $C$DW$757, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$757, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$757, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$757, DW_AT_decl_line(0x200) .dwattr $C$DW$757, DW_AT_decl_column(0x0d) $C$DW$758 .dwtag DW_TAG_member .dwattr $C$DW$758, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$758, DW_AT_name("Reserved") .dwattr $C$DW$758, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$758, DW_AT_data_member_location[DW_OP_plus_uconst 0x12] .dwattr $C$DW$758, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$758, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$758, DW_AT_decl_line(0x201) .dwattr $C$DW$758, DW_AT_decl_column(0x0d) $C$DW$759 .dwtag DW_TAG_member .dwattr $C$DW$759, DW_AT_type(*$C$DW$T$99) .dwattr $C$DW$759, DW_AT_name("service_name") .dwattr $C$DW$759, DW_AT_TI_symbol_name("service_name") .dwattr $C$DW$759, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$759, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$759, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$759, DW_AT_decl_line(0x202) .dwattr $C$DW$759, DW_AT_decl_column(0x0d) $C$DW$760 .dwtag DW_TAG_member .dwattr $C$DW$760, DW_AT_type(*$C$DW$T$100) .dwattr $C$DW$760, DW_AT_name("service_host") .dwattr $C$DW$760, DW_AT_TI_symbol_name("service_host") .dwattr $C$DW$760, DW_AT_data_member_location[DW_OP_plus_uconst 0x50] .dwattr $C$DW$760, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$760, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$760, DW_AT_decl_line(0x203) .dwattr $C$DW$760, DW_AT_decl_column(0x0d) $C$DW$761 .dwtag DW_TAG_member .dwattr $C$DW$761, DW_AT_type(*$C$DW$T$102) .dwattr $C$DW$761, DW_AT_name("service_text") .dwattr $C$DW$761, DW_AT_TI_symbol_name("service_text") .dwattr $C$DW$761, DW_AT_data_member_location[DW_OP_plus_uconst 0x90] .dwattr $C$DW$761, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$761, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$761, DW_AT_decl_line(0x204) .dwattr $C$DW$761, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$106, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$106, DW_AT_decl_line(0x1fe) .dwattr $C$DW$T$106, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$106 $C$DW$T$490 .dwtag DW_TAG_typedef .dwattr $C$DW$T$490, DW_AT_name("SlNetAppGetFullServiceWithTextIpv6List_t") .dwattr $C$DW$T$490, DW_AT_type(*$C$DW$T$106) .dwattr $C$DW$T$490, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$490, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$490, DW_AT_decl_line(0x205) .dwattr $C$DW$T$490, DW_AT_decl_column(0x02) $C$DW$T$107 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$107, DW_AT_byte_size(0x18) $C$DW$762 .dwtag DW_TAG_member .dwattr $C$DW$762, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$762, DW_AT_name("t") .dwattr $C$DW$762, DW_AT_TI_symbol_name("t") .dwattr $C$DW$762, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$762, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$762, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$762, DW_AT_decl_line(0x217) .dwattr $C$DW$762, DW_AT_decl_column(0x0d) $C$DW$763 .dwtag DW_TAG_member .dwattr $C$DW$763, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$763, DW_AT_name("p") .dwattr $C$DW$763, DW_AT_TI_symbol_name("p") .dwattr $C$DW$763, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$763, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$763, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$763, DW_AT_decl_line(0x218) .dwattr $C$DW$763, DW_AT_decl_column(0x0d) $C$DW$764 .dwtag DW_TAG_member .dwattr $C$DW$764, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$764, DW_AT_name("k") .dwattr $C$DW$764, DW_AT_TI_symbol_name("k") .dwattr $C$DW$764, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$764, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$764, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$764, DW_AT_decl_line(0x219) .dwattr $C$DW$764, DW_AT_decl_column(0x0d) $C$DW$765 .dwtag DW_TAG_member .dwattr $C$DW$765, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$765, DW_AT_name("RetransInterval") .dwattr $C$DW$765, DW_AT_TI_symbol_name("RetransInterval") .dwattr $C$DW$765, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$765, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$765, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$765, DW_AT_decl_line(0x21a) .dwattr $C$DW$765, DW_AT_decl_column(0x0d) $C$DW$766 .dwtag DW_TAG_member .dwattr $C$DW$766, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$766, DW_AT_name("Maxinterval") .dwattr $C$DW$766, DW_AT_TI_symbol_name("Maxinterval") .dwattr $C$DW$766, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$766, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$766, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$766, DW_AT_decl_line(0x21b) .dwattr $C$DW$766, DW_AT_decl_column(0x0d) $C$DW$767 .dwtag DW_TAG_member .dwattr $C$DW$767, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$767, DW_AT_name("max_time") .dwattr $C$DW$767, DW_AT_TI_symbol_name("max_time") .dwattr $C$DW$767, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$767, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$767, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$767, DW_AT_decl_line(0x21c) .dwattr $C$DW$767, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$107, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$107, DW_AT_decl_line(0x208) .dwattr $C$DW$T$107, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$107 $C$DW$T$491 .dwtag DW_TAG_typedef .dwattr $C$DW$T$491, DW_AT_name("SlNetAppServiceAdvertiseTimingParameters_t") .dwattr $C$DW$T$491, DW_AT_type(*$C$DW$T$107) .dwattr $C$DW$T$491, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$491, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$491, DW_AT_decl_line(0x21d) .dwattr $C$DW$T$491, DW_AT_decl_column(0x02) $C$DW$T$108 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$108, DW_AT_byte_size(0x04) $C$DW$768 .dwtag DW_TAG_member .dwattr $C$DW$768, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$768, DW_AT_name("MaxResponseTime") .dwattr $C$DW$768, DW_AT_TI_symbol_name("MaxResponseTime") .dwattr $C$DW$768, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$768, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$768, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$768, DW_AT_decl_line(0x221) .dwattr $C$DW$768, DW_AT_decl_column(0x0c) $C$DW$769 .dwtag DW_TAG_member .dwattr $C$DW$769, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$769, DW_AT_name("NumOfRetries") .dwattr $C$DW$769, DW_AT_TI_symbol_name("NumOfRetries") .dwattr $C$DW$769, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$769, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$769, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$769, DW_AT_decl_line(0x222) .dwattr $C$DW$769, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$108, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$108, DW_AT_decl_line(0x220) .dwattr $C$DW$T$108, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$108 $C$DW$T$492 .dwtag DW_TAG_typedef .dwattr $C$DW$T$492, DW_AT_name("SlNetAppDnsClientTime_t") .dwattr $C$DW$T$492, DW_AT_type(*$C$DW$T$108) .dwattr $C$DW$T$492, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$492, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$492, DW_AT_decl_line(0x223) .dwattr $C$DW$T$492, DW_AT_decl_column(0x02) $C$DW$T$109 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$109, DW_AT_byte_size(0x4c) $C$DW$770 .dwtag DW_TAG_member .dwattr $C$DW$770, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$770, DW_AT_name("Status") .dwattr $C$DW$770, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$770, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$770, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$770, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$770, DW_AT_decl_line(0x1c7) .dwattr $C$DW$770, DW_AT_decl_column(0x0d) $C$DW$771 .dwtag DW_TAG_member .dwattr $C$DW$771, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$771, DW_AT_name("SsidLen") .dwattr $C$DW$771, DW_AT_TI_symbol_name("SsidLen") .dwattr $C$DW$771, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$771, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$771, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$771, DW_AT_decl_line(0x1c8) .dwattr $C$DW$771, DW_AT_decl_column(0x0d) $C$DW$772 .dwtag DW_TAG_member .dwattr $C$DW$772, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$772, DW_AT_name("Ssid") .dwattr $C$DW$772, DW_AT_TI_symbol_name("Ssid") .dwattr $C$DW$772, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$772, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$772, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$772, DW_AT_decl_line(0x1c9) .dwattr $C$DW$772, DW_AT_decl_column(0x0d) $C$DW$773 .dwtag DW_TAG_member .dwattr $C$DW$773, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$773, DW_AT_name("PrivateTokenLen") .dwattr $C$DW$773, DW_AT_TI_symbol_name("PrivateTokenLen") .dwattr $C$DW$773, DW_AT_data_member_location[DW_OP_plus_uconst 0x28] .dwattr $C$DW$773, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$773, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$773, DW_AT_decl_line(0x1ca) .dwattr $C$DW$773, DW_AT_decl_column(0x0d) $C$DW$774 .dwtag DW_TAG_member .dwattr $C$DW$774, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$774, DW_AT_name("PrivateToken") .dwattr $C$DW$774, DW_AT_TI_symbol_name("PrivateToken") .dwattr $C$DW$774, DW_AT_data_member_location[DW_OP_plus_uconst 0x2c] .dwattr $C$DW$774, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$774, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$774, DW_AT_decl_line(0x1cb) .dwattr $C$DW$774, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$109, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$109, DW_AT_decl_line(0x1c6) .dwattr $C$DW$T$109, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$109 $C$DW$T$493 .dwtag DW_TAG_typedef .dwattr $C$DW$T$493, DW_AT_name("SlWlanSmartConfigStartAsyncResponse_t") .dwattr $C$DW$T$493, DW_AT_type(*$C$DW$T$109) .dwattr $C$DW$T$493, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$493, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$493, DW_AT_decl_line(0x1cc) .dwattr $C$DW$T$493, DW_AT_decl_column(0x02) $C$DW$T$110 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$110, DW_AT_byte_size(0x04) $C$DW$775 .dwtag DW_TAG_member .dwattr $C$DW$775, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$775, DW_AT_name("Status") .dwattr $C$DW$775, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$775, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$775, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$775, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$775, DW_AT_decl_line(0x1d0) .dwattr $C$DW$775, DW_AT_decl_column(0x0d) $C$DW$776 .dwtag DW_TAG_member .dwattr $C$DW$776, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$776, DW_AT_name("Padding") .dwattr $C$DW$776, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$776, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$776, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$776, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$776, DW_AT_decl_line(0x1d1) .dwattr $C$DW$776, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$110, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$110, DW_AT_decl_line(0x1cf) .dwattr $C$DW$T$110, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$110 $C$DW$T$494 .dwtag DW_TAG_typedef .dwattr $C$DW$T$494, DW_AT_name("SlWlanSmartConfigStopAsyncResponse_t") .dwattr $C$DW$T$494, DW_AT_type(*$C$DW$T$110) .dwattr $C$DW$T$494, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$494, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$494, DW_AT_decl_line(0x1d2) .dwattr $C$DW$T$494, DW_AT_decl_column(0x02) $C$DW$T$111 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$111, DW_AT_byte_size(0x04) $C$DW$777 .dwtag DW_TAG_member .dwattr $C$DW$777, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$777, DW_AT_name("Status") .dwattr $C$DW$777, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$777, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$777, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$777, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$777, DW_AT_decl_line(0x1d6) .dwattr $C$DW$777, DW_AT_decl_column(0x0d) $C$DW$778 .dwtag DW_TAG_member .dwattr $C$DW$778, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$778, DW_AT_name("Padding") .dwattr $C$DW$778, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$778, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$778, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$778, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$778, DW_AT_decl_line(0x1d7) .dwattr $C$DW$778, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$111, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$111, DW_AT_decl_line(0x1d5) .dwattr $C$DW$T$111, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$111 $C$DW$T$495 .dwtag DW_TAG_typedef .dwattr $C$DW$T$495, DW_AT_name("SlWlanConnFailureAsyncResponse_t") .dwattr $C$DW$T$495, DW_AT_type(*$C$DW$T$111) .dwattr $C$DW$T$495, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$495, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$495, DW_AT_decl_line(0x1d8) .dwattr $C$DW$T$495, DW_AT_decl_column(0x02) $C$DW$T$112 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$112, DW_AT_byte_size(0x04) $C$DW$779 .dwtag DW_TAG_member .dwattr $C$DW$779, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$779, DW_AT_name("Status") .dwattr $C$DW$779, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$779, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$779, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$779, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$779, DW_AT_decl_line(0x1dc) .dwattr $C$DW$779, DW_AT_decl_column(0x0d) $C$DW$780 .dwtag DW_TAG_member .dwattr $C$DW$780, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$780, DW_AT_name("Padding") .dwattr $C$DW$780, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$780, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$780, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$780, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$780, DW_AT_decl_line(0x1dd) .dwattr $C$DW$780, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$112, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$112, DW_AT_decl_line(0x1db) .dwattr $C$DW$T$112, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$112 $C$DW$T$496 .dwtag DW_TAG_typedef .dwattr $C$DW$T$496, DW_AT_name("SlWlanProvisioningStatusAsyncResponse_t") .dwattr $C$DW$T$496, DW_AT_type(*$C$DW$T$112) .dwattr $C$DW$T$496, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$496, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$496, DW_AT_decl_line(0x1de) .dwattr $C$DW$T$496, DW_AT_decl_column(0x02) $C$DW$T$114 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$114, DW_AT_byte_size(0x09) $C$DW$781 .dwtag DW_TAG_member .dwattr $C$DW$781, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$781, DW_AT_name("Type") .dwattr $C$DW$781, DW_AT_TI_symbol_name("Type") .dwattr $C$DW$781, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$781, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$781, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$781, DW_AT_decl_line(0x1ef) .dwattr $C$DW$781, DW_AT_decl_column(0x0d) $C$DW$782 .dwtag DW_TAG_member .dwattr $C$DW$782, DW_AT_type(*$C$DW$T$113) .dwattr $C$DW$782, DW_AT_name("UserActionIdBitmap") .dwattr $C$DW$782, DW_AT_TI_symbol_name("UserActionIdBitmap") .dwattr $C$DW$782, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$782, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$782, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$782, DW_AT_decl_line(0x1f0) .dwattr $C$DW$782, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$114, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$114, DW_AT_decl_line(0x1ee) .dwattr $C$DW$T$114, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$114 $C$DW$T$234 .dwtag DW_TAG_typedef .dwattr $C$DW$T$234, DW_AT_name("SlWlanEventRxFilterInfo_t") .dwattr $C$DW$T$234, DW_AT_type(*$C$DW$T$114) .dwattr $C$DW$T$234, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$234, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$234, DW_AT_decl_line(0x1f1) .dwattr $C$DW$T$234, DW_AT_decl_column(0x02) $C$DW$T$115 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$115, DW_AT_byte_size(0x28) $C$DW$783 .dwtag DW_TAG_member .dwattr $C$DW$783, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$783, DW_AT_name("SsidLen") .dwattr $C$DW$783, DW_AT_TI_symbol_name("SsidLen") .dwattr $C$DW$783, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$783, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$783, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$783, DW_AT_decl_line(0x205) .dwattr $C$DW$783, DW_AT_decl_column(0x0d) $C$DW$784 .dwtag DW_TAG_member .dwattr $C$DW$784, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$784, DW_AT_name("SsidName") .dwattr $C$DW$784, DW_AT_TI_symbol_name("SsidName") .dwattr $C$DW$784, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$784, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$784, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$784, DW_AT_decl_line(0x206) .dwattr $C$DW$784, DW_AT_decl_column(0x0d) $C$DW$785 .dwtag DW_TAG_member .dwattr $C$DW$785, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$785, DW_AT_name("Bssid") .dwattr $C$DW$785, DW_AT_TI_symbol_name("Bssid") .dwattr $C$DW$785, DW_AT_data_member_location[DW_OP_plus_uconst 0x21] .dwattr $C$DW$785, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$785, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$785, DW_AT_decl_line(0x207) .dwattr $C$DW$785, DW_AT_decl_column(0x0d) $C$DW$786 .dwtag DW_TAG_member .dwattr $C$DW$786, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$786, DW_AT_name("ReasonCode") .dwattr $C$DW$786, DW_AT_TI_symbol_name("ReasonCode") .dwattr $C$DW$786, DW_AT_data_member_location[DW_OP_plus_uconst 0x27] .dwattr $C$DW$786, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$786, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$786, DW_AT_decl_line(0x208) .dwattr $C$DW$786, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$115, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$115, DW_AT_decl_line(0x204) .dwattr $C$DW$T$115, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$115 $C$DW$T$225 .dwtag DW_TAG_typedef .dwattr $C$DW$T$225, DW_AT_name("SlWlanEventDisconnect_t") .dwattr $C$DW$T$225, DW_AT_type(*$C$DW$T$115) .dwattr $C$DW$T$225, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$225, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$225, DW_AT_decl_line(0x209) .dwattr $C$DW$T$225, DW_AT_decl_column(0x03) $C$DW$T$116 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$116, DW_AT_byte_size(0x08) $C$DW$787 .dwtag DW_TAG_member .dwattr $C$DW$787, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$787, DW_AT_name("Mac") .dwattr $C$DW$787, DW_AT_TI_symbol_name("Mac") .dwattr $C$DW$787, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$787, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$787, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$787, DW_AT_decl_line(0x20d) .dwattr $C$DW$787, DW_AT_decl_column(0x0b) $C$DW$788 .dwtag DW_TAG_member .dwattr $C$DW$788, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$788, DW_AT_name("Padding") .dwattr $C$DW$788, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$788, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$788, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$788, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$788, DW_AT_decl_line(0x20e) .dwattr $C$DW$788, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$116, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$116, DW_AT_decl_line(0x20c) .dwattr $C$DW$T$116, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$116 $C$DW$T$226 .dwtag DW_TAG_typedef .dwattr $C$DW$T$226, DW_AT_name("SlWlanEventSTAAdded_t") .dwattr $C$DW$T$226, DW_AT_type(*$C$DW$T$116) .dwattr $C$DW$T$226, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$226, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$226, DW_AT_decl_line(0x20f) .dwattr $C$DW$T$226, DW_AT_decl_column(0x02) $C$DW$T$227 .dwtag DW_TAG_typedef .dwattr $C$DW$T$227, DW_AT_name("SlWlanEventSTARemoved_t") .dwattr $C$DW$T$227, DW_AT_type(*$C$DW$T$116) .dwattr $C$DW$T$227, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$227, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$227, DW_AT_decl_line(0x20f) .dwattr $C$DW$T$227, DW_AT_decl_column(0x19) $C$DW$T$117 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$117, DW_AT_byte_size(0x4c) $C$DW$789 .dwtag DW_TAG_member .dwattr $C$DW$789, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$789, DW_AT_name("SsidLen") .dwattr $C$DW$789, DW_AT_TI_symbol_name("SsidLen") .dwattr $C$DW$789, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$789, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$789, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$789, DW_AT_decl_line(0x21f) .dwattr $C$DW$789, DW_AT_decl_column(0x0d) $C$DW$790 .dwtag DW_TAG_member .dwattr $C$DW$790, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$790, DW_AT_name("SsidName") .dwattr $C$DW$790, DW_AT_TI_symbol_name("SsidName") .dwattr $C$DW$790, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$790, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$790, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$790, DW_AT_decl_line(0x220) .dwattr $C$DW$790, DW_AT_decl_column(0x0d) $C$DW$791 .dwtag DW_TAG_member .dwattr $C$DW$791, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$791, DW_AT_name("Bssid") .dwattr $C$DW$791, DW_AT_TI_symbol_name("Bssid") .dwattr $C$DW$791, DW_AT_data_member_location[DW_OP_plus_uconst 0x21] .dwattr $C$DW$791, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$791, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$791, DW_AT_decl_line(0x221) .dwattr $C$DW$791, DW_AT_decl_column(0x0d) $C$DW$792 .dwtag DW_TAG_member .dwattr $C$DW$792, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$792, DW_AT_name("ReasonCode") .dwattr $C$DW$792, DW_AT_TI_symbol_name("ReasonCode") .dwattr $C$DW$792, DW_AT_data_member_location[DW_OP_plus_uconst 0x27] .dwattr $C$DW$792, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$792, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$792, DW_AT_decl_line(0x222) .dwattr $C$DW$792, DW_AT_decl_column(0x0d) $C$DW$793 .dwtag DW_TAG_member .dwattr $C$DW$793, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$793, DW_AT_name("GoDeviceNameLen") .dwattr $C$DW$793, DW_AT_TI_symbol_name("GoDeviceNameLen") .dwattr $C$DW$793, DW_AT_data_member_location[DW_OP_plus_uconst 0x28] .dwattr $C$DW$793, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$793, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$793, DW_AT_decl_line(0x223) .dwattr $C$DW$793, DW_AT_decl_column(0x0d) $C$DW$794 .dwtag DW_TAG_member .dwattr $C$DW$794, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$794, DW_AT_name("GoDeviceName") .dwattr $C$DW$794, DW_AT_TI_symbol_name("GoDeviceName") .dwattr $C$DW$794, DW_AT_data_member_location[DW_OP_plus_uconst 0x29] .dwattr $C$DW$794, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$794, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$794, DW_AT_decl_line(0x224) .dwattr $C$DW$794, DW_AT_decl_column(0x0d) $C$DW$795 .dwtag DW_TAG_member .dwattr $C$DW$795, DW_AT_type(*$C$DW$T$22) .dwattr $C$DW$795, DW_AT_name("Padding") .dwattr $C$DW$795, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$795, DW_AT_data_member_location[DW_OP_plus_uconst 0x49] .dwattr $C$DW$795, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$795, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$795, DW_AT_decl_line(0x225) .dwattr $C$DW$795, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$117, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$117, DW_AT_decl_line(0x21e) .dwattr $C$DW$T$117, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$117 $C$DW$T$228 .dwtag DW_TAG_typedef .dwattr $C$DW$T$228, DW_AT_name("SlWlanEventP2PDisconnect_t") .dwattr $C$DW$T$228, DW_AT_type(*$C$DW$T$117) .dwattr $C$DW$T$228, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$228, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$228, DW_AT_decl_line(0x226) .dwattr $C$DW$T$228, DW_AT_decl_column(0x03) $C$DW$T$118 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$118, DW_AT_byte_size(0x48) $C$DW$796 .dwtag DW_TAG_member .dwattr $C$DW$796, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$796, DW_AT_name("Mac") .dwattr $C$DW$796, DW_AT_TI_symbol_name("Mac") .dwattr $C$DW$796, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$796, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$796, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$796, DW_AT_decl_line(0x22a) .dwattr $C$DW$796, DW_AT_decl_column(0x0d) $C$DW$797 .dwtag DW_TAG_member .dwattr $C$DW$797, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$797, DW_AT_name("ClDeviceNameLen") .dwattr $C$DW$797, DW_AT_TI_symbol_name("ClDeviceNameLen") .dwattr $C$DW$797, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$797, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$797, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$797, DW_AT_decl_line(0x22b) .dwattr $C$DW$797, DW_AT_decl_column(0x0d) $C$DW$798 .dwtag DW_TAG_member .dwattr $C$DW$798, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$798, DW_AT_name("ClDeviceName") .dwattr $C$DW$798, DW_AT_TI_symbol_name("ClDeviceName") .dwattr $C$DW$798, DW_AT_data_member_location[DW_OP_plus_uconst 0x7] .dwattr $C$DW$798, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$798, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$798, DW_AT_decl_line(0x22c) .dwattr $C$DW$798, DW_AT_decl_column(0x0d) $C$DW$799 .dwtag DW_TAG_member .dwattr $C$DW$799, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$799, DW_AT_name("OwnSsidLen") .dwattr $C$DW$799, DW_AT_TI_symbol_name("OwnSsidLen") .dwattr $C$DW$799, DW_AT_data_member_location[DW_OP_plus_uconst 0x27] .dwattr $C$DW$799, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$799, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$799, DW_AT_decl_line(0x22d) .dwattr $C$DW$799, DW_AT_decl_column(0x0d) $C$DW$800 .dwtag DW_TAG_member .dwattr $C$DW$800, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$800, DW_AT_name("OwnSsid") .dwattr $C$DW$800, DW_AT_TI_symbol_name("OwnSsid") .dwattr $C$DW$800, DW_AT_data_member_location[DW_OP_plus_uconst 0x28] .dwattr $C$DW$800, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$800, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$800, DW_AT_decl_line(0x22e) .dwattr $C$DW$800, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$118, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$118, DW_AT_decl_line(0x229) .dwattr $C$DW$T$118, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$118 $C$DW$T$229 .dwtag DW_TAG_typedef .dwattr $C$DW$T$229, DW_AT_name("SlWlanEventP2PClientAdded_t") .dwattr $C$DW$T$229, DW_AT_type(*$C$DW$T$118) .dwattr $C$DW$T$229, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$229, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$229, DW_AT_decl_line(0x22f) .dwattr $C$DW$T$229, DW_AT_decl_column(0x02) $C$DW$T$230 .dwtag DW_TAG_typedef .dwattr $C$DW$T$230, DW_AT_name("SlWlanEventP2PClientRemoved_t") .dwattr $C$DW$T$230, DW_AT_type(*$C$DW$T$118) .dwattr $C$DW$T$230, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$230, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$230, DW_AT_decl_line(0x22f) .dwattr $C$DW$T$230, DW_AT_decl_column(0x1f) $C$DW$T$119 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$119, DW_AT_byte_size(0x28) $C$DW$801 .dwtag DW_TAG_member .dwattr $C$DW$801, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$801, DW_AT_name("GoDeviceNameLen") .dwattr $C$DW$801, DW_AT_TI_symbol_name("GoDeviceNameLen") .dwattr $C$DW$801, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$801, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$801, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$801, DW_AT_decl_line(0x233) .dwattr $C$DW$801, DW_AT_decl_column(0x0d) $C$DW$802 .dwtag DW_TAG_member .dwattr $C$DW$802, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$802, DW_AT_name("GoDeviceName") .dwattr $C$DW$802, DW_AT_TI_symbol_name("GoDeviceName") .dwattr $C$DW$802, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$802, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$802, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$802, DW_AT_decl_line(0x234) .dwattr $C$DW$802, DW_AT_decl_column(0x0d) $C$DW$803 .dwtag DW_TAG_member .dwattr $C$DW$803, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$803, DW_AT_name("Mac") .dwattr $C$DW$803, DW_AT_TI_symbol_name("Mac") .dwattr $C$DW$803, DW_AT_data_member_location[DW_OP_plus_uconst 0x21] .dwattr $C$DW$803, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$803, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$803, DW_AT_decl_line(0x235) .dwattr $C$DW$803, DW_AT_decl_column(0x0d) $C$DW$804 .dwtag DW_TAG_member .dwattr $C$DW$804, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$804, DW_AT_name("WpsMethod") .dwattr $C$DW$804, DW_AT_TI_symbol_name("WpsMethod") .dwattr $C$DW$804, DW_AT_data_member_location[DW_OP_plus_uconst 0x27] .dwattr $C$DW$804, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$804, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$804, DW_AT_decl_line(0x236) .dwattr $C$DW$804, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$119, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$119, DW_AT_decl_line(0x232) .dwattr $C$DW$T$119, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$119 $C$DW$T$231 .dwtag DW_TAG_typedef .dwattr $C$DW$T$231, DW_AT_name("SlWlanEventP2PDevFound_t") .dwattr $C$DW$T$231, DW_AT_type(*$C$DW$T$119) .dwattr $C$DW$T$231, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$231, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$231, DW_AT_decl_line(0x237) .dwattr $C$DW$T$231, DW_AT_decl_column(0x02) $C$DW$T$232 .dwtag DW_TAG_typedef .dwattr $C$DW$T$232, DW_AT_name("SlWlanEventP2PRequest_t") .dwattr $C$DW$T$232, DW_AT_type(*$C$DW$T$119) .dwattr $C$DW$T$232, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$232, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$232, DW_AT_decl_line(0x237) .dwattr $C$DW$T$232, DW_AT_decl_column(0x1c) $C$DW$T$120 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$120, DW_AT_byte_size(0x04) $C$DW$805 .dwtag DW_TAG_member .dwattr $C$DW$805, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$805, DW_AT_name("Status") .dwattr $C$DW$805, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$805, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$805, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$805, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$805, DW_AT_decl_line(0x23c) .dwattr $C$DW$805, DW_AT_decl_column(0x0d) $C$DW$806 .dwtag DW_TAG_member .dwattr $C$DW$806, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$806, DW_AT_name("Padding") .dwattr $C$DW$806, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$806, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$806, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$806, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$806, DW_AT_decl_line(0x23d) .dwattr $C$DW$806, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$120, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$120, DW_AT_decl_line(0x23b) .dwattr $C$DW$T$120, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$120 $C$DW$T$233 .dwtag DW_TAG_typedef .dwattr $C$DW$T$233, DW_AT_name("SlWlanEventP2PConnectFail_t") .dwattr $C$DW$T$233, DW_AT_type(*$C$DW$T$120) .dwattr $C$DW$T$233, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$233, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$233, DW_AT_decl_line(0x23e) .dwattr $C$DW$T$233, DW_AT_decl_column(0x02) $C$DW$T$121 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$121, DW_AT_byte_size(0x28) $C$DW$807 .dwtag DW_TAG_member .dwattr $C$DW$807, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$807, DW_AT_name("ProvisioningStatus") .dwattr $C$DW$807, DW_AT_TI_symbol_name("ProvisioningStatus") .dwattr $C$DW$807, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$807, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$807, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$807, DW_AT_decl_line(0x242) .dwattr $C$DW$807, DW_AT_decl_column(0x0a) $C$DW$808 .dwtag DW_TAG_member .dwattr $C$DW$808, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$808, DW_AT_name("Role") .dwattr $C$DW$808, DW_AT_TI_symbol_name("Role") .dwattr $C$DW$808, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$808, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$808, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$808, DW_AT_decl_line(0x243) .dwattr $C$DW$808, DW_AT_decl_column(0x0a) $C$DW$809 .dwtag DW_TAG_member .dwattr $C$DW$809, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$809, DW_AT_name("WlanStatus") .dwattr $C$DW$809, DW_AT_TI_symbol_name("WlanStatus") .dwattr $C$DW$809, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$809, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$809, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$809, DW_AT_decl_line(0x244) .dwattr $C$DW$809, DW_AT_decl_column(0x0a) $C$DW$810 .dwtag DW_TAG_member .dwattr $C$DW$810, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$810, DW_AT_name("Ssidlen") .dwattr $C$DW$810, DW_AT_TI_symbol_name("Ssidlen") .dwattr $C$DW$810, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$810, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$810, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$810, DW_AT_decl_line(0x245) .dwattr $C$DW$810, DW_AT_decl_column(0x0a) $C$DW$811 .dwtag DW_TAG_member .dwattr $C$DW$811, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$811, DW_AT_name("Ssid") .dwattr $C$DW$811, DW_AT_TI_symbol_name("Ssid") .dwattr $C$DW$811, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$811, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$811, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$811, DW_AT_decl_line(0x246) .dwattr $C$DW$811, DW_AT_decl_column(0x0a) $C$DW$812 .dwtag DW_TAG_member .dwattr $C$DW$812, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$812, DW_AT_name("Reserved") .dwattr $C$DW$812, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$812, DW_AT_data_member_location[DW_OP_plus_uconst 0x24] .dwattr $C$DW$812, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$812, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$812, DW_AT_decl_line(0x247) .dwattr $C$DW$812, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$121, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$121, DW_AT_decl_line(0x241) .dwattr $C$DW$T$121, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$121 $C$DW$T$235 .dwtag DW_TAG_typedef .dwattr $C$DW$T$235, DW_AT_name("SlWlanEventProvisioningStatus_t") .dwattr $C$DW$T$235, DW_AT_type(*$C$DW$T$121) .dwattr $C$DW$T$235, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$235, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$235, DW_AT_decl_line(0x248) .dwattr $C$DW$T$235, DW_AT_decl_column(0x02) $C$DW$T$122 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$122, DW_AT_byte_size(0x4c) $C$DW$813 .dwtag DW_TAG_member .dwattr $C$DW$813, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$813, DW_AT_name("Status") .dwattr $C$DW$813, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$813, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$813, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$813, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$813, DW_AT_decl_line(0x24c) .dwattr $C$DW$813, DW_AT_decl_column(0x0d) $C$DW$814 .dwtag DW_TAG_member .dwattr $C$DW$814, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$814, DW_AT_name("SsidLen") .dwattr $C$DW$814, DW_AT_TI_symbol_name("SsidLen") .dwattr $C$DW$814, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$814, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$814, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$814, DW_AT_decl_line(0x24d) .dwattr $C$DW$814, DW_AT_decl_column(0x0d) $C$DW$815 .dwtag DW_TAG_member .dwattr $C$DW$815, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$815, DW_AT_name("Ssid") .dwattr $C$DW$815, DW_AT_TI_symbol_name("Ssid") .dwattr $C$DW$815, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$815, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$815, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$815, DW_AT_decl_line(0x24e) .dwattr $C$DW$815, DW_AT_decl_column(0x0d) $C$DW$816 .dwtag DW_TAG_member .dwattr $C$DW$816, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$816, DW_AT_name("ReservedLen") .dwattr $C$DW$816, DW_AT_TI_symbol_name("ReservedLen") .dwattr $C$DW$816, DW_AT_data_member_location[DW_OP_plus_uconst 0x28] .dwattr $C$DW$816, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$816, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$816, DW_AT_decl_line(0x24f) .dwattr $C$DW$816, DW_AT_decl_column(0x0d) $C$DW$817 .dwtag DW_TAG_member .dwattr $C$DW$817, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$817, DW_AT_name("Reserved") .dwattr $C$DW$817, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$817, DW_AT_data_member_location[DW_OP_plus_uconst 0x2c] .dwattr $C$DW$817, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$817, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$817, DW_AT_decl_line(0x250) .dwattr $C$DW$817, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$122, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$122, DW_AT_decl_line(0x24b) .dwattr $C$DW$T$122, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$122 $C$DW$T$236 .dwtag DW_TAG_typedef .dwattr $C$DW$T$236, DW_AT_name("SlWlanEventProvisioningProfileAdded_t") .dwattr $C$DW$T$236, DW_AT_type(*$C$DW$T$122) .dwattr $C$DW$T$236, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$236, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$236, DW_AT_decl_line(0x251) .dwattr $C$DW$T$236, DW_AT_decl_column(0x03) $C$DW$T$124 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$124, DW_AT_byte_size(0x50) $C$DW$818 .dwtag DW_TAG_member .dwattr $C$DW$818, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$818, DW_AT_name("Id") .dwattr $C$DW$818, DW_AT_TI_symbol_name("Id") .dwattr $C$DW$818, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$818, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$818, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$818, DW_AT_decl_line(0x268) .dwattr $C$DW$818, DW_AT_decl_column(0x19) $C$DW$819 .dwtag DW_TAG_member .dwattr $C$DW$819, DW_AT_type(*$C$DW$T$123) .dwattr $C$DW$819, DW_AT_name("Data") .dwattr $C$DW$819, DW_AT_TI_symbol_name("Data") .dwattr $C$DW$819, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$819, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$819, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$819, DW_AT_decl_line(0x269) .dwattr $C$DW$819, DW_AT_decl_column(0x19) .dwattr $C$DW$T$124, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$124, DW_AT_decl_line(0x267) .dwattr $C$DW$T$124, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$124 $C$DW$T$497 .dwtag DW_TAG_typedef .dwattr $C$DW$T$497, DW_AT_name("SlWlanEvent_t") .dwattr $C$DW$T$497, DW_AT_type(*$C$DW$T$124) .dwattr $C$DW$T$497, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$497, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$497, DW_AT_decl_line(0x26a) .dwattr $C$DW$T$497, DW_AT_decl_column(0x03) $C$DW$T$127 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$127, DW_AT_byte_size(0x4c) $C$DW$820 .dwtag DW_TAG_member .dwattr $C$DW$820, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$820, DW_AT_name("ReceivedValidPacketsNumber") .dwattr $C$DW$820, DW_AT_TI_symbol_name("ReceivedValidPacketsNumber") .dwattr $C$DW$820, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$820, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$820, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$820, DW_AT_decl_line(0x26e) .dwattr $C$DW$820, DW_AT_decl_column(0x0b) $C$DW$821 .dwtag DW_TAG_member .dwattr $C$DW$821, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$821, DW_AT_name("ReceivedFcsErrorPacketsNumber") .dwattr $C$DW$821, DW_AT_TI_symbol_name("ReceivedFcsErrorPacketsNumber") .dwattr $C$DW$821, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$821, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$821, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$821, DW_AT_decl_line(0x26f) .dwattr $C$DW$821, DW_AT_decl_column(0x0b) $C$DW$822 .dwtag DW_TAG_member .dwattr $C$DW$822, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$822, DW_AT_name("ReceivedAddressMismatchPacketsNumber") .dwattr $C$DW$822, DW_AT_TI_symbol_name("ReceivedAddressMismatchPacketsNumber") .dwattr $C$DW$822, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$822, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$822, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$822, DW_AT_decl_line(0x270) .dwattr $C$DW$822, DW_AT_decl_column(0x0b) $C$DW$823 .dwtag DW_TAG_member .dwattr $C$DW$823, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$823, DW_AT_name("AvarageDataCtrlRssi") .dwattr $C$DW$823, DW_AT_TI_symbol_name("AvarageDataCtrlRssi") .dwattr $C$DW$823, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$823, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$823, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$823, DW_AT_decl_line(0x271) .dwattr $C$DW$823, DW_AT_decl_column(0x0b) $C$DW$824 .dwtag DW_TAG_member .dwattr $C$DW$824, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$824, DW_AT_name("AvarageMgMntRssi") .dwattr $C$DW$824, DW_AT_TI_symbol_name("AvarageMgMntRssi") .dwattr $C$DW$824, DW_AT_data_member_location[DW_OP_plus_uconst 0xe] .dwattr $C$DW$824, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$824, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$824, DW_AT_decl_line(0x272) .dwattr $C$DW$824, DW_AT_decl_column(0x0b) $C$DW$825 .dwtag DW_TAG_member .dwattr $C$DW$825, DW_AT_type(*$C$DW$T$125) .dwattr $C$DW$825, DW_AT_name("RateHistogram") .dwattr $C$DW$825, DW_AT_TI_symbol_name("RateHistogram") .dwattr $C$DW$825, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$825, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$825, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$825, DW_AT_decl_line(0x273) .dwattr $C$DW$825, DW_AT_decl_column(0x0b) $C$DW$826 .dwtag DW_TAG_member .dwattr $C$DW$826, DW_AT_type(*$C$DW$T$126) .dwattr $C$DW$826, DW_AT_name("RssiHistogram") .dwattr $C$DW$826, DW_AT_TI_symbol_name("RssiHistogram") .dwattr $C$DW$826, DW_AT_data_member_location[DW_OP_plus_uconst 0x38] .dwattr $C$DW$826, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$826, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$826, DW_AT_decl_line(0x274) .dwattr $C$DW$826, DW_AT_decl_column(0x0b) $C$DW$827 .dwtag DW_TAG_member .dwattr $C$DW$827, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$827, DW_AT_name("StartTimeStamp") .dwattr $C$DW$827, DW_AT_TI_symbol_name("StartTimeStamp") .dwattr $C$DW$827, DW_AT_data_member_location[DW_OP_plus_uconst 0x44] .dwattr $C$DW$827, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$827, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$827, DW_AT_decl_line(0x275) .dwattr $C$DW$827, DW_AT_decl_column(0x0b) $C$DW$828 .dwtag DW_TAG_member .dwattr $C$DW$828, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$828, DW_AT_name("GetTimeStamp") .dwattr $C$DW$828, DW_AT_TI_symbol_name("GetTimeStamp") .dwattr $C$DW$828, DW_AT_data_member_location[DW_OP_plus_uconst 0x48] .dwattr $C$DW$828, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$828, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$828, DW_AT_decl_line(0x276) .dwattr $C$DW$828, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$127, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$127, DW_AT_decl_line(0x26d) .dwattr $C$DW$T$127, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$127 $C$DW$T$498 .dwtag DW_TAG_typedef .dwattr $C$DW$T$498, DW_AT_name("SlWlanGetRxStatResponse_t") .dwattr $C$DW$T$498, DW_AT_type(*$C$DW$T$127) .dwattr $C$DW$T$498, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$498, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$498, DW_AT_decl_line(0x277) .dwattr $C$DW$T$498, DW_AT_decl_column(0x02) $C$DW$T$129 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$129, DW_AT_byte_size(0x2c) $C$DW$829 .dwtag DW_TAG_member .dwattr $C$DW$829, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$829, DW_AT_name("Ssid") .dwattr $C$DW$829, DW_AT_TI_symbol_name("Ssid") .dwattr $C$DW$829, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$829, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$829, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$829, DW_AT_decl_line(0x27b) .dwattr $C$DW$829, DW_AT_decl_column(0x09) $C$DW$830 .dwtag DW_TAG_member .dwattr $C$DW$830, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$830, DW_AT_name("Bssid") .dwattr $C$DW$830, DW_AT_TI_symbol_name("Bssid") .dwattr $C$DW$830, DW_AT_data_member_location[DW_OP_plus_uconst 0x20] .dwattr $C$DW$830, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$830, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$830, DW_AT_decl_line(0x27c) .dwattr $C$DW$830, DW_AT_decl_column(0x09) $C$DW$831 .dwtag DW_TAG_member .dwattr $C$DW$831, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$831, DW_AT_name("SsidLen") .dwattr $C$DW$831, DW_AT_TI_symbol_name("SsidLen") .dwattr $C$DW$831, DW_AT_data_member_location[DW_OP_plus_uconst 0x26] .dwattr $C$DW$831, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$831, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$831, DW_AT_decl_line(0x27d) .dwattr $C$DW$831, DW_AT_decl_column(0x09) $C$DW$832 .dwtag DW_TAG_member .dwattr $C$DW$832, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$832, DW_AT_name("Rssi") .dwattr $C$DW$832, DW_AT_TI_symbol_name("Rssi") .dwattr $C$DW$832, DW_AT_data_member_location[DW_OP_plus_uconst 0x27] .dwattr $C$DW$832, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$832, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$832, DW_AT_decl_line(0x27e) .dwattr $C$DW$832, DW_AT_decl_column(0x09) $C$DW$833 .dwtag DW_TAG_member .dwattr $C$DW$833, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$833, DW_AT_name("SecurityInfo") .dwattr $C$DW$833, DW_AT_TI_symbol_name("SecurityInfo") .dwattr $C$DW$833, DW_AT_data_member_location[DW_OP_plus_uconst 0x28] .dwattr $C$DW$833, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$833, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$833, DW_AT_decl_line(0x27f) .dwattr $C$DW$833, DW_AT_decl_column(0x0a) $C$DW$834 .dwtag DW_TAG_member .dwattr $C$DW$834, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$834, DW_AT_name("Channel") .dwattr $C$DW$834, DW_AT_TI_symbol_name("Channel") .dwattr $C$DW$834, DW_AT_data_member_location[DW_OP_plus_uconst 0x2a] .dwattr $C$DW$834, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$834, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$834, DW_AT_decl_line(0x280) .dwattr $C$DW$834, DW_AT_decl_column(0x09) $C$DW$835 .dwtag DW_TAG_member .dwattr $C$DW$835, DW_AT_type(*$C$DW$T$128) .dwattr $C$DW$835, DW_AT_name("Reserved") .dwattr $C$DW$835, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$835, DW_AT_data_member_location[DW_OP_plus_uconst 0x2b] .dwattr $C$DW$835, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$835, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$835, DW_AT_decl_line(0x281) .dwattr $C$DW$835, DW_AT_decl_column(0x09) .dwattr $C$DW$T$129, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$129, DW_AT_decl_line(0x27a) .dwattr $C$DW$T$129, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$129 $C$DW$T$499 .dwtag DW_TAG_typedef .dwattr $C$DW$T$499, DW_AT_name("SlWlanNetworkEntry_t") .dwattr $C$DW$T$499, DW_AT_type(*$C$DW$T$129) .dwattr $C$DW$T$499, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$499, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$499, DW_AT_decl_line(0x282) .dwattr $C$DW$T$499, DW_AT_decl_column(0x02) $C$DW$T$131 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$131, DW_AT_byte_size(0x0c) $C$DW$836 .dwtag DW_TAG_member .dwattr $C$DW$836, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$836, DW_AT_name("Type") .dwattr $C$DW$836, DW_AT_TI_symbol_name("Type") .dwattr $C$DW$836, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$836, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$836, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$836, DW_AT_decl_line(0x286) .dwattr $C$DW$836, DW_AT_decl_column(0x0b) $C$DW$837 .dwtag DW_TAG_member .dwattr $C$DW$837, DW_AT_type(*$C$DW$T$130) .dwattr $C$DW$837, DW_AT_name("Key") .dwattr $C$DW$837, DW_AT_TI_symbol_name("Key") .dwattr $C$DW$837, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$837, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$837, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$837, DW_AT_decl_line(0x287) .dwattr $C$DW$837, DW_AT_decl_column(0x0b) $C$DW$838 .dwtag DW_TAG_member .dwattr $C$DW$838, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$838, DW_AT_name("KeyLen") .dwattr $C$DW$838, DW_AT_TI_symbol_name("KeyLen") .dwattr $C$DW$838, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$838, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$838, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$838, DW_AT_decl_line(0x288) .dwattr $C$DW$838, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$131, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$131, DW_AT_decl_line(0x285) .dwattr $C$DW$T$131, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$131 $C$DW$T$500 .dwtag DW_TAG_typedef .dwattr $C$DW$T$500, DW_AT_name("SlWlanSecParams_t") .dwattr $C$DW$T$500, DW_AT_type(*$C$DW$T$131) .dwattr $C$DW$T$500, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$500, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$500, DW_AT_decl_line(0x289) .dwattr $C$DW$T$500, DW_AT_decl_column(0x02) $C$DW$T$132 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$132, DW_AT_byte_size(0x14) $C$DW$839 .dwtag DW_TAG_member .dwattr $C$DW$839, DW_AT_type(*$C$DW$T$130) .dwattr $C$DW$839, DW_AT_name("User") .dwattr $C$DW$839, DW_AT_TI_symbol_name("User") .dwattr $C$DW$839, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$839, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$839, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$839, DW_AT_decl_line(0x28d) .dwattr $C$DW$839, DW_AT_decl_column(0x0b) $C$DW$840 .dwtag DW_TAG_member .dwattr $C$DW$840, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$840, DW_AT_name("UserLen") .dwattr $C$DW$840, DW_AT_TI_symbol_name("UserLen") .dwattr $C$DW$840, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$840, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$840, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$840, DW_AT_decl_line(0x28e) .dwattr $C$DW$840, DW_AT_decl_column(0x0b) $C$DW$841 .dwtag DW_TAG_member .dwattr $C$DW$841, DW_AT_type(*$C$DW$T$130) .dwattr $C$DW$841, DW_AT_name("AnonUser") .dwattr $C$DW$841, DW_AT_TI_symbol_name("AnonUser") .dwattr $C$DW$841, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$841, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$841, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$841, DW_AT_decl_line(0x28f) .dwattr $C$DW$841, DW_AT_decl_column(0x0b) $C$DW$842 .dwtag DW_TAG_member .dwattr $C$DW$842, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$842, DW_AT_name("AnonUserLen") .dwattr $C$DW$842, DW_AT_TI_symbol_name("AnonUserLen") .dwattr $C$DW$842, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$842, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$842, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$842, DW_AT_decl_line(0x290) .dwattr $C$DW$842, DW_AT_decl_column(0x0b) $C$DW$843 .dwtag DW_TAG_member .dwattr $C$DW$843, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$843, DW_AT_name("CertIndex") .dwattr $C$DW$843, DW_AT_TI_symbol_name("CertIndex") .dwattr $C$DW$843, DW_AT_data_member_location[DW_OP_plus_uconst 0xd] .dwattr $C$DW$843, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$843, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$843, DW_AT_decl_line(0x291) .dwattr $C$DW$843, DW_AT_decl_column(0x0b) $C$DW$844 .dwtag DW_TAG_member .dwattr $C$DW$844, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$844, DW_AT_name("EapMethod") .dwattr $C$DW$844, DW_AT_TI_symbol_name("EapMethod") .dwattr $C$DW$844, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$844, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$844, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$844, DW_AT_decl_line(0x292) .dwattr $C$DW$844, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$132, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$132, DW_AT_decl_line(0x28c) .dwattr $C$DW$T$132, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$132 $C$DW$T$501 .dwtag DW_TAG_typedef .dwattr $C$DW$T$501, DW_AT_name("SlWlanSecParamsExt_t") .dwattr $C$DW$T$501, DW_AT_type(*$C$DW$T$132) .dwattr $C$DW$T$501, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$501, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$501, DW_AT_decl_line(0x293) .dwattr $C$DW$T$501, DW_AT_decl_column(0x02) $C$DW$T$134 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$134, DW_AT_byte_size(0x88) $C$DW$845 .dwtag DW_TAG_member .dwattr $C$DW$845, DW_AT_type(*$C$DW$T$133) .dwattr $C$DW$845, DW_AT_name("User") .dwattr $C$DW$845, DW_AT_TI_symbol_name("User") .dwattr $C$DW$845, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$845, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$845, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$845, DW_AT_decl_line(0x297) .dwattr $C$DW$845, DW_AT_decl_column(0x0b) $C$DW$846 .dwtag DW_TAG_member .dwattr $C$DW$846, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$846, DW_AT_name("UserLen") .dwattr $C$DW$846, DW_AT_TI_symbol_name("UserLen") .dwattr $C$DW$846, DW_AT_data_member_location[DW_OP_plus_uconst 0x40] .dwattr $C$DW$846, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$846, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$846, DW_AT_decl_line(0x298) .dwattr $C$DW$846, DW_AT_decl_column(0x0b) $C$DW$847 .dwtag DW_TAG_member .dwattr $C$DW$847, DW_AT_type(*$C$DW$T$133) .dwattr $C$DW$847, DW_AT_name("AnonUser") .dwattr $C$DW$847, DW_AT_TI_symbol_name("AnonUser") .dwattr $C$DW$847, DW_AT_data_member_location[DW_OP_plus_uconst 0x41] .dwattr $C$DW$847, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$847, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$847, DW_AT_decl_line(0x299) .dwattr $C$DW$847, DW_AT_decl_column(0x0b) $C$DW$848 .dwtag DW_TAG_member .dwattr $C$DW$848, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$848, DW_AT_name("AnonUserLen") .dwattr $C$DW$848, DW_AT_TI_symbol_name("AnonUserLen") .dwattr $C$DW$848, DW_AT_data_member_location[DW_OP_plus_uconst 0x81] .dwattr $C$DW$848, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$848, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$848, DW_AT_decl_line(0x29a) .dwattr $C$DW$848, DW_AT_decl_column(0x0b) $C$DW$849 .dwtag DW_TAG_member .dwattr $C$DW$849, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$849, DW_AT_name("CertIndex") .dwattr $C$DW$849, DW_AT_TI_symbol_name("CertIndex") .dwattr $C$DW$849, DW_AT_data_member_location[DW_OP_plus_uconst 0x82] .dwattr $C$DW$849, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$849, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$849, DW_AT_decl_line(0x29b) .dwattr $C$DW$849, DW_AT_decl_column(0x0b) $C$DW$850 .dwtag DW_TAG_member .dwattr $C$DW$850, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$850, DW_AT_name("EapMethod") .dwattr $C$DW$850, DW_AT_TI_symbol_name("EapMethod") .dwattr $C$DW$850, DW_AT_data_member_location[DW_OP_plus_uconst 0x84] .dwattr $C$DW$850, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$850, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$850, DW_AT_decl_line(0x29c) .dwattr $C$DW$850, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$134, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$134, DW_AT_decl_line(0x296) .dwattr $C$DW$T$134, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$134 $C$DW$T$502 .dwtag DW_TAG_typedef .dwattr $C$DW$T$502, DW_AT_name("SlWlanGetSecParamsExt_t") .dwattr $C$DW$T$502, DW_AT_type(*$C$DW$T$134) .dwattr $C$DW$T$502, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$502, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$502, DW_AT_decl_line(0x29d) .dwattr $C$DW$T$502, DW_AT_decl_column(0x02) $C$DW$T$135 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$135, DW_AT_byte_size(0x08) $C$DW$851 .dwtag DW_TAG_member .dwattr $C$DW$851, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$851, DW_AT_name("ChannelsMask") .dwattr $C$DW$851, DW_AT_TI_symbol_name("ChannelsMask") .dwattr $C$DW$851, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$851, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$851, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$851, DW_AT_decl_line(0x2bc) .dwattr $C$DW$851, DW_AT_decl_column(0x0c) $C$DW$852 .dwtag DW_TAG_member .dwattr $C$DW$852, DW_AT_type(*$C$DW$T$12) .dwattr $C$DW$852, DW_AT_name("RssiThreshold") .dwattr $C$DW$852, DW_AT_TI_symbol_name("RssiThreshold") .dwattr $C$DW$852, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$852, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$852, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$852, DW_AT_decl_line(0x2bd) .dwattr $C$DW$852, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$135, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$135, DW_AT_decl_line(0x2bb) .dwattr $C$DW$T$135, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$135 $C$DW$T$503 .dwtag DW_TAG_typedef .dwattr $C$DW$T$503, DW_AT_name("SlWlanScanParamCommand_t") .dwattr $C$DW$T$503, DW_AT_type(*$C$DW$T$135) .dwattr $C$DW$T$503, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$503, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$503, DW_AT_decl_line(0x2be) .dwattr $C$DW$T$503, DW_AT_decl_column(0x02) $C$DW$T$137 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$137, DW_AT_byte_size(0x102) $C$DW$853 .dwtag DW_TAG_member .dwattr $C$DW$853, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$853, DW_AT_name("Id") .dwattr $C$DW$853, DW_AT_TI_symbol_name("Id") .dwattr $C$DW$853, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$853, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$853, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$853, DW_AT_decl_line(0x2c2) .dwattr $C$DW$853, DW_AT_decl_column(0x0b) $C$DW$854 .dwtag DW_TAG_member .dwattr $C$DW$854, DW_AT_type(*$C$DW$T$22) .dwattr $C$DW$854, DW_AT_name("Oui") .dwattr $C$DW$854, DW_AT_TI_symbol_name("Oui") .dwattr $C$DW$854, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$854, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$854, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$854, DW_AT_decl_line(0x2c3) .dwattr $C$DW$854, DW_AT_decl_column(0x0b) $C$DW$855 .dwtag DW_TAG_member .dwattr $C$DW$855, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$855, DW_AT_name("Length") .dwattr $C$DW$855, DW_AT_TI_symbol_name("Length") .dwattr $C$DW$855, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$855, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$855, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$855, DW_AT_decl_line(0x2c4) .dwattr $C$DW$855, DW_AT_decl_column(0x0b) $C$DW$856 .dwtag DW_TAG_member .dwattr $C$DW$856, DW_AT_type(*$C$DW$T$136) .dwattr $C$DW$856, DW_AT_name("Data") .dwattr $C$DW$856, DW_AT_TI_symbol_name("Data") .dwattr $C$DW$856, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$856, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$856, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$856, DW_AT_decl_line(0x2c5) .dwattr $C$DW$856, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$137, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$137, DW_AT_decl_line(0x2c1) .dwattr $C$DW$T$137, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$137 $C$DW$T$138 .dwtag DW_TAG_typedef .dwattr $C$DW$T$138, DW_AT_name("SlWlanInfoElement_t") .dwattr $C$DW$T$138, DW_AT_type(*$C$DW$T$137) .dwattr $C$DW$T$138, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$138, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$138, DW_AT_decl_line(0x2c6) .dwattr $C$DW$T$138, DW_AT_decl_column(0x03) $C$DW$T$139 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$139, DW_AT_byte_size(0x104) $C$DW$857 .dwtag DW_TAG_member .dwattr $C$DW$857, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$857, DW_AT_name("Index") .dwattr $C$DW$857, DW_AT_TI_symbol_name("Index") .dwattr $C$DW$857, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$857, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$857, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$857, DW_AT_decl_line(0x2ca) .dwattr $C$DW$857, DW_AT_decl_column(0x12) $C$DW$858 .dwtag DW_TAG_member .dwattr $C$DW$858, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$858, DW_AT_name("Role") .dwattr $C$DW$858, DW_AT_TI_symbol_name("Role") .dwattr $C$DW$858, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$858, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$858, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$858, DW_AT_decl_line(0x2cb) .dwattr $C$DW$858, DW_AT_decl_column(0x12) $C$DW$859 .dwtag DW_TAG_member .dwattr $C$DW$859, DW_AT_type(*$C$DW$T$138) .dwattr $C$DW$859, DW_AT_name("IE") .dwattr $C$DW$859, DW_AT_TI_symbol_name("IE") .dwattr $C$DW$859, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$859, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$859, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$859, DW_AT_decl_line(0x2cc) .dwattr $C$DW$859, DW_AT_decl_column(0x1b) .dwattr $C$DW$T$139, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$139, DW_AT_decl_line(0x2c9) .dwattr $C$DW$T$139, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$139 $C$DW$T$504 .dwtag DW_TAG_typedef .dwattr $C$DW$T$504, DW_AT_name("SlWlanSetInfoElement_t") .dwattr $C$DW$T$504, DW_AT_type(*$C$DW$T$139) .dwattr $C$DW$T$504, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$504, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$504, DW_AT_decl_line(0x2cd) .dwattr $C$DW$T$504, DW_AT_decl_column(0x03) $C$DW$T$140 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$140, DW_AT_byte_size(0x08) $C$DW$860 .dwtag DW_TAG_member .dwattr $C$DW$860, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$860, DW_AT_name("Reserved") .dwattr $C$DW$860, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$860, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$860, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$860, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$860, DW_AT_decl_line(0x2d1) .dwattr $C$DW$860, DW_AT_decl_column(0x11) $C$DW$861 .dwtag DW_TAG_member .dwattr $C$DW$861, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$861, DW_AT_name("Reserved2") .dwattr $C$DW$861, DW_AT_TI_symbol_name("Reserved2") .dwattr $C$DW$861, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$861, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$861, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$861, DW_AT_decl_line(0x2d2) .dwattr $C$DW$861, DW_AT_decl_column(0x11) $C$DW$862 .dwtag DW_TAG_member .dwattr $C$DW$862, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$862, DW_AT_name("MaxSleepTimeMs") .dwattr $C$DW$862, DW_AT_TI_symbol_name("MaxSleepTimeMs") .dwattr $C$DW$862, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$862, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$862, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$862, DW_AT_decl_line(0x2d3) .dwattr $C$DW$862, DW_AT_decl_column(0x11) $C$DW$863 .dwtag DW_TAG_member .dwattr $C$DW$863, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$863, DW_AT_name("Reserved3") .dwattr $C$DW$863, DW_AT_TI_symbol_name("Reserved3") .dwattr $C$DW$863, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$863, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$863, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$863, DW_AT_decl_line(0x2d4) .dwattr $C$DW$863, DW_AT_decl_column(0x11) .dwattr $C$DW$T$140, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$140, DW_AT_decl_line(0x2d0) .dwattr $C$DW$T$140, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$140 $C$DW$T$505 .dwtag DW_TAG_typedef .dwattr $C$DW$T$505, DW_AT_name("SlWlanPmPolicyParams_t") .dwattr $C$DW$T$505, DW_AT_type(*$C$DW$T$140) .dwattr $C$DW$T$505, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$505, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$505, DW_AT_decl_line(0x2d5) .dwattr $C$DW$T$505, DW_AT_decl_column(0x03) $C$DW$T$142 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$142, DW_AT_byte_size(0x14) $C$DW$864 .dwtag DW_TAG_member .dwattr $C$DW$864, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$864, DW_AT_name("Offset") .dwattr $C$DW$864, DW_AT_TI_symbol_name("Offset") .dwattr $C$DW$864, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$864, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$864, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$864, DW_AT_decl_line(0x2ed) .dwattr $C$DW$864, DW_AT_decl_column(0x0d) $C$DW$865 .dwtag DW_TAG_member .dwattr $C$DW$865, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$865, DW_AT_name("Length") .dwattr $C$DW$865, DW_AT_TI_symbol_name("Length") .dwattr $C$DW$865, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$865, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$865, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$865, DW_AT_decl_line(0x2ee) .dwattr $C$DW$865, DW_AT_decl_column(0x0d) $C$DW$866 .dwtag DW_TAG_member .dwattr $C$DW$866, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$866, DW_AT_name("Reserved") .dwattr $C$DW$866, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$866, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$866, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$866, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$866, DW_AT_decl_line(0x2ef) .dwattr $C$DW$866, DW_AT_decl_column(0x0d) $C$DW$867 .dwtag DW_TAG_member .dwattr $C$DW$867, DW_AT_type(*$C$DW$T$141) .dwattr $C$DW$867, DW_AT_name("Value") .dwattr $C$DW$867, DW_AT_TI_symbol_name("Value") .dwattr $C$DW$867, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$867, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$867, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$867, DW_AT_decl_line(0x2f0) .dwattr $C$DW$867, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$142, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$142, DW_AT_decl_line(0x2ec) .dwattr $C$DW$T$142, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$142 $C$DW$T$238 .dwtag DW_TAG_typedef .dwattr $C$DW$T$238, DW_AT_name("SlWlanRxFilterPatternArg_t") .dwattr $C$DW$T$238, DW_AT_type(*$C$DW$T$142) .dwattr $C$DW$T$238, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$238, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$238, DW_AT_decl_line(0x2f1) .dwattr $C$DW$T$238, DW_AT_decl_column(0x02) $C$DW$T$144 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$144, DW_AT_byte_size(0x34) $C$DW$868 .dwtag DW_TAG_member .dwattr $C$DW$868, DW_AT_type(*$C$DW$T$143) .dwattr $C$DW$868, DW_AT_name("Value") .dwattr $C$DW$868, DW_AT_TI_symbol_name("Value") .dwattr $C$DW$868, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$868, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$868, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$868, DW_AT_decl_line(0x35f) .dwattr $C$DW$868, DW_AT_decl_column(0x31) $C$DW$869 .dwtag DW_TAG_member .dwattr $C$DW$869, DW_AT_type(*$C$DW$T$141) .dwattr $C$DW$869, DW_AT_name("Mask") .dwattr $C$DW$869, DW_AT_TI_symbol_name("Mask") .dwattr $C$DW$869, DW_AT_data_member_location[DW_OP_plus_uconst 0x24] .dwattr $C$DW$869, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$869, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$869, DW_AT_decl_line(0x360) .dwattr $C$DW$869, DW_AT_decl_column(0x31) .dwattr $C$DW$T$144, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$144, DW_AT_decl_line(0x35e) .dwattr $C$DW$T$144, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$144 $C$DW$T$145 .dwtag DW_TAG_typedef .dwattr $C$DW$T$145, DW_AT_name("SlWlanRxFilterRuleHeaderArgs_t") .dwattr $C$DW$T$145, DW_AT_type(*$C$DW$T$144) .dwattr $C$DW$T$145, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$145, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$145, DW_AT_decl_line(0x362) .dwattr $C$DW$T$145, DW_AT_decl_column(0x02) $C$DW$T$148 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$148, DW_AT_byte_size(0x38) $C$DW$870 .dwtag DW_TAG_member .dwattr $C$DW$870, DW_AT_type(*$C$DW$T$145) .dwattr $C$DW$870, DW_AT_name("Args") .dwattr $C$DW$870, DW_AT_TI_symbol_name("Args") .dwattr $C$DW$870, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$870, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$870, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$870, DW_AT_decl_line(0x368) .dwattr $C$DW$870, DW_AT_decl_column(0x31) $C$DW$871 .dwtag DW_TAG_member .dwattr $C$DW$871, DW_AT_type(*$C$DW$T$146) .dwattr $C$DW$871, DW_AT_name("Field") .dwattr $C$DW$871, DW_AT_TI_symbol_name("Field") .dwattr $C$DW$871, DW_AT_data_member_location[DW_OP_plus_uconst 0x34] .dwattr $C$DW$871, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$871, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$871, DW_AT_decl_line(0x369) .dwattr $C$DW$871, DW_AT_decl_column(0x31) $C$DW$872 .dwtag DW_TAG_member .dwattr $C$DW$872, DW_AT_type(*$C$DW$T$147) .dwattr $C$DW$872, DW_AT_name("CompareFunc") .dwattr $C$DW$872, DW_AT_TI_symbol_name("CompareFunc") .dwattr $C$DW$872, DW_AT_data_member_location[DW_OP_plus_uconst 0x35] .dwattr $C$DW$872, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$872, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$872, DW_AT_decl_line(0x36a) .dwattr $C$DW$872, DW_AT_decl_column(0x31) $C$DW$873 .dwtag DW_TAG_member .dwattr $C$DW$873, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$873, DW_AT_name("Padding") .dwattr $C$DW$873, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$873, DW_AT_data_member_location[DW_OP_plus_uconst 0x36] .dwattr $C$DW$873, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$873, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$873, DW_AT_decl_line(0x36b) .dwattr $C$DW$873, DW_AT_decl_column(0x31) .dwattr $C$DW$T$148, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$148, DW_AT_decl_line(0x367) .dwattr $C$DW$T$148, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$148 $C$DW$T$248 .dwtag DW_TAG_typedef .dwattr $C$DW$T$248, DW_AT_name("SlWlanRxFilterRuleHeader_t") .dwattr $C$DW$T$248, DW_AT_type(*$C$DW$T$148) .dwattr $C$DW$T$248, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$248, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$248, DW_AT_decl_line(0x36c) .dwattr $C$DW$T$248, DW_AT_decl_column(0x02) $C$DW$T$152 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$152, DW_AT_byte_size(0x04) $C$DW$874 .dwtag DW_TAG_member .dwattr $C$DW$874, DW_AT_type(*$C$DW$T$149) .dwattr $C$DW$874, DW_AT_name("Operator") .dwattr $C$DW$874, DW_AT_TI_symbol_name("Operator") .dwattr $C$DW$874, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$874, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$874, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$874, DW_AT_decl_line(0x37a) .dwattr $C$DW$874, DW_AT_decl_column(0x31) $C$DW$875 .dwtag DW_TAG_member .dwattr $C$DW$875, DW_AT_type(*$C$DW$T$151) .dwattr $C$DW$875, DW_AT_name("CombinationFilterId") .dwattr $C$DW$875, DW_AT_TI_symbol_name("CombinationFilterId") .dwattr $C$DW$875, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$875, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$875, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$875, DW_AT_decl_line(0x37b) .dwattr $C$DW$875, DW_AT_decl_column(0x31) $C$DW$876 .dwtag DW_TAG_member .dwattr $C$DW$876, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$876, DW_AT_name("Padding") .dwattr $C$DW$876, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$876, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$876, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$876, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$876, DW_AT_decl_line(0x37c) .dwattr $C$DW$876, DW_AT_decl_column(0x31) .dwattr $C$DW$T$152, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$152, DW_AT_decl_line(0x379) .dwattr $C$DW$T$152, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$152 $C$DW$T$249 .dwtag DW_TAG_typedef .dwattr $C$DW$T$249, DW_AT_name("SlWlanRxFilterRuleCombination_t") .dwattr $C$DW$T$249, DW_AT_type(*$C$DW$T$152) .dwattr $C$DW$T$249, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$249, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$249, DW_AT_decl_line(0x37d) .dwattr $C$DW$T$249, DW_AT_decl_column(0x02) $C$DW$T$157 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$157, DW_AT_byte_size(0x0c) $C$DW$877 .dwtag DW_TAG_member .dwattr $C$DW$877, DW_AT_type(*$C$DW$T$150) .dwattr $C$DW$877, DW_AT_name("ParentFilterID") .dwattr $C$DW$877, DW_AT_TI_symbol_name("ParentFilterID") .dwattr $C$DW$877, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$877, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$877, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$877, DW_AT_decl_line(0x3af) .dwattr $C$DW$877, DW_AT_decl_column(0x2d) $C$DW$878 .dwtag DW_TAG_member .dwattr $C$DW$878, DW_AT_type(*$C$DW$T$153) .dwattr $C$DW$878, DW_AT_name("Counter") .dwattr $C$DW$878, DW_AT_TI_symbol_name("Counter") .dwattr $C$DW$878, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$878, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$878, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$878, DW_AT_decl_line(0x3b0) .dwattr $C$DW$878, DW_AT_decl_column(0x2d) $C$DW$879 .dwtag DW_TAG_member .dwattr $C$DW$879, DW_AT_type(*$C$DW$T$154) .dwattr $C$DW$879, DW_AT_name("ConnectionState") .dwattr $C$DW$879, DW_AT_TI_symbol_name("ConnectionState") .dwattr $C$DW$879, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$879, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$879, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$879, DW_AT_decl_line(0x3b1) .dwattr $C$DW$879, DW_AT_decl_column(0x2d) $C$DW$880 .dwtag DW_TAG_member .dwattr $C$DW$880, DW_AT_type(*$C$DW$T$155) .dwattr $C$DW$880, DW_AT_name("Role") .dwattr $C$DW$880, DW_AT_TI_symbol_name("Role") .dwattr $C$DW$880, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$880, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$880, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$880, DW_AT_decl_line(0x3b2) .dwattr $C$DW$880, DW_AT_decl_column(0x2d) $C$DW$881 .dwtag DW_TAG_member .dwattr $C$DW$881, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$881, DW_AT_name("CounterVal") .dwattr $C$DW$881, DW_AT_TI_symbol_name("CounterVal") .dwattr $C$DW$881, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$881, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$881, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$881, DW_AT_decl_line(0x3b3) .dwattr $C$DW$881, DW_AT_decl_column(0x2d) $C$DW$882 .dwtag DW_TAG_member .dwattr $C$DW$882, DW_AT_type(*$C$DW$T$156) .dwattr $C$DW$882, DW_AT_name("CompareFunction") .dwattr $C$DW$882, DW_AT_TI_symbol_name("CompareFunction") .dwattr $C$DW$882, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$882, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$882, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$882, DW_AT_decl_line(0x3b4) .dwattr $C$DW$882, DW_AT_decl_column(0x2d) $C$DW$883 .dwtag DW_TAG_member .dwattr $C$DW$883, DW_AT_type(*$C$DW$T$22) .dwattr $C$DW$883, DW_AT_name("Padding") .dwattr $C$DW$883, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$883, DW_AT_data_member_location[DW_OP_plus_uconst 0x9] .dwattr $C$DW$883, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$883, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$883, DW_AT_decl_line(0x3b5) .dwattr $C$DW$883, DW_AT_decl_column(0x2d) .dwattr $C$DW$T$157, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$157, DW_AT_decl_line(0x3ae) .dwattr $C$DW$T$157, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$157 $C$DW$T$506 .dwtag DW_TAG_typedef .dwattr $C$DW$T$506, DW_AT_name("SlWlanRxFilterTrigger_t") .dwattr $C$DW$T$506, DW_AT_type(*$C$DW$T$157) .dwattr $C$DW$T$506, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$506, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$506, DW_AT_decl_line(0x3b6) .dwattr $C$DW$T$506, DW_AT_decl_column(0x03) $C$DW$T$159 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$159, DW_AT_byte_size(0x08) $C$DW$884 .dwtag DW_TAG_member .dwattr $C$DW$884, DW_AT_type(*$C$DW$T$158) .dwattr $C$DW$884, DW_AT_name("Type") .dwattr $C$DW$884, DW_AT_TI_symbol_name("Type") .dwattr $C$DW$884, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$884, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$884, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$884, DW_AT_decl_line(0x3c8) .dwattr $C$DW$884, DW_AT_decl_column(0x20) $C$DW$885 .dwtag DW_TAG_member .dwattr $C$DW$885, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$885, DW_AT_name("Counter") .dwattr $C$DW$885, DW_AT_TI_symbol_name("Counter") .dwattr $C$DW$885, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$885, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$885, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$885, DW_AT_decl_line(0x3c9) .dwattr $C$DW$885, DW_AT_decl_column(0x0c) $C$DW$886 .dwtag DW_TAG_member .dwattr $C$DW$886, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$886, DW_AT_name("Reserved") .dwattr $C$DW$886, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$886, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$886, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$886, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$886, DW_AT_decl_line(0x3ca) .dwattr $C$DW$886, DW_AT_decl_column(0x0c) $C$DW$887 .dwtag DW_TAG_member .dwattr $C$DW$887, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$887, DW_AT_name("UserId") .dwattr $C$DW$887, DW_AT_TI_symbol_name("UserId") .dwattr $C$DW$887, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$887, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$887, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$887, DW_AT_decl_line(0x3cb) .dwattr $C$DW$887, DW_AT_decl_column(0x0c) $C$DW$888 .dwtag DW_TAG_member .dwattr $C$DW$888, DW_AT_type(*$C$DW$T$22) .dwattr $C$DW$888, DW_AT_name("Padding") .dwattr $C$DW$888, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$888, DW_AT_data_member_location[DW_OP_plus_uconst 0x5] .dwattr $C$DW$888, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$888, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$888, DW_AT_decl_line(0x3cc) .dwattr $C$DW$888, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$159, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$159, DW_AT_decl_line(0x3c7) .dwattr $C$DW$T$159, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$159 $C$DW$T$507 .dwtag DW_TAG_typedef .dwattr $C$DW$T$507, DW_AT_name("SlWlanRxFilterAction_t") .dwattr $C$DW$T$507, DW_AT_type(*$C$DW$T$159) .dwattr $C$DW$T$507, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$507, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$507, DW_AT_decl_line(0x3ce) .dwattr $C$DW$T$507, DW_AT_decl_column(0x03) $C$DW$T$161 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$161, DW_AT_byte_size(0x14) $C$DW$889 .dwtag DW_TAG_member .dwattr $C$DW$889, DW_AT_type(*$C$DW$T$160) .dwattr $C$DW$889, DW_AT_name("FilterBitmap") .dwattr $C$DW$889, DW_AT_TI_symbol_name("FilterBitmap") .dwattr $C$DW$889, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$889, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$889, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$889, DW_AT_decl_line(0x3d3) .dwattr $C$DW$889, DW_AT_decl_column(0x1c) $C$DW$890 .dwtag DW_TAG_member .dwattr $C$DW$890, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$890, DW_AT_name("Padding") .dwattr $C$DW$890, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$890, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$890, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$890, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$890, DW_AT_decl_line(0x3d4) .dwattr $C$DW$890, DW_AT_decl_column(0x09) .dwattr $C$DW$T$161, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$161, DW_AT_decl_line(0x3d2) .dwattr $C$DW$T$161, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$161 $C$DW$T$508 .dwtag DW_TAG_typedef .dwattr $C$DW$T$508, DW_AT_name("SlWlanRxFilterOperationCommandBuff_t") .dwattr $C$DW$T$508, DW_AT_type(*$C$DW$T$161) .dwattr $C$DW$T$508, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$508, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$508, DW_AT_decl_line(0x3d6) .dwattr $C$DW$T$508, DW_AT_decl_column(0x03) $C$DW$T$162 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$162, DW_AT_byte_size(0x38) $C$DW$891 .dwtag DW_TAG_member .dwattr $C$DW$891, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$891, DW_AT_name("FilterId") .dwattr $C$DW$891, DW_AT_TI_symbol_name("FilterId") .dwattr $C$DW$891, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$891, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$891, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$891, DW_AT_decl_line(0x3db) .dwattr $C$DW$891, DW_AT_decl_column(0x0a) $C$DW$892 .dwtag DW_TAG_member .dwattr $C$DW$892, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$892, DW_AT_name("BinaryOrAscii") .dwattr $C$DW$892, DW_AT_TI_symbol_name("BinaryOrAscii") .dwattr $C$DW$892, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$892, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$892, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$892, DW_AT_decl_line(0x3dc) .dwattr $C$DW$892, DW_AT_decl_column(0x0a) $C$DW$893 .dwtag DW_TAG_member .dwattr $C$DW$893, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$893, DW_AT_name("Padding") .dwattr $C$DW$893, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$893, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$893, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$893, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$893, DW_AT_decl_line(0x3dd) .dwattr $C$DW$893, DW_AT_decl_column(0x09) $C$DW$894 .dwtag DW_TAG_member .dwattr $C$DW$894, DW_AT_type(*$C$DW$T$145) .dwattr $C$DW$894, DW_AT_name("Args") .dwattr $C$DW$894, DW_AT_TI_symbol_name("Args") .dwattr $C$DW$894, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$894, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$894, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$894, DW_AT_decl_line(0x3de) .dwattr $C$DW$894, DW_AT_decl_column(0x24) .dwattr $C$DW$T$162, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$162, DW_AT_decl_line(0x3da) .dwattr $C$DW$T$162, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$162 $C$DW$T$509 .dwtag DW_TAG_typedef .dwattr $C$DW$T$509, DW_AT_name("SlWlanRxFilterUpdateArgsCommandBuff_t") .dwattr $C$DW$T$509, DW_AT_type(*$C$DW$T$162) .dwattr $C$DW$T$509, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$509, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$509, DW_AT_decl_line(0x3e1) .dwattr $C$DW$T$509, DW_AT_decl_column(0x03) $C$DW$T$163 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$163, DW_AT_byte_size(0x10) $C$DW$895 .dwtag DW_TAG_member .dwattr $C$DW$895, DW_AT_type(*$C$DW$T$160) .dwattr $C$DW$895, DW_AT_name("FilterIdMask") .dwattr $C$DW$895, DW_AT_TI_symbol_name("FilterIdMask") .dwattr $C$DW$895, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$895, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$895, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$895, DW_AT_decl_line(0x3e6) .dwattr $C$DW$895, DW_AT_decl_column(0x1c) .dwattr $C$DW$T$163, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$163, DW_AT_decl_line(0x3e5) .dwattr $C$DW$T$163, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$163 $C$DW$T$510 .dwtag DW_TAG_typedef .dwattr $C$DW$T$510, DW_AT_name("SlWlanRxFilterRetrieveStateBuff_t") .dwattr $C$DW$T$510, DW_AT_type(*$C$DW$T$163) .dwattr $C$DW$T$510, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$510, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$510, DW_AT_decl_line(0x3e8) .dwattr $C$DW$T$510, DW_AT_decl_column(0x02) $C$DW$T$165 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$165, DW_AT_byte_size(0x04) $C$DW$896 .dwtag DW_TAG_member .dwattr $C$DW$896, DW_AT_type(*$C$DW$T$164) .dwattr $C$DW$896, DW_AT_name("FilterBitmap") .dwattr $C$DW$896, DW_AT_TI_symbol_name("FilterBitmap") .dwattr $C$DW$896, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$896, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$896, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$896, DW_AT_decl_line(0x3ed) .dwattr $C$DW$896, DW_AT_decl_column(0x25) .dwattr $C$DW$T$165, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$165, DW_AT_decl_line(0x3ec) .dwattr $C$DW$T$165, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$165 $C$DW$T$511 .dwtag DW_TAG_typedef .dwattr $C$DW$T$511, DW_AT_name("SlWlanRxFilterSysFiltersSetStateBuff_t") .dwattr $C$DW$T$511, DW_AT_type(*$C$DW$T$165) .dwattr $C$DW$T$511, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$511, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$511, DW_AT_decl_line(0x3ef) .dwattr $C$DW$T$511, DW_AT_decl_column(0x03) $C$DW$T$166 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$166, DW_AT_byte_size(0x04) $C$DW$897 .dwtag DW_TAG_member .dwattr $C$DW$897, DW_AT_type(*$C$DW$T$164) .dwattr $C$DW$897, DW_AT_name("FilterBitmap") .dwattr $C$DW$897, DW_AT_TI_symbol_name("FilterBitmap") .dwattr $C$DW$897, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$897, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$897, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$897, DW_AT_decl_line(0x3f4) .dwattr $C$DW$897, DW_AT_decl_column(0x25) .dwattr $C$DW$T$166, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$166, DW_AT_decl_line(0x3f3) .dwattr $C$DW$T$166, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$166 $C$DW$T$512 .dwtag DW_TAG_typedef .dwattr $C$DW$T$512, DW_AT_name("SlWlanRxFilterSysFiltersRetrieveStateBuff_t") .dwattr $C$DW$T$512, DW_AT_type(*$C$DW$T$166) .dwattr $C$DW$T$512, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$512, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$512, DW_AT_decl_line(0x3f6) .dwattr $C$DW$T$512, DW_AT_decl_column(0x03) $C$DW$T$167 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$167, DW_AT_byte_size(0x04) $C$DW$898 .dwtag DW_TAG_member .dwattr $C$DW$898, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$898, DW_AT_name("Status") .dwattr $C$DW$898, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$898, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$898, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$898, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$898, DW_AT_decl_line(0x59) .dwattr $C$DW$898, DW_AT_decl_column(0x0d) $C$DW$899 .dwtag DW_TAG_member .dwattr $C$DW$899, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$899, DW_AT_name("Caller") .dwattr $C$DW$899, DW_AT_TI_symbol_name("Caller") .dwattr $C$DW$899, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$899, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$899, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$899, DW_AT_decl_line(0x5a) .dwattr $C$DW$899, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$167, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$167, DW_AT_decl_line(0x58) .dwattr $C$DW$T$167, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$167 $C$DW$T$251 .dwtag DW_TAG_typedef .dwattr $C$DW$T$251, DW_AT_name("SlDeviceEventResetRequest_t") .dwattr $C$DW$T$251, DW_AT_type(*$C$DW$T$167) .dwattr $C$DW$T$251, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$251, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$251, DW_AT_decl_line(0x5b) .dwattr $C$DW$T$251, DW_AT_decl_column(0x02) $C$DW$T$170 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$170, DW_AT_byte_size(0x04) $C$DW$900 .dwtag DW_TAG_member .dwattr $C$DW$900, DW_AT_type(*$C$DW$T$169) .dwattr $C$DW$900, DW_AT_name("Source") .dwattr $C$DW$900, DW_AT_TI_symbol_name("Source") .dwattr $C$DW$900, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$900, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$900, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$900, DW_AT_decl_line(0x6a) .dwattr $C$DW$900, DW_AT_decl_column(0x19) $C$DW$901 .dwtag DW_TAG_member .dwattr $C$DW$901, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$901, DW_AT_name("Code") .dwattr $C$DW$901, DW_AT_TI_symbol_name("Code") .dwattr $C$DW$901, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$901, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$901, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$901, DW_AT_decl_line(0x6b) .dwattr $C$DW$901, DW_AT_decl_column(0x19) .dwattr $C$DW$T$170, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$170, DW_AT_decl_line(0x69) .dwattr $C$DW$T$170, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$170 $C$DW$T$252 .dwtag DW_TAG_typedef .dwattr $C$DW$T$252, DW_AT_name("SlDeviceEventError_t") .dwattr $C$DW$T$252, DW_AT_type(*$C$DW$T$170) .dwattr $C$DW$T$252, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$252, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$252, DW_AT_decl_line(0x6c) .dwattr $C$DW$T$252, DW_AT_decl_column(0x02) $C$DW$T$172 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$172, DW_AT_byte_size(0x08) $C$DW$902 .dwtag DW_TAG_member .dwattr $C$DW$902, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$902, DW_AT_name("Id") .dwattr $C$DW$902, DW_AT_TI_symbol_name("Id") .dwattr $C$DW$902, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$902, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$902, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$902, DW_AT_decl_line(0x7f) .dwattr $C$DW$902, DW_AT_decl_column(0x19) $C$DW$903 .dwtag DW_TAG_member .dwattr $C$DW$903, DW_AT_type(*$C$DW$T$171) .dwattr $C$DW$903, DW_AT_name("Data") .dwattr $C$DW$903, DW_AT_TI_symbol_name("Data") .dwattr $C$DW$903, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$903, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$903, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$903, DW_AT_decl_line(0x80) .dwattr $C$DW$903, DW_AT_decl_column(0x1c) .dwattr $C$DW$T$172, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$172, DW_AT_decl_line(0x7e) .dwattr $C$DW$T$172, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$172 $C$DW$T$513 .dwtag DW_TAG_typedef .dwattr $C$DW$T$513, DW_AT_name("SlDeviceEvent_t") .dwattr $C$DW$T$513, DW_AT_type(*$C$DW$T$172) .dwattr $C$DW$T$513, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$513, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$513, DW_AT_decl_line(0x81) .dwattr $C$DW$T$513, DW_AT_decl_column(0x02) $C$DW$T$173 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$173, DW_AT_byte_size(0x08) $C$DW$904 .dwtag DW_TAG_member .dwattr $C$DW$904, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$904, DW_AT_name("Code") .dwattr $C$DW$904, DW_AT_TI_symbol_name("Code") .dwattr $C$DW$904, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$904, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$904, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$904, DW_AT_decl_line(0x8d) .dwattr $C$DW$904, DW_AT_decl_column(0x19) $C$DW$905 .dwtag DW_TAG_member .dwattr $C$DW$905, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$905, DW_AT_name("Value") .dwattr $C$DW$905, DW_AT_TI_symbol_name("Value") .dwattr $C$DW$905, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$905, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$905, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$905, DW_AT_decl_line(0x8e) .dwattr $C$DW$905, DW_AT_decl_column(0x19) .dwattr $C$DW$T$173, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$173, DW_AT_decl_line(0x8c) .dwattr $C$DW$T$173, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$173 $C$DW$T$254 .dwtag DW_TAG_typedef .dwattr $C$DW$T$254, DW_AT_name("SlDeviceFatalDeviceAssert_t") .dwattr $C$DW$T$254, DW_AT_type(*$C$DW$T$173) .dwattr $C$DW$T$254, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$254, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$254, DW_AT_decl_line(0x8f) .dwattr $C$DW$T$254, DW_AT_decl_column(0x03) $C$DW$T$174 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$174, DW_AT_byte_size(0x04) $C$DW$906 .dwtag DW_TAG_member .dwattr $C$DW$906, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$906, DW_AT_name("Code") .dwattr $C$DW$906, DW_AT_TI_symbol_name("Code") .dwattr $C$DW$906, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$906, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$906, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$906, DW_AT_decl_line(0x94) .dwattr $C$DW$906, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$174, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$174, DW_AT_decl_line(0x93) .dwattr $C$DW$T$174, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$174 $C$DW$T$256 .dwtag DW_TAG_typedef .dwattr $C$DW$T$256, DW_AT_name("SlDeviceFatalCmdTimeout_t") .dwattr $C$DW$T$256, DW_AT_type(*$C$DW$T$174) .dwattr $C$DW$T$256, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$256, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$256, DW_AT_decl_line(0x95) .dwattr $C$DW$T$256, DW_AT_decl_column(0x1c) $C$DW$T$255 .dwtag DW_TAG_typedef .dwattr $C$DW$T$255, DW_AT_name("SlDeviceFatalNoCmdAck_t") .dwattr $C$DW$T$255, DW_AT_type(*$C$DW$T$174) .dwattr $C$DW$T$255, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$255, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$255, DW_AT_decl_line(0x95) .dwattr $C$DW$T$255, DW_AT_decl_column(0x03) $C$DW$T$176 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$176, DW_AT_byte_size(0x0c) $C$DW$907 .dwtag DW_TAG_member .dwattr $C$DW$907, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$907, DW_AT_name("Id") .dwattr $C$DW$907, DW_AT_TI_symbol_name("Id") .dwattr $C$DW$907, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$907, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$907, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$907, DW_AT_decl_line(0xa2) .dwattr $C$DW$907, DW_AT_decl_column(0x1d) $C$DW$908 .dwtag DW_TAG_member .dwattr $C$DW$908, DW_AT_type(*$C$DW$T$175) .dwattr $C$DW$908, DW_AT_name("Data") .dwattr $C$DW$908, DW_AT_TI_symbol_name("Data") .dwattr $C$DW$908, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$908, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$908, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$908, DW_AT_decl_line(0xa3) .dwattr $C$DW$908, DW_AT_decl_column(0x20) .dwattr $C$DW$T$176, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$176, DW_AT_decl_line(0xa1) .dwattr $C$DW$T$176, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$176 $C$DW$T$514 .dwtag DW_TAG_typedef .dwattr $C$DW$T$514, DW_AT_name("SlDeviceFatal_t") .dwattr $C$DW$T$514, DW_AT_type(*$C$DW$T$176) .dwattr $C$DW$T$514, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$514, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$514, DW_AT_decl_line(0xa4) .dwattr $C$DW$T$514, DW_AT_decl_column(0x02) $C$DW$T$177 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$177, DW_AT_byte_size(0x14) $C$DW$909 .dwtag DW_TAG_member .dwattr $C$DW$909, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$909, DW_AT_name("ChipId") .dwattr $C$DW$909, DW_AT_TI_symbol_name("ChipId") .dwattr $C$DW$909, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$909, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$909, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$909, DW_AT_decl_line(0x102) .dwattr $C$DW$909, DW_AT_decl_column(0x19) $C$DW$910 .dwtag DW_TAG_member .dwattr $C$DW$910, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$910, DW_AT_name("FwVersion") .dwattr $C$DW$910, DW_AT_TI_symbol_name("FwVersion") .dwattr $C$DW$910, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$910, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$910, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$910, DW_AT_decl_line(0x103) .dwattr $C$DW$910, DW_AT_decl_column(0x19) $C$DW$911 .dwtag DW_TAG_member .dwattr $C$DW$911, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$911, DW_AT_name("PhyVersion") .dwattr $C$DW$911, DW_AT_TI_symbol_name("PhyVersion") .dwattr $C$DW$911, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$911, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$911, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$911, DW_AT_decl_line(0x104) .dwattr $C$DW$911, DW_AT_decl_column(0x19) $C$DW$912 .dwtag DW_TAG_member .dwattr $C$DW$912, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$912, DW_AT_name("NwpVersion") .dwattr $C$DW$912, DW_AT_TI_symbol_name("NwpVersion") .dwattr $C$DW$912, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$912, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$912, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$912, DW_AT_decl_line(0x105) .dwattr $C$DW$912, DW_AT_decl_column(0x19) $C$DW$913 .dwtag DW_TAG_member .dwattr $C$DW$913, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$913, DW_AT_name("RomVersion") .dwattr $C$DW$913, DW_AT_TI_symbol_name("RomVersion") .dwattr $C$DW$913, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$913, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$913, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$913, DW_AT_decl_line(0x106) .dwattr $C$DW$913, DW_AT_decl_column(0x19) $C$DW$914 .dwtag DW_TAG_member .dwattr $C$DW$914, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$914, DW_AT_name("Padding") .dwattr $C$DW$914, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$914, DW_AT_data_member_location[DW_OP_plus_uconst 0x12] .dwattr $C$DW$914, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$914, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$914, DW_AT_decl_line(0x107) .dwattr $C$DW$914, DW_AT_decl_column(0x19) .dwattr $C$DW$T$177, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$177, DW_AT_decl_line(0x101) .dwattr $C$DW$T$177, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$177 $C$DW$T$515 .dwtag DW_TAG_typedef .dwattr $C$DW$T$515, DW_AT_name("SlDeviceVersion_t") .dwattr $C$DW$T$515, DW_AT_type(*$C$DW$T$177) .dwattr $C$DW$T$515, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$515, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$515, DW_AT_decl_line(0x108) .dwattr $C$DW$T$515, DW_AT_decl_column(0x02) $C$DW$T$179 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$179, DW_AT_byte_size(0x2c) $C$DW$915 .dwtag DW_TAG_member .dwattr $C$DW$915, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$915, DW_AT_name("tm_sec") .dwattr $C$DW$915, DW_AT_TI_symbol_name("tm_sec") .dwattr $C$DW$915, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$915, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$915, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$915, DW_AT_decl_line(0x10e) .dwattr $C$DW$915, DW_AT_decl_column(0x19) $C$DW$916 .dwtag DW_TAG_member .dwattr $C$DW$916, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$916, DW_AT_name("tm_min") .dwattr $C$DW$916, DW_AT_TI_symbol_name("tm_min") .dwattr $C$DW$916, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$916, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$916, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$916, DW_AT_decl_line(0x10f) .dwattr $C$DW$916, DW_AT_decl_column(0x19) $C$DW$917 .dwtag DW_TAG_member .dwattr $C$DW$917, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$917, DW_AT_name("tm_hour") .dwattr $C$DW$917, DW_AT_TI_symbol_name("tm_hour") .dwattr $C$DW$917, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$917, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$917, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$917, DW_AT_decl_line(0x110) .dwattr $C$DW$917, DW_AT_decl_column(0x19) $C$DW$918 .dwtag DW_TAG_member .dwattr $C$DW$918, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$918, DW_AT_name("tm_day") .dwattr $C$DW$918, DW_AT_TI_symbol_name("tm_day") .dwattr $C$DW$918, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$918, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$918, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$918, DW_AT_decl_line(0x112) .dwattr $C$DW$918, DW_AT_decl_column(0x19) $C$DW$919 .dwtag DW_TAG_member .dwattr $C$DW$919, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$919, DW_AT_name("tm_mon") .dwattr $C$DW$919, DW_AT_TI_symbol_name("tm_mon") .dwattr $C$DW$919, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$919, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$919, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$919, DW_AT_decl_line(0x113) .dwattr $C$DW$919, DW_AT_decl_column(0x19) $C$DW$920 .dwtag DW_TAG_member .dwattr $C$DW$920, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$920, DW_AT_name("tm_year") .dwattr $C$DW$920, DW_AT_TI_symbol_name("tm_year") .dwattr $C$DW$920, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$920, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$920, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$920, DW_AT_decl_line(0x114) .dwattr $C$DW$920, DW_AT_decl_column(0x19) $C$DW$921 .dwtag DW_TAG_member .dwattr $C$DW$921, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$921, DW_AT_name("tm_week_day") .dwattr $C$DW$921, DW_AT_TI_symbol_name("tm_week_day") .dwattr $C$DW$921, DW_AT_data_member_location[DW_OP_plus_uconst 0x18] .dwattr $C$DW$921, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$921, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$921, DW_AT_decl_line(0x115) .dwattr $C$DW$921, DW_AT_decl_column(0x19) $C$DW$922 .dwtag DW_TAG_member .dwattr $C$DW$922, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$922, DW_AT_name("tm_year_day") .dwattr $C$DW$922, DW_AT_TI_symbol_name("tm_year_day") .dwattr $C$DW$922, DW_AT_data_member_location[DW_OP_plus_uconst 0x1c] .dwattr $C$DW$922, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$922, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$922, DW_AT_decl_line(0x116) .dwattr $C$DW$922, DW_AT_decl_column(0x19) $C$DW$923 .dwtag DW_TAG_member .dwattr $C$DW$923, DW_AT_type(*$C$DW$T$178) .dwattr $C$DW$923, DW_AT_name("reserved") .dwattr $C$DW$923, DW_AT_TI_symbol_name("reserved") .dwattr $C$DW$923, DW_AT_data_member_location[DW_OP_plus_uconst 0x20] .dwattr $C$DW$923, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$923, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$923, DW_AT_decl_line(0x117) .dwattr $C$DW$923, DW_AT_decl_column(0x19) .dwattr $C$DW$T$179, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$179, DW_AT_decl_line(0x10c) .dwattr $C$DW$T$179, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$179 $C$DW$T$516 .dwtag DW_TAG_typedef .dwattr $C$DW$T$516, DW_AT_name("SlDateTime_t") .dwattr $C$DW$T$516, DW_AT_type(*$C$DW$T$179) .dwattr $C$DW$T$516, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$516, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$516, DW_AT_decl_line(0x118) .dwattr $C$DW$T$516, DW_AT_decl_column(0x02) $C$DW$T$180 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$180, DW_AT_byte_size(0x08) $C$DW$924 .dwtag DW_TAG_member .dwattr $C$DW$924, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$924, DW_AT_name("ChipId") .dwattr $C$DW$924, DW_AT_TI_symbol_name("ChipId") .dwattr $C$DW$924, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$924, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$924, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$924, DW_AT_decl_line(0x120) .dwattr $C$DW$924, DW_AT_decl_column(0x0d) $C$DW$925 .dwtag DW_TAG_member .dwattr $C$DW$925, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$925, DW_AT_name("MoreData") .dwattr $C$DW$925, DW_AT_TI_symbol_name("MoreData") .dwattr $C$DW$925, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$925, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$925, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$925, DW_AT_decl_line(0x121) .dwattr $C$DW$925, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$180, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$180, DW_AT_decl_line(0x11f) .dwattr $C$DW$T$180, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$180 $C$DW$T$517 .dwtag DW_TAG_typedef .dwattr $C$DW$T$517, DW_AT_name("SlDeviceInitInfo_t") .dwattr $C$DW$T$517, DW_AT_type(*$C$DW$T$180) .dwattr $C$DW$T$517, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$517, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$517, DW_AT_decl_line(0x122) .dwattr $C$DW$T$517, DW_AT_decl_column(0x02) $C$DW$T$518 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$518, DW_AT_type(*$C$DW$T$517) .dwattr $C$DW$T$518, DW_AT_address_class(0x20) $C$DW$T$181 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$181, DW_AT_byte_size(0x04) $C$DW$926 .dwtag DW_TAG_member .dwattr $C$DW$926, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$926, DW_AT_name("DnsSecondServerAddr") .dwattr $C$DW$926, DW_AT_TI_symbol_name("DnsSecondServerAddr") .dwattr $C$DW$926, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$926, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$926, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$926, DW_AT_decl_line(0x80) .dwattr $C$DW$926, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$181, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$181, DW_AT_decl_line(0x7f) .dwattr $C$DW$T$181, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$181 $C$DW$T$519 .dwtag DW_TAG_typedef .dwattr $C$DW$T$519, DW_AT_name("SlNetCfgIpV4DnsClientArgs_t") .dwattr $C$DW$T$519, DW_AT_type(*$C$DW$T$181) .dwattr $C$DW$T$519, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$519, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$519, DW_AT_decl_line(0x81) .dwattr $C$DW$T$519, DW_AT_decl_column(0x02) $C$DW$T$183 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$183, DW_AT_byte_size(0x24) $C$DW$927 .dwtag DW_TAG_member .dwattr $C$DW$927, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$927, DW_AT_name("Ip") .dwattr $C$DW$927, DW_AT_TI_symbol_name("Ip") .dwattr $C$DW$927, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$927, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$927, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$927, DW_AT_decl_line(0x86) .dwattr $C$DW$927, DW_AT_decl_column(0x0b) $C$DW$928 .dwtag DW_TAG_member .dwattr $C$DW$928, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$928, DW_AT_name("Gateway") .dwattr $C$DW$928, DW_AT_TI_symbol_name("Gateway") .dwattr $C$DW$928, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$928, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$928, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$928, DW_AT_decl_line(0x87) .dwattr $C$DW$928, DW_AT_decl_column(0x0b) $C$DW$929 .dwtag DW_TAG_member .dwattr $C$DW$929, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$929, DW_AT_name("Mask") .dwattr $C$DW$929, DW_AT_TI_symbol_name("Mask") .dwattr $C$DW$929, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$929, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$929, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$929, DW_AT_decl_line(0x88) .dwattr $C$DW$929, DW_AT_decl_column(0x0b) $C$DW$930 .dwtag DW_TAG_member .dwattr $C$DW$930, DW_AT_type(*$C$DW$T$182) .dwattr $C$DW$930, DW_AT_name("Dns") .dwattr $C$DW$930, DW_AT_TI_symbol_name("Dns") .dwattr $C$DW$930, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$930, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$930, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$930, DW_AT_decl_line(0x89) .dwattr $C$DW$930, DW_AT_decl_column(0x0b) $C$DW$931 .dwtag DW_TAG_member .dwattr $C$DW$931, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$931, DW_AT_name("DhcpServer") .dwattr $C$DW$931, DW_AT_TI_symbol_name("DhcpServer") .dwattr $C$DW$931, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$931, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$931, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$931, DW_AT_decl_line(0x8a) .dwattr $C$DW$931, DW_AT_decl_column(0x0b) $C$DW$932 .dwtag DW_TAG_member .dwattr $C$DW$932, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$932, DW_AT_name("LeaseTime") .dwattr $C$DW$932, DW_AT_TI_symbol_name("LeaseTime") .dwattr $C$DW$932, DW_AT_data_member_location[DW_OP_plus_uconst 0x18] .dwattr $C$DW$932, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$932, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$932, DW_AT_decl_line(0x8b) .dwattr $C$DW$932, DW_AT_decl_column(0x0b) $C$DW$933 .dwtag DW_TAG_member .dwattr $C$DW$933, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$933, DW_AT_name("TimeToRenew") .dwattr $C$DW$933, DW_AT_TI_symbol_name("TimeToRenew") .dwattr $C$DW$933, DW_AT_data_member_location[DW_OP_plus_uconst 0x1c] .dwattr $C$DW$933, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$933, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$933, DW_AT_decl_line(0x8c) .dwattr $C$DW$933, DW_AT_decl_column(0x0b) $C$DW$934 .dwtag DW_TAG_member .dwattr $C$DW$934, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$934, DW_AT_name("DhcpState") .dwattr $C$DW$934, DW_AT_TI_symbol_name("DhcpState") .dwattr $C$DW$934, DW_AT_data_member_location[DW_OP_plus_uconst 0x20] .dwattr $C$DW$934, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$934, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$934, DW_AT_decl_line(0x8d) .dwattr $C$DW$934, DW_AT_decl_column(0x0b) $C$DW$935 .dwtag DW_TAG_member .dwattr $C$DW$935, DW_AT_type(*$C$DW$T$22) .dwattr $C$DW$935, DW_AT_name("Reserved") .dwattr $C$DW$935, DW_AT_TI_symbol_name("Reserved") .dwattr $C$DW$935, DW_AT_data_member_location[DW_OP_plus_uconst 0x21] .dwattr $C$DW$935, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$935, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$935, DW_AT_decl_line(0x8e) .dwattr $C$DW$935, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$183, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$183, DW_AT_decl_line(0x85) .dwattr $C$DW$T$183, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$183 $C$DW$T$520 .dwtag DW_TAG_typedef .dwattr $C$DW$T$520, DW_AT_name("SlNetCfgIpv4DhcpClient_t") .dwattr $C$DW$T$520, DW_AT_type(*$C$DW$T$183) .dwattr $C$DW$T$520, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$520, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$520, DW_AT_decl_line(0x8f) .dwattr $C$DW$T$520, DW_AT_decl_column(0x03) $C$DW$T$184 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$184, DW_AT_byte_size(0x10) $C$DW$936 .dwtag DW_TAG_member .dwattr $C$DW$936, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$936, DW_AT_name("Ip") .dwattr $C$DW$936, DW_AT_TI_symbol_name("Ip") .dwattr $C$DW$936, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$936, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$936, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$936, DW_AT_decl_line(0xa5) .dwattr $C$DW$936, DW_AT_decl_column(0x0b) $C$DW$937 .dwtag DW_TAG_member .dwattr $C$DW$937, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$937, DW_AT_name("IpMask") .dwattr $C$DW$937, DW_AT_TI_symbol_name("IpMask") .dwattr $C$DW$937, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$937, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$937, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$937, DW_AT_decl_line(0xa6) .dwattr $C$DW$937, DW_AT_decl_column(0x0b) $C$DW$938 .dwtag DW_TAG_member .dwattr $C$DW$938, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$938, DW_AT_name("IpGateway") .dwattr $C$DW$938, DW_AT_TI_symbol_name("IpGateway") .dwattr $C$DW$938, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$938, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$938, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$938, DW_AT_decl_line(0xa7) .dwattr $C$DW$938, DW_AT_decl_column(0x0b) $C$DW$939 .dwtag DW_TAG_member .dwattr $C$DW$939, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$939, DW_AT_name("IpDnsServer") .dwattr $C$DW$939, DW_AT_TI_symbol_name("IpDnsServer") .dwattr $C$DW$939, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$939, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$939, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$939, DW_AT_decl_line(0xa8) .dwattr $C$DW$939, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$184, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$184, DW_AT_decl_line(0xa4) .dwattr $C$DW$T$184, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$184 $C$DW$T$521 .dwtag DW_TAG_typedef .dwattr $C$DW$T$521, DW_AT_name("SlNetCfgIpV4Args_t") .dwattr $C$DW$T$521, DW_AT_type(*$C$DW$T$184) .dwattr $C$DW$T$521, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$521, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$521, DW_AT_decl_line(0xa9) .dwattr $C$DW$T$521, DW_AT_decl_column(0x02) $C$DW$T$185 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$185, DW_AT_byte_size(0x24) $C$DW$940 .dwtag DW_TAG_member .dwattr $C$DW$940, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$940, DW_AT_name("Ip") .dwattr $C$DW$940, DW_AT_TI_symbol_name("Ip") .dwattr $C$DW$940, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$940, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$940, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$940, DW_AT_decl_line(0xad) .dwattr $C$DW$940, DW_AT_decl_column(0x0b) $C$DW$941 .dwtag DW_TAG_member .dwattr $C$DW$941, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$941, DW_AT_name("IpDnsServer") .dwattr $C$DW$941, DW_AT_TI_symbol_name("IpDnsServer") .dwattr $C$DW$941, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$941, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$941, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$941, DW_AT_decl_line(0xae) .dwattr $C$DW$941, DW_AT_decl_column(0x0b) $C$DW$942 .dwtag DW_TAG_member .dwattr $C$DW$942, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$942, DW_AT_name("IpV6Flags") .dwattr $C$DW$942, DW_AT_TI_symbol_name("IpV6Flags") .dwattr $C$DW$942, DW_AT_data_member_location[DW_OP_plus_uconst 0x20] .dwattr $C$DW$942, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$942, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$942, DW_AT_decl_line(0xaf) .dwattr $C$DW$942, DW_AT_decl_column(0x0b) .dwattr $C$DW$T$185, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$185, DW_AT_decl_line(0xac) .dwattr $C$DW$T$185, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$185 $C$DW$T$522 .dwtag DW_TAG_typedef .dwattr $C$DW$T$522, DW_AT_name("SlNetCfgIpV6Args_t") .dwattr $C$DW$T$522, DW_AT_type(*$C$DW$T$185) .dwattr $C$DW$T$522, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$522, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$522, DW_AT_decl_line(0xb0) .dwattr $C$DW$T$522, DW_AT_decl_column(0x02) $C$DW$T$186 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$186, DW_AT_byte_size(0x2c) $C$DW$943 .dwtag DW_TAG_member .dwattr $C$DW$943, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$943, DW_AT_name("Ip") .dwattr $C$DW$943, DW_AT_TI_symbol_name("Ip") .dwattr $C$DW$943, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$943, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$943, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$943, DW_AT_decl_line(0xb9) .dwattr $C$DW$943, DW_AT_decl_column(0x0a) $C$DW$944 .dwtag DW_TAG_member .dwattr $C$DW$944, DW_AT_type(*$C$DW$T$20) .dwattr $C$DW$944, DW_AT_name("MacAddr") .dwattr $C$DW$944, DW_AT_TI_symbol_name("MacAddr") .dwattr $C$DW$944, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$944, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$944, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$944, DW_AT_decl_line(0xba) .dwattr $C$DW$944, DW_AT_decl_column(0x0a) $C$DW$945 .dwtag DW_TAG_member .dwattr $C$DW$945, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$945, DW_AT_name("Status") .dwattr $C$DW$945, DW_AT_TI_symbol_name("Status") .dwattr $C$DW$945, DW_AT_data_member_location[DW_OP_plus_uconst 0xa] .dwattr $C$DW$945, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$945, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$945, DW_AT_decl_line(0xbb) .dwattr $C$DW$945, DW_AT_decl_column(0x0a) $C$DW$946 .dwtag DW_TAG_member .dwattr $C$DW$946, DW_AT_type(*$C$DW$T$19) .dwattr $C$DW$946, DW_AT_name("Name") .dwattr $C$DW$946, DW_AT_TI_symbol_name("Name") .dwattr $C$DW$946, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$946, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$946, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$946, DW_AT_decl_line(0xbc) .dwattr $C$DW$946, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$186, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$186, DW_AT_decl_line(0xb8) .dwattr $C$DW$T$186, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$186 $C$DW$T$523 .dwtag DW_TAG_typedef .dwattr $C$DW$T$523, DW_AT_name("SlNetCfgStaInfo_t") .dwattr $C$DW$T$523, DW_AT_type(*$C$DW$T$186) .dwattr $C$DW$T$523, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$523, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netcfg.h") .dwattr $C$DW$T$523, DW_AT_decl_line(0xbd) .dwattr $C$DW$T$523, DW_AT_decl_column(0x03) $C$DW$T$187 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$187, DW_AT_byte_size(0x04) $C$DW$947 .dwtag DW_TAG_member .dwattr $C$DW$947, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$947, DW_AT_name("Padding") .dwattr $C$DW$947, DW_AT_TI_symbol_name("Padding") .dwattr $C$DW$947, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$947, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$947, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$947, DW_AT_decl_line(0xac) .dwattr $C$DW$947, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$187, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$187, DW_AT_decl_line(0xab) .dwattr $C$DW$T$187, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$187 $C$DW$T$258 .dwtag DW_TAG_typedef .dwattr $C$DW$T$258, DW_AT_name("SlNetUtilCryptoEcCustomCurveParam_t") .dwattr $C$DW$T$258, DW_AT_type(*$C$DW$T$187) .dwattr $C$DW$T$258, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$258, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$258, DW_AT_decl_line(0xad) .dwattr $C$DW$T$258, DW_AT_decl_column(0x03) $C$DW$T$189 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$189, DW_AT_byte_size(0x05) $C$DW$948 .dwtag DW_TAG_member .dwattr $C$DW$948, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$948, DW_AT_name("CurveType") .dwattr $C$DW$948, DW_AT_TI_symbol_name("CurveType") .dwattr $C$DW$948, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$948, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$948, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$948, DW_AT_decl_line(0xc5) .dwattr $C$DW$948, DW_AT_decl_column(0x25) $C$DW$949 .dwtag DW_TAG_member .dwattr $C$DW$949, DW_AT_type(*$C$DW$T$188) .dwattr $C$DW$949, DW_AT_name("CurveParams") .dwattr $C$DW$949, DW_AT_TI_symbol_name("CurveParams") .dwattr $C$DW$949, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$949, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$949, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$949, DW_AT_decl_line(0xc6) .dwattr $C$DW$949, DW_AT_decl_column(0x25) .dwattr $C$DW$T$189, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$189, DW_AT_decl_line(0xc4) .dwattr $C$DW$T$189, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$189 $C$DW$T$260 .dwtag DW_TAG_typedef .dwattr $C$DW$T$260, DW_AT_name("SlNetUtilCryptoEcKeyParams_t") .dwattr $C$DW$T$260, DW_AT_type(*$C$DW$T$189) .dwattr $C$DW$T$260, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$260, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$260, DW_AT_decl_line(0xc7) .dwattr $C$DW$T$260, DW_AT_decl_column(0x03) $C$DW$T$191 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$191, DW_AT_byte_size(0x08) $C$DW$950 .dwtag DW_TAG_member .dwattr $C$DW$950, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$950, DW_AT_name("KeyAlgo") .dwattr $C$DW$950, DW_AT_TI_symbol_name("KeyAlgo") .dwattr $C$DW$950, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$950, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$950, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$950, DW_AT_decl_line(0xd5) .dwattr $C$DW$950, DW_AT_decl_column(0x24) $C$DW$951 .dwtag DW_TAG_member .dwattr $C$DW$951, DW_AT_type(*$C$DW$T$190) .dwattr $C$DW$951, DW_AT_name("KeyParams") .dwattr $C$DW$951, DW_AT_TI_symbol_name("KeyParams") .dwattr $C$DW$951, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$951, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$951, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$951, DW_AT_decl_line(0xd6) .dwattr $C$DW$951, DW_AT_decl_column(0x24) $C$DW$952 .dwtag DW_TAG_member .dwattr $C$DW$952, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$952, DW_AT_name("KeyFileNameLen") .dwattr $C$DW$952, DW_AT_TI_symbol_name("KeyFileNameLen") .dwattr $C$DW$952, DW_AT_data_member_location[DW_OP_plus_uconst 0x6] .dwattr $C$DW$952, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$952, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$952, DW_AT_decl_line(0xd7) .dwattr $C$DW$952, DW_AT_decl_column(0x24) $C$DW$953 .dwtag DW_TAG_member .dwattr $C$DW$953, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$953, DW_AT_name("CertFileNameLen") .dwattr $C$DW$953, DW_AT_TI_symbol_name("CertFileNameLen") .dwattr $C$DW$953, DW_AT_data_member_location[DW_OP_plus_uconst 0x7] .dwattr $C$DW$953, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$953, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$953, DW_AT_decl_line(0xd8) .dwattr $C$DW$953, DW_AT_decl_column(0x24) .dwattr $C$DW$T$191, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$191, DW_AT_decl_line(0xd4) .dwattr $C$DW$T$191, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$191 $C$DW$T$524 .dwtag DW_TAG_typedef .dwattr $C$DW$T$524, DW_AT_name("SlNetUtilCryptoPubKeyInfo_t") .dwattr $C$DW$T$524, DW_AT_type(*$C$DW$T$191) .dwattr $C$DW$T$524, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$524, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$524, DW_AT_decl_line(0xd9) .dwattr $C$DW$T$524, DW_AT_decl_column(0x02) $C$DW$T$192 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$192, DW_AT_byte_size(0x0c) $C$DW$954 .dwtag DW_TAG_member .dwattr $C$DW$954, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$954, DW_AT_name("ObjId") .dwattr $C$DW$954, DW_AT_TI_symbol_name("ObjId") .dwattr $C$DW$954, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$954, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$954, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$954, DW_AT_decl_line(0xe1) .dwattr $C$DW$954, DW_AT_decl_column(0x10) $C$DW$955 .dwtag DW_TAG_member .dwattr $C$DW$955, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$955, DW_AT_name("SigType") .dwattr $C$DW$955, DW_AT_TI_symbol_name("SigType") .dwattr $C$DW$955, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$955, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$955, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$955, DW_AT_decl_line(0xe2) .dwattr $C$DW$955, DW_AT_decl_column(0x10) $C$DW$956 .dwtag DW_TAG_member .dwattr $C$DW$956, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$956, DW_AT_name("Flags") .dwattr $C$DW$956, DW_AT_TI_symbol_name("Flags") .dwattr $C$DW$956, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$956, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$956, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$956, DW_AT_decl_line(0xe3) .dwattr $C$DW$956, DW_AT_decl_column(0x10) .dwattr $C$DW$T$192, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$192, DW_AT_decl_line(0xe0) .dwattr $C$DW$T$192, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$192 $C$DW$T$525 .dwtag DW_TAG_typedef .dwattr $C$DW$T$525, DW_AT_name("SlNetUtilCryptoCmdSignAttrib_t") .dwattr $C$DW$T$525, DW_AT_type(*$C$DW$T$192) .dwattr $C$DW$T$525, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$525, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$525, DW_AT_decl_line(0xe4) .dwattr $C$DW$T$525, DW_AT_decl_column(0x03) $C$DW$T$193 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$193, DW_AT_byte_size(0x10) $C$DW$957 .dwtag DW_TAG_member .dwattr $C$DW$957, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$957, DW_AT_name("ObjId") .dwattr $C$DW$957, DW_AT_TI_symbol_name("ObjId") .dwattr $C$DW$957, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$957, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$957, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$957, DW_AT_decl_line(0xea) .dwattr $C$DW$957, DW_AT_decl_column(0x10) $C$DW$958 .dwtag DW_TAG_member .dwattr $C$DW$958, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$958, DW_AT_name("SigType") .dwattr $C$DW$958, DW_AT_TI_symbol_name("SigType") .dwattr $C$DW$958, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$958, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$958, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$958, DW_AT_decl_line(0xeb) .dwattr $C$DW$958, DW_AT_decl_column(0x10) $C$DW$959 .dwtag DW_TAG_member .dwattr $C$DW$959, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$959, DW_AT_name("Flags") .dwattr $C$DW$959, DW_AT_TI_symbol_name("Flags") .dwattr $C$DW$959, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$959, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$959, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$959, DW_AT_decl_line(0xec) .dwattr $C$DW$959, DW_AT_decl_column(0x10) $C$DW$960 .dwtag DW_TAG_member .dwattr $C$DW$960, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$960, DW_AT_name("MsgLen") .dwattr $C$DW$960, DW_AT_TI_symbol_name("MsgLen") .dwattr $C$DW$960, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$960, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$960, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$960, DW_AT_decl_line(0xed) .dwattr $C$DW$960, DW_AT_decl_column(0x10) $C$DW$961 .dwtag DW_TAG_member .dwattr $C$DW$961, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$961, DW_AT_name("SigLen") .dwattr $C$DW$961, DW_AT_TI_symbol_name("SigLen") .dwattr $C$DW$961, DW_AT_data_member_location[DW_OP_plus_uconst 0xe] .dwattr $C$DW$961, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$961, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$961, DW_AT_decl_line(0xee) .dwattr $C$DW$961, DW_AT_decl_column(0x10) .dwattr $C$DW$T$193, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$193, DW_AT_decl_line(0xe9) .dwattr $C$DW$T$193, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$193 $C$DW$T$526 .dwtag DW_TAG_typedef .dwattr $C$DW$T$526, DW_AT_name("SlNetUtilCryptoCmdVerifyAttrib_t") .dwattr $C$DW$T$526, DW_AT_type(*$C$DW$T$193) .dwattr $C$DW$T$526, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$526, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$526, DW_AT_decl_line(0xef) .dwattr $C$DW$T$526, DW_AT_decl_column(0x03) $C$DW$T$194 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$194, DW_AT_byte_size(0x0c) $C$DW$962 .dwtag DW_TAG_member .dwattr $C$DW$962, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$962, DW_AT_name("ObjId") .dwattr $C$DW$962, DW_AT_TI_symbol_name("ObjId") .dwattr $C$DW$962, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$962, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$962, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$962, DW_AT_decl_line(0xf4) .dwattr $C$DW$962, DW_AT_decl_column(0x10) $C$DW$963 .dwtag DW_TAG_member .dwattr $C$DW$963, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$963, DW_AT_name("Flags") .dwattr $C$DW$963, DW_AT_TI_symbol_name("Flags") .dwattr $C$DW$963, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$963, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$963, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$963, DW_AT_decl_line(0xf5) .dwattr $C$DW$963, DW_AT_decl_column(0x10) $C$DW$964 .dwtag DW_TAG_member .dwattr $C$DW$964, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$964, DW_AT_name("SubCmd") .dwattr $C$DW$964, DW_AT_TI_symbol_name("SubCmd") .dwattr $C$DW$964, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$964, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$964, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$964, DW_AT_decl_line(0xf6) .dwattr $C$DW$964, DW_AT_decl_column(0x10) .dwattr $C$DW$T$194, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$194, DW_AT_decl_line(0xf3) .dwattr $C$DW$T$194, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$194 $C$DW$T$527 .dwtag DW_TAG_typedef .dwattr $C$DW$T$527, DW_AT_name("SlNetUtilCryptoCmdCreateCertAttrib_t") .dwattr $C$DW$T$527, DW_AT_type(*$C$DW$T$194) .dwattr $C$DW$T$527, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$527, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$527, DW_AT_decl_line(0xf7) .dwattr $C$DW$T$527, DW_AT_decl_column(0x03) $C$DW$T$195 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$195, DW_AT_byte_size(0x0c) $C$DW$965 .dwtag DW_TAG_member .dwattr $C$DW$965, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$965, DW_AT_name("ObjId") .dwattr $C$DW$965, DW_AT_TI_symbol_name("ObjId") .dwattr $C$DW$965, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$965, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$965, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$965, DW_AT_decl_line(0xfd) .dwattr $C$DW$965, DW_AT_decl_column(0x10) $C$DW$966 .dwtag DW_TAG_member .dwattr $C$DW$966, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$966, DW_AT_name("Flags") .dwattr $C$DW$966, DW_AT_TI_symbol_name("Flags") .dwattr $C$DW$966, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$966, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$966, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$966, DW_AT_decl_line(0xfe) .dwattr $C$DW$966, DW_AT_decl_column(0x10) $C$DW$967 .dwtag DW_TAG_member .dwattr $C$DW$967, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$967, DW_AT_name("SubCmd") .dwattr $C$DW$967, DW_AT_TI_symbol_name("SubCmd") .dwattr $C$DW$967, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$967, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$967, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$967, DW_AT_decl_line(0xff) .dwattr $C$DW$967, DW_AT_decl_column(0x10) .dwattr $C$DW$T$195, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$195, DW_AT_decl_line(0xfc) .dwattr $C$DW$T$195, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$195 $C$DW$T$528 .dwtag DW_TAG_typedef .dwattr $C$DW$T$528, DW_AT_name("SlNetUtilCryptoCmdKeyMgnt_t") .dwattr $C$DW$T$528, DW_AT_type(*$C$DW$T$195) .dwattr $C$DW$T$528, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$528, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$528, DW_AT_decl_line(0x100) .dwattr $C$DW$T$528, DW_AT_decl_column(0x03) $C$DW$T$196 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$196, DW_AT_byte_size(0x04) $C$DW$968 .dwtag DW_TAG_member .dwattr $C$DW$968, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$968, DW_AT_name("NumOfRetries") .dwattr $C$DW$968, DW_AT_TI_symbol_name("NumOfRetries") .dwattr $C$DW$968, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$968, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$968, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$968, DW_AT_decl_line(0x105) .dwattr $C$DW$968, DW_AT_decl_column(0x0a) $C$DW$969 .dwtag DW_TAG_member .dwattr $C$DW$969, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$969, DW_AT_name("Timeout") .dwattr $C$DW$969, DW_AT_TI_symbol_name("Timeout") .dwattr $C$DW$969, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$969, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$969, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$969, DW_AT_decl_line(0x106) .dwattr $C$DW$969, DW_AT_decl_column(0x0a) .dwattr $C$DW$T$196, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$196, DW_AT_decl_line(0x104) .dwattr $C$DW$T$196, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$196 $C$DW$T$529 .dwtag DW_TAG_typedef .dwattr $C$DW$T$529, DW_AT_name("NetUtilCmdArpLookupAttrib_t") .dwattr $C$DW$T$529, DW_AT_type(*$C$DW$T$196) .dwattr $C$DW$T$529, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$529, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$529, DW_AT_decl_line(0x107) .dwattr $C$DW$T$529, DW_AT_decl_column(0x02) $C$DW$T$199 .dwtag DW_TAG_union_type .dwattr $C$DW$T$199, DW_AT_byte_size(0x4c) $C$DW$970 .dwtag DW_TAG_member .dwattr $C$DW$970, DW_AT_type(*$C$DW$T$197) .dwattr $C$DW$970, DW_AT_name("StaConnect") .dwattr $C$DW$970, DW_AT_TI_symbol_name("StaConnect") .dwattr $C$DW$970, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$970, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$970, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$970, DW_AT_decl_line(0x2a4) .dwattr $C$DW$970, DW_AT_decl_column(0x20) $C$DW$971 .dwtag DW_TAG_member .dwattr $C$DW$971, DW_AT_type(*$C$DW$T$198) .dwattr $C$DW$971, DW_AT_name("P2PConnect") .dwattr $C$DW$971, DW_AT_TI_symbol_name("P2PConnect") .dwattr $C$DW$971, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$971, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$971, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$971, DW_AT_decl_line(0x2a5) .dwattr $C$DW$971, DW_AT_decl_column(0x20) .dwattr $C$DW$T$199, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$199, DW_AT_decl_line(0x2a3) .dwattr $C$DW$T$199, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$199 $C$DW$T$24 .dwtag DW_TAG_typedef .dwattr $C$DW$T$24, DW_AT_name("SlWlanConnectionInfo_u") .dwattr $C$DW$T$24, DW_AT_type(*$C$DW$T$199) .dwattr $C$DW$T$24, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$24, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$24, DW_AT_decl_line(0x2a6) .dwattr $C$DW$T$24, DW_AT_decl_column(0x03) $C$DW$T$206 .dwtag DW_TAG_union_type .dwattr $C$DW$T$206, DW_AT_byte_size(0x10) $C$DW$972 .dwtag DW_TAG_member .dwattr $C$DW$972, DW_AT_type(*$C$DW$T$201) .dwattr $C$DW$972, DW_AT_name("_S6_u8") .dwattr $C$DW$972, DW_AT_TI_symbol_name("_S6_u8") .dwattr $C$DW$972, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$972, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$972, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$972, DW_AT_decl_line(0x1c8) .dwattr $C$DW$972, DW_AT_decl_column(0x12) $C$DW$973 .dwtag DW_TAG_member .dwattr $C$DW$973, DW_AT_type(*$C$DW$T$203) .dwattr $C$DW$973, DW_AT_name("_S6_u16") .dwattr $C$DW$973, DW_AT_TI_symbol_name("_S6_u16") .dwattr $C$DW$973, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$973, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$973, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$973, DW_AT_decl_line(0x1c9) .dwattr $C$DW$973, DW_AT_decl_column(0x12) $C$DW$974 .dwtag DW_TAG_member .dwattr $C$DW$974, DW_AT_type(*$C$DW$T$205) .dwattr $C$DW$974, DW_AT_name("_S6_u32") .dwattr $C$DW$974, DW_AT_TI_symbol_name("_S6_u32") .dwattr $C$DW$974, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$974, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$974, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$974, DW_AT_decl_line(0x1ca) .dwattr $C$DW$974, DW_AT_decl_column(0x12) .dwattr $C$DW$T$206, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$206, DW_AT_decl_line(0x1c7) .dwattr $C$DW$T$206, DW_AT_decl_column(0x05) .dwendtag $C$DW$T$206 $C$DW$T$208 .dwtag DW_TAG_union_type .dwattr $C$DW$T$208, DW_AT_byte_size(0x04) $C$DW$975 .dwtag DW_TAG_member .dwattr $C$DW$975, DW_AT_type(*$C$DW$T$207) .dwattr $C$DW$975, DW_AT_name("Index") .dwattr $C$DW$975, DW_AT_TI_symbol_name("Index") .dwattr $C$DW$975, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$975, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$975, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$975, DW_AT_decl_line(0xbb) .dwattr $C$DW$975, DW_AT_decl_column(0x18) $C$DW$976 .dwtag DW_TAG_member .dwattr $C$DW$976, DW_AT_type(*$C$DW$T$12) .dwattr $C$DW$976, DW_AT_name("ErrorNumber") .dwattr $C$DW$976, DW_AT_TI_symbol_name("ErrorNumber") .dwattr $C$DW$976, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$976, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$976, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$976, DW_AT_decl_line(0xbc) .dwattr $C$DW$976, DW_AT_decl_column(0x18) .dwattr $C$DW$T$208, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$208, DW_AT_decl_line(0xba) .dwattr $C$DW$T$208, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$208 $C$DW$T$530 .dwtag DW_TAG_typedef .dwattr $C$DW$T$530, DW_AT_name("SlFsFileNameIndexOrError_t") .dwattr $C$DW$T$530, DW_AT_type(*$C$DW$T$208) .dwattr $C$DW$T$530, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$530, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/fs.h") .dwattr $C$DW$T$530, DW_AT_decl_line(0xbd) .dwattr $C$DW$T$530, DW_AT_decl_column(0x02) $C$DW$T$209 .dwtag DW_TAG_union_type .dwattr $C$DW$T$209, DW_AT_byte_size(0x10) $C$DW$977 .dwtag DW_TAG_member .dwattr $C$DW$977, DW_AT_type(*$C$DW$T$141) .dwattr $C$DW$977, DW_AT_name("_S6_u8") .dwattr $C$DW$977, DW_AT_TI_symbol_name("_S6_u8") .dwattr $C$DW$977, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$977, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$977, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$977, DW_AT_decl_line(0xed) .dwattr $C$DW$977, DW_AT_decl_column(0x0f) $C$DW$978 .dwtag DW_TAG_member .dwattr $C$DW$978, DW_AT_type(*$C$DW$T$30) .dwattr $C$DW$978, DW_AT_name("_S6_u32") .dwattr $C$DW$978, DW_AT_TI_symbol_name("_S6_u32") .dwattr $C$DW$978, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$978, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$978, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$978, DW_AT_decl_line(0xee) .dwattr $C$DW$978, DW_AT_decl_column(0x0f) .dwattr $C$DW$T$209, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$209, DW_AT_decl_line(0xec) .dwattr $C$DW$T$209, DW_AT_decl_column(0x05) .dwendtag $C$DW$T$209 $C$DW$T$212 .dwtag DW_TAG_union_type .dwattr $C$DW$T$212, DW_AT_byte_size(0x84) $C$DW$979 .dwtag DW_TAG_member .dwattr $C$DW$979, DW_AT_type(*$C$DW$T$210) .dwattr $C$DW$979, DW_AT_name("SockTxFailData") .dwattr $C$DW$979, DW_AT_TI_symbol_name("SockTxFailData") .dwattr $C$DW$979, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$979, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$979, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$979, DW_AT_decl_line(0x11f) .dwattr $C$DW$979, DW_AT_decl_column(0x1f) $C$DW$980 .dwtag DW_TAG_member .dwattr $C$DW$980, DW_AT_type(*$C$DW$T$211) .dwattr $C$DW$980, DW_AT_name("SockAsyncData") .dwattr $C$DW$980, DW_AT_TI_symbol_name("SockAsyncData") .dwattr $C$DW$980, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$980, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$980, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$980, DW_AT_decl_line(0x120) .dwattr $C$DW$980, DW_AT_decl_column(0x1f) .dwattr $C$DW$T$212, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$212, DW_AT_decl_line(0x11e) .dwattr $C$DW$T$212, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$212 $C$DW$T$52 .dwtag DW_TAG_typedef .dwattr $C$DW$T$52, DW_AT_name("SlSockEventData_u") .dwattr $C$DW$T$52, DW_AT_type(*$C$DW$T$212) .dwattr $C$DW$T$52, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$52, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$52, DW_AT_decl_line(0x121) .dwattr $C$DW$T$52, DW_AT_decl_column(0x03) $C$DW$T$221 .dwtag DW_TAG_union_type .dwattr $C$DW$T$221, DW_AT_byte_size(0x20) $C$DW$981 .dwtag DW_TAG_member .dwattr $C$DW$981, DW_AT_type(*$C$DW$T$213) .dwattr $C$DW$981, DW_AT_name("IpAcquiredV4") .dwattr $C$DW$981, DW_AT_TI_symbol_name("IpAcquiredV4") .dwattr $C$DW$981, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$981, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$981, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$981, DW_AT_decl_line(0x10c) .dwattr $C$DW$981, DW_AT_decl_column(0x22) $C$DW$982 .dwtag DW_TAG_member .dwattr $C$DW$982, DW_AT_type(*$C$DW$T$214) .dwattr $C$DW$982, DW_AT_name("IpAcquiredV6") .dwattr $C$DW$982, DW_AT_TI_symbol_name("IpAcquiredV6") .dwattr $C$DW$982, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$982, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$982, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$982, DW_AT_decl_line(0x10d) .dwattr $C$DW$982, DW_AT_decl_column(0x22) $C$DW$983 .dwtag DW_TAG_member .dwattr $C$DW$983, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$983, DW_AT_name("Sd") .dwattr $C$DW$983, DW_AT_TI_symbol_name("Sd") .dwattr $C$DW$983, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$983, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$983, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$983, DW_AT_decl_line(0x10e) .dwattr $C$DW$983, DW_AT_decl_column(0x22) $C$DW$984 .dwtag DW_TAG_member .dwattr $C$DW$984, DW_AT_type(*$C$DW$T$215) .dwattr $C$DW$984, DW_AT_name("IpLeased") .dwattr $C$DW$984, DW_AT_TI_symbol_name("IpLeased") .dwattr $C$DW$984, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$984, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$984, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$984, DW_AT_decl_line(0x10f) .dwattr $C$DW$984, DW_AT_decl_column(0x22) $C$DW$985 .dwtag DW_TAG_member .dwattr $C$DW$985, DW_AT_type(*$C$DW$T$216) .dwattr $C$DW$985, DW_AT_name("IpReleased") .dwattr $C$DW$985, DW_AT_TI_symbol_name("IpReleased") .dwattr $C$DW$985, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$985, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$985, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$985, DW_AT_decl_line(0x110) .dwattr $C$DW$985, DW_AT_decl_column(0x22) $C$DW$986 .dwtag DW_TAG_member .dwattr $C$DW$986, DW_AT_type(*$C$DW$T$217) .dwattr $C$DW$986, DW_AT_name("IpV4Lost") .dwattr $C$DW$986, DW_AT_TI_symbol_name("IpV4Lost") .dwattr $C$DW$986, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$986, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$986, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$986, DW_AT_decl_line(0x111) .dwattr $C$DW$986, DW_AT_decl_column(0x22) $C$DW$987 .dwtag DW_TAG_member .dwattr $C$DW$987, DW_AT_type(*$C$DW$T$218) .dwattr $C$DW$987, DW_AT_name("DhcpIpAcquireTimeout") .dwattr $C$DW$987, DW_AT_TI_symbol_name("DhcpIpAcquireTimeout") .dwattr $C$DW$987, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$987, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$987, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$987, DW_AT_decl_line(0x112) .dwattr $C$DW$987, DW_AT_decl_column(0x22) $C$DW$988 .dwtag DW_TAG_member .dwattr $C$DW$988, DW_AT_type(*$C$DW$T$219) .dwattr $C$DW$988, DW_AT_name("IpCollision") .dwattr $C$DW$988, DW_AT_TI_symbol_name("IpCollision") .dwattr $C$DW$988, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$988, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$988, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$988, DW_AT_decl_line(0x113) .dwattr $C$DW$988, DW_AT_decl_column(0x22) $C$DW$989 .dwtag DW_TAG_member .dwattr $C$DW$989, DW_AT_type(*$C$DW$T$220) .dwattr $C$DW$989, DW_AT_name("IpV6Lost") .dwattr $C$DW$989, DW_AT_TI_symbol_name("IpV6Lost") .dwattr $C$DW$989, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$989, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$989, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$989, DW_AT_decl_line(0x114) .dwattr $C$DW$989, DW_AT_decl_column(0x22) .dwattr $C$DW$T$221, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$221, DW_AT_decl_line(0x10b) .dwattr $C$DW$T$221, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$221 $C$DW$T$80 .dwtag DW_TAG_typedef .dwattr $C$DW$T$80, DW_AT_name("SlNetAppEventData_u") .dwattr $C$DW$T$80, DW_AT_type(*$C$DW$T$221) .dwattr $C$DW$T$80, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$80, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$80, DW_AT_decl_line(0x115) .dwattr $C$DW$T$80, DW_AT_decl_column(0x03) $C$DW$T$223 .dwtag DW_TAG_union_type .dwattr $C$DW$T$223, DW_AT_byte_size(0x18) $C$DW$990 .dwtag DW_TAG_member .dwattr $C$DW$990, DW_AT_type(*$C$DW$T$87) .dwattr $C$DW$990, DW_AT_name("HttpTokenName") .dwattr $C$DW$990, DW_AT_TI_symbol_name("HttpTokenName") .dwattr $C$DW$990, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$990, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$990, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$990, DW_AT_decl_line(0x14b) .dwattr $C$DW$990, DW_AT_decl_column(0x27) $C$DW$991 .dwtag DW_TAG_member .dwattr $C$DW$991, DW_AT_type(*$C$DW$T$222) .dwattr $C$DW$991, DW_AT_name("HttpPostData") .dwattr $C$DW$991, DW_AT_TI_symbol_name("HttpPostData") .dwattr $C$DW$991, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$991, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$991, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$991, DW_AT_decl_line(0x14c) .dwattr $C$DW$991, DW_AT_decl_column(0x27) .dwattr $C$DW$T$223, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$223, DW_AT_decl_line(0x14a) .dwattr $C$DW$T$223, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$223 $C$DW$T$89 .dwtag DW_TAG_typedef .dwattr $C$DW$T$89, DW_AT_name("SlNetAppHttpServerEventData_u") .dwattr $C$DW$T$89, DW_AT_type(*$C$DW$T$223) .dwattr $C$DW$T$89, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$89, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$89, DW_AT_decl_line(0x14d) .dwattr $C$DW$T$89, DW_AT_decl_column(0x03) $C$DW$T$224 .dwtag DW_TAG_union_type .dwattr $C$DW$T$224, DW_AT_byte_size(0x08) $C$DW$992 .dwtag DW_TAG_member .dwattr $C$DW$992, DW_AT_type(*$C$DW$T$87) .dwattr $C$DW$992, DW_AT_name("TokenValue") .dwattr $C$DW$992, DW_AT_TI_symbol_name("TokenValue") .dwattr $C$DW$992, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$992, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$992, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$992, DW_AT_decl_line(0x151) .dwattr $C$DW$992, DW_AT_decl_column(0x20) .dwattr $C$DW$T$224, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$224, DW_AT_decl_line(0x150) .dwattr $C$DW$T$224, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$224 $C$DW$T$91 .dwtag DW_TAG_typedef .dwattr $C$DW$T$91, DW_AT_name("SlNetAppHttpServerResponsedata_u") .dwattr $C$DW$T$91, DW_AT_type(*$C$DW$T$224) .dwattr $C$DW$T$91, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$91, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$91, DW_AT_decl_line(0x152) .dwattr $C$DW$T$91, DW_AT_decl_column(0x03) $C$DW$T$237 .dwtag DW_TAG_union_type .dwattr $C$DW$T$237, DW_AT_byte_size(0x4c) $C$DW$993 .dwtag DW_TAG_member .dwattr $C$DW$993, DW_AT_type(*$C$DW$T$197) .dwattr $C$DW$993, DW_AT_name("Connect") .dwattr $C$DW$993, DW_AT_TI_symbol_name("Connect") .dwattr $C$DW$993, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$993, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$993, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$993, DW_AT_decl_line(0x255) .dwattr $C$DW$993, DW_AT_decl_column(0x32) $C$DW$994 .dwtag DW_TAG_member .dwattr $C$DW$994, DW_AT_type(*$C$DW$T$225) .dwattr $C$DW$994, DW_AT_name("Disconnect") .dwattr $C$DW$994, DW_AT_TI_symbol_name("Disconnect") .dwattr $C$DW$994, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$994, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$994, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$994, DW_AT_decl_line(0x256) .dwattr $C$DW$994, DW_AT_decl_column(0x32) $C$DW$995 .dwtag DW_TAG_member .dwattr $C$DW$995, DW_AT_type(*$C$DW$T$226) .dwattr $C$DW$995, DW_AT_name("STAAdded") .dwattr $C$DW$995, DW_AT_TI_symbol_name("STAAdded") .dwattr $C$DW$995, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$995, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$995, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$995, DW_AT_decl_line(0x257) .dwattr $C$DW$995, DW_AT_decl_column(0x32) $C$DW$996 .dwtag DW_TAG_member .dwattr $C$DW$996, DW_AT_type(*$C$DW$T$227) .dwattr $C$DW$996, DW_AT_name("STARemoved") .dwattr $C$DW$996, DW_AT_TI_symbol_name("STARemoved") .dwattr $C$DW$996, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$996, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$996, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$996, DW_AT_decl_line(0x258) .dwattr $C$DW$996, DW_AT_decl_column(0x32) $C$DW$997 .dwtag DW_TAG_member .dwattr $C$DW$997, DW_AT_type(*$C$DW$T$198) .dwattr $C$DW$997, DW_AT_name("P2PConnect") .dwattr $C$DW$997, DW_AT_TI_symbol_name("P2PConnect") .dwattr $C$DW$997, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$997, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$997, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$997, DW_AT_decl_line(0x259) .dwattr $C$DW$997, DW_AT_decl_column(0x32) $C$DW$998 .dwtag DW_TAG_member .dwattr $C$DW$998, DW_AT_type(*$C$DW$T$228) .dwattr $C$DW$998, DW_AT_name("P2PDisconnect") .dwattr $C$DW$998, DW_AT_TI_symbol_name("P2PDisconnect") .dwattr $C$DW$998, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$998, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$998, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$998, DW_AT_decl_line(0x25a) .dwattr $C$DW$998, DW_AT_decl_column(0x32) $C$DW$999 .dwtag DW_TAG_member .dwattr $C$DW$999, DW_AT_type(*$C$DW$T$229) .dwattr $C$DW$999, DW_AT_name("P2PClientAdded") .dwattr $C$DW$999, DW_AT_TI_symbol_name("P2PClientAdded") .dwattr $C$DW$999, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$999, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$999, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$999, DW_AT_decl_line(0x25b) .dwattr $C$DW$999, DW_AT_decl_column(0x32) $C$DW$1000 .dwtag DW_TAG_member .dwattr $C$DW$1000, DW_AT_type(*$C$DW$T$230) .dwattr $C$DW$1000, DW_AT_name("P2PClientRemoved") .dwattr $C$DW$1000, DW_AT_TI_symbol_name("P2PClientRemoved") .dwattr $C$DW$1000, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1000, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1000, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1000, DW_AT_decl_line(0x25c) .dwattr $C$DW$1000, DW_AT_decl_column(0x32) $C$DW$1001 .dwtag DW_TAG_member .dwattr $C$DW$1001, DW_AT_type(*$C$DW$T$231) .dwattr $C$DW$1001, DW_AT_name("P2PDevFound") .dwattr $C$DW$1001, DW_AT_TI_symbol_name("P2PDevFound") .dwattr $C$DW$1001, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1001, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1001, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1001, DW_AT_decl_line(0x25d) .dwattr $C$DW$1001, DW_AT_decl_column(0x32) $C$DW$1002 .dwtag DW_TAG_member .dwattr $C$DW$1002, DW_AT_type(*$C$DW$T$232) .dwattr $C$DW$1002, DW_AT_name("P2PRequest") .dwattr $C$DW$1002, DW_AT_TI_symbol_name("P2PRequest") .dwattr $C$DW$1002, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1002, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1002, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1002, DW_AT_decl_line(0x25e) .dwattr $C$DW$1002, DW_AT_decl_column(0x32) $C$DW$1003 .dwtag DW_TAG_member .dwattr $C$DW$1003, DW_AT_type(*$C$DW$T$233) .dwattr $C$DW$1003, DW_AT_name("P2PConnectFail") .dwattr $C$DW$1003, DW_AT_TI_symbol_name("P2PConnectFail") .dwattr $C$DW$1003, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1003, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1003, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1003, DW_AT_decl_line(0x25f) .dwattr $C$DW$1003, DW_AT_decl_column(0x32) $C$DW$1004 .dwtag DW_TAG_member .dwattr $C$DW$1004, DW_AT_type(*$C$DW$T$234) .dwattr $C$DW$1004, DW_AT_name("RxFilterInfo") .dwattr $C$DW$1004, DW_AT_TI_symbol_name("RxFilterInfo") .dwattr $C$DW$1004, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1004, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1004, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1004, DW_AT_decl_line(0x260) .dwattr $C$DW$1004, DW_AT_decl_column(0x32) $C$DW$1005 .dwtag DW_TAG_member .dwattr $C$DW$1005, DW_AT_type(*$C$DW$T$235) .dwattr $C$DW$1005, DW_AT_name("ProvisioningStatus") .dwattr $C$DW$1005, DW_AT_TI_symbol_name("ProvisioningStatus") .dwattr $C$DW$1005, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1005, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1005, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1005, DW_AT_decl_line(0x261) .dwattr $C$DW$1005, DW_AT_decl_column(0x32) $C$DW$1006 .dwtag DW_TAG_member .dwattr $C$DW$1006, DW_AT_type(*$C$DW$T$236) .dwattr $C$DW$1006, DW_AT_name("ProvisioningProfileAdded") .dwattr $C$DW$1006, DW_AT_TI_symbol_name("ProvisioningProfileAdded") .dwattr $C$DW$1006, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1006, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1006, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1006, DW_AT_decl_line(0x262) .dwattr $C$DW$1006, DW_AT_decl_column(0x32) .dwattr $C$DW$T$237, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$237, DW_AT_decl_line(0x254) .dwattr $C$DW$T$237, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$237 $C$DW$T$123 .dwtag DW_TAG_typedef .dwattr $C$DW$T$123, DW_AT_name("SlWlanEventData_u") .dwattr $C$DW$T$123, DW_AT_type(*$C$DW$T$237) .dwattr $C$DW$T$123, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$123, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$123, DW_AT_decl_line(0x264) .dwattr $C$DW$T$123, DW_AT_decl_column(0x03) $C$DW$T$247 .dwtag DW_TAG_union_type .dwattr $C$DW$T$247, DW_AT_byte_size(0x24) $C$DW$1007 .dwtag DW_TAG_member .dwattr $C$DW$1007, DW_AT_type(*$C$DW$T$238) .dwattr $C$DW$1007, DW_AT_name("Pattern") .dwattr $C$DW$1007, DW_AT_TI_symbol_name("Pattern") .dwattr $C$DW$1007, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1007, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1007, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1007, DW_AT_decl_line(0x327) .dwattr $C$DW$1007, DW_AT_decl_column(0x21) $C$DW$1008 .dwtag DW_TAG_member .dwattr $C$DW$1008, DW_AT_type(*$C$DW$T$239) .dwattr $C$DW$1008, DW_AT_name("Ipv4") .dwattr $C$DW$1008, DW_AT_TI_symbol_name("Ipv4") .dwattr $C$DW$1008, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1008, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1008, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1008, DW_AT_decl_line(0x32a) .dwattr $C$DW$1008, DW_AT_decl_column(0x09) $C$DW$1009 .dwtag DW_TAG_member .dwattr $C$DW$1009, DW_AT_type(*$C$DW$T$240) .dwattr $C$DW$1009, DW_AT_name("Ipv4Ascii") .dwattr $C$DW$1009, DW_AT_TI_symbol_name("Ipv4Ascii") .dwattr $C$DW$1009, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1009, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1009, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1009, DW_AT_decl_line(0x32d) .dwattr $C$DW$1009, DW_AT_decl_column(0x09) $C$DW$1010 .dwtag DW_TAG_member .dwattr $C$DW$1010, DW_AT_type(*$C$DW$T$240) .dwattr $C$DW$1010, DW_AT_name("Ipv6") .dwattr $C$DW$1010, DW_AT_TI_symbol_name("Ipv6") .dwattr $C$DW$1010, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1010, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1010, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1010, DW_AT_decl_line(0x330) .dwattr $C$DW$1010, DW_AT_decl_column(0x09) $C$DW$1011 .dwtag DW_TAG_member .dwattr $C$DW$1011, DW_AT_type(*$C$DW$T$241) .dwattr $C$DW$1011, DW_AT_name("Mac") .dwattr $C$DW$1011, DW_AT_TI_symbol_name("Mac") .dwattr $C$DW$1011, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1011, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1011, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1011, DW_AT_decl_line(0x333) .dwattr $C$DW$1011, DW_AT_decl_column(0x09) $C$DW$1012 .dwtag DW_TAG_member .dwattr $C$DW$1012, DW_AT_type(*$C$DW$T$243) .dwattr $C$DW$1012, DW_AT_name("MacAscii") .dwattr $C$DW$1012, DW_AT_TI_symbol_name("MacAscii") .dwattr $C$DW$1012, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1012, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1012, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1012, DW_AT_decl_line(0x336) .dwattr $C$DW$1012, DW_AT_decl_column(0x09) $C$DW$1013 .dwtag DW_TAG_member .dwattr $C$DW$1013, DW_AT_type(*$C$DW$T$241) .dwattr $C$DW$1013, DW_AT_name("Bssid") .dwattr $C$DW$1013, DW_AT_TI_symbol_name("Bssid") .dwattr $C$DW$1013, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1013, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1013, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1013, DW_AT_decl_line(0x339) .dwattr $C$DW$1013, DW_AT_decl_column(0x09) $C$DW$1014 .dwtag DW_TAG_member .dwattr $C$DW$1014, DW_AT_type(*$C$DW$T$182) .dwattr $C$DW$1014, DW_AT_name("FrameLength") .dwattr $C$DW$1014, DW_AT_TI_symbol_name("FrameLength") .dwattr $C$DW$1014, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1014, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1014, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1014, DW_AT_decl_line(0x33c) .dwattr $C$DW$1014, DW_AT_decl_column(0x0a) $C$DW$1015 .dwtag DW_TAG_member .dwattr $C$DW$1015, DW_AT_type(*$C$DW$T$244) .dwattr $C$DW$1015, DW_AT_name("Port") .dwattr $C$DW$1015, DW_AT_TI_symbol_name("Port") .dwattr $C$DW$1015, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1015, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1015, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1015, DW_AT_decl_line(0x33f) .dwattr $C$DW$1015, DW_AT_decl_column(0x0a) $C$DW$1016 .dwtag DW_TAG_member .dwattr $C$DW$1016, DW_AT_type(*$C$DW$T$182) .dwattr $C$DW$1016, DW_AT_name("EtherType") .dwattr $C$DW$1016, DW_AT_TI_symbol_name("EtherType") .dwattr $C$DW$1016, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1016, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1016, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1016, DW_AT_decl_line(0x342) .dwattr $C$DW$1016, DW_AT_decl_column(0x0a) $C$DW$1017 .dwtag DW_TAG_member .dwattr $C$DW$1017, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$1017, DW_AT_name("IpVersion") .dwattr $C$DW$1017, DW_AT_TI_symbol_name("IpVersion") .dwattr $C$DW$1017, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1017, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1017, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1017, DW_AT_decl_line(0x345) .dwattr $C$DW$1017, DW_AT_decl_column(0x09) $C$DW$1018 .dwtag DW_TAG_member .dwattr $C$DW$1018, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$1018, DW_AT_name("Frametype") .dwattr $C$DW$1018, DW_AT_TI_symbol_name("Frametype") .dwattr $C$DW$1018, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1018, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1018, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1018, DW_AT_decl_line(0x348) .dwattr $C$DW$1018, DW_AT_decl_column(0x09) $C$DW$1019 .dwtag DW_TAG_member .dwattr $C$DW$1019, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$1019, DW_AT_name("FrameSubtype") .dwattr $C$DW$1019, DW_AT_TI_symbol_name("FrameSubtype") .dwattr $C$DW$1019, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1019, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1019, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1019, DW_AT_decl_line(0x34b) .dwattr $C$DW$1019, DW_AT_decl_column(0x09) $C$DW$1020 .dwtag DW_TAG_member .dwattr $C$DW$1020, DW_AT_type(*$C$DW$T$36) .dwattr $C$DW$1020, DW_AT_name("IpProtocol") .dwattr $C$DW$1020, DW_AT_TI_symbol_name("IpProtocol") .dwattr $C$DW$1020, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1020, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1020, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1020, DW_AT_decl_line(0x34e) .dwattr $C$DW$1020, DW_AT_decl_column(0x09) $C$DW$1021 .dwtag DW_TAG_member .dwattr $C$DW$1021, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$1021, DW_AT_name("IpVersionAscii") .dwattr $C$DW$1021, DW_AT_TI_symbol_name("IpVersionAscii") .dwattr $C$DW$1021, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1021, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1021, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1021, DW_AT_decl_line(0x351) .dwattr $C$DW$1021, DW_AT_decl_column(0x09) $C$DW$1022 .dwtag DW_TAG_member .dwattr $C$DW$1022, DW_AT_type(*$C$DW$T$239) .dwattr $C$DW$1022, DW_AT_name("FrametypeAscii") .dwattr $C$DW$1022, DW_AT_TI_symbol_name("FrametypeAscii") .dwattr $C$DW$1022, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1022, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1022, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1022, DW_AT_decl_line(0x354) .dwattr $C$DW$1022, DW_AT_decl_column(0x09) $C$DW$1023 .dwtag DW_TAG_member .dwattr $C$DW$1023, DW_AT_type(*$C$DW$T$246) .dwattr $C$DW$1023, DW_AT_name("IpProtocolAscii") .dwattr $C$DW$1023, DW_AT_TI_symbol_name("IpProtocolAscii") .dwattr $C$DW$1023, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1023, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1023, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1023, DW_AT_decl_line(0x358) .dwattr $C$DW$1023, DW_AT_decl_column(0x09) .dwattr $C$DW$T$247, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$247, DW_AT_decl_line(0x325) .dwattr $C$DW$T$247, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$247 $C$DW$T$143 .dwtag DW_TAG_typedef .dwattr $C$DW$T$143, DW_AT_name("SlWlanRxFilterHeaderArg_u") .dwattr $C$DW$T$143, DW_AT_type(*$C$DW$T$247) .dwattr $C$DW$T$143, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$143, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$143, DW_AT_decl_line(0x35a) .dwattr $C$DW$T$143, DW_AT_decl_column(0x02) $C$DW$T$250 .dwtag DW_TAG_union_type .dwattr $C$DW$T$250, DW_AT_byte_size(0x38) $C$DW$1024 .dwtag DW_TAG_member .dwattr $C$DW$1024, DW_AT_type(*$C$DW$T$248) .dwattr $C$DW$1024, DW_AT_name("Header") .dwattr $C$DW$1024, DW_AT_TI_symbol_name("Header") .dwattr $C$DW$1024, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1024, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1024, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1024, DW_AT_decl_line(0x382) .dwattr $C$DW$1024, DW_AT_decl_column(0x31) $C$DW$1025 .dwtag DW_TAG_member .dwattr $C$DW$1025, DW_AT_type(*$C$DW$T$249) .dwattr $C$DW$1025, DW_AT_name("Combination") .dwattr $C$DW$1025, DW_AT_TI_symbol_name("Combination") .dwattr $C$DW$1025, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1025, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1025, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$1025, DW_AT_decl_line(0x383) .dwattr $C$DW$1025, DW_AT_decl_column(0x31) .dwattr $C$DW$T$250, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$250, DW_AT_decl_line(0x381) .dwattr $C$DW$T$250, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$250 $C$DW$T$531 .dwtag DW_TAG_typedef .dwattr $C$DW$T$531, DW_AT_name("SlWlanRxFilterRule_u") .dwattr $C$DW$T$531, DW_AT_type(*$C$DW$T$250) .dwattr $C$DW$T$531, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$531, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$531, DW_AT_decl_line(0x384) .dwattr $C$DW$T$531, DW_AT_decl_column(0x02) $C$DW$T$253 .dwtag DW_TAG_union_type .dwattr $C$DW$T$253, DW_AT_byte_size(0x04) $C$DW$1026 .dwtag DW_TAG_member .dwattr $C$DW$1026, DW_AT_type(*$C$DW$T$251) .dwattr $C$DW$1026, DW_AT_name("ResetRequest") .dwattr $C$DW$1026, DW_AT_TI_symbol_name("ResetRequest") .dwattr $C$DW$1026, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1026, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1026, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$1026, DW_AT_decl_line(0x70) .dwattr $C$DW$1026, DW_AT_decl_column(0x24) $C$DW$1027 .dwtag DW_TAG_member .dwattr $C$DW$1027, DW_AT_type(*$C$DW$T$252) .dwattr $C$DW$1027, DW_AT_name("Error") .dwattr $C$DW$1027, DW_AT_TI_symbol_name("Error") .dwattr $C$DW$1027, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1027, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1027, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$1027, DW_AT_decl_line(0x71) .dwattr $C$DW$1027, DW_AT_decl_column(0x21) .dwattr $C$DW$T$253, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$253, DW_AT_decl_line(0x6f) .dwattr $C$DW$T$253, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$253 $C$DW$T$171 .dwtag DW_TAG_typedef .dwattr $C$DW$T$171, DW_AT_name("SlDeviceEventData_u") .dwattr $C$DW$T$171, DW_AT_type(*$C$DW$T$253) .dwattr $C$DW$T$171, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$171, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$171, DW_AT_decl_line(0x72) .dwattr $C$DW$T$171, DW_AT_decl_column(0x02) $C$DW$T$257 .dwtag DW_TAG_union_type .dwattr $C$DW$T$257, DW_AT_byte_size(0x08) $C$DW$1028 .dwtag DW_TAG_member .dwattr $C$DW$1028, DW_AT_type(*$C$DW$T$254) .dwattr $C$DW$1028, DW_AT_name("DeviceAssert") .dwattr $C$DW$1028, DW_AT_TI_symbol_name("DeviceAssert") .dwattr $C$DW$1028, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1028, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1028, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$1028, DW_AT_decl_line(0x9a) .dwattr $C$DW$1028, DW_AT_decl_column(0x28) $C$DW$1029 .dwtag DW_TAG_member .dwattr $C$DW$1029, DW_AT_type(*$C$DW$T$255) .dwattr $C$DW$1029, DW_AT_name("NoCmdAck") .dwattr $C$DW$1029, DW_AT_TI_symbol_name("NoCmdAck") .dwattr $C$DW$1029, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1029, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1029, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$1029, DW_AT_decl_line(0x9b) .dwattr $C$DW$1029, DW_AT_decl_column(0x28) $C$DW$1030 .dwtag DW_TAG_member .dwattr $C$DW$1030, DW_AT_type(*$C$DW$T$256) .dwattr $C$DW$1030, DW_AT_name("CmdTimeout") .dwattr $C$DW$1030, DW_AT_TI_symbol_name("CmdTimeout") .dwattr $C$DW$1030, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1030, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1030, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$1030, DW_AT_decl_line(0x9c) .dwattr $C$DW$1030, DW_AT_decl_column(0x26) .dwattr $C$DW$T$257, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$257, DW_AT_decl_line(0x99) .dwattr $C$DW$T$257, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$257 $C$DW$T$175 .dwtag DW_TAG_typedef .dwattr $C$DW$T$175, DW_AT_name("SlDeviceFatalData_u") .dwattr $C$DW$T$175, DW_AT_type(*$C$DW$T$257) .dwattr $C$DW$T$175, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$175, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$175, DW_AT_decl_line(0x9d) .dwattr $C$DW$T$175, DW_AT_decl_column(0x02) $C$DW$T$259 .dwtag DW_TAG_union_type .dwattr $C$DW$T$259, DW_AT_byte_size(0x04) $C$DW$1031 .dwtag DW_TAG_member .dwattr $C$DW$1031, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$1031, DW_AT_name("NamedCurveParams") .dwattr $C$DW$1031, DW_AT_TI_symbol_name("NamedCurveParams") .dwattr $C$DW$1031, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1031, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1031, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$1031, DW_AT_decl_line(0xb3) .dwattr $C$DW$1031, DW_AT_decl_column(0x2a) $C$DW$1032 .dwtag DW_TAG_member .dwattr $C$DW$1032, DW_AT_type(*$C$DW$T$258) .dwattr $C$DW$1032, DW_AT_name("CustomCurveParams") .dwattr $C$DW$1032, DW_AT_TI_symbol_name("CustomCurveParams") .dwattr $C$DW$1032, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1032, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1032, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$1032, DW_AT_decl_line(0xb4) .dwattr $C$DW$1032, DW_AT_decl_column(0x2a) .dwattr $C$DW$T$259, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$259, DW_AT_decl_line(0xb2) .dwattr $C$DW$T$259, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$259 $C$DW$T$188 .dwtag DW_TAG_typedef .dwattr $C$DW$T$188, DW_AT_name("SlNetUtilCryptoEcCurveParams_u") .dwattr $C$DW$T$188, DW_AT_type(*$C$DW$T$259) .dwattr $C$DW$T$188, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$188, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$188, DW_AT_decl_line(0xb5) .dwattr $C$DW$T$188, DW_AT_decl_column(0x03) $C$DW$T$261 .dwtag DW_TAG_union_type .dwattr $C$DW$T$261, DW_AT_byte_size(0x05) $C$DW$1033 .dwtag DW_TAG_member .dwattr $C$DW$1033, DW_AT_type(*$C$DW$T$260) .dwattr $C$DW$1033, DW_AT_name("EcParams") .dwattr $C$DW$1033, DW_AT_TI_symbol_name("EcParams") .dwattr $C$DW$1033, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1033, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1033, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$1033, DW_AT_decl_line(0xcd) .dwattr $C$DW$1033, DW_AT_decl_column(0x25) .dwattr $C$DW$T$261, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$261, DW_AT_decl_line(0xcb) .dwattr $C$DW$T$261, DW_AT_decl_column(0x01) .dwendtag $C$DW$T$261 $C$DW$T$190 .dwtag DW_TAG_typedef .dwattr $C$DW$T$190, DW_AT_name("SlNetUtilCryptoPubKeyParams_u") .dwattr $C$DW$T$190, DW_AT_type(*$C$DW$T$261) .dwattr $C$DW$T$190, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$190, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netutil.h") .dwattr $C$DW$T$190, DW_AT_decl_line(0xd0) .dwattr $C$DW$T$190, DW_AT_decl_column(0x03) $C$DW$T$262 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$262, DW_AT_name("ClockP_FreqHz") .dwattr $C$DW$T$262, DW_AT_byte_size(0x08) $C$DW$1034 .dwtag DW_TAG_member .dwattr $C$DW$1034, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1034, DW_AT_name("hi") .dwattr $C$DW$1034, DW_AT_TI_symbol_name("hi") .dwattr $C$DW$1034, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1034, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1034, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1034, DW_AT_decl_line(0x5c) .dwattr $C$DW$1034, DW_AT_decl_column(0x0e) $C$DW$1035 .dwtag DW_TAG_member .dwattr $C$DW$1035, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1035, DW_AT_name("lo") .dwattr $C$DW$1035, DW_AT_TI_symbol_name("lo") .dwattr $C$DW$1035, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1035, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1035, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1035, DW_AT_decl_line(0x5d) .dwattr $C$DW$1035, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$262, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$262, DW_AT_decl_line(0x5b) .dwattr $C$DW$T$262, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$262 $C$DW$T$532 .dwtag DW_TAG_typedef .dwattr $C$DW$T$532, DW_AT_name("ClockP_FreqHz") .dwattr $C$DW$T$532, DW_AT_type(*$C$DW$T$262) .dwattr $C$DW$T$532, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$532, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$532, DW_AT_decl_line(0x5e) .dwattr $C$DW$T$532, DW_AT_decl_column(0x03) $C$DW$T$265 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$265, DW_AT_name("ClockP_Params") .dwattr $C$DW$T$265, DW_AT_byte_size(0x0c) $C$DW$1036 .dwtag DW_TAG_member .dwattr $C$DW$1036, DW_AT_type(*$C$DW$T$263) .dwattr $C$DW$1036, DW_AT_name("startFlag") .dwattr $C$DW$1036, DW_AT_TI_symbol_name("startFlag") .dwattr $C$DW$1036, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1036, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1036, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1036, DW_AT_decl_line(0x8d) .dwattr $C$DW$1036, DW_AT_decl_column(0x0f) $C$DW$1037 .dwtag DW_TAG_member .dwattr $C$DW$1037, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1037, DW_AT_name("period") .dwattr $C$DW$1037, DW_AT_TI_symbol_name("period") .dwattr $C$DW$1037, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1037, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1037, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1037, DW_AT_decl_line(0x8e) .dwattr $C$DW$1037, DW_AT_decl_column(0x0f) $C$DW$1038 .dwtag DW_TAG_member .dwattr $C$DW$1038, DW_AT_type(*$C$DW$T$264) .dwattr $C$DW$1038, DW_AT_name("arg") .dwattr $C$DW$1038, DW_AT_TI_symbol_name("arg") .dwattr $C$DW$1038, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1038, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1038, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1038, DW_AT_decl_line(0x8f) .dwattr $C$DW$1038, DW_AT_decl_column(0x0f) .dwattr $C$DW$T$265, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$265, DW_AT_decl_line(0x8c) .dwattr $C$DW$T$265, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$265 $C$DW$T$533 .dwtag DW_TAG_typedef .dwattr $C$DW$T$533, DW_AT_name("ClockP_Params") .dwattr $C$DW$T$533, DW_AT_type(*$C$DW$T$265) .dwattr $C$DW$T$533, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$533, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$533, DW_AT_decl_line(0x90) .dwattr $C$DW$T$533, DW_AT_decl_column(0x03) $C$DW$T$534 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$534, DW_AT_name("ClockP_Status") .dwattr $C$DW$T$534, DW_AT_byte_size(0x01) $C$DW$1039 .dwtag DW_TAG_enumerator .dwattr $C$DW$1039, DW_AT_name("ClockP_OK") .dwattr $C$DW$1039, DW_AT_const_value(0x00) .dwattr $C$DW$1039, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1039, DW_AT_decl_line(0x64) .dwattr $C$DW$1039, DW_AT_decl_column(0x05) $C$DW$1040 .dwtag DW_TAG_enumerator .dwattr $C$DW$1040, DW_AT_name("ClockP_FAILURE") .dwattr $C$DW$1040, DW_AT_const_value(-1) .dwattr $C$DW$1040, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1040, DW_AT_decl_line(0x65) .dwattr $C$DW$1040, DW_AT_decl_column(0x05) .dwattr $C$DW$T$534, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$534, DW_AT_decl_line(0x63) .dwattr $C$DW$T$534, DW_AT_decl_column(0x0e) .dwendtag $C$DW$T$534 $C$DW$T$535 .dwtag DW_TAG_typedef .dwattr $C$DW$T$535, DW_AT_name("ClockP_Status") .dwattr $C$DW$T$535, DW_AT_type(*$C$DW$T$534) .dwattr $C$DW$T$535, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$535, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$535, DW_AT_decl_line(0x66) .dwattr $C$DW$T$535, DW_AT_decl_column(0x03) $C$DW$T$268 .dwtag DW_TAG_union_type .dwattr $C$DW$T$268, DW_AT_name("ClockP_Struct") .dwattr $C$DW$T$268, DW_AT_byte_size(0x24) $C$DW$1041 .dwtag DW_TAG_member .dwattr $C$DW$1041, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1041, DW_AT_name("dummy") .dwattr $C$DW$1041, DW_AT_TI_symbol_name("dummy") .dwattr $C$DW$1041, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1041, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1041, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1041, DW_AT_decl_line(0x54) .dwattr $C$DW$1041, DW_AT_decl_column(0x0e) $C$DW$1042 .dwtag DW_TAG_member .dwattr $C$DW$1042, DW_AT_type(*$C$DW$T$267) .dwattr $C$DW$1042, DW_AT_name("data") .dwattr $C$DW$1042, DW_AT_TI_symbol_name("data") .dwattr $C$DW$1042, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1042, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1042, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$1042, DW_AT_decl_line(0x55) .dwattr $C$DW$1042, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$268, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$268, DW_AT_decl_line(0x53) .dwattr $C$DW$T$268, DW_AT_decl_column(0x0f) .dwendtag $C$DW$T$268 $C$DW$T$536 .dwtag DW_TAG_typedef .dwattr $C$DW$T$536, DW_AT_name("ClockP_Struct") .dwattr $C$DW$T$536, DW_AT_type(*$C$DW$T$268) .dwattr $C$DW$T$536, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$536, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$536, DW_AT_decl_line(0x56) .dwattr $C$DW$T$536, DW_AT_decl_column(0x03) $C$DW$T$271 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$271, DW_AT_name("MutexP_Params") .dwattr $C$DW$T$271, DW_AT_byte_size(0x04) $C$DW$1043 .dwtag DW_TAG_member .dwattr $C$DW$1043, DW_AT_type(*$C$DW$T$270) .dwattr $C$DW$1043, DW_AT_name("callback") .dwattr $C$DW$1043, DW_AT_TI_symbol_name("callback") .dwattr $C$DW$1043, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1043, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1043, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$1043, DW_AT_decl_line(0x73) .dwattr $C$DW$1043, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$271, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$T$271, DW_AT_decl_line(0x72) .dwattr $C$DW$T$271, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$271 $C$DW$T$537 .dwtag DW_TAG_typedef .dwattr $C$DW$T$537, DW_AT_name("MutexP_Params") .dwattr $C$DW$T$537, DW_AT_type(*$C$DW$T$271) .dwattr $C$DW$T$537, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$537, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$T$537, DW_AT_decl_line(0x74) .dwattr $C$DW$T$537, DW_AT_decl_column(0x03) $C$DW$T$538 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$538, DW_AT_name("MutexP_Status") .dwattr $C$DW$T$538, DW_AT_byte_size(0x01) $C$DW$1044 .dwtag DW_TAG_enumerator .dwattr $C$DW$1044, DW_AT_name("MutexP_OK") .dwattr $C$DW$1044, DW_AT_const_value(0x00) .dwattr $C$DW$1044, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$1044, DW_AT_decl_line(0x5b) .dwattr $C$DW$1044, DW_AT_decl_column(0x05) $C$DW$1045 .dwtag DW_TAG_enumerator .dwattr $C$DW$1045, DW_AT_name("MutexP_FAILURE") .dwattr $C$DW$1045, DW_AT_const_value(-1) .dwattr $C$DW$1045, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$1045, DW_AT_decl_line(0x5d) .dwattr $C$DW$1045, DW_AT_decl_column(0x05) .dwattr $C$DW$T$538, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$T$538, DW_AT_decl_line(0x59) .dwattr $C$DW$T$538, DW_AT_decl_column(0x0e) .dwendtag $C$DW$T$538 $C$DW$T$539 .dwtag DW_TAG_typedef .dwattr $C$DW$T$539, DW_AT_name("MutexP_Status") .dwattr $C$DW$T$539, DW_AT_type(*$C$DW$T$538) .dwattr $C$DW$T$539, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$539, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$T$539, DW_AT_decl_line(0x5e) .dwattr $C$DW$T$539, DW_AT_decl_column(0x03) $C$DW$T$273 .dwtag DW_TAG_union_type .dwattr $C$DW$T$273, DW_AT_name("MutexP_Struct") .dwattr $C$DW$T$273, DW_AT_byte_size(0x28) $C$DW$1046 .dwtag DW_TAG_member .dwattr $C$DW$1046, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1046, DW_AT_name("dummy") .dwattr $C$DW$1046, DW_AT_TI_symbol_name("dummy") .dwattr $C$DW$1046, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1046, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1046, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$1046, DW_AT_decl_line(0x52) .dwattr $C$DW$1046, DW_AT_decl_column(0x0e) $C$DW$1047 .dwtag DW_TAG_member .dwattr $C$DW$1047, DW_AT_type(*$C$DW$T$272) .dwattr $C$DW$1047, DW_AT_name("data") .dwattr $C$DW$1047, DW_AT_TI_symbol_name("data") .dwattr $C$DW$1047, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1047, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1047, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$1047, DW_AT_decl_line(0x53) .dwattr $C$DW$1047, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$273, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$T$273, DW_AT_decl_line(0x51) .dwattr $C$DW$T$273, DW_AT_decl_column(0x0f) .dwendtag $C$DW$T$273 $C$DW$T$540 .dwtag DW_TAG_typedef .dwattr $C$DW$T$540, DW_AT_name("MutexP_Struct") .dwattr $C$DW$T$540, DW_AT_type(*$C$DW$T$273) .dwattr $C$DW$T$540, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$540, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$T$540, DW_AT_decl_line(0x54) .dwattr $C$DW$T$540, DW_AT_decl_column(0x03) $C$DW$T$274 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$274, DW_AT_name("SemaphoreP_Mode") .dwattr $C$DW$T$274, DW_AT_byte_size(0x01) $C$DW$1048 .dwtag DW_TAG_enumerator .dwattr $C$DW$1048, DW_AT_name("SemaphoreP_Mode_COUNTING") .dwattr $C$DW$1048, DW_AT_const_value(0x00) .dwattr $C$DW$1048, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1048, DW_AT_decl_line(0x78) .dwattr $C$DW$1048, DW_AT_decl_column(0x05) $C$DW$1049 .dwtag DW_TAG_enumerator .dwattr $C$DW$1049, DW_AT_name("SemaphoreP_Mode_BINARY") .dwattr $C$DW$1049, DW_AT_const_value(0x01) .dwattr $C$DW$1049, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1049, DW_AT_decl_line(0x79) .dwattr $C$DW$1049, DW_AT_decl_column(0x05) .dwattr $C$DW$T$274, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$274, DW_AT_decl_line(0x77) .dwattr $C$DW$T$274, DW_AT_decl_column(0x0e) .dwendtag $C$DW$T$274 $C$DW$T$275 .dwtag DW_TAG_typedef .dwattr $C$DW$T$275, DW_AT_name("SemaphoreP_Mode") .dwattr $C$DW$T$275, DW_AT_type(*$C$DW$T$274) .dwattr $C$DW$T$275, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$275, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$275, DW_AT_decl_line(0x7a) .dwattr $C$DW$T$275, DW_AT_decl_column(0x03) $C$DW$T$276 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$276, DW_AT_name("SemaphoreP_Params") .dwattr $C$DW$T$276, DW_AT_byte_size(0x08) $C$DW$1050 .dwtag DW_TAG_member .dwattr $C$DW$1050, DW_AT_type(*$C$DW$T$275) .dwattr $C$DW$1050, DW_AT_name("mode") .dwattr $C$DW$1050, DW_AT_TI_symbol_name("mode") .dwattr $C$DW$1050, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1050, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1050, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1050, DW_AT_decl_line(0x86) .dwattr $C$DW$1050, DW_AT_decl_column(0x15) $C$DW$1051 .dwtag DW_TAG_member .dwattr $C$DW$1051, DW_AT_type(*$C$DW$T$270) .dwattr $C$DW$1051, DW_AT_name("callback") .dwattr $C$DW$1051, DW_AT_TI_symbol_name("callback") .dwattr $C$DW$1051, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1051, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1051, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1051, DW_AT_decl_line(0x87) .dwattr $C$DW$1051, DW_AT_decl_column(0x0c) .dwattr $C$DW$T$276, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$276, DW_AT_decl_line(0x85) .dwattr $C$DW$T$276, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$276 $C$DW$T$541 .dwtag DW_TAG_typedef .dwattr $C$DW$T$541, DW_AT_name("SemaphoreP_Params") .dwattr $C$DW$T$541, DW_AT_type(*$C$DW$T$276) .dwattr $C$DW$T$541, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$541, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$541, DW_AT_decl_line(0x88) .dwattr $C$DW$T$541, DW_AT_decl_column(0x03) $C$DW$T$542 .dwtag DW_TAG_enumeration_type .dwattr $C$DW$T$542, DW_AT_name("SemaphoreP_Status") .dwattr $C$DW$T$542, DW_AT_byte_size(0x01) $C$DW$1052 .dwtag DW_TAG_enumerator .dwattr $C$DW$1052, DW_AT_name("SemaphoreP_OK") .dwattr $C$DW$1052, DW_AT_const_value(0x00) .dwattr $C$DW$1052, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1052, DW_AT_decl_line(0x66) .dwattr $C$DW$1052, DW_AT_decl_column(0x05) $C$DW$1053 .dwtag DW_TAG_enumerator .dwattr $C$DW$1053, DW_AT_name("SemaphoreP_TIMEOUT") .dwattr $C$DW$1053, DW_AT_const_value(-1) .dwattr $C$DW$1053, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1053, DW_AT_decl_line(0x68) .dwattr $C$DW$1053, DW_AT_decl_column(0x05) .dwattr $C$DW$T$542, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$542, DW_AT_decl_line(0x64) .dwattr $C$DW$T$542, DW_AT_decl_column(0x0e) .dwendtag $C$DW$T$542 $C$DW$T$543 .dwtag DW_TAG_typedef .dwattr $C$DW$T$543, DW_AT_name("SemaphoreP_Status") .dwattr $C$DW$T$543, DW_AT_type(*$C$DW$T$542) .dwattr $C$DW$T$543, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$543, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$543, DW_AT_decl_line(0x69) .dwattr $C$DW$T$543, DW_AT_decl_column(0x03) $C$DW$T$278 .dwtag DW_TAG_union_type .dwattr $C$DW$T$278, DW_AT_name("SemaphoreP_Struct") .dwattr $C$DW$T$278, DW_AT_byte_size(0x1c) $C$DW$1054 .dwtag DW_TAG_member .dwattr $C$DW$1054, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1054, DW_AT_name("dummy") .dwattr $C$DW$1054, DW_AT_TI_symbol_name("dummy") .dwattr $C$DW$1054, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1054, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1054, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1054, DW_AT_decl_line(0x53) .dwattr $C$DW$1054, DW_AT_decl_column(0x0e) $C$DW$1055 .dwtag DW_TAG_member .dwattr $C$DW$1055, DW_AT_type(*$C$DW$T$277) .dwattr $C$DW$1055, DW_AT_name("data") .dwattr $C$DW$1055, DW_AT_TI_symbol_name("data") .dwattr $C$DW$1055, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1055, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1055, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$1055, DW_AT_decl_line(0x54) .dwattr $C$DW$1055, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$278, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$278, DW_AT_decl_line(0x52) .dwattr $C$DW$T$278, DW_AT_decl_column(0x0f) .dwendtag $C$DW$T$278 $C$DW$T$544 .dwtag DW_TAG_typedef .dwattr $C$DW$T$544, DW_AT_name("SemaphoreP_Struct") .dwattr $C$DW$T$544, DW_AT_type(*$C$DW$T$278) .dwattr $C$DW$T$544, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$544, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$544, DW_AT_decl_line(0x55) .dwattr $C$DW$T$544, DW_AT_decl_column(0x03) $C$DW$T$280 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$280, DW_AT_name("SlEventsListNode_s") .dwattr $C$DW$T$280, DW_AT_byte_size(0x08) $C$DW$1056 .dwtag DW_TAG_member .dwattr $C$DW$1056, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$1056, DW_AT_name("event") .dwattr $C$DW$1056, DW_AT_TI_symbol_name("event") .dwattr $C$DW$1056, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1056, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1056, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$1056, DW_AT_decl_line(0x49) .dwattr $C$DW$1056, DW_AT_decl_column(0x0b) $C$DW$1057 .dwtag DW_TAG_member .dwattr $C$DW$1057, DW_AT_type(*$C$DW$T$279) .dwattr $C$DW$1057, DW_AT_name("next") .dwattr $C$DW$1057, DW_AT_TI_symbol_name("next") .dwattr $C$DW$1057, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1057, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1057, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$1057, DW_AT_decl_line(0x4a) .dwattr $C$DW$1057, DW_AT_decl_column(0x20) .dwattr $C$DW$T$280, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$T$280, DW_AT_decl_line(0x47) .dwattr $C$DW$T$280, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$280 $C$DW$T$545 .dwtag DW_TAG_typedef .dwattr $C$DW$T$545, DW_AT_name("SlEventsListNode_t") .dwattr $C$DW$T$545, DW_AT_type(*$C$DW$T$280) .dwattr $C$DW$T$545, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$545, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/eventreg.h") .dwattr $C$DW$T$545, DW_AT_decl_line(0x4b) .dwattr $C$DW$T$545, DW_AT_decl_column(0x02) $C$DW$T$279 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$279, DW_AT_type(*$C$DW$T$280) .dwattr $C$DW$T$279, DW_AT_address_class(0x20) $C$DW$T$282 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$282, DW_AT_name("SlFdSet_t") .dwattr $C$DW$T$282, DW_AT_byte_size(0x04) $C$DW$1058 .dwtag DW_TAG_member .dwattr $C$DW$1058, DW_AT_type(*$C$DW$T$281) .dwattr $C$DW$1058, DW_AT_name("fd_array") .dwattr $C$DW$1058, DW_AT_TI_symbol_name("fd_array") .dwattr $C$DW$1058, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1058, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1058, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1058, DW_AT_decl_line(0x1a3) .dwattr $C$DW$1058, DW_AT_decl_column(0x10) .dwattr $C$DW$T$282, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$282, DW_AT_decl_line(0x1a1) .dwattr $C$DW$T$282, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$282 $C$DW$T$546 .dwtag DW_TAG_typedef .dwattr $C$DW$T$546, DW_AT_name("SlFdSet_t") .dwattr $C$DW$T$546, DW_AT_type(*$C$DW$T$282) .dwattr $C$DW$T$546, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$546, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$546, DW_AT_decl_line(0x1a4) .dwattr $C$DW$T$546, DW_AT_decl_column(0x03) $C$DW$T$547 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$547, DW_AT_type(*$C$DW$T$546) .dwattr $C$DW$T$547, DW_AT_address_class(0x20) $C$DW$T$283 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$283, DW_AT_name("SlIn6Addr_t") .dwattr $C$DW$T$283, DW_AT_byte_size(0x10) $C$DW$1059 .dwtag DW_TAG_member .dwattr $C$DW$1059, DW_AT_type(*$C$DW$T$209) .dwattr $C$DW$1059, DW_AT_name("_S6_un") .dwattr $C$DW$1059, DW_AT_TI_symbol_name("_S6_un") .dwattr $C$DW$1059, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1059, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1059, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1059, DW_AT_decl_line(0xef) .dwattr $C$DW$1059, DW_AT_decl_column(0x07) .dwattr $C$DW$T$283, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$283, DW_AT_decl_line(0xe9) .dwattr $C$DW$T$283, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$283 $C$DW$T$66 .dwtag DW_TAG_typedef .dwattr $C$DW$T$66, DW_AT_name("SlIn6Addr_t") .dwattr $C$DW$T$66, DW_AT_type(*$C$DW$T$283) .dwattr $C$DW$T$66, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$66, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$66, DW_AT_decl_line(0xf0) .dwattr $C$DW$T$66, DW_AT_decl_column(0x02) $C$DW$T$284 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$284, DW_AT_name("SlInAddr_t") .dwattr $C$DW$T$284, DW_AT_byte_size(0x04) $C$DW$1060 .dwtag DW_TAG_member .dwattr $C$DW$1060, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$1060, DW_AT_name("s_addr") .dwattr $C$DW$1060, DW_AT_TI_symbol_name("s_addr") .dwattr $C$DW$1060, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1060, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1060, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1060, DW_AT_decl_line(0xde) .dwattr $C$DW$1060, DW_AT_decl_column(0x14) .dwattr $C$DW$T$284, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$284, DW_AT_decl_line(0xdb) .dwattr $C$DW$T$284, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$284 $C$DW$T$64 .dwtag DW_TAG_typedef .dwattr $C$DW$T$64, DW_AT_name("SlInAddr_t") .dwattr $C$DW$T$64, DW_AT_type(*$C$DW$T$284) .dwattr $C$DW$T$64, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$64, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$64, DW_AT_decl_line(0xe6) .dwattr $C$DW$T$64, DW_AT_decl_column(0x02) $C$DW$T$354 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$354, DW_AT_name("SlNetIf_Config_t") .dwattr $C$DW$T$354, DW_AT_byte_size(0x58) $C$DW$1061 .dwtag DW_TAG_member .dwattr $C$DW$1061, DW_AT_type(*$C$DW$T$288) .dwattr $C$DW$1061, DW_AT_name("sockCreate") .dwattr $C$DW$1061, DW_AT_TI_symbol_name("sockCreate") .dwattr $C$DW$1061, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1061, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1061, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1061, DW_AT_decl_line(0x9d) .dwattr $C$DW$1061, DW_AT_decl_column(0x0f) $C$DW$1062 .dwtag DW_TAG_member .dwattr $C$DW$1062, DW_AT_type(*$C$DW$T$291) .dwattr $C$DW$1062, DW_AT_name("sockClose") .dwattr $C$DW$1062, DW_AT_TI_symbol_name("sockClose") .dwattr $C$DW$1062, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1062, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1062, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1062, DW_AT_decl_line(0x9e) .dwattr $C$DW$1062, DW_AT_decl_column(0x0f) $C$DW$1063 .dwtag DW_TAG_member .dwattr $C$DW$1063, DW_AT_type(*$C$DW$T$293) .dwattr $C$DW$1063, DW_AT_name("sockShutdown") .dwattr $C$DW$1063, DW_AT_TI_symbol_name("sockShutdown") .dwattr $C$DW$1063, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1063, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1063, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1063, DW_AT_decl_line(0x9f) .dwattr $C$DW$1063, DW_AT_decl_column(0x0f) $C$DW$1064 .dwtag DW_TAG_member .dwattr $C$DW$1064, DW_AT_type(*$C$DW$T$299) .dwattr $C$DW$1064, DW_AT_name("sockAccept") .dwattr $C$DW$1064, DW_AT_TI_symbol_name("sockAccept") .dwattr $C$DW$1064, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$1064, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1064, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1064, DW_AT_decl_line(0xa0) .dwattr $C$DW$1064, DW_AT_decl_column(0x0f) $C$DW$1065 .dwtag DW_TAG_member .dwattr $C$DW$1065, DW_AT_type(*$C$DW$T$303) .dwattr $C$DW$1065, DW_AT_name("sockBind") .dwattr $C$DW$1065, DW_AT_TI_symbol_name("sockBind") .dwattr $C$DW$1065, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$1065, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1065, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1065, DW_AT_decl_line(0xa1) .dwattr $C$DW$1065, DW_AT_decl_column(0x0f) $C$DW$1066 .dwtag DW_TAG_member .dwattr $C$DW$1066, DW_AT_type(*$C$DW$T$293) .dwattr $C$DW$1066, DW_AT_name("sockListen") .dwattr $C$DW$1066, DW_AT_TI_symbol_name("sockListen") .dwattr $C$DW$1066, DW_AT_data_member_location[DW_OP_plus_uconst 0x14] .dwattr $C$DW$1066, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1066, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1066, DW_AT_decl_line(0xa2) .dwattr $C$DW$1066, DW_AT_decl_column(0x0f) $C$DW$1067 .dwtag DW_TAG_member .dwattr $C$DW$1067, DW_AT_type(*$C$DW$T$305) .dwattr $C$DW$1067, DW_AT_name("sockConnect") .dwattr $C$DW$1067, DW_AT_TI_symbol_name("sockConnect") .dwattr $C$DW$1067, DW_AT_data_member_location[DW_OP_plus_uconst 0x18] .dwattr $C$DW$1067, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1067, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1067, DW_AT_decl_line(0xa3) .dwattr $C$DW$1067, DW_AT_decl_column(0x0f) $C$DW$1068 .dwtag DW_TAG_member .dwattr $C$DW$1068, DW_AT_type(*$C$DW$T$307) .dwattr $C$DW$1068, DW_AT_name("sockGetPeerName") .dwattr $C$DW$1068, DW_AT_TI_symbol_name("sockGetPeerName") .dwattr $C$DW$1068, DW_AT_data_member_location[DW_OP_plus_uconst 0x1c] .dwattr $C$DW$1068, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1068, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1068, DW_AT_decl_line(0xa4) .dwattr $C$DW$1068, DW_AT_decl_column(0x0f) $C$DW$1069 .dwtag DW_TAG_member .dwattr $C$DW$1069, DW_AT_type(*$C$DW$T$307) .dwattr $C$DW$1069, DW_AT_name("sockGetLocalName") .dwattr $C$DW$1069, DW_AT_TI_symbol_name("sockGetLocalName") .dwattr $C$DW$1069, DW_AT_data_member_location[DW_OP_plus_uconst 0x20] .dwattr $C$DW$1069, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1069, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1069, DW_AT_decl_line(0xa5) .dwattr $C$DW$1069, DW_AT_decl_column(0x0f) $C$DW$1070 .dwtag DW_TAG_member .dwattr $C$DW$1070, DW_AT_type(*$C$DW$T$313) .dwattr $C$DW$1070, DW_AT_name("sockSelect") .dwattr $C$DW$1070, DW_AT_TI_symbol_name("sockSelect") .dwattr $C$DW$1070, DW_AT_data_member_location[DW_OP_plus_uconst 0x24] .dwattr $C$DW$1070, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1070, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1070, DW_AT_decl_line(0xa6) .dwattr $C$DW$1070, DW_AT_decl_column(0x0f) $C$DW$1071 .dwtag DW_TAG_member .dwattr $C$DW$1071, DW_AT_type(*$C$DW$T$315) .dwattr $C$DW$1071, DW_AT_name("sockSetOpt") .dwattr $C$DW$1071, DW_AT_TI_symbol_name("sockSetOpt") .dwattr $C$DW$1071, DW_AT_data_member_location[DW_OP_plus_uconst 0x28] .dwattr $C$DW$1071, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1071, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1071, DW_AT_decl_line(0xa7) .dwattr $C$DW$1071, DW_AT_decl_column(0x0f) $C$DW$1072 .dwtag DW_TAG_member .dwattr $C$DW$1072, DW_AT_type(*$C$DW$T$317) .dwattr $C$DW$1072, DW_AT_name("sockGetOpt") .dwattr $C$DW$1072, DW_AT_TI_symbol_name("sockGetOpt") .dwattr $C$DW$1072, DW_AT_data_member_location[DW_OP_plus_uconst 0x2c] .dwattr $C$DW$1072, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1072, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1072, DW_AT_decl_line(0xa8) .dwattr $C$DW$1072, DW_AT_decl_column(0x0f) $C$DW$1073 .dwtag DW_TAG_member .dwattr $C$DW$1073, DW_AT_type(*$C$DW$T$319) .dwattr $C$DW$1073, DW_AT_name("sockRecv") .dwattr $C$DW$1073, DW_AT_TI_symbol_name("sockRecv") .dwattr $C$DW$1073, DW_AT_data_member_location[DW_OP_plus_uconst 0x30] .dwattr $C$DW$1073, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1073, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1073, DW_AT_decl_line(0xa9) .dwattr $C$DW$1073, DW_AT_decl_column(0x0f) $C$DW$1074 .dwtag DW_TAG_member .dwattr $C$DW$1074, DW_AT_type(*$C$DW$T$321) .dwattr $C$DW$1074, DW_AT_name("sockRecvFrom") .dwattr $C$DW$1074, DW_AT_TI_symbol_name("sockRecvFrom") .dwattr $C$DW$1074, DW_AT_data_member_location[DW_OP_plus_uconst 0x34] .dwattr $C$DW$1074, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1074, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1074, DW_AT_decl_line(0xaa) .dwattr $C$DW$1074, DW_AT_decl_column(0x0f) $C$DW$1075 .dwtag DW_TAG_member .dwattr $C$DW$1075, DW_AT_type(*$C$DW$T$325) .dwattr $C$DW$1075, DW_AT_name("sockSend") .dwattr $C$DW$1075, DW_AT_TI_symbol_name("sockSend") .dwattr $C$DW$1075, DW_AT_data_member_location[DW_OP_plus_uconst 0x38] .dwattr $C$DW$1075, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1075, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1075, DW_AT_decl_line(0xab) .dwattr $C$DW$1075, DW_AT_decl_column(0x0f) $C$DW$1076 .dwtag DW_TAG_member .dwattr $C$DW$1076, DW_AT_type(*$C$DW$T$327) .dwattr $C$DW$1076, DW_AT_name("sockSendTo") .dwattr $C$DW$1076, DW_AT_TI_symbol_name("sockSendTo") .dwattr $C$DW$1076, DW_AT_data_member_location[DW_OP_plus_uconst 0x3c] .dwattr $C$DW$1076, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1076, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1076, DW_AT_decl_line(0xac) .dwattr $C$DW$1076, DW_AT_decl_column(0x0f) $C$DW$1077 .dwtag DW_TAG_member .dwattr $C$DW$1077, DW_AT_type(*$C$DW$T$333) .dwattr $C$DW$1077, DW_AT_name("sockstartSec") .dwattr $C$DW$1077, DW_AT_TI_symbol_name("sockstartSec") .dwattr $C$DW$1077, DW_AT_data_member_location[DW_OP_plus_uconst 0x40] .dwattr $C$DW$1077, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1077, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1077, DW_AT_decl_line(0xad) .dwattr $C$DW$1077, DW_AT_decl_column(0x0f) $C$DW$1078 .dwtag DW_TAG_member .dwattr $C$DW$1078, DW_AT_type(*$C$DW$T$340) .dwattr $C$DW$1078, DW_AT_name("utilGetHostByName") .dwattr $C$DW$1078, DW_AT_TI_symbol_name("utilGetHostByName") .dwattr $C$DW$1078, DW_AT_data_member_location[DW_OP_plus_uconst 0x44] .dwattr $C$DW$1078, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1078, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1078, DW_AT_decl_line(0xb0) .dwattr $C$DW$1078, DW_AT_decl_column(0x0f) $C$DW$1079 .dwtag DW_TAG_member .dwattr $C$DW$1079, DW_AT_type(*$C$DW$T$344) .dwattr $C$DW$1079, DW_AT_name("ifGetIPAddr") .dwattr $C$DW$1079, DW_AT_TI_symbol_name("ifGetIPAddr") .dwattr $C$DW$1079, DW_AT_data_member_location[DW_OP_plus_uconst 0x48] .dwattr $C$DW$1079, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1079, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1079, DW_AT_decl_line(0xb3) .dwattr $C$DW$1079, DW_AT_decl_column(0x0f) $C$DW$1080 .dwtag DW_TAG_member .dwattr $C$DW$1080, DW_AT_type(*$C$DW$T$346) .dwattr $C$DW$1080, DW_AT_name("ifGetConnectionStatus") .dwattr $C$DW$1080, DW_AT_TI_symbol_name("ifGetConnectionStatus") .dwattr $C$DW$1080, DW_AT_data_member_location[DW_OP_plus_uconst 0x4c] .dwattr $C$DW$1080, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1080, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1080, DW_AT_decl_line(0xb4) .dwattr $C$DW$1080, DW_AT_decl_column(0x0f) $C$DW$1081 .dwtag DW_TAG_member .dwattr $C$DW$1081, DW_AT_type(*$C$DW$T$349) .dwattr $C$DW$1081, DW_AT_name("ifLoadSecObj") .dwattr $C$DW$1081, DW_AT_TI_symbol_name("ifLoadSecObj") .dwattr $C$DW$1081, DW_AT_data_member_location[DW_OP_plus_uconst 0x50] .dwattr $C$DW$1081, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1081, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1081, DW_AT_decl_line(0xb5) .dwattr $C$DW$1081, DW_AT_decl_column(0x0f) $C$DW$1082 .dwtag DW_TAG_member .dwattr $C$DW$1082, DW_AT_type(*$C$DW$T$353) .dwattr $C$DW$1082, DW_AT_name("ifCreateContext") .dwattr $C$DW$1082, DW_AT_TI_symbol_name("ifCreateContext") .dwattr $C$DW$1082, DW_AT_data_member_location[DW_OP_plus_uconst 0x54] .dwattr $C$DW$1082, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1082, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1082, DW_AT_decl_line(0xb6) .dwattr $C$DW$1082, DW_AT_decl_column(0x0f) .dwattr $C$DW$T$354, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$354, DW_AT_decl_line(0x9a) .dwattr $C$DW$T$354, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$354 $C$DW$T$355 .dwtag DW_TAG_typedef .dwattr $C$DW$T$355, DW_AT_name("SlNetIf_Config_t") .dwattr $C$DW$T$355, DW_AT_type(*$C$DW$T$354) .dwattr $C$DW$T$355, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$355, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$355, DW_AT_decl_line(0xb8) .dwattr $C$DW$T$355, DW_AT_decl_column(0x03) $C$DW$T$356 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$356, DW_AT_type(*$C$DW$T$355) .dwattr $C$DW$T$356, DW_AT_address_class(0x20) $C$DW$T$357 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$357, DW_AT_name("SlNetIf_t") .dwattr $C$DW$T$357, DW_AT_byte_size(0x14) $C$DW$1083 .dwtag DW_TAG_member .dwattr $C$DW$1083, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1083, DW_AT_name("ifID") .dwattr $C$DW$1083, DW_AT_TI_symbol_name("ifID") .dwattr $C$DW$1083, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1083, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1083, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1083, DW_AT_decl_line(0xc1) .dwattr $C$DW$1083, DW_AT_decl_column(0x17) $C$DW$1084 .dwtag DW_TAG_member .dwattr $C$DW$1084, DW_AT_type(*$C$DW$T$334) .dwattr $C$DW$1084, DW_AT_name("ifName") .dwattr $C$DW$1084, DW_AT_TI_symbol_name("ifName") .dwattr $C$DW$1084, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1084, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1084, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1084, DW_AT_decl_line(0xc2) .dwattr $C$DW$1084, DW_AT_decl_column(0x17) $C$DW$1085 .dwtag DW_TAG_member .dwattr $C$DW$1085, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$1085, DW_AT_name("flags") .dwattr $C$DW$1085, DW_AT_TI_symbol_name("flags") .dwattr $C$DW$1085, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1085, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1085, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1085, DW_AT_decl_line(0xc3) .dwattr $C$DW$1085, DW_AT_decl_column(0x17) $C$DW$1086 .dwtag DW_TAG_member .dwattr $C$DW$1086, DW_AT_type(*$C$DW$T$356) .dwattr $C$DW$1086, DW_AT_name("ifConf") .dwattr $C$DW$1086, DW_AT_TI_symbol_name("ifConf") .dwattr $C$DW$1086, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$1086, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1086, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1086, DW_AT_decl_line(0xc4) .dwattr $C$DW$1086, DW_AT_decl_column(0x17) $C$DW$1087 .dwtag DW_TAG_member .dwattr $C$DW$1087, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$1087, DW_AT_name("ifContext") .dwattr $C$DW$1087, DW_AT_TI_symbol_name("ifContext") .dwattr $C$DW$1087, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$1087, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1087, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$1087, DW_AT_decl_line(0xc5) .dwattr $C$DW$1087, DW_AT_decl_column(0x17) .dwattr $C$DW$T$357, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$357, DW_AT_decl_line(0xbf) .dwattr $C$DW$T$357, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$357 $C$DW$T$548 .dwtag DW_TAG_typedef .dwattr $C$DW$T$548, DW_AT_name("SlNetIf_t") .dwattr $C$DW$T$548, DW_AT_type(*$C$DW$T$357) .dwattr $C$DW$T$548, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$548, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetif.h") .dwattr $C$DW$T$548, DW_AT_decl_line(0xc6) .dwattr $C$DW$T$548, DW_AT_decl_column(0x03) $C$DW$T$359 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$359, DW_AT_name("SlNetSock_AddrIn6_t") .dwattr $C$DW$T$359, DW_AT_byte_size(0x1c) $C$DW$1088 .dwtag DW_TAG_member .dwattr $C$DW$1088, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$1088, DW_AT_name("sin6_family") .dwattr $C$DW$1088, DW_AT_TI_symbol_name("sin6_family") .dwattr $C$DW$1088, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1088, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1088, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1088, DW_AT_decl_line(0x256) .dwattr $C$DW$1088, DW_AT_decl_column(0x19) $C$DW$1089 .dwtag DW_TAG_member .dwattr $C$DW$1089, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$1089, DW_AT_name("sin6_port") .dwattr $C$DW$1089, DW_AT_TI_symbol_name("sin6_port") .dwattr $C$DW$1089, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$1089, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1089, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1089, DW_AT_decl_line(0x257) .dwattr $C$DW$1089, DW_AT_decl_column(0x19) $C$DW$1090 .dwtag DW_TAG_member .dwattr $C$DW$1090, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1090, DW_AT_name("sin6_flowinfo") .dwattr $C$DW$1090, DW_AT_TI_symbol_name("sin6_flowinfo") .dwattr $C$DW$1090, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1090, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1090, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1090, DW_AT_decl_line(0x258) .dwattr $C$DW$1090, DW_AT_decl_column(0x19) $C$DW$1091 .dwtag DW_TAG_member .dwattr $C$DW$1091, DW_AT_type(*$C$DW$T$358) .dwattr $C$DW$1091, DW_AT_name("sin6_addr") .dwattr $C$DW$1091, DW_AT_TI_symbol_name("sin6_addr") .dwattr $C$DW$1091, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1091, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1091, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1091, DW_AT_decl_line(0x259) .dwattr $C$DW$1091, DW_AT_decl_column(0x19) $C$DW$1092 .dwtag DW_TAG_member .dwattr $C$DW$1092, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1092, DW_AT_name("sin6_scope_id") .dwattr $C$DW$1092, DW_AT_TI_symbol_name("sin6_scope_id") .dwattr $C$DW$1092, DW_AT_data_member_location[DW_OP_plus_uconst 0x18] .dwattr $C$DW$1092, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1092, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1092, DW_AT_decl_line(0x25a) .dwattr $C$DW$1092, DW_AT_decl_column(0x19) .dwattr $C$DW$T$359, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$359, DW_AT_decl_line(0x254) .dwattr $C$DW$T$359, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$359 $C$DW$T$549 .dwtag DW_TAG_typedef .dwattr $C$DW$T$549, DW_AT_name("SlNetSock_AddrIn6_t") .dwattr $C$DW$T$549, DW_AT_type(*$C$DW$T$359) .dwattr $C$DW$T$549, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$549, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$549, DW_AT_decl_line(0x25b) .dwattr $C$DW$T$549, DW_AT_decl_column(0x03) $C$DW$T$363 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$363, DW_AT_name("SlNetSock_AddrIn_t") .dwattr $C$DW$T$363, DW_AT_byte_size(0x10) $C$DW$1093 .dwtag DW_TAG_member .dwattr $C$DW$1093, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$1093, DW_AT_name("sin_family") .dwattr $C$DW$1093, DW_AT_TI_symbol_name("sin_family") .dwattr $C$DW$1093, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1093, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1093, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1093, DW_AT_decl_line(0x262) .dwattr $C$DW$1093, DW_AT_decl_column(0x18) $C$DW$1094 .dwtag DW_TAG_member .dwattr $C$DW$1094, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$1094, DW_AT_name("sin_port") .dwattr $C$DW$1094, DW_AT_TI_symbol_name("sin_port") .dwattr $C$DW$1094, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$1094, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1094, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1094, DW_AT_decl_line(0x263) .dwattr $C$DW$1094, DW_AT_decl_column(0x18) $C$DW$1095 .dwtag DW_TAG_member .dwattr $C$DW$1095, DW_AT_type(*$C$DW$T$360) .dwattr $C$DW$1095, DW_AT_name("sin_addr") .dwattr $C$DW$1095, DW_AT_TI_symbol_name("sin_addr") .dwattr $C$DW$1095, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1095, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1095, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1095, DW_AT_decl_line(0x264) .dwattr $C$DW$1095, DW_AT_decl_column(0x18) $C$DW$1096 .dwtag DW_TAG_member .dwattr $C$DW$1096, DW_AT_type(*$C$DW$T$362) .dwattr $C$DW$1096, DW_AT_name("sin_zero") .dwattr $C$DW$1096, DW_AT_TI_symbol_name("sin_zero") .dwattr $C$DW$1096, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1096, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1096, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1096, DW_AT_decl_line(0x265) .dwattr $C$DW$1096, DW_AT_decl_column(0x18) .dwattr $C$DW$T$363, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$363, DW_AT_decl_line(0x260) .dwattr $C$DW$T$363, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$363 $C$DW$T$550 .dwtag DW_TAG_typedef .dwattr $C$DW$T$550, DW_AT_name("SlNetSock_AddrIn_t") .dwattr $C$DW$T$550, DW_AT_type(*$C$DW$T$363) .dwattr $C$DW$T$550, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$550, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$550, DW_AT_decl_line(0x266) .dwattr $C$DW$T$550, DW_AT_decl_column(0x03) $C$DW$T$365 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$365, DW_AT_name("SlNetSock_Addr_t") .dwattr $C$DW$T$365, DW_AT_byte_size(0x10) $C$DW$1097 .dwtag DW_TAG_member .dwattr $C$DW$1097, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$1097, DW_AT_name("sa_family") .dwattr $C$DW$1097, DW_AT_TI_symbol_name("sa_family") .dwattr $C$DW$1097, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1097, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1097, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1097, DW_AT_decl_line(0x24d) .dwattr $C$DW$1097, DW_AT_decl_column(0x0e) $C$DW$1098 .dwtag DW_TAG_member .dwattr $C$DW$1098, DW_AT_type(*$C$DW$T$364) .dwattr $C$DW$1098, DW_AT_name("sa_data") .dwattr $C$DW$1098, DW_AT_TI_symbol_name("sa_data") .dwattr $C$DW$1098, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$1098, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1098, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1098, DW_AT_decl_line(0x24e) .dwattr $C$DW$1098, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$365, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$365, DW_AT_decl_line(0x24b) .dwattr $C$DW$T$365, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$365 $C$DW$T$294 .dwtag DW_TAG_typedef .dwattr $C$DW$T$294, DW_AT_name("SlNetSock_Addr_t") .dwattr $C$DW$T$294, DW_AT_type(*$C$DW$T$365) .dwattr $C$DW$T$294, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$294, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$294, DW_AT_decl_line(0x24f) .dwattr $C$DW$T$294, DW_AT_decl_column(0x03) $C$DW$T$300 .dwtag DW_TAG_const_type .dwattr $C$DW$T$300, DW_AT_type(*$C$DW$T$294) $C$DW$T$301 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$301, DW_AT_type(*$C$DW$T$300) .dwattr $C$DW$T$301, DW_AT_address_class(0x20) $C$DW$T$295 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$295, DW_AT_type(*$C$DW$T$294) .dwattr $C$DW$T$295, DW_AT_address_class(0x20) $C$DW$T$366 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$366, DW_AT_name("SlNetSock_In6Addr_t") .dwattr $C$DW$T$366, DW_AT_byte_size(0x10) $C$DW$1099 .dwtag DW_TAG_member .dwattr $C$DW$1099, DW_AT_type(*$C$DW$T$206) .dwattr $C$DW$1099, DW_AT_name("_S6_un") .dwattr $C$DW$1099, DW_AT_TI_symbol_name("_S6_un") .dwattr $C$DW$1099, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1099, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1099, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1099, DW_AT_decl_line(0x1cb) .dwattr $C$DW$1099, DW_AT_decl_column(0x07) .dwattr $C$DW$T$366, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$366, DW_AT_decl_line(0x1c4) .dwattr $C$DW$T$366, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$366 $C$DW$T$358 .dwtag DW_TAG_typedef .dwattr $C$DW$T$358, DW_AT_name("SlNetSock_In6Addr_t") .dwattr $C$DW$T$358, DW_AT_type(*$C$DW$T$366) .dwattr $C$DW$T$358, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$358, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$358, DW_AT_decl_line(0x1cc) .dwattr $C$DW$T$358, DW_AT_decl_column(0x03) $C$DW$T$367 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$367, DW_AT_name("SlNetSock_InAddr_t") .dwattr $C$DW$T$367, DW_AT_byte_size(0x04) $C$DW$1100 .dwtag DW_TAG_member .dwattr $C$DW$1100, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1100, DW_AT_name("s_addr") .dwattr $C$DW$1100, DW_AT_TI_symbol_name("s_addr") .dwattr $C$DW$1100, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1100, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1100, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1100, DW_AT_decl_line(0x1ad) .dwattr $C$DW$1100, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$367, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$367, DW_AT_decl_line(0x1aa) .dwattr $C$DW$T$367, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$367 $C$DW$T$360 .dwtag DW_TAG_typedef .dwattr $C$DW$T$360, DW_AT_name("SlNetSock_InAddr_t") .dwattr $C$DW$T$360, DW_AT_type(*$C$DW$T$367) .dwattr $C$DW$T$360, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$360, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$360, DW_AT_decl_line(0x1bf) .dwattr $C$DW$T$360, DW_AT_decl_column(0x03) $C$DW$T$368 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$368, DW_AT_name("SlNetSock_IpMreq_t") .dwattr $C$DW$T$368, DW_AT_byte_size(0x08) $C$DW$1101 .dwtag DW_TAG_member .dwattr $C$DW$1101, DW_AT_type(*$C$DW$T$360) .dwattr $C$DW$1101, DW_AT_name("imr_multiaddr") .dwattr $C$DW$1101, DW_AT_TI_symbol_name("imr_multiaddr") .dwattr $C$DW$1101, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1101, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1101, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1101, DW_AT_decl_line(0x21b) .dwattr $C$DW$1101, DW_AT_decl_column(0x18) $C$DW$1102 .dwtag DW_TAG_member .dwattr $C$DW$1102, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1102, DW_AT_name("imr_interface") .dwattr $C$DW$1102, DW_AT_TI_symbol_name("imr_interface") .dwattr $C$DW$1102, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1102, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1102, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1102, DW_AT_decl_line(0x21c) .dwattr $C$DW$1102, DW_AT_decl_column(0x18) .dwattr $C$DW$T$368, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$368, DW_AT_decl_line(0x219) .dwattr $C$DW$T$368, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$368 $C$DW$T$551 .dwtag DW_TAG_typedef .dwattr $C$DW$T$551, DW_AT_name("SlNetSock_IpMreq_t") .dwattr $C$DW$T$551, DW_AT_type(*$C$DW$T$368) .dwattr $C$DW$T$551, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$551, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$551, DW_AT_decl_line(0x21d) .dwattr $C$DW$T$551, DW_AT_decl_column(0x03) $C$DW$T$369 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$369, DW_AT_name("SlNetSock_IpV6Mreq_t") .dwattr $C$DW$T$369, DW_AT_byte_size(0x14) $C$DW$1103 .dwtag DW_TAG_member .dwattr $C$DW$1103, DW_AT_type(*$C$DW$T$358) .dwattr $C$DW$1103, DW_AT_name("ipv6mr_multiaddr") .dwattr $C$DW$1103, DW_AT_TI_symbol_name("ipv6mr_multiaddr") .dwattr $C$DW$1103, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1103, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1103, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1103, DW_AT_decl_line(0x224) .dwattr $C$DW$1103, DW_AT_decl_column(0x19) $C$DW$1104 .dwtag DW_TAG_member .dwattr $C$DW$1104, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1104, DW_AT_name("ipv6mr_interface") .dwattr $C$DW$1104, DW_AT_TI_symbol_name("ipv6mr_interface") .dwattr $C$DW$1104, DW_AT_data_member_location[DW_OP_plus_uconst 0x10] .dwattr $C$DW$1104, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1104, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1104, DW_AT_decl_line(0x225) .dwattr $C$DW$1104, DW_AT_decl_column(0x19) .dwattr $C$DW$T$369, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$369, DW_AT_decl_line(0x222) .dwattr $C$DW$T$369, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$369 $C$DW$T$552 .dwtag DW_TAG_typedef .dwattr $C$DW$T$552, DW_AT_name("SlNetSock_IpV6Mreq_t") .dwattr $C$DW$T$552, DW_AT_type(*$C$DW$T$369) .dwattr $C$DW$T$552, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$552, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$552, DW_AT_decl_line(0x226) .dwattr $C$DW$T$552, DW_AT_decl_column(0x03) $C$DW$T$370 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$370, DW_AT_name("SlNetSock_Keepalive_t") .dwattr $C$DW$T$370, DW_AT_byte_size(0x04) $C$DW$1105 .dwtag DW_TAG_member .dwattr $C$DW$1105, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1105, DW_AT_name("keepaliveEnabled") .dwattr $C$DW$1105, DW_AT_TI_symbol_name("keepaliveEnabled") .dwattr $C$DW$1105, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1105, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1105, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1105, DW_AT_decl_line(0x1d3) .dwattr $C$DW$1105, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$370, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$370, DW_AT_decl_line(0x1d1) .dwattr $C$DW$T$370, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$370 $C$DW$T$553 .dwtag DW_TAG_typedef .dwattr $C$DW$T$553, DW_AT_name("SlNetSock_Keepalive_t") .dwattr $C$DW$T$553, DW_AT_type(*$C$DW$T$370) .dwattr $C$DW$T$553, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$553, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$553, DW_AT_decl_line(0x1d4) .dwattr $C$DW$T$553, DW_AT_decl_column(0x03) $C$DW$T$371 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$371, DW_AT_name("SlNetSock_NonIpBoundary_t") .dwattr $C$DW$T$371, DW_AT_byte_size(0x04) $C$DW$1106 .dwtag DW_TAG_member .dwattr $C$DW$1106, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$1106, DW_AT_name("nonIpBoundaryEnabled") .dwattr $C$DW$1106, DW_AT_TI_symbol_name("nonIpBoundaryEnabled") .dwattr $C$DW$1106, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1106, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1106, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1106, DW_AT_decl_line(0x1db) .dwattr $C$DW$1106, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$371, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$371, DW_AT_decl_line(0x1d9) .dwattr $C$DW$T$371, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$371 $C$DW$T$554 .dwtag DW_TAG_typedef .dwattr $C$DW$T$554, DW_AT_name("SlNetSock_NonIpBoundary_t") .dwattr $C$DW$T$554, DW_AT_type(*$C$DW$T$371) .dwattr $C$DW$T$554, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$554, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$554, DW_AT_decl_line(0x1dc) .dwattr $C$DW$T$554, DW_AT_decl_column(0x03) $C$DW$T$372 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$372, DW_AT_name("SlNetSock_Nonblocking_t") .dwattr $C$DW$T$372, DW_AT_byte_size(0x04) $C$DW$1107 .dwtag DW_TAG_member .dwattr $C$DW$1107, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1107, DW_AT_name("nonBlockingEnabled") .dwattr $C$DW$1107, DW_AT_TI_symbol_name("nonBlockingEnabled") .dwattr $C$DW$1107, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1107, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1107, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1107, DW_AT_decl_line(0x1eb) .dwattr $C$DW$1107, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$372, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$372, DW_AT_decl_line(0x1e9) .dwattr $C$DW$T$372, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$372 $C$DW$T$555 .dwtag DW_TAG_typedef .dwattr $C$DW$T$555, DW_AT_name("SlNetSock_Nonblocking_t") .dwattr $C$DW$T$555, DW_AT_type(*$C$DW$T$372) .dwattr $C$DW$T$555, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$555, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$555, DW_AT_decl_line(0x1ec) .dwattr $C$DW$T$555, DW_AT_decl_column(0x03) $C$DW$T$374 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$374, DW_AT_name("SlNetSock_SdSet_t") .dwattr $C$DW$T$374, DW_AT_byte_size(0x04) $C$DW$1108 .dwtag DW_TAG_member .dwattr $C$DW$1108, DW_AT_type(*$C$DW$T$373) .dwattr $C$DW$1108, DW_AT_name("sdSetBitmap") .dwattr $C$DW$1108, DW_AT_TI_symbol_name("sdSetBitmap") .dwattr $C$DW$1108, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1108, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1108, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1108, DW_AT_decl_line(0x26d) .dwattr $C$DW$1108, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$374, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$374, DW_AT_decl_line(0x26b) .dwattr $C$DW$T$374, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$374 $C$DW$T$308 .dwtag DW_TAG_typedef .dwattr $C$DW$T$308, DW_AT_name("SlNetSock_SdSet_t") .dwattr $C$DW$T$308, DW_AT_type(*$C$DW$T$374) .dwattr $C$DW$T$308, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$308, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$308, DW_AT_decl_line(0x26e) .dwattr $C$DW$T$308, DW_AT_decl_column(0x03) $C$DW$T$309 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$309, DW_AT_type(*$C$DW$T$308) .dwattr $C$DW$T$309, DW_AT_address_class(0x20) $C$DW$T$378 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$378, DW_AT_name("SlNetSock_SecAttribNode_t") .dwattr $C$DW$T$378, DW_AT_byte_size(0x10) $C$DW$1109 .dwtag DW_TAG_member .dwattr $C$DW$1109, DW_AT_type(*$C$DW$T$376) .dwattr $C$DW$1109, DW_AT_name("attribName") .dwattr $C$DW$1109, DW_AT_TI_symbol_name("attribName") .dwattr $C$DW$1109, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1109, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1109, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1109, DW_AT_decl_line(0x1f3) .dwattr $C$DW$1109, DW_AT_decl_column(0x27) $C$DW$1110 .dwtag DW_TAG_member .dwattr $C$DW$1110, DW_AT_type(*$C$DW$T$347) .dwattr $C$DW$1110, DW_AT_name("attribBuff") .dwattr $C$DW$1110, DW_AT_TI_symbol_name("attribBuff") .dwattr $C$DW$1110, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1110, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1110, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1110, DW_AT_decl_line(0x1f4) .dwattr $C$DW$1110, DW_AT_decl_column(0x27) $C$DW$1111 .dwtag DW_TAG_member .dwattr $C$DW$1111, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$1111, DW_AT_name("attribBuffLen") .dwattr $C$DW$1111, DW_AT_TI_symbol_name("attribBuffLen") .dwattr $C$DW$1111, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1111, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1111, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1111, DW_AT_decl_line(0x1f5) .dwattr $C$DW$1111, DW_AT_decl_column(0x27) $C$DW$1112 .dwtag DW_TAG_member .dwattr $C$DW$1112, DW_AT_type(*$C$DW$T$377) .dwattr $C$DW$1112, DW_AT_name("next") .dwattr $C$DW$1112, DW_AT_TI_symbol_name("next") .dwattr $C$DW$1112, DW_AT_data_member_location[DW_OP_plus_uconst 0xc] .dwattr $C$DW$1112, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1112, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1112, DW_AT_decl_line(0x1f6) .dwattr $C$DW$1112, DW_AT_decl_column(0x27) .dwattr $C$DW$T$378, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$378, DW_AT_decl_line(0x1f1) .dwattr $C$DW$T$378, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$378 $C$DW$T$328 .dwtag DW_TAG_typedef .dwattr $C$DW$T$328, DW_AT_name("SlNetSock_SecAttribNode_t") .dwattr $C$DW$T$328, DW_AT_type(*$C$DW$T$378) .dwattr $C$DW$T$328, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$328, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$328, DW_AT_decl_line(0x1f7) .dwattr $C$DW$T$328, DW_AT_decl_column(0x03) $C$DW$T$329 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$329, DW_AT_type(*$C$DW$T$328) .dwattr $C$DW$T$329, DW_AT_address_class(0x20) $C$DW$T$330 .dwtag DW_TAG_typedef .dwattr $C$DW$T$330, DW_AT_name("SlNetSockSecAttrib_t") .dwattr $C$DW$T$330, DW_AT_type(*$C$DW$T$329) .dwattr $C$DW$T$330, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$330, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$330, DW_AT_decl_line(0x1fc) .dwattr $C$DW$T$330, DW_AT_decl_column(0x25) $C$DW$T$331 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$331, DW_AT_type(*$C$DW$T$330) .dwattr $C$DW$T$331, DW_AT_address_class(0x20) $C$DW$T$377 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$377, DW_AT_type(*$C$DW$T$378) .dwattr $C$DW$T$377, DW_AT_address_class(0x20) $C$DW$T$379 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$379, DW_AT_name("SlNetSock_SecureALPN_t") .dwattr $C$DW$T$379, DW_AT_byte_size(0x04) $C$DW$1113 .dwtag DW_TAG_member .dwattr $C$DW$1113, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1113, DW_AT_name("secureALPN") .dwattr $C$DW$1113, DW_AT_TI_symbol_name("secureALPN") .dwattr $C$DW$1113, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1113, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1113, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1113, DW_AT_decl_line(0x203) .dwattr $C$DW$1113, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$379, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$379, DW_AT_decl_line(0x201) .dwattr $C$DW$T$379, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$379 $C$DW$T$556 .dwtag DW_TAG_typedef .dwattr $C$DW$T$556, DW_AT_name("SlNetSock_SecureALPN_t") .dwattr $C$DW$T$556, DW_AT_type(*$C$DW$T$379) .dwattr $C$DW$T$556, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$556, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$556, DW_AT_decl_line(0x204) .dwattr $C$DW$T$556, DW_AT_decl_column(0x03) $C$DW$T$380 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$380, DW_AT_name("SlNetSock_SecureMask_t") .dwattr $C$DW$T$380, DW_AT_byte_size(0x04) $C$DW$1114 .dwtag DW_TAG_member .dwattr $C$DW$1114, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1114, DW_AT_name("secureMask") .dwattr $C$DW$1114, DW_AT_TI_symbol_name("secureMask") .dwattr $C$DW$1114, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1114, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1114, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1114, DW_AT_decl_line(0x20b) .dwattr $C$DW$1114, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$380, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$380, DW_AT_decl_line(0x209) .dwattr $C$DW$T$380, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$380 $C$DW$T$557 .dwtag DW_TAG_typedef .dwattr $C$DW$T$557, DW_AT_name("SlNetSock_SecureMask_t") .dwattr $C$DW$T$557, DW_AT_type(*$C$DW$T$380) .dwattr $C$DW$T$557, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$557, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$557, DW_AT_decl_line(0x20c) .dwattr $C$DW$T$557, DW_AT_decl_column(0x03) $C$DW$T$381 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$381, DW_AT_name("SlNetSock_SecureMethod_t") .dwattr $C$DW$T$381, DW_AT_byte_size(0x01) $C$DW$1115 .dwtag DW_TAG_member .dwattr $C$DW$1115, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$1115, DW_AT_name("secureMethod") .dwattr $C$DW$1115, DW_AT_TI_symbol_name("secureMethod") .dwattr $C$DW$1115, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1115, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1115, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1115, DW_AT_decl_line(0x213) .dwattr $C$DW$1115, DW_AT_decl_column(0x0d) .dwattr $C$DW$T$381, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$381, DW_AT_decl_line(0x211) .dwattr $C$DW$T$381, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$381 $C$DW$T$558 .dwtag DW_TAG_typedef .dwattr $C$DW$T$558, DW_AT_name("SlNetSock_SecureMethod_t") .dwattr $C$DW$T$558, DW_AT_type(*$C$DW$T$381) .dwattr $C$DW$T$558, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$558, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$558, DW_AT_decl_line(0x214) .dwattr $C$DW$T$558, DW_AT_decl_column(0x03) $C$DW$T$384 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$384, DW_AT_name("SlNetSock_Timeval_t") .dwattr $C$DW$T$384, DW_AT_byte_size(0x08) $C$DW$1116 .dwtag DW_TAG_member .dwattr $C$DW$1116, DW_AT_type(*$C$DW$T$382) .dwattr $C$DW$1116, DW_AT_name("tv_sec") .dwattr $C$DW$1116, DW_AT_TI_symbol_name("tv_sec") .dwattr $C$DW$1116, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1116, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1116, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1116, DW_AT_decl_line(0x23f) .dwattr $C$DW$1116, DW_AT_decl_column(0x1a) $C$DW$1117 .dwtag DW_TAG_member .dwattr $C$DW$1117, DW_AT_type(*$C$DW$T$383) .dwattr $C$DW$1117, DW_AT_name("tv_usec") .dwattr $C$DW$1117, DW_AT_TI_symbol_name("tv_usec") .dwattr $C$DW$1117, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1117, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1117, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1117, DW_AT_decl_line(0x240) .dwattr $C$DW$1117, DW_AT_decl_column(0x1a) .dwattr $C$DW$T$384, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$384, DW_AT_decl_line(0x23d) .dwattr $C$DW$T$384, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$384 $C$DW$T$310 .dwtag DW_TAG_typedef .dwattr $C$DW$T$310, DW_AT_name("SlNetSock_Timeval_t") .dwattr $C$DW$T$310, DW_AT_type(*$C$DW$T$384) .dwattr $C$DW$T$310, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$310, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$310, DW_AT_decl_line(0x241) .dwattr $C$DW$T$310, DW_AT_decl_column(0x03) $C$DW$T$311 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$311, DW_AT_type(*$C$DW$T$310) .dwattr $C$DW$T$311, DW_AT_address_class(0x20) $C$DW$T$385 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$385, DW_AT_name("SlNetSock_TransceiverRxOverHead_t") .dwattr $C$DW$T$385, DW_AT_byte_size(0x08) $C$DW$1118 .dwtag DW_TAG_member .dwattr $C$DW$1118, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$1118, DW_AT_name("rate") .dwattr $C$DW$1118, DW_AT_TI_symbol_name("rate") .dwattr $C$DW$1118, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1118, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1118, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1118, DW_AT_decl_line(0x276) .dwattr $C$DW$1118, DW_AT_decl_column(0x0e) $C$DW$1119 .dwtag DW_TAG_member .dwattr $C$DW$1119, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$1119, DW_AT_name("channel") .dwattr $C$DW$1119, DW_AT_TI_symbol_name("channel") .dwattr $C$DW$1119, DW_AT_data_member_location[DW_OP_plus_uconst 0x1] .dwattr $C$DW$1119, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1119, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1119, DW_AT_decl_line(0x277) .dwattr $C$DW$1119, DW_AT_decl_column(0x0e) $C$DW$1120 .dwtag DW_TAG_member .dwattr $C$DW$1120, DW_AT_type(*$C$DW$T$361) .dwattr $C$DW$1120, DW_AT_name("rssi") .dwattr $C$DW$1120, DW_AT_TI_symbol_name("rssi") .dwattr $C$DW$1120, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$1120, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1120, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1120, DW_AT_decl_line(0x278) .dwattr $C$DW$1120, DW_AT_decl_column(0x0e) $C$DW$1121 .dwtag DW_TAG_member .dwattr $C$DW$1121, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$1121, DW_AT_name("padding") .dwattr $C$DW$1121, DW_AT_TI_symbol_name("padding") .dwattr $C$DW$1121, DW_AT_data_member_location[DW_OP_plus_uconst 0x3] .dwattr $C$DW$1121, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1121, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1121, DW_AT_decl_line(0x279) .dwattr $C$DW$1121, DW_AT_decl_column(0x0e) $C$DW$1122 .dwtag DW_TAG_member .dwattr $C$DW$1122, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1122, DW_AT_name("timestamp") .dwattr $C$DW$1122, DW_AT_TI_symbol_name("timestamp") .dwattr $C$DW$1122, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1122, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1122, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1122, DW_AT_decl_line(0x27a) .dwattr $C$DW$1122, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$385, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$385, DW_AT_decl_line(0x274) .dwattr $C$DW$T$385, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$385 $C$DW$T$559 .dwtag DW_TAG_typedef .dwattr $C$DW$T$559, DW_AT_name("SlNetSock_TransceiverRxOverHead_t") .dwattr $C$DW$T$559, DW_AT_type(*$C$DW$T$385) .dwattr $C$DW$T$559, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$559, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$559, DW_AT_decl_line(0x27b) .dwattr $C$DW$T$559, DW_AT_decl_column(0x03) $C$DW$T$386 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$386, DW_AT_name("SlNetSock_Winsize_t") .dwattr $C$DW$T$386, DW_AT_byte_size(0x04) $C$DW$1123 .dwtag DW_TAG_member .dwattr $C$DW$1123, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1123, DW_AT_name("winSize") .dwattr $C$DW$1123, DW_AT_TI_symbol_name("winSize") .dwattr $C$DW$1123, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1123, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1123, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1123, DW_AT_decl_line(0x1e3) .dwattr $C$DW$1123, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$386, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$386, DW_AT_decl_line(0x1e1) .dwattr $C$DW$T$386, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$386 $C$DW$T$560 .dwtag DW_TAG_typedef .dwattr $C$DW$T$560, DW_AT_name("SlNetSock_Winsize_t") .dwattr $C$DW$T$560, DW_AT_type(*$C$DW$T$386) .dwattr $C$DW$T$560, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$560, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$560, DW_AT_decl_line(0x1e4) .dwattr $C$DW$T$560, DW_AT_decl_column(0x03) $C$DW$T$387 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$387, DW_AT_name("SlNetSock_linger_t") .dwattr $C$DW$T$387, DW_AT_byte_size(0x08) $C$DW$1124 .dwtag DW_TAG_member .dwattr $C$DW$1124, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1124, DW_AT_name("l_onoff") .dwattr $C$DW$1124, DW_AT_TI_symbol_name("l_onoff") .dwattr $C$DW$1124, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1124, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1124, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1124, DW_AT_decl_line(0x22d) .dwattr $C$DW$1124, DW_AT_decl_column(0x0e) $C$DW$1125 .dwtag DW_TAG_member .dwattr $C$DW$1125, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$1125, DW_AT_name("l_linger") .dwattr $C$DW$1125, DW_AT_TI_symbol_name("l_linger") .dwattr $C$DW$1125, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1125, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1125, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$1125, DW_AT_decl_line(0x22e) .dwattr $C$DW$1125, DW_AT_decl_column(0x0e) .dwattr $C$DW$T$387, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$387, DW_AT_decl_line(0x22b) .dwattr $C$DW$T$387, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$387 $C$DW$T$561 .dwtag DW_TAG_typedef .dwattr $C$DW$T$561, DW_AT_name("SlNetSock_linger_t") .dwattr $C$DW$T$561, DW_AT_type(*$C$DW$T$387) .dwattr $C$DW$T$561, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$561, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$561, DW_AT_decl_line(0x22f) .dwattr $C$DW$T$561, DW_AT_decl_column(0x03) $C$DW$T$388 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$388, DW_AT_name("SlSockAddrIn6_t") .dwattr $C$DW$T$388, DW_AT_byte_size(0x1c) $C$DW$1126 .dwtag DW_TAG_member .dwattr $C$DW$1126, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$1126, DW_AT_name("sin6_family") .dwattr $C$DW$1126, DW_AT_TI_symbol_name("sin6_family") .dwattr $C$DW$1126, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1126, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1126, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1126, DW_AT_decl_line(0x18b) .dwattr $C$DW$1126, DW_AT_decl_column(0x14) $C$DW$1127 .dwtag DW_TAG_member .dwattr $C$DW$1127, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$1127, DW_AT_name("sin6_port") .dwattr $C$DW$1127, DW_AT_TI_symbol_name("sin6_port") .dwattr $C$DW$1127, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$1127, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1127, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1127, DW_AT_decl_line(0x18c) .dwattr $C$DW$1127, DW_AT_decl_column(0x14) $C$DW$1128 .dwtag DW_TAG_member .dwattr $C$DW$1128, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$1128, DW_AT_name("sin6_flowinfo") .dwattr $C$DW$1128, DW_AT_TI_symbol_name("sin6_flowinfo") .dwattr $C$DW$1128, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1128, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1128, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1128, DW_AT_decl_line(0x18d) .dwattr $C$DW$1128, DW_AT_decl_column(0x14) $C$DW$1129 .dwtag DW_TAG_member .dwattr $C$DW$1129, DW_AT_type(*$C$DW$T$66) .dwattr $C$DW$1129, DW_AT_name("sin6_addr") .dwattr $C$DW$1129, DW_AT_TI_symbol_name("sin6_addr") .dwattr $C$DW$1129, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1129, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1129, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1129, DW_AT_decl_line(0x18e) .dwattr $C$DW$1129, DW_AT_decl_column(0x14) $C$DW$1130 .dwtag DW_TAG_member .dwattr $C$DW$1130, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$1130, DW_AT_name("sin6_scope_id") .dwattr $C$DW$1130, DW_AT_TI_symbol_name("sin6_scope_id") .dwattr $C$DW$1130, DW_AT_data_member_location[DW_OP_plus_uconst 0x18] .dwattr $C$DW$1130, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1130, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1130, DW_AT_decl_line(0x18f) .dwattr $C$DW$1130, DW_AT_decl_column(0x14) .dwattr $C$DW$T$388, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$388, DW_AT_decl_line(0x189) .dwattr $C$DW$T$388, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$388 $C$DW$T$562 .dwtag DW_TAG_typedef .dwattr $C$DW$T$562, DW_AT_name("SlSockAddrIn6_t") .dwattr $C$DW$T$562, DW_AT_type(*$C$DW$T$388) .dwattr $C$DW$T$562, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$562, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$562, DW_AT_decl_line(0x190) .dwattr $C$DW$T$562, DW_AT_decl_column(0x02) $C$DW$T$389 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$389, DW_AT_name("SlSockAddrIn_t") .dwattr $C$DW$T$389, DW_AT_byte_size(0x10) $C$DW$1131 .dwtag DW_TAG_member .dwattr $C$DW$1131, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$1131, DW_AT_name("sin_family") .dwattr $C$DW$1131, DW_AT_TI_symbol_name("sin_family") .dwattr $C$DW$1131, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1131, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1131, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1131, DW_AT_decl_line(0x196) .dwattr $C$DW$1131, DW_AT_decl_column(0x17) $C$DW$1132 .dwtag DW_TAG_member .dwattr $C$DW$1132, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$1132, DW_AT_name("sin_port") .dwattr $C$DW$1132, DW_AT_TI_symbol_name("sin_port") .dwattr $C$DW$1132, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$1132, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1132, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1132, DW_AT_decl_line(0x197) .dwattr $C$DW$1132, DW_AT_decl_column(0x17) $C$DW$1133 .dwtag DW_TAG_member .dwattr $C$DW$1133, DW_AT_type(*$C$DW$T$64) .dwattr $C$DW$1133, DW_AT_name("sin_addr") .dwattr $C$DW$1133, DW_AT_TI_symbol_name("sin_addr") .dwattr $C$DW$1133, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1133, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1133, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1133, DW_AT_decl_line(0x198) .dwattr $C$DW$1133, DW_AT_decl_column(0x17) $C$DW$1134 .dwtag DW_TAG_member .dwattr $C$DW$1134, DW_AT_type(*$C$DW$T$58) .dwattr $C$DW$1134, DW_AT_name("sin_zero") .dwattr $C$DW$1134, DW_AT_TI_symbol_name("sin_zero") .dwattr $C$DW$1134, DW_AT_data_member_location[DW_OP_plus_uconst 0x8] .dwattr $C$DW$1134, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1134, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1134, DW_AT_decl_line(0x199) .dwattr $C$DW$1134, DW_AT_decl_column(0x17) .dwattr $C$DW$T$389, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$389, DW_AT_decl_line(0x194) .dwattr $C$DW$T$389, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$389 $C$DW$T$563 .dwtag DW_TAG_typedef .dwattr $C$DW$T$563, DW_AT_name("SlSockAddrIn_t") .dwattr $C$DW$T$563, DW_AT_type(*$C$DW$T$389) .dwattr $C$DW$T$563, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$563, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$563, DW_AT_decl_line(0x19a) .dwattr $C$DW$T$563, DW_AT_decl_column(0x02) $C$DW$T$391 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$391, DW_AT_name("SlSockAddr_t") .dwattr $C$DW$T$391, DW_AT_byte_size(0x10) $C$DW$1135 .dwtag DW_TAG_member .dwattr $C$DW$1135, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$1135, DW_AT_name("sa_family") .dwattr $C$DW$1135, DW_AT_TI_symbol_name("sa_family") .dwattr $C$DW$1135, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1135, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1135, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1135, DW_AT_decl_line(0x185) .dwattr $C$DW$1135, DW_AT_decl_column(0x13) $C$DW$1136 .dwtag DW_TAG_member .dwattr $C$DW$1136, DW_AT_type(*$C$DW$T$390) .dwattr $C$DW$1136, DW_AT_name("sa_data") .dwattr $C$DW$1136, DW_AT_TI_symbol_name("sa_data") .dwattr $C$DW$1136, DW_AT_data_member_location[DW_OP_plus_uconst 0x2] .dwattr $C$DW$1136, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1136, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1136, DW_AT_decl_line(0x186) .dwattr $C$DW$1136, DW_AT_decl_column(0x13) .dwattr $C$DW$T$391, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$391, DW_AT_decl_line(0x183) .dwattr $C$DW$T$391, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$391 $C$DW$T$564 .dwtag DW_TAG_typedef .dwattr $C$DW$T$564, DW_AT_name("SlSockAddr_t") .dwattr $C$DW$T$564, DW_AT_type(*$C$DW$T$391) .dwattr $C$DW$T$564, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$564, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$564, DW_AT_decl_line(0x187) .dwattr $C$DW$T$564, DW_AT_decl_column(0x02) $C$DW$T$565 .dwtag DW_TAG_const_type .dwattr $C$DW$T$565, DW_AT_type(*$C$DW$T$564) $C$DW$T$566 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$566, DW_AT_type(*$C$DW$T$565) .dwattr $C$DW$T$566, DW_AT_address_class(0x20) $C$DW$T$567 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$567, DW_AT_type(*$C$DW$T$564) .dwattr $C$DW$T$567, DW_AT_address_class(0x20) $C$DW$T$394 .dwtag DW_TAG_structure_type .dwattr $C$DW$T$394, DW_AT_name("SlTimeval_t") .dwattr $C$DW$T$394, DW_AT_byte_size(0x08) $C$DW$1137 .dwtag DW_TAG_member .dwattr $C$DW$1137, DW_AT_type(*$C$DW$T$392) .dwattr $C$DW$1137, DW_AT_name("tv_sec") .dwattr $C$DW$1137, DW_AT_TI_symbol_name("tv_sec") .dwattr $C$DW$1137, DW_AT_data_member_location[DW_OP_plus_uconst 0x0] .dwattr $C$DW$1137, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1137, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1137, DW_AT_decl_line(0x17c) .dwattr $C$DW$1137, DW_AT_decl_column(0x17) $C$DW$1138 .dwtag DW_TAG_member .dwattr $C$DW$1138, DW_AT_type(*$C$DW$T$393) .dwattr $C$DW$1138, DW_AT_name("tv_usec") .dwattr $C$DW$1138, DW_AT_TI_symbol_name("tv_usec") .dwattr $C$DW$1138, DW_AT_data_member_location[DW_OP_plus_uconst 0x4] .dwattr $C$DW$1138, DW_AT_accessibility(DW_ACCESS_public) .dwattr $C$DW$1138, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$1138, DW_AT_decl_line(0x17d) .dwattr $C$DW$1138, DW_AT_decl_column(0x17) .dwattr $C$DW$T$394, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$394, DW_AT_decl_line(0x17a) .dwattr $C$DW$T$394, DW_AT_decl_column(0x10) .dwendtag $C$DW$T$394 $C$DW$T$568 .dwtag DW_TAG_typedef .dwattr $C$DW$T$568, DW_AT_name("SlTimeval_t") .dwattr $C$DW$T$568, DW_AT_type(*$C$DW$T$394) .dwattr $C$DW$T$568, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$568, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$568, DW_AT_decl_line(0x17e) .dwattr $C$DW$T$568, DW_AT_decl_column(0x02) $C$DW$T$569 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$569, DW_AT_type(*$C$DW$T$394) .dwattr $C$DW$T$569, DW_AT_address_class(0x20) $C$DW$T$2 .dwtag DW_TAG_unspecified_type .dwattr $C$DW$T$2, DW_AT_name("void") $C$DW$T$3 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$3, DW_AT_type(*$C$DW$T$2) .dwattr $C$DW$T$3, DW_AT_address_class(0x20) $C$DW$T$570 .dwtag DW_TAG_typedef .dwattr $C$DW$T$570, DW_AT_name("ClockP_Handle") .dwattr $C$DW$T$570, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$T$570, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$570, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$570, DW_AT_decl_line(0x6f) .dwattr $C$DW$T$570, DW_AT_decl_column(0x10) $C$DW$T$571 .dwtag DW_TAG_typedef .dwattr $C$DW$T$571, DW_AT_name("MutexP_Handle") .dwattr $C$DW$T$571, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$T$571, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$571, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/MutexP.h") .dwattr $C$DW$T$571, DW_AT_decl_line(0x67) .dwattr $C$DW$T$571, DW_AT_decl_column(0x0f) $C$DW$T$572 .dwtag DW_TAG_typedef .dwattr $C$DW$T$572, DW_AT_name("SemaphoreP_Handle") .dwattr $C$DW$T$572, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$T$572, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$572, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/SemaphoreP.h") .dwattr $C$DW$T$572, DW_AT_decl_line(0x72) .dwattr $C$DW$T$572, DW_AT_decl_column(0x10) $C$DW$T$286 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$286, DW_AT_type(*$C$DW$T$3) .dwattr $C$DW$T$286, DW_AT_address_class(0x20) $C$DW$T$269 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$269, DW_AT_language(DW_LANG_C) .dwendtag $C$DW$T$269 $C$DW$T$270 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$270, DW_AT_type(*$C$DW$T$269) .dwattr $C$DW$T$270, DW_AT_address_class(0x20) $C$DW$T$576 .dwtag DW_TAG_typedef .dwattr $C$DW$T$576, DW_AT_name("SL_P_EVENT_HANDLER") .dwattr $C$DW$T$576, DW_AT_type(*$C$DW$T$270) .dwattr $C$DW$T$576, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$576, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/cc_pal.h") .dwattr $C$DW$T$576, DW_AT_decl_line(0x53) .dwattr $C$DW$T$576, DW_AT_decl_column(0x10) $C$DW$T$322 .dwtag DW_TAG_const_type .dwattr $C$DW$T$322, DW_AT_type(*$C$DW$T$2) $C$DW$T$323 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$323, DW_AT_type(*$C$DW$T$322) .dwattr $C$DW$T$323, DW_AT_address_class(0x20) $C$DW$T$577 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$577, DW_AT_language(DW_LANG_C) $C$DW$1139 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1139, DW_AT_type(*$C$DW$T$264) .dwendtag $C$DW$T$577 $C$DW$T$578 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$578, DW_AT_type(*$C$DW$T$577) .dwattr $C$DW$T$578, DW_AT_address_class(0x20) $C$DW$T$579 .dwtag DW_TAG_typedef .dwattr $C$DW$T$579, DW_AT_name("ClockP_Fxn") .dwattr $C$DW$T$579, DW_AT_type(*$C$DW$T$578) .dwattr $C$DW$T$579, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$579, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/dpl/ClockP.h") .dwattr $C$DW$T$579, DW_AT_decl_line(0x78) .dwattr $C$DW$T$579, DW_AT_decl_column(0x10) $C$DW$T$580 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$580, DW_AT_language(DW_LANG_C) $C$DW$1140 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1140, DW_AT_type(*$C$DW$T$477) .dwendtag $C$DW$T$580 $C$DW$T$581 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$581, DW_AT_type(*$C$DW$T$580) .dwattr $C$DW$T$581, DW_AT_address_class(0x20) $C$DW$T$582 .dwtag DW_TAG_typedef .dwattr $C$DW$T$582, DW_AT_name("P_SL_DEV_PING_CALLBACK") .dwattr $C$DW$T$582, DW_AT_type(*$C$DW$T$581) .dwattr $C$DW$T$582, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$582, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/netapp.h") .dwattr $C$DW$T$582, DW_AT_decl_line(0x228) .dwattr $C$DW$T$582, DW_AT_decl_column(0x10) $C$DW$T$583 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$583, DW_AT_language(DW_LANG_C) $C$DW$1141 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1141, DW_AT_type(*$C$DW$T$13) $C$DW$1142 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1142, DW_AT_type(*$C$DW$T$518) .dwendtag $C$DW$T$583 $C$DW$T$584 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$584, DW_AT_type(*$C$DW$T$583) .dwattr $C$DW$T$584, DW_AT_address_class(0x20) $C$DW$T$585 .dwtag DW_TAG_typedef .dwattr $C$DW$T$585, DW_AT_name("P_INIT_CALLBACK") .dwattr $C$DW$T$585, DW_AT_type(*$C$DW$T$584) .dwattr $C$DW$T$585, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$585, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/device.h") .dwattr $C$DW$T$585, DW_AT_decl_line(0x124) .dwattr $C$DW$T$585, DW_AT_decl_column(0x10) $C$DW$T$4 .dwtag DW_TAG_base_type .dwattr $C$DW$T$4, DW_AT_encoding(DW_ATE_boolean) .dwattr $C$DW$T$4, DW_AT_name("bool") .dwattr $C$DW$T$4, DW_AT_byte_size(0x01) $C$DW$T$5 .dwtag DW_TAG_base_type .dwattr $C$DW$T$5, DW_AT_encoding(DW_ATE_signed_char) .dwattr $C$DW$T$5, DW_AT_name("signed char") .dwattr $C$DW$T$5, DW_AT_byte_size(0x01) $C$DW$T$150 .dwtag DW_TAG_typedef .dwattr $C$DW$T$150, DW_AT_name("SlWlanRxFilterID_t") .dwattr $C$DW$T$150, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$150, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$150, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$150, DW_AT_decl_line(0x2d7) .dwattr $C$DW$T$150, DW_AT_decl_column(0x11) $C$DW$T$151 .dwtag DW_TAG_array_type .dwattr $C$DW$T$151, DW_AT_type(*$C$DW$T$150) .dwattr $C$DW$T$151, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$151, DW_AT_byte_size(0x02) $C$DW$1143 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1143, DW_AT_upper_bound(0x01) .dwendtag $C$DW$T$151 $C$DW$T$49 .dwtag DW_TAG_array_type .dwattr $C$DW$T$49, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$49, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$49, DW_AT_byte_size(0x80) $C$DW$1144 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1144, DW_AT_upper_bound(0x7f) .dwendtag $C$DW$T$49 $C$DW$T$58 .dwtag DW_TAG_array_type .dwattr $C$DW$T$58, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$58, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$58, DW_AT_byte_size(0x08) $C$DW$1145 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1145, DW_AT_upper_bound(0x07) .dwendtag $C$DW$T$58 $C$DW$T$59 .dwtag DW_TAG_array_type .dwattr $C$DW$T$59, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$59, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$59, DW_AT_byte_size(0x10) $C$DW$1146 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1146, DW_AT_upper_bound(0x0f) .dwendtag $C$DW$T$59 $C$DW$T$60 .dwtag DW_TAG_array_type .dwattr $C$DW$T$60, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$60, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$60, DW_AT_byte_size(0x02) $C$DW$1147 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1147, DW_AT_upper_bound(0x01) .dwendtag $C$DW$T$60 $C$DW$T$128 .dwtag DW_TAG_array_type .dwattr $C$DW$T$128, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$128, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$128, DW_AT_byte_size(0x01) $C$DW$1148 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1148, DW_AT_upper_bound(0x00) .dwendtag $C$DW$T$128 $C$DW$T$130 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$130, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$130, DW_AT_address_class(0x20) $C$DW$T$133 .dwtag DW_TAG_array_type .dwattr $C$DW$T$133, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$133, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$133, DW_AT_byte_size(0x40) $C$DW$1149 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1149, DW_AT_upper_bound(0x3f) .dwendtag $C$DW$T$133 $C$DW$T$361 .dwtag DW_TAG_typedef .dwattr $C$DW$T$361, DW_AT_name("int8_t") .dwattr $C$DW$T$361, DW_AT_type(*$C$DW$T$5) .dwattr $C$DW$T$361, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$361, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$361, DW_AT_decl_line(0x2a) .dwattr $C$DW$T$361, DW_AT_decl_column(0x1d) $C$DW$T$362 .dwtag DW_TAG_array_type .dwattr $C$DW$T$362, DW_AT_type(*$C$DW$T$361) .dwattr $C$DW$T$362, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$362, DW_AT_byte_size(0x08) $C$DW$1150 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1150, DW_AT_upper_bound(0x07) .dwendtag $C$DW$T$362 $C$DW$T$586 .dwtag DW_TAG_typedef .dwattr $C$DW$T$586, DW_AT_name("int_least8_t") .dwattr $C$DW$T$586, DW_AT_type(*$C$DW$T$361) .dwattr $C$DW$T$586, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$586, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$586, DW_AT_decl_line(0x37) .dwattr $C$DW$T$586, DW_AT_decl_column(0x17) $C$DW$T$6 .dwtag DW_TAG_base_type .dwattr $C$DW$T$6, DW_AT_encoding(DW_ATE_unsigned_char) .dwattr $C$DW$T$6, DW_AT_name("unsigned char") .dwattr $C$DW$T$6, DW_AT_byte_size(0x01) $C$DW$T$158 .dwtag DW_TAG_typedef .dwattr $C$DW$T$158, DW_AT_name("SlWlanRxFilterActionType_t") .dwattr $C$DW$T$158, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$158, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$158, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$158, DW_AT_decl_line(0x3bb) .dwattr $C$DW$T$158, DW_AT_decl_column(0x0d) $C$DW$T$153 .dwtag DW_TAG_typedef .dwattr $C$DW$T$153, DW_AT_name("SlWlanRxFilterCounterId_t") .dwattr $C$DW$T$153, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$153, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$153, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$153, DW_AT_decl_line(0x39b) .dwattr $C$DW$T$153, DW_AT_decl_column(0x0d) $C$DW$T$587 .dwtag DW_TAG_typedef .dwattr $C$DW$T$587, DW_AT_name("SlWlanRxFilterFlags_u") .dwattr $C$DW$T$587, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$587, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$587, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$587, DW_AT_decl_line(0x2f8) .dwattr $C$DW$T$587, DW_AT_decl_column(0x0d) $C$DW$T$149 .dwtag DW_TAG_typedef .dwattr $C$DW$T$149, DW_AT_name("SlWlanRxFilterRuleCombinationOperator_t") .dwattr $C$DW$T$149, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$149, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$149, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$149, DW_AT_decl_line(0x36f) .dwattr $C$DW$T$149, DW_AT_decl_column(0x0d) $C$DW$T$147 .dwtag DW_TAG_typedef .dwattr $C$DW$T$147, DW_AT_name("SlWlanRxFilterRuleHeaderCompareFunction_t") .dwattr $C$DW$T$147, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$147, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$147, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$147, DW_AT_decl_line(0x2ff) .dwattr $C$DW$T$147, DW_AT_decl_column(0x0d) $C$DW$T$146 .dwtag DW_TAG_typedef .dwattr $C$DW$T$146, DW_AT_name("SlWlanRxFilterRuleHeaderField_t") .dwattr $C$DW$T$146, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$146, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$146, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$146, DW_AT_decl_line(0x30d) .dwattr $C$DW$T$146, DW_AT_decl_column(0x0d) $C$DW$T$588 .dwtag DW_TAG_typedef .dwattr $C$DW$T$588, DW_AT_name("SlWlanRxFilterRuleType_t") .dwattr $C$DW$T$588, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$588, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$588, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$588, DW_AT_decl_line(0x2f3) .dwattr $C$DW$T$588, DW_AT_decl_column(0x0d) $C$DW$T$589 .dwtag DW_TAG_typedef .dwattr $C$DW$T$589, DW_AT_name("SlWlanRxFilterSysFilters_t") .dwattr $C$DW$T$589, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$589, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$589, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$589, DW_AT_decl_line(0x2df) .dwattr $C$DW$T$589, DW_AT_decl_column(0x0e) $C$DW$T$156 .dwtag DW_TAG_typedef .dwattr $C$DW$T$156, DW_AT_name("SlWlanRxFilterTriggerCompareFunction_t") .dwattr $C$DW$T$156, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$156, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$156, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$156, DW_AT_decl_line(0x306) .dwattr $C$DW$T$156, DW_AT_decl_column(0x0d) $C$DW$T$154 .dwtag DW_TAG_typedef .dwattr $C$DW$T$154, DW_AT_name("SlWlanRxFilterTriggerConnectionStates_t") .dwattr $C$DW$T$154, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$154, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$154, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$154, DW_AT_decl_line(0x393) .dwattr $C$DW$T$154, DW_AT_decl_column(0x0d) $C$DW$T$155 .dwtag DW_TAG_typedef .dwattr $C$DW$T$155, DW_AT_name("SlWlanRxFilterTriggerRoles_t") .dwattr $C$DW$T$155, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$155, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$155, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$155, DW_AT_decl_line(0x38c) .dwattr $C$DW$T$155, DW_AT_decl_column(0x0d) $C$DW$T$590 .dwtag DW_TAG_typedef .dwattr $C$DW$T$590, DW_AT_name("_SlArgSize_t") .dwattr $C$DW$T$590, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$590, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$590, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$T$590, DW_AT_decl_line(0x17d) .dwattr $C$DW$T$590, DW_AT_decl_column(0x0f) $C$DW$T$19 .dwtag DW_TAG_array_type .dwattr $C$DW$T$19, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$19, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$19, DW_AT_byte_size(0x20) $C$DW$1151 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1151, DW_AT_upper_bound(0x1f) .dwendtag $C$DW$T$19 $C$DW$T$20 .dwtag DW_TAG_array_type .dwattr $C$DW$T$20, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$20, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$20, DW_AT_byte_size(0x06) $C$DW$1152 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1152, DW_AT_upper_bound(0x05) .dwendtag $C$DW$T$20 $C$DW$T$241 .dwtag DW_TAG_array_type .dwattr $C$DW$T$241, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$241, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$241, DW_AT_byte_size(0x0c) $C$DW$1153 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1153, DW_AT_upper_bound(0x01) $C$DW$1154 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1154, DW_AT_upper_bound(0x05) .dwendtag $C$DW$T$241 $C$DW$T$22 .dwtag DW_TAG_array_type .dwattr $C$DW$T$22, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$22, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$22, DW_AT_byte_size(0x03) $C$DW$1155 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1155, DW_AT_upper_bound(0x02) .dwendtag $C$DW$T$22 $C$DW$T$36 .dwtag DW_TAG_array_type .dwattr $C$DW$T$36, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$36, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$36, DW_AT_byte_size(0x02) $C$DW$1156 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1156, DW_AT_upper_bound(0x01) .dwendtag $C$DW$T$36 $C$DW$T$69 .dwtag DW_TAG_array_type .dwattr $C$DW$T$69, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$69, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$69, DW_AT_byte_size(0x04) $C$DW$1157 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1157, DW_AT_upper_bound(0x03) .dwendtag $C$DW$T$69 $C$DW$T$164 .dwtag DW_TAG_typedef .dwattr $C$DW$T$164, DW_AT_name("SlWlanRxFilterSysFiltersMask_t") .dwattr $C$DW$T$164, DW_AT_type(*$C$DW$T$69) .dwattr $C$DW$T$164, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$164, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$164, DW_AT_decl_line(0x2e9) .dwattr $C$DW$T$164, DW_AT_decl_column(0x0f) $C$DW$T$239 .dwtag DW_TAG_array_type .dwattr $C$DW$T$239, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$239, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$239, DW_AT_byte_size(0x08) $C$DW$1158 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1158, DW_AT_upper_bound(0x01) $C$DW$1159 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1159, DW_AT_upper_bound(0x03) .dwendtag $C$DW$T$239 $C$DW$T$84 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$84, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$84, DW_AT_address_class(0x20) $C$DW$T$99 .dwtag DW_TAG_array_type .dwattr $C$DW$T$99, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$99, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$99, DW_AT_byte_size(0x3c) $C$DW$1160 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1160, DW_AT_upper_bound(0x3b) .dwendtag $C$DW$T$99 $C$DW$T$100 .dwtag DW_TAG_array_type .dwattr $C$DW$T$100, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$100, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$100, DW_AT_byte_size(0x40) $C$DW$1161 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1161, DW_AT_upper_bound(0x3f) .dwendtag $C$DW$T$100 $C$DW$T$102 .dwtag DW_TAG_array_type .dwattr $C$DW$T$102, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$102, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$102, DW_AT_byte_size(0x100) $C$DW$1162 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1162, DW_AT_upper_bound(0xff) .dwendtag $C$DW$T$102 $C$DW$T$113 .dwtag DW_TAG_array_type .dwattr $C$DW$T$113, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$113, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$113, DW_AT_byte_size(0x08) $C$DW$1163 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1163, DW_AT_upper_bound(0x07) .dwendtag $C$DW$T$113 $C$DW$T$136 .dwtag DW_TAG_array_type .dwattr $C$DW$T$136, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$136, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$136, DW_AT_byte_size(0xfc) $C$DW$1164 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1164, DW_AT_upper_bound(0xfb) .dwendtag $C$DW$T$136 $C$DW$T$141 .dwtag DW_TAG_array_type .dwattr $C$DW$T$141, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$141, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$141, DW_AT_byte_size(0x10) $C$DW$1165 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1165, DW_AT_upper_bound(0x0f) .dwendtag $C$DW$T$141 $C$DW$T$160 .dwtag DW_TAG_typedef .dwattr $C$DW$T$160, DW_AT_name("SlWlanRxFilterIdMask_t") .dwattr $C$DW$T$160, DW_AT_type(*$C$DW$T$141) .dwattr $C$DW$T$160, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$160, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/wlan.h") .dwattr $C$DW$T$160, DW_AT_decl_line(0x2dd) .dwattr $C$DW$T$160, DW_AT_decl_column(0x0f) $C$DW$T$240 .dwtag DW_TAG_array_type .dwattr $C$DW$T$240, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$240, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$240, DW_AT_byte_size(0x20) $C$DW$1166 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1166, DW_AT_upper_bound(0x01) $C$DW$1167 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1167, DW_AT_upper_bound(0x0f) .dwendtag $C$DW$T$240 $C$DW$T$242 .dwtag DW_TAG_array_type .dwattr $C$DW$T$242, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$242, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$242, DW_AT_byte_size(0x12) $C$DW$1168 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1168, DW_AT_upper_bound(0x11) .dwendtag $C$DW$T$242 $C$DW$T$243 .dwtag DW_TAG_array_type .dwattr $C$DW$T$243, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$243, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$243, DW_AT_byte_size(0x24) $C$DW$1169 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1169, DW_AT_upper_bound(0x01) $C$DW$1170 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1170, DW_AT_upper_bound(0x11) .dwendtag $C$DW$T$243 $C$DW$T$245 .dwtag DW_TAG_array_type .dwattr $C$DW$T$245, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$245, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$245, DW_AT_byte_size(0x05) $C$DW$1171 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1171, DW_AT_upper_bound(0x04) .dwendtag $C$DW$T$245 $C$DW$T$246 .dwtag DW_TAG_array_type .dwattr $C$DW$T$246, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$246, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$246, DW_AT_byte_size(0x0a) $C$DW$1172 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1172, DW_AT_upper_bound(0x01) $C$DW$1173 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1173, DW_AT_upper_bound(0x04) .dwendtag $C$DW$T$246 $C$DW$T$390 .dwtag DW_TAG_array_type .dwattr $C$DW$T$390, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$390, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$390, DW_AT_byte_size(0x0e) $C$DW$1174 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1174, DW_AT_upper_bound(0x0d) .dwendtag $C$DW$T$390 $C$DW$T$591 .dwtag DW_TAG_const_type .dwattr $C$DW$T$591, DW_AT_type(*$C$DW$T$6) $C$DW$T$592 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$592, DW_AT_type(*$C$DW$T$591) .dwattr $C$DW$T$592, DW_AT_address_class(0x20) $C$DW$T$200 .dwtag DW_TAG_typedef .dwattr $C$DW$T$200, DW_AT_name("uint8_t") .dwattr $C$DW$T$200, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$200, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$200, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$200, DW_AT_decl_line(0x2b) .dwattr $C$DW$T$200, DW_AT_decl_column(0x1c) $C$DW$T$201 .dwtag DW_TAG_array_type .dwattr $C$DW$T$201, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$T$201, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$201, DW_AT_byte_size(0x10) $C$DW$1175 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1175, DW_AT_upper_bound(0x0f) .dwendtag $C$DW$T$201 $C$DW$T$347 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$347, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$T$347, DW_AT_address_class(0x20) $C$DW$T$364 .dwtag DW_TAG_array_type .dwattr $C$DW$T$364, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$T$364, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$364, DW_AT_byte_size(0x0e) $C$DW$1176 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1176, DW_AT_upper_bound(0x0d) .dwendtag $C$DW$T$364 $C$DW$T$338 .dwtag DW_TAG_const_type .dwattr $C$DW$T$338, DW_AT_type(*$C$DW$T$200) $C$DW$T$593 .dwtag DW_TAG_typedef .dwattr $C$DW$T$593, DW_AT_name("uint_least8_t") .dwattr $C$DW$T$593, DW_AT_type(*$C$DW$T$200) .dwattr $C$DW$T$593, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$593, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$593, DW_AT_decl_line(0x38) .dwattr $C$DW$T$593, DW_AT_decl_column(0x16) $C$DW$T$7 .dwtag DW_TAG_base_type .dwattr $C$DW$T$7, DW_AT_encoding(DW_ATE_signed_char) .dwattr $C$DW$T$7, DW_AT_name("wchar_t") .dwattr $C$DW$T$7, DW_AT_byte_size(0x02) $C$DW$T$8 .dwtag DW_TAG_base_type .dwattr $C$DW$T$8, DW_AT_encoding(DW_ATE_signed) .dwattr $C$DW$T$8, DW_AT_name("short") .dwattr $C$DW$T$8, DW_AT_byte_size(0x02) $C$DW$T$594 .dwtag DW_TAG_typedef .dwattr $C$DW$T$594, DW_AT_name("_SlDataSize_t") .dwattr $C$DW$T$594, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$T$594, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$594, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$T$594, DW_AT_decl_line(0x17e) .dwattr $C$DW$T$594, DW_AT_decl_column(0x10) $C$DW$T$595 .dwtag DW_TAG_typedef .dwattr $C$DW$T$595, DW_AT_name("_SlReturnVal_t") .dwattr $C$DW$T$595, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$T$595, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$595, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$T$595, DW_AT_decl_line(0x17f) .dwattr $C$DW$T$595, DW_AT_decl_column(0x10) $C$DW$T$596 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$596, DW_AT_type(*$C$DW$T$595) .dwattr $C$DW$T$596, DW_AT_language(DW_LANG_C) $C$DW$1177 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1177, DW_AT_type(*$C$DW$T$3) .dwendtag $C$DW$T$596 $C$DW$T$597 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$597, DW_AT_type(*$C$DW$T$596) .dwattr $C$DW$T$597, DW_AT_address_class(0x20) $C$DW$T$598 .dwtag DW_TAG_typedef .dwattr $C$DW$T$598, DW_AT_name("_SlSpawnEntryFunc_t") .dwattr $C$DW$T$598, DW_AT_type(*$C$DW$T$597) .dwattr $C$DW$T$598, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$598, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$T$598, DW_AT_decl_line(0x36a) .dwattr $C$DW$T$598, DW_AT_decl_column(0x1a) $C$DW$T$26 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$26, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$T$26, DW_AT_language(DW_LANG_C) $C$DW$1178 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1178, DW_AT_type(*$C$DW$T$3) .dwendtag $C$DW$T$26 $C$DW$T$27 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$27, DW_AT_type(*$C$DW$T$26) .dwattr $C$DW$T$27, DW_AT_address_class(0x20) $C$DW$T$28 .dwtag DW_TAG_typedef .dwattr $C$DW$T$28, DW_AT_name("P_OS_SPAWN_ENTRY") .dwattr $C$DW$T$28, DW_AT_type(*$C$DW$T$27) .dwattr $C$DW$T$28, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$28, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/cc_pal.h") .dwattr $C$DW$T$28, DW_AT_decl_line(0x60) .dwattr $C$DW$T$28, DW_AT_decl_column(0x18) $C$DW$T$285 .dwtag DW_TAG_typedef .dwattr $C$DW$T$285, DW_AT_name("int16_t") .dwattr $C$DW$T$285, DW_AT_type(*$C$DW$T$8) .dwattr $C$DW$T$285, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$285, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$285, DW_AT_decl_line(0x2c) .dwattr $C$DW$T$285, DW_AT_decl_column(0x1d) $C$DW$T$287 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$287, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$T$287, DW_AT_language(DW_LANG_C) $C$DW$1179 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1179, DW_AT_type(*$C$DW$T$3) $C$DW$1180 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1180, DW_AT_type(*$C$DW$T$285) $C$DW$1181 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1181, DW_AT_type(*$C$DW$T$285) $C$DW$1182 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1182, DW_AT_type(*$C$DW$T$285) $C$DW$1183 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1183, DW_AT_type(*$C$DW$T$286) .dwendtag $C$DW$T$287 $C$DW$T$288 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$288, DW_AT_type(*$C$DW$T$287) .dwattr $C$DW$T$288, DW_AT_address_class(0x20) $C$DW$T$298 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$298, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$T$298, DW_AT_language(DW_LANG_C) $C$DW$1184 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1184, DW_AT_type(*$C$DW$T$285) $C$DW$1185 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1185, DW_AT_type(*$C$DW$T$3) $C$DW$1186 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1186, DW_AT_type(*$C$DW$T$295) $C$DW$1187 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1187, DW_AT_type(*$C$DW$T$297) $C$DW$1188 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1188, DW_AT_type(*$C$DW$T$200) $C$DW$1189 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1189, DW_AT_type(*$C$DW$T$286) .dwendtag $C$DW$T$298 $C$DW$T$299 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$299, DW_AT_type(*$C$DW$T$298) .dwattr $C$DW$T$299, DW_AT_address_class(0x20) $C$DW$T$636 .dwtag DW_TAG_const_type .dwattr $C$DW$T$636, DW_AT_type(*$C$DW$T$285) $C$DW$T$637 .dwtag DW_TAG_array_type .dwattr $C$DW$T$637, DW_AT_type(*$C$DW$T$636) .dwattr $C$DW$T$637, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$637, DW_AT_byte_size(0x14) $C$DW$1190 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1190, DW_AT_upper_bound(0x09) .dwendtag $C$DW$T$637 $C$DW$T$638 .dwtag DW_TAG_array_type .dwattr $C$DW$T$638, DW_AT_type(*$C$DW$T$636) .dwattr $C$DW$T$638, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$638, DW_AT_byte_size(0x10) $C$DW$1191 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1191, DW_AT_upper_bound(0x07) .dwendtag $C$DW$T$638 $C$DW$T$640 .dwtag DW_TAG_typedef .dwattr $C$DW$T$640, DW_AT_name("int_least16_t") .dwattr $C$DW$T$640, DW_AT_type(*$C$DW$T$285) .dwattr $C$DW$T$640, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$640, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$640, DW_AT_decl_line(0x3a) .dwattr $C$DW$T$640, DW_AT_decl_column(0x17) $C$DW$T$9 .dwtag DW_TAG_base_type .dwattr $C$DW$T$9, DW_AT_encoding(DW_ATE_unsigned) .dwattr $C$DW$T$9, DW_AT_name("unsigned short") .dwattr $C$DW$T$9, DW_AT_byte_size(0x02) $C$DW$T$607 .dwtag DW_TAG_typedef .dwattr $C$DW$T$607, DW_AT_name("SlSocklen_t") .dwattr $C$DW$T$607, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$607, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$607, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$607, DW_AT_decl_line(0x180) .dwattr $C$DW$T$607, DW_AT_decl_column(0x0e) $C$DW$T$608 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$608, DW_AT_type(*$C$DW$T$607) .dwattr $C$DW$T$608, DW_AT_address_class(0x20) $C$DW$T$641 .dwtag DW_TAG_typedef .dwattr $C$DW$T$641, DW_AT_name("_SlOpcode_t") .dwattr $C$DW$T$641, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$641, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$641, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/simplelink.h") .dwattr $C$DW$T$641, DW_AT_decl_line(0x17c) .dwattr $C$DW$T$641, DW_AT_decl_column(0x0f) $C$DW$T$125 .dwtag DW_TAG_array_type .dwattr $C$DW$T$125, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$125, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$125, DW_AT_byte_size(0x28) $C$DW$1192 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1192, DW_AT_upper_bound(0x13) .dwendtag $C$DW$T$125 $C$DW$T$126 .dwtag DW_TAG_array_type .dwattr $C$DW$T$126, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$126, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$126, DW_AT_byte_size(0x0c) $C$DW$1193 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1193, DW_AT_upper_bound(0x05) .dwendtag $C$DW$T$126 $C$DW$T$244 .dwtag DW_TAG_array_type .dwattr $C$DW$T$244, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$244, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$244, DW_AT_byte_size(0x04) $C$DW$1194 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1194, DW_AT_upper_bound(0x01) .dwendtag $C$DW$T$244 $C$DW$T$629 .dwtag DW_TAG_const_type .dwattr $C$DW$T$629, DW_AT_type(*$C$DW$T$9) $C$DW$T$633 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$633, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$633, DW_AT_address_class(0x20) $C$DW$T$202 .dwtag DW_TAG_typedef .dwattr $C$DW$T$202, DW_AT_name("uint16_t") .dwattr $C$DW$T$202, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$202, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$202, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$202, DW_AT_decl_line(0x2d) .dwattr $C$DW$T$202, DW_AT_decl_column(0x1c) $C$DW$T$296 .dwtag DW_TAG_typedef .dwattr $C$DW$T$296, DW_AT_name("SlNetSocklen_t") .dwattr $C$DW$T$296, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$T$296, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$296, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$296, DW_AT_decl_line(0x246) .dwattr $C$DW$T$296, DW_AT_decl_column(0x12) $C$DW$T$297 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$297, DW_AT_type(*$C$DW$T$296) .dwattr $C$DW$T$297, DW_AT_address_class(0x20) $C$DW$T$203 .dwtag DW_TAG_array_type .dwattr $C$DW$T$203, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$T$203, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$203, DW_AT_byte_size(0x10) $C$DW$1195 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1195, DW_AT_upper_bound(0x07) .dwendtag $C$DW$T$203 $C$DW$T$337 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$337, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$T$337, DW_AT_address_class(0x20) $C$DW$T$335 .dwtag DW_TAG_const_type .dwattr $C$DW$T$335, DW_AT_type(*$C$DW$T$202) $C$DW$T$642 .dwtag DW_TAG_typedef .dwattr $C$DW$T$642, DW_AT_name("uint_least16_t") .dwattr $C$DW$T$642, DW_AT_type(*$C$DW$T$202) .dwattr $C$DW$T$642, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$642, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$642, DW_AT_decl_line(0x3b) .dwattr $C$DW$T$642, DW_AT_decl_column(0x16) $C$DW$T$643 .dwtag DW_TAG_typedef .dwattr $C$DW$T$643, DW_AT_name("wchar_t") .dwattr $C$DW$T$643, DW_AT_type(*$C$DW$T$9) .dwattr $C$DW$T$643, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$643, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stddef.h") .dwattr $C$DW$T$643, DW_AT_decl_line(0x41) .dwattr $C$DW$T$643, DW_AT_decl_column(0x1a) $C$DW$T$10 .dwtag DW_TAG_base_type .dwattr $C$DW$T$10, DW_AT_encoding(DW_ATE_signed) .dwattr $C$DW$T$10, DW_AT_name("int") .dwattr $C$DW$T$10, DW_AT_byte_size(0x04) $C$DW$T$644 .dwtag DW_TAG_typedef .dwattr $C$DW$T$644, DW_AT_name("Fd_t") .dwattr $C$DW$T$644, DW_AT_type(*$C$DW$T$10) .dwattr $C$DW$T$644, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$644, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/cc_pal.h") .dwattr $C$DW$T$644, DW_AT_decl_line(0x47) .dwattr $C$DW$T$644, DW_AT_decl_column(0x0d) $C$DW$T$645 .dwtag DW_TAG_typedef .dwattr $C$DW$T$645, DW_AT_name("_SlFd_t") .dwattr $C$DW$T$645, DW_AT_type(*$C$DW$T$10) .dwattr $C$DW$T$645, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$645, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/porting/user.h") .dwattr $C$DW$T$645, DW_AT_decl_line(0x34) .dwattr $C$DW$T$645, DW_AT_decl_column(0x14) $C$DW$T$289 .dwtag DW_TAG_typedef .dwattr $C$DW$T$289, DW_AT_name("int32_t") .dwattr $C$DW$T$289, DW_AT_type(*$C$DW$T$10) .dwattr $C$DW$T$289, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$289, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$289, DW_AT_decl_line(0x2e) .dwattr $C$DW$T$289, DW_AT_decl_column(0x1d) $C$DW$T$382 .dwtag DW_TAG_typedef .dwattr $C$DW$T$382, DW_AT_name("SlNetSockTime_t") .dwattr $C$DW$T$382, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$382, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$382, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$382, DW_AT_decl_line(0x234) .dwattr $C$DW$T$382, DW_AT_decl_column(0x11) $C$DW$T$383 .dwtag DW_TAG_typedef .dwattr $C$DW$T$383, DW_AT_name("SlNetSockuseconds_t") .dwattr $C$DW$T$383, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$383, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$383, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/net/slnetsock.h") .dwattr $C$DW$T$383, DW_AT_decl_line(0x238) .dwattr $C$DW$T$383, DW_AT_decl_column(0x11) $C$DW$T$290 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$290, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$290, DW_AT_language(DW_LANG_C) $C$DW$1196 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1196, DW_AT_type(*$C$DW$T$285) $C$DW$1197 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1197, DW_AT_type(*$C$DW$T$3) .dwendtag $C$DW$T$290 $C$DW$T$291 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$291, DW_AT_type(*$C$DW$T$290) .dwattr $C$DW$T$291, DW_AT_address_class(0x20) $C$DW$T$292 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$292, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$292, DW_AT_language(DW_LANG_C) $C$DW$1198 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1198, DW_AT_type(*$C$DW$T$285) $C$DW$1199 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1199, DW_AT_type(*$C$DW$T$3) $C$DW$1200 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1200, DW_AT_type(*$C$DW$T$285) .dwendtag $C$DW$T$292 $C$DW$T$293 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$293, DW_AT_type(*$C$DW$T$292) .dwattr $C$DW$T$293, DW_AT_address_class(0x20) $C$DW$T$302 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$302, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$302, DW_AT_language(DW_LANG_C) $C$DW$1201 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1201, DW_AT_type(*$C$DW$T$285) $C$DW$1202 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1202, DW_AT_type(*$C$DW$T$3) $C$DW$1203 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1203, DW_AT_type(*$C$DW$T$301) $C$DW$1204 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1204, DW_AT_type(*$C$DW$T$285) .dwendtag $C$DW$T$302 $C$DW$T$303 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$303, DW_AT_type(*$C$DW$T$302) .dwattr $C$DW$T$303, DW_AT_address_class(0x20) $C$DW$T$304 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$304, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$304, DW_AT_language(DW_LANG_C) $C$DW$1205 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1205, DW_AT_type(*$C$DW$T$285) $C$DW$1206 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1206, DW_AT_type(*$C$DW$T$3) $C$DW$1207 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1207, DW_AT_type(*$C$DW$T$301) $C$DW$1208 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1208, DW_AT_type(*$C$DW$T$296) $C$DW$1209 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1209, DW_AT_type(*$C$DW$T$200) .dwendtag $C$DW$T$304 $C$DW$T$305 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$305, DW_AT_type(*$C$DW$T$304) .dwattr $C$DW$T$305, DW_AT_address_class(0x20) $C$DW$T$306 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$306, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$306, DW_AT_language(DW_LANG_C) $C$DW$1210 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1210, DW_AT_type(*$C$DW$T$285) $C$DW$1211 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1211, DW_AT_type(*$C$DW$T$3) $C$DW$1212 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1212, DW_AT_type(*$C$DW$T$295) $C$DW$1213 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1213, DW_AT_type(*$C$DW$T$297) .dwendtag $C$DW$T$306 $C$DW$T$307 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$307, DW_AT_type(*$C$DW$T$306) .dwattr $C$DW$T$307, DW_AT_address_class(0x20) $C$DW$T$312 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$312, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$312, DW_AT_language(DW_LANG_C) $C$DW$1214 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1214, DW_AT_type(*$C$DW$T$3) $C$DW$1215 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1215, DW_AT_type(*$C$DW$T$285) $C$DW$1216 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1216, DW_AT_type(*$C$DW$T$309) $C$DW$1217 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1217, DW_AT_type(*$C$DW$T$309) $C$DW$1218 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1218, DW_AT_type(*$C$DW$T$309) $C$DW$1219 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1219, DW_AT_type(*$C$DW$T$311) .dwendtag $C$DW$T$312 $C$DW$T$313 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$313, DW_AT_type(*$C$DW$T$312) .dwattr $C$DW$T$313, DW_AT_address_class(0x20) $C$DW$T$314 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$314, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$314, DW_AT_language(DW_LANG_C) $C$DW$1220 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1220, DW_AT_type(*$C$DW$T$285) $C$DW$1221 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1221, DW_AT_type(*$C$DW$T$3) $C$DW$1222 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1222, DW_AT_type(*$C$DW$T$285) $C$DW$1223 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1223, DW_AT_type(*$C$DW$T$285) $C$DW$1224 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1224, DW_AT_type(*$C$DW$T$3) $C$DW$1225 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1225, DW_AT_type(*$C$DW$T$296) .dwendtag $C$DW$T$314 $C$DW$T$315 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$315, DW_AT_type(*$C$DW$T$314) .dwattr $C$DW$T$315, DW_AT_address_class(0x20) $C$DW$T$316 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$316, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$316, DW_AT_language(DW_LANG_C) $C$DW$1226 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1226, DW_AT_type(*$C$DW$T$285) $C$DW$1227 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1227, DW_AT_type(*$C$DW$T$3) $C$DW$1228 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1228, DW_AT_type(*$C$DW$T$285) $C$DW$1229 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1229, DW_AT_type(*$C$DW$T$285) $C$DW$1230 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1230, DW_AT_type(*$C$DW$T$3) $C$DW$1231 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1231, DW_AT_type(*$C$DW$T$297) .dwendtag $C$DW$T$316 $C$DW$T$317 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$317, DW_AT_type(*$C$DW$T$316) .dwattr $C$DW$T$317, DW_AT_address_class(0x20) $C$DW$T$318 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$318, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$318, DW_AT_language(DW_LANG_C) $C$DW$1232 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1232, DW_AT_type(*$C$DW$T$285) $C$DW$1233 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1233, DW_AT_type(*$C$DW$T$3) $C$DW$1234 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1234, DW_AT_type(*$C$DW$T$3) $C$DW$1235 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1235, DW_AT_type(*$C$DW$T$204) $C$DW$1236 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1236, DW_AT_type(*$C$DW$T$204) .dwendtag $C$DW$T$318 $C$DW$T$319 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$319, DW_AT_type(*$C$DW$T$318) .dwattr $C$DW$T$319, DW_AT_address_class(0x20) $C$DW$T$320 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$320, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$320, DW_AT_language(DW_LANG_C) $C$DW$1237 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1237, DW_AT_type(*$C$DW$T$285) $C$DW$1238 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1238, DW_AT_type(*$C$DW$T$3) $C$DW$1239 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1239, DW_AT_type(*$C$DW$T$3) $C$DW$1240 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1240, DW_AT_type(*$C$DW$T$204) $C$DW$1241 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1241, DW_AT_type(*$C$DW$T$204) $C$DW$1242 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1242, DW_AT_type(*$C$DW$T$295) $C$DW$1243 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1243, DW_AT_type(*$C$DW$T$297) .dwendtag $C$DW$T$320 $C$DW$T$321 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$321, DW_AT_type(*$C$DW$T$320) .dwattr $C$DW$T$321, DW_AT_address_class(0x20) $C$DW$T$324 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$324, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$324, DW_AT_language(DW_LANG_C) $C$DW$1244 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1244, DW_AT_type(*$C$DW$T$285) $C$DW$1245 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1245, DW_AT_type(*$C$DW$T$3) $C$DW$1246 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1246, DW_AT_type(*$C$DW$T$323) $C$DW$1247 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1247, DW_AT_type(*$C$DW$T$204) $C$DW$1248 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1248, DW_AT_type(*$C$DW$T$204) .dwendtag $C$DW$T$324 $C$DW$T$325 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$325, DW_AT_type(*$C$DW$T$324) .dwattr $C$DW$T$325, DW_AT_address_class(0x20) $C$DW$T$326 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$326, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$326, DW_AT_language(DW_LANG_C) $C$DW$1249 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1249, DW_AT_type(*$C$DW$T$285) $C$DW$1250 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1250, DW_AT_type(*$C$DW$T$3) $C$DW$1251 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1251, DW_AT_type(*$C$DW$T$323) $C$DW$1252 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1252, DW_AT_type(*$C$DW$T$204) $C$DW$1253 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1253, DW_AT_type(*$C$DW$T$204) $C$DW$1254 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1254, DW_AT_type(*$C$DW$T$301) $C$DW$1255 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1255, DW_AT_type(*$C$DW$T$296) .dwendtag $C$DW$T$326 $C$DW$T$327 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$327, DW_AT_type(*$C$DW$T$326) .dwattr $C$DW$T$327, DW_AT_address_class(0x20) $C$DW$T$332 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$332, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$332, DW_AT_language(DW_LANG_C) $C$DW$1256 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1256, DW_AT_type(*$C$DW$T$285) $C$DW$1257 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1257, DW_AT_type(*$C$DW$T$3) $C$DW$1258 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1258, DW_AT_type(*$C$DW$T$331) $C$DW$1259 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1259, DW_AT_type(*$C$DW$T$200) .dwendtag $C$DW$T$332 $C$DW$T$333 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$333, DW_AT_type(*$C$DW$T$332) .dwattr $C$DW$T$333, DW_AT_address_class(0x20) $C$DW$T$339 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$339, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$339, DW_AT_language(DW_LANG_C) $C$DW$1260 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1260, DW_AT_type(*$C$DW$T$3) $C$DW$1261 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1261, DW_AT_type(*$C$DW$T$334) $C$DW$1262 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1262, DW_AT_type(*$C$DW$T$335) $C$DW$1263 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1263, DW_AT_type(*$C$DW$T$336) $C$DW$1264 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1264, DW_AT_type(*$C$DW$T$337) $C$DW$1265 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1265, DW_AT_type(*$C$DW$T$338) .dwendtag $C$DW$T$339 $C$DW$T$340 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$340, DW_AT_type(*$C$DW$T$339) .dwattr $C$DW$T$340, DW_AT_address_class(0x20) $C$DW$T$343 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$343, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$343, DW_AT_language(DW_LANG_C) $C$DW$1266 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1266, DW_AT_type(*$C$DW$T$3) $C$DW$1267 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1267, DW_AT_type(*$C$DW$T$342) $C$DW$1268 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1268, DW_AT_type(*$C$DW$T$337) $C$DW$1269 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1269, DW_AT_type(*$C$DW$T$336) .dwendtag $C$DW$T$343 $C$DW$T$344 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$344, DW_AT_type(*$C$DW$T$343) .dwattr $C$DW$T$344, DW_AT_address_class(0x20) $C$DW$T$345 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$345, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$345, DW_AT_language(DW_LANG_C) $C$DW$1270 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1270, DW_AT_type(*$C$DW$T$3) .dwendtag $C$DW$T$345 $C$DW$T$346 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$346, DW_AT_type(*$C$DW$T$345) .dwattr $C$DW$T$346, DW_AT_address_class(0x20) $C$DW$T$348 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$348, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$348, DW_AT_language(DW_LANG_C) $C$DW$1271 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1271, DW_AT_type(*$C$DW$T$3) $C$DW$1272 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1272, DW_AT_type(*$C$DW$T$202) $C$DW$1273 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1273, DW_AT_type(*$C$DW$T$334) $C$DW$1274 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1274, DW_AT_type(*$C$DW$T$285) $C$DW$1275 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1275, DW_AT_type(*$C$DW$T$347) $C$DW$1276 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1276, DW_AT_type(*$C$DW$T$285) .dwendtag $C$DW$T$348 $C$DW$T$349 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$349, DW_AT_type(*$C$DW$T$348) .dwattr $C$DW$T$349, DW_AT_address_class(0x20) $C$DW$T$352 .dwtag DW_TAG_subroutine_type .dwattr $C$DW$T$352, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$352, DW_AT_language(DW_LANG_C) $C$DW$1277 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1277, DW_AT_type(*$C$DW$T$202) $C$DW$1278 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1278, DW_AT_type(*$C$DW$T$351) $C$DW$1279 .dwtag DW_TAG_formal_parameter .dwattr $C$DW$1279, DW_AT_type(*$C$DW$T$286) .dwendtag $C$DW$T$352 $C$DW$T$353 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$353, DW_AT_type(*$C$DW$T$352) .dwattr $C$DW$T$353, DW_AT_address_class(0x20) $C$DW$T$646 .dwtag DW_TAG_typedef .dwattr $C$DW$T$646, DW_AT_name("int_fast16_t") .dwattr $C$DW$T$646, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$646, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$646, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$646, DW_AT_decl_line(0x47) .dwattr $C$DW$T$646, DW_AT_decl_column(0x17) $C$DW$T$647 .dwtag DW_TAG_typedef .dwattr $C$DW$T$647, DW_AT_name("int_fast32_t") .dwattr $C$DW$T$647, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$647, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$647, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$647, DW_AT_decl_line(0x4a) .dwattr $C$DW$T$647, DW_AT_decl_column(0x17) $C$DW$T$648 .dwtag DW_TAG_typedef .dwattr $C$DW$T$648, DW_AT_name("int_fast8_t") .dwattr $C$DW$T$648, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$648, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$648, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$648, DW_AT_decl_line(0x45) .dwattr $C$DW$T$648, DW_AT_decl_column(0x17) $C$DW$T$649 .dwtag DW_TAG_typedef .dwattr $C$DW$T$649, DW_AT_name("int_least32_t") .dwattr $C$DW$T$649, DW_AT_type(*$C$DW$T$289) .dwattr $C$DW$T$649, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$649, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$649, DW_AT_decl_line(0x3c) .dwattr $C$DW$T$649, DW_AT_decl_column(0x17) $C$DW$T$650 .dwtag DW_TAG_typedef .dwattr $C$DW$T$650, DW_AT_name("intptr_t") .dwattr $C$DW$T$650, DW_AT_type(*$C$DW$T$10) .dwattr $C$DW$T$650, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$650, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$650, DW_AT_decl_line(0x52) .dwattr $C$DW$T$650, DW_AT_decl_column(0x1a) $C$DW$T$651 .dwtag DW_TAG_typedef .dwattr $C$DW$T$651, DW_AT_name("ptrdiff_t") .dwattr $C$DW$T$651, DW_AT_type(*$C$DW$T$10) .dwattr $C$DW$T$651, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$651, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stddef.h") .dwattr $C$DW$T$651, DW_AT_decl_line(0x36) .dwattr $C$DW$T$651, DW_AT_decl_column(0x1c) $C$DW$T$11 .dwtag DW_TAG_base_type .dwattr $C$DW$T$11, DW_AT_encoding(DW_ATE_unsigned) .dwattr $C$DW$T$11, DW_AT_name("unsigned int") .dwattr $C$DW$T$11, DW_AT_byte_size(0x04) $C$DW$T$573 .dwtag DW_TAG_typedef .dwattr $C$DW$T$573, DW_AT_name("size_t") .dwattr $C$DW$T$573, DW_AT_type(*$C$DW$T$11) .dwattr $C$DW$T$573, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$573, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/string.h") .dwattr $C$DW$T$573, DW_AT_decl_line(0x3f) .dwattr $C$DW$T$573, DW_AT_decl_column(0x19) $C$DW$T$204 .dwtag DW_TAG_typedef .dwattr $C$DW$T$204, DW_AT_name("uint32_t") .dwattr $C$DW$T$204, DW_AT_type(*$C$DW$T$11) .dwattr $C$DW$T$204, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$204, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$204, DW_AT_decl_line(0x2f) .dwattr $C$DW$T$204, DW_AT_decl_column(0x1c) $C$DW$T$205 .dwtag DW_TAG_array_type .dwattr $C$DW$T$205, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$T$205, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$205, DW_AT_byte_size(0x10) $C$DW$1280 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1280, DW_AT_upper_bound(0x03) .dwendtag $C$DW$T$205 $C$DW$T$336 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$336, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$T$336, DW_AT_address_class(0x20) $C$DW$T$373 .dwtag DW_TAG_array_type .dwattr $C$DW$T$373, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$T$373, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$373, DW_AT_byte_size(0x04) $C$DW$1281 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1281, DW_AT_upper_bound(0x00) .dwendtag $C$DW$T$373 $C$DW$T$652 .dwtag DW_TAG_typedef .dwattr $C$DW$T$652, DW_AT_name("uint_fast16_t") .dwattr $C$DW$T$652, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$T$652, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$652, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$652, DW_AT_decl_line(0x48) .dwattr $C$DW$T$652, DW_AT_decl_column(0x16) $C$DW$T$653 .dwtag DW_TAG_typedef .dwattr $C$DW$T$653, DW_AT_name("uint_fast32_t") .dwattr $C$DW$T$653, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$T$653, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$653, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$653, DW_AT_decl_line(0x4b) .dwattr $C$DW$T$653, DW_AT_decl_column(0x16) $C$DW$T$654 .dwtag DW_TAG_typedef .dwattr $C$DW$T$654, DW_AT_name("uint_fast8_t") .dwattr $C$DW$T$654, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$T$654, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$654, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$654, DW_AT_decl_line(0x46) .dwattr $C$DW$T$654, DW_AT_decl_column(0x16) $C$DW$T$655 .dwtag DW_TAG_typedef .dwattr $C$DW$T$655, DW_AT_name("uint_least32_t") .dwattr $C$DW$T$655, DW_AT_type(*$C$DW$T$204) .dwattr $C$DW$T$655, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$655, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$655, DW_AT_decl_line(0x3d) .dwattr $C$DW$T$655, DW_AT_decl_column(0x16) $C$DW$T$264 .dwtag DW_TAG_typedef .dwattr $C$DW$T$264, DW_AT_name("uintptr_t") .dwattr $C$DW$T$264, DW_AT_type(*$C$DW$T$11) .dwattr $C$DW$T$264, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$264, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$264, DW_AT_decl_line(0x53) .dwattr $C$DW$T$264, DW_AT_decl_column(0x1a) $C$DW$T$12 .dwtag DW_TAG_base_type .dwattr $C$DW$T$12, DW_AT_encoding(DW_ATE_signed) .dwattr $C$DW$T$12, DW_AT_name("long") .dwattr $C$DW$T$12, DW_AT_byte_size(0x04) $C$DW$T$393 .dwtag DW_TAG_typedef .dwattr $C$DW$T$393, DW_AT_name("SlSuseconds_t") .dwattr $C$DW$T$393, DW_AT_type(*$C$DW$T$12) .dwattr $C$DW$T$393, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$393, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$393, DW_AT_decl_line(0x178) .dwattr $C$DW$T$393, DW_AT_decl_column(0x10) $C$DW$T$392 .dwtag DW_TAG_typedef .dwattr $C$DW$T$392, DW_AT_name("SlTime_t") .dwattr $C$DW$T$392, DW_AT_type(*$C$DW$T$12) .dwattr $C$DW$T$392, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$392, DW_AT_decl_file("/vagrant/Q4_04/sdk_root/source/ti/drivers/net/wifi/sl_socket.h") .dwattr $C$DW$T$392, DW_AT_decl_line(0x177) .dwattr $C$DW$T$392, DW_AT_decl_column(0x10) $C$DW$T$599 .dwtag DW_TAG_const_type .dwattr $C$DW$T$599, DW_AT_type(*$C$DW$T$12) $C$DW$T$13 .dwtag DW_TAG_base_type .dwattr $C$DW$T$13, DW_AT_encoding(DW_ATE_unsigned) .dwattr $C$DW$T$13, DW_AT_name("unsigned long") .dwattr $C$DW$T$13, DW_AT_byte_size(0x04) $C$DW$T$30 .dwtag DW_TAG_array_type .dwattr $C$DW$T$30, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$T$30, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$30, DW_AT_byte_size(0x10) $C$DW$1282 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1282, DW_AT_upper_bound(0x03) .dwendtag $C$DW$T$30 $C$DW$T$178 .dwtag DW_TAG_array_type .dwattr $C$DW$T$178, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$T$178, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$178, DW_AT_byte_size(0x0c) $C$DW$1283 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1283, DW_AT_upper_bound(0x02) .dwendtag $C$DW$T$178 $C$DW$T$182 .dwtag DW_TAG_array_type .dwattr $C$DW$T$182, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$T$182, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$182, DW_AT_byte_size(0x08) $C$DW$1284 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1284, DW_AT_upper_bound(0x01) .dwendtag $C$DW$T$182 $C$DW$T$281 .dwtag DW_TAG_array_type .dwattr $C$DW$T$281, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$T$281, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$281, DW_AT_byte_size(0x04) $C$DW$1285 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1285, DW_AT_upper_bound(0x00) .dwendtag $C$DW$T$281 $C$DW$T$600 .dwtag DW_TAG_const_type .dwattr $C$DW$T$600, DW_AT_type(*$C$DW$T$13) $C$DW$T$630 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$630, DW_AT_type(*$C$DW$T$13) .dwattr $C$DW$T$630, DW_AT_address_class(0x20) $C$DW$T$14 .dwtag DW_TAG_base_type .dwattr $C$DW$T$14, DW_AT_encoding(DW_ATE_signed) .dwattr $C$DW$T$14, DW_AT_name("long long") .dwattr $C$DW$T$14, DW_AT_byte_size(0x08) $C$DW$T$660 .dwtag DW_TAG_typedef .dwattr $C$DW$T$660, DW_AT_name("int64_t") .dwattr $C$DW$T$660, DW_AT_type(*$C$DW$T$14) .dwattr $C$DW$T$660, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$660, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$660, DW_AT_decl_line(0x32) .dwattr $C$DW$T$660, DW_AT_decl_column(0x21) $C$DW$T$661 .dwtag DW_TAG_typedef .dwattr $C$DW$T$661, DW_AT_name("int_fast64_t") .dwattr $C$DW$T$661, DW_AT_type(*$C$DW$T$660) .dwattr $C$DW$T$661, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$661, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$661, DW_AT_decl_line(0x4e) .dwattr $C$DW$T$661, DW_AT_decl_column(0x17) $C$DW$T$662 .dwtag DW_TAG_typedef .dwattr $C$DW$T$662, DW_AT_name("int_least64_t") .dwattr $C$DW$T$662, DW_AT_type(*$C$DW$T$660) .dwattr $C$DW$T$662, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$662, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$662, DW_AT_decl_line(0x40) .dwattr $C$DW$T$662, DW_AT_decl_column(0x17) $C$DW$T$663 .dwtag DW_TAG_typedef .dwattr $C$DW$T$663, DW_AT_name("intmax_t") .dwattr $C$DW$T$663, DW_AT_type(*$C$DW$T$14) .dwattr $C$DW$T$663, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$663, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$663, DW_AT_decl_line(0x56) .dwattr $C$DW$T$663, DW_AT_decl_column(0x20) $C$DW$T$15 .dwtag DW_TAG_base_type .dwattr $C$DW$T$15, DW_AT_encoding(DW_ATE_unsigned) .dwattr $C$DW$T$15, DW_AT_name("unsigned long long") .dwattr $C$DW$T$15, DW_AT_byte_size(0x08) $C$DW$T$664 .dwtag DW_TAG_typedef .dwattr $C$DW$T$664, DW_AT_name("uint64_t") .dwattr $C$DW$T$664, DW_AT_type(*$C$DW$T$15) .dwattr $C$DW$T$664, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$664, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$664, DW_AT_decl_line(0x33) .dwattr $C$DW$T$664, DW_AT_decl_column(0x20) $C$DW$T$665 .dwtag DW_TAG_typedef .dwattr $C$DW$T$665, DW_AT_name("uint_fast64_t") .dwattr $C$DW$T$665, DW_AT_type(*$C$DW$T$664) .dwattr $C$DW$T$665, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$665, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$665, DW_AT_decl_line(0x4f) .dwattr $C$DW$T$665, DW_AT_decl_column(0x16) $C$DW$T$666 .dwtag DW_TAG_typedef .dwattr $C$DW$T$666, DW_AT_name("uint_least64_t") .dwattr $C$DW$T$666, DW_AT_type(*$C$DW$T$664) .dwattr $C$DW$T$666, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$666, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$666, DW_AT_decl_line(0x41) .dwattr $C$DW$T$666, DW_AT_decl_column(0x16) $C$DW$T$667 .dwtag DW_TAG_typedef .dwattr $C$DW$T$667, DW_AT_name("uintmax_t") .dwattr $C$DW$T$667, DW_AT_type(*$C$DW$T$15) .dwattr $C$DW$T$667, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$667, DW_AT_decl_file("/opt/ti/ccs-latest/ccsv7/tools/compiler/ti-cgt-arm_16.9.6.LTS/include/stdint.h") .dwattr $C$DW$T$667, DW_AT_decl_line(0x57) .dwattr $C$DW$T$667, DW_AT_decl_column(0x20) $C$DW$T$16 .dwtag DW_TAG_base_type .dwattr $C$DW$T$16, DW_AT_encoding(DW_ATE_float) .dwattr $C$DW$T$16, DW_AT_name("float") .dwattr $C$DW$T$16, DW_AT_byte_size(0x04) $C$DW$T$17 .dwtag DW_TAG_base_type .dwattr $C$DW$T$17, DW_AT_encoding(DW_ATE_float) .dwattr $C$DW$T$17, DW_AT_name("double") .dwattr $C$DW$T$17, DW_AT_byte_size(0x08) $C$DW$T$18 .dwtag DW_TAG_base_type .dwattr $C$DW$T$18, DW_AT_encoding(DW_ATE_float) .dwattr $C$DW$T$18, DW_AT_name("long double") .dwattr $C$DW$T$18, DW_AT_byte_size(0x08) $C$DW$T$263 .dwtag DW_TAG_base_type .dwattr $C$DW$T$263, DW_AT_encoding(DW_ATE_unsigned_char) .dwattr $C$DW$T$263, DW_AT_name("unsigned char") .dwattr $C$DW$T$263, DW_AT_byte_size(0x01) $C$DW$T$267 .dwtag DW_TAG_array_type .dwattr $C$DW$T$267, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$267, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$267, DW_AT_byte_size(0x24) $C$DW$1286 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1286, DW_AT_upper_bound(0x23) .dwendtag $C$DW$T$267 $C$DW$T$272 .dwtag DW_TAG_array_type .dwattr $C$DW$T$272, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$272, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$272, DW_AT_byte_size(0x28) $C$DW$1287 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1287, DW_AT_upper_bound(0x27) .dwendtag $C$DW$T$272 $C$DW$T$277 .dwtag DW_TAG_array_type .dwattr $C$DW$T$277, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$277, DW_AT_language(DW_LANG_C) .dwattr $C$DW$T$277, DW_AT_byte_size(0x1c) $C$DW$1288 .dwtag DW_TAG_subrange_type .dwattr $C$DW$1288, DW_AT_upper_bound(0x1b) .dwendtag $C$DW$T$277 $C$DW$T$334 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$334, DW_AT_type(*$C$DW$T$6) .dwattr $C$DW$T$334, DW_AT_address_class(0x20) $C$DW$T$350 .dwtag DW_TAG_const_type .dwattr $C$DW$T$350, DW_AT_type(*$C$DW$T$6) $C$DW$T$351 .dwtag DW_TAG_pointer_type .dwattr $C$DW$T$351, DW_AT_type(*$C$DW$T$350) .dwattr $C$DW$T$351, DW_AT_address_class(0x20) .dwattr $C$DW$CU, DW_AT_language(DW_LANG_C) ;*************************************************************** ;* DWARF CIE ENTRIES * ;*************************************************************** $C$DW$CIE .dwcie 14 .dwcfi cfa_register, 13 .dwcfi cfa_offset, 0 .dwcfi same_value, 4 .dwcfi same_value, 5 .dwcfi same_value, 6 .dwcfi same_value, 7 .dwcfi same_value, 8 .dwcfi same_value, 9 .dwcfi same_value, 10 .dwcfi same_value, 11 .dwendentry ;*************************************************************** ;* DWARF REGISTER MAP * ;*************************************************************** $C$DW$1289 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1289, DW_AT_name("A1") .dwattr $C$DW$1289, DW_AT_location[DW_OP_reg0] $C$DW$1290 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1290, DW_AT_name("A2") .dwattr $C$DW$1290, DW_AT_location[DW_OP_reg1] $C$DW$1291 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1291, DW_AT_name("A3") .dwattr $C$DW$1291, DW_AT_location[DW_OP_reg2] $C$DW$1292 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1292, DW_AT_name("A4") .dwattr $C$DW$1292, DW_AT_location[DW_OP_reg3] $C$DW$1293 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1293, DW_AT_name("V1") .dwattr $C$DW$1293, DW_AT_location[DW_OP_reg4] $C$DW$1294 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1294, DW_AT_name("V2") .dwattr $C$DW$1294, DW_AT_location[DW_OP_reg5] $C$DW$1295 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1295, DW_AT_name("V3") .dwattr $C$DW$1295, DW_AT_location[DW_OP_reg6] $C$DW$1296 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1296, DW_AT_name("V4") .dwattr $C$DW$1296, DW_AT_location[DW_OP_reg7] $C$DW$1297 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1297, DW_AT_name("V5") .dwattr $C$DW$1297, DW_AT_location[DW_OP_reg8] $C$DW$1298 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1298, DW_AT_name("V6") .dwattr $C$DW$1298, DW_AT_location[DW_OP_reg9] $C$DW$1299 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1299, DW_AT_name("V7") .dwattr $C$DW$1299, DW_AT_location[DW_OP_reg10] $C$DW$1300 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1300, DW_AT_name("V8") .dwattr $C$DW$1300, DW_AT_location[DW_OP_reg11] $C$DW$1301 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1301, DW_AT_name("V9") .dwattr $C$DW$1301, DW_AT_location[DW_OP_reg12] $C$DW$1302 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1302, DW_AT_name("SP") .dwattr $C$DW$1302, DW_AT_location[DW_OP_reg13] $C$DW$1303 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1303, DW_AT_name("LR") .dwattr $C$DW$1303, DW_AT_location[DW_OP_reg14] $C$DW$1304 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1304, DW_AT_name("PC") .dwattr $C$DW$1304, DW_AT_location[DW_OP_reg15] $C$DW$1305 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1305, DW_AT_name("SR") .dwattr $C$DW$1305, DW_AT_location[DW_OP_reg17] $C$DW$1306 .dwtag DW_TAG_TI_assign_register .dwattr $C$DW$1306, DW_AT_name("AP") .dwattr $C$DW$1306, DW_AT_location[DW_OP_reg7] .dwendtag $C$DW$CU
; Dummy function to keep rest of libs happy ; ; $Id: readbyte.asm,v 1.5 2016-03-06 21:39:54 dom Exp $ ; SECTION code_clib PUBLIC readbyte PUBLIC _readbyte .readbyte ._readbyte ret
; A264619: a(0) = 1; for n>0, working in binary, write n followed by 1 then n-reversed (including leading zeros); show result in base 10. ; 1,7,21,31,73,93,107,127,273,313,341,381,403,443,471,511,1057,1137,1193,1273,1317,1397,1453,1533,1571,1651,1707,1787,1831,1911,1967,2047,4161,4321,4433,4593,4681,4841,4953,5113,5189,5349,5461,5621,5709,5869,5981,6141,6211,6371,6483,6643,6731,6891,7003,7163,7239,7399,7511,7671,7759,7919,8031,8191,16513,16833,17057,17377,17553,17873,18097,18417,18569,18889,19113,19433,19609,19929,20153,20473,20613,20933,21157,21477,21653,21973,22197,22517,22669,22989,23213,23533,23709,24029,24253,24573,24707,25027 mov $1,2 lpb $0 mov $2,$0 div $0,2 seq $2,47264 ; Numbers that are congruent to 0 or 5 mod 6. add $1,$2 mul $1,2 lpe div $1,2 mov $0,$1
%ifdef CONFIG { "RegData": { "RAX": "0x1", "RBX": "0x0" }, "MemoryRegions": { "0x100000000": "4096" } } %endif mov r15, 0xe0000000 mov r10, 0x2 mov r11, 0x0 mov r12, 0x1 cmp r10d, r12d mov rax, 0 mov rbx, 0 setnz al setz bl hlt
#include <vector> #include <iostream> #include <cstdlib> #include <algorithm> int BinarySearch(std::vector<int>& arr, int value){ if(arr.empty()){return -1;} int start = 0; int end = arr.size()-1; while(start<end){ int middle = (start+end)/2; if(arr[middle]==value){return middle;} if(arr[middle] > value){ end = middle-1; } else{ start = middle+1; } } return -1; } int main(){ std::vector<int> arr; for(int i = 0; i < 10; i++){ arr.push_back(rand()%10); } sort(arr.begin(),arr.end()); for(auto element : arr){ std::cout << element << ' '; } std::cout << std::endl; std::cout << BinarySearch(arr, 7) << std::endl; //std::cout << std::binary_search(arr, 7) << std::endl; return 0; }
; A061006: a(n) = (n-1)! mod n. ; 0,1,2,2,4,0,6,0,0,0,10,0,12,0,0,0,16,0,18,0,0,0,22,0,0,0,0,0,28,0,30,0,0,0,0,0,36,0,0,0,40,0,42,0,0,0,46,0,0,0,0,0,52,0,0,0,0,0,58,0,60,0,0,0,0,0,66,0,0,0,70,0,72,0,0,0,0,0,78,0,0,0,82,0,0,0,0,0,88,0,0,0,0,0,0,0,96,0,0,0,100,0,102,0,0,0,106,0,108,0,0,0,112,0,0,0,0,0,0,0,0,0,0,0,0,0,126,0,0,0,130,0,0,0,0,0,136,0,138,0,0,0,0,0,0,0,0,0,148,0,150,0,0,0,0,0,156,0,0,0,0,0,162,0,0,0,166,0,0,0,0,0,172,0,0,0,0,0,178,0,180,0,0,0,0,0,0,0,0,0,190,0,192,0,0,0,196,0,198,0,0,0,0,0,0,0,0,0,0,0,210,0,0,0,0,0,0,0,0,0,0,0,222,0,0,0,226,0,228,0,0,0,232,0,0,0,0,0,238,0,240,0,0,0,0,0,0,0,0,0 sub $0,2 mov $1,2 bin $1,$0 mov $2,$1 cmp $2,0 add $1,$2 div $0,$1 add $0,2 mov $1,$0 cal $0,10051 ; Characteristic function of primes: 1 if n is prime, else 0. mul $1,$0
; A005030: a(n) = 5*3^n. ; 5,15,45,135,405,1215,3645,10935,32805,98415,295245,885735,2657205,7971615,23914845,71744535,215233605,645700815,1937102445,5811307335,17433922005,52301766015,156905298045,470715894135,1412147682405,4236443047215,12709329141645,38127987424935,114383962274805,343151886824415,1029455660473245,3088366981419735 mov $1,3 pow $1,$0 mul $1,5
; ; Small C+ Runtime Library ; ; Z88 Application functions ; ; *** Z88 SPECIFIC FUNCTION - probably no equiv for your machine! *** ; ; 11/4/99 ; ; Save User Screen ; ; int savescr(void) ; ; Returns 0 on failure, or handle on success XLIB savescr INCLUDE "#saverst.def" .savescr ld a,SR_SUS call_oz(os_sr) ld hl,0 ret c push ix pop hl ret
; vim:filetype=nasm ts=8 ; libFLAC - Free Lossless Audio Codec library ; Copyright (C) 2001-2009 Josh Coalson ; Copyright (C) 2011-2016 Xiph.Org Foundation ; ; Redistribution and use in source and binary forms, with or without ; modification, are permitted provided that the following conditions ; are met: ; ; - Redistributions of source code must retain the above copyright ; notice, this list of conditions and the following disclaimer. ; ; - Redistributions in binary form must reproduce the above copyright ; notice, this list of conditions and the following disclaimer in the ; documentation and/or other materials provided with the distribution. ; ; - Neither the name of the Xiph.org Foundation nor the names of its ; contributors may be used to endorse or promote products derived from ; this software without specific prior written permission. ; ; THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS ; ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT ; LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR ; A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR ; CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, ; EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, ; PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR ; PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF ; LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING ; NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS ; SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. %include "nasm.h" data_section cglobal FLAC__cpu_have_cpuid_asm_ia32 cglobal FLAC__cpu_info_asm_ia32 code_section ; ********************************************************************** ; ; FLAC__uint32 FLAC__cpu_have_cpuid_asm_ia32() ; cident FLAC__cpu_have_cpuid_asm_ia32 pushfd pop eax mov edx, eax xor eax, 0x00200000 push eax popfd pushfd pop eax xor eax, edx and eax, 0x00200000 shr eax, 0x15 push edx popfd ret ; ********************************************************************** ; ; void FLAC__cpu_info_asm_ia32(FLAC__uint32 level, FLAC__uint32 *eax, FLAC__uint32 *ebx, FLAC__uint32 *ecx, FLAC__uint32 *edx) ; cident FLAC__cpu_info_asm_ia32 ;[esp + 8] == level ;[esp + 12] == flags_eax ;[esp + 16] == flags_ebx ;[esp + 20] == flags_ecx ;[esp + 24] == flags_edx push ebx call FLAC__cpu_have_cpuid_asm_ia32 test eax, eax jz .no_cpuid mov eax, [esp + 8] and eax, 0x80000000 cpuid cmp eax, [esp + 8] jb .no_cpuid xor ecx, ecx mov eax, [esp + 8] cpuid push ebx ;[esp + 16] == flags_eax mov ebx, [esp + 16] mov [ebx], eax pop eax ;[esp + 16] == flags_ebx mov ebx, [esp + 16] mov [ebx], eax mov ebx, [esp + 20] mov [ebx], ecx mov ebx, [esp + 24] mov [ebx], edx jmp .end .no_cpuid: xor eax, eax mov ebx, [esp + 12] mov [ebx], eax mov ebx, [esp + 16] mov [ebx], eax mov ebx, [esp + 20] mov [ebx], eax mov ebx, [esp + 24] mov [ebx], eax .end: pop ebx ret ; end
#include <math/subtract/subtract.h> int math::subtract( int a, int b ) { return a - b; }
// // bind_no_placeholders_test.cpp - test for BOOST_BIND_NO_PLACEHOLDERS // // Copyright (c) 2001, 2002 Peter Dimov and Multi Media Ltd. // Copyright (c) 2001 David Abrahams // Copyright (c) 2015 Peter Dimov // // Distributed under the Boost Software License, Version 1.0. // See accompanying file LICENSE_1_0.txt or copy at // http://www.boost.org/LICENSE_1_0.txt // #define BOOST_BIND_NO_PLACEHOLDERS #include <boost/bind.hpp> #include <boost/core/lightweight_test.hpp> // long f_0() { return 17041L; } long f_1(long a) { return a; } long f_2(long a, long b) { return a + 10 * b; } long f_3(long a, long b, long c) { return a + 10 * b + 100 * c; } long f_4(long a, long b, long c, long d) { return a + 10 * b + 100 * c + 1000 * d; } long f_5(long a, long b, long c, long d, long e) { return a + 10 * b + 100 * c + 1000 * d + 10000 * e; } long f_6(long a, long b, long c, long d, long e, long f) { return a + 10 * b + 100 * c + 1000 * d + 10000 * e + 100000 * f; } long f_7(long a, long b, long c, long d, long e, long f, long g) { return a + 10 * b + 100 * c + 1000 * d + 10000 * e + 100000 * f + 1000000 * g; } long f_8(long a, long b, long c, long d, long e, long f, long g, long h) { return a + 10 * b + 100 * c + 1000 * d + 10000 * e + 100000 * f + 1000000 * g + 10000000 * h; } long f_9(long a, long b, long c, long d, long e, long f, long g, long h, long i) { return a + 10 * b + 100 * c + 1000 * d + 10000 * e + 100000 * f + 1000000 * g + 10000000 * h + 100000000 * i; } void function_test() { using namespace boost; arg<1> _1; arg<2> _2; arg<3> _3; arg<4> _4; arg<5> _5; arg<6> _6; arg<7> _7; arg<8> _8; arg<9> _9; BOOST_TEST( bind(f_0)() == 17041L ); BOOST_TEST( bind(f_1, _1)(1) == 1L ); BOOST_TEST( bind(f_2, _1, _2)(1, 2) == 21L ); BOOST_TEST( bind(f_3, _1, _2, _3)(1, 2, 3) == 321L ); BOOST_TEST( bind(f_4, _1, _2, _3, _4)(1, 2, 3, 4) == 4321L ); BOOST_TEST( bind(f_5, _1, _2, _3, _4, _5)(1, 2, 3, 4, 5) == 54321L ); BOOST_TEST( bind(f_6, _1, _2, _3, _4, _5, _6)(1, 2, 3, 4, 5, 6) == 654321L ); BOOST_TEST( bind(f_7, _1, _2, _3, _4, _5, _6, _7)(1, 2, 3, 4, 5, 6, 7) == 7654321L ); BOOST_TEST( bind(f_8, _1, _2, _3, _4, _5, _6, _7, _8)(1, 2, 3, 4, 5, 6, 7, 8) == 87654321L ); BOOST_TEST( bind(f_9, _1, _2, _3, _4, _5, _6, _7, _8, _9)(1, 2, 3, 4, 5, 6, 7, 8, 9) == 987654321L ); } int main() { function_test(); return boost::report_errors(); }