id
float64
706
1.8k
title
stringlengths
1
343
abstract
stringlengths
6
6.09k
categories
stringlengths
5
125
processed_abstract
stringlengths
2
5.96k
tokenized_abstract
stringlengths
8
8.74k
centroid
stringlengths
2.1k
2.17k
1,803.09367
Opposition diagrams for automorphisms of small spherical buildings
An automorphism $\theta$ of a spherical building $\Delta$ is called \textit{capped} if it satisfies the following property: if there exist both type $J_1$ and $J_2$ simplices of $\Delta$ mapped onto opposite simplices by $\theta$ then there exists a type $J_1\cup J_2$ simplex of $\Delta$ mapped onto an opposite simpl...
math.CO
an automorphism theta of a spherical building delta is called textitcapped if it satisfies the following property if there exist both type j_1 and j_2 simplices of delta mapped onto opposite simplices by theta then there exists a type j_1cup j_2 simplex of delta mapped onto an opposite simplex by theta in previous work...
[['an', 'automorphism', 'theta', 'of', 'a', 'spherical', 'building', 'delta', 'is', 'called', 'textitcapped', 'if', 'it', 'satisfies', 'the', 'following', 'property', 'if', 'there', 'exist', 'both', 'type', 'j_1', 'and', 'j_2', 'simplices', 'of', 'delta', 'mapped', 'onto', 'opposite', 'simplices', 'by', 'theta', 'then'...
[-0.17085841884194264, 0.1182438481337158, -0.040730379955393484, 0.016952537166372197, -0.04959135783579329, -0.13093630154135413, 0.01990435434714088, 0.38117038749383186, -0.2866469197424835, -0.19598376898673073, 0.0912882983138592, -0.3144227662477, -0.1771417593575436, 0.170391634296112, -0.10987278570035665, -0....
1,803.09368
Variations on the $S_n$-module $Lie_n$
We define, for each subset $S$ of primes, an $S_n$-module $Lie_n^S$ with interesting properties. When $S=\emptyset,$ this is the well-known representation $Lie_n$ of $S_n$ afforded by the free Lie algebra. The most intriguing case is $S=\{2\},$ giving a decomposition of the regular representation as a sum of {exter...
math.RT math.CO
we define for each subset s of primes an s_nmodule lie_ns with interesting properties when semptyset this is the wellknown representation lie_n of s_n afforded by the free lie algebra the most intriguing case is s2 giving a decomposition of the regular representation as a sum of exterior powers of modules lie_n2 this i...
[['we', 'define', 'for', 'each', 'subset', 's', 'of', 'primes', 'an', 's_nmodule', 'lie_ns', 'with', 'interesting', 'properties', 'when', 'semptyset', 'this', 'is', 'the', 'wellknown', 'representation', 'lie_n', 'of', 's_n', 'afforded', 'by', 'the', 'free', 'lie', 'algebra', 'the', 'most', 'intriguing', 'case', 'is', '...
[-0.15856547682148636, 0.02585996475575305, -0.1012788556907682, 0.04136457084900563, -0.1256952228700849, -0.09617930906676468, -0.005521974975694042, 0.30407992176189547, -0.37465267508086053, -0.20017771555443004, 0.12323343582750909, -0.21956766625402116, -0.1525411415744312, 0.17542500381104376, -0.117495282027691...
1,803.09369
Towards a Cybernetic Foundation for Natural Resource Governance
This study explores the potential of the cybernetic method of inquiry for the problem of natural resource governance. The systems way of thinking has already enabled scientists to gain considerable headway in framing global environmental challenges. On the other hand, technical solutions to environmental problems hav...
cs.SY
this study explores the potential of the cybernetic method of inquiry for the problem of natural resource governance the systems way of thinking has already enabled scientists to gain considerable headway in framing global environmental challenges on the other hand technical solutions to environmental problems have beg...
[['this', 'study', 'explores', 'the', 'potential', 'of', 'the', 'cybernetic', 'method', 'of', 'inquiry', 'for', 'the', 'problem', 'of', 'natural', 'resource', 'governance', 'the', 'systems', 'way', 'of', 'thinking', 'has', 'already', 'enabled', 'scientists', 'to', 'gain', 'considerable', 'headway', 'in', 'framing', 'gl...
[-0.10307841519929774, 0.0334207547897224, -0.0808421606090658, 0.08004155226399444, -0.0800514464923245, -0.13450832848884015, 0.07909587261960134, 0.35675890380645403, -0.28838315624572025, -0.34445603382408896, 0.09026919944106691, -0.23175776949847623, -0.214450941680746, 0.1994148158583112, -0.13762234620672698, 0...
1,803.0937
Popular Matching in Roommates Setting is NP-hard
An input to the Popular Matching problem, in the roommates setting, consists of a graph $G$ and each vertex ranks its neighbors in strict order, known as its preference. In the Popular Matching problem the objective is to test whether there exists a matching $M^\star$ such that there is no matching $M$ where more peo...
cs.DS cs.CC cs.GT
an input to the popular matching problem in the roommates setting consists of a graph g and each vertex ranks its neighbors in strict order known as its preference in the popular matching problem the objective is to test whether there exists a matching mstar such that there is no matching m where more people are happie...
[['an', 'input', 'to', 'the', 'popular', 'matching', 'problem', 'in', 'the', 'roommates', 'setting', 'consists', 'of', 'a', 'graph', 'g', 'and', 'each', 'vertex', 'ranks', 'its', 'neighbors', 'in', 'strict', 'order', 'known', 'as', 'its', 'preference', 'in', 'the', 'popular', 'matching', 'problem', 'the', 'objective', ...
[-0.11022332337497752, 0.03342685853296608, -0.034108424495321275, 0.07818332442091595, -0.11150787552983008, -0.1391906792950798, 0.05755065840454407, 0.42392859611587197, -0.2669484228644447, -0.3605261102830078, 0.11515216709128306, -0.30170777168435353, -0.15527395030663932, 0.13378594371983232, -0.1364306551723869...
1,803.09371
StaQC: A Systematically Mined Question-Code Dataset from Stack Overflow
Stack Overflow (SO) has been a great source of natural language questions and their code solutions (i.e., question-code pairs), which are critical for many tasks including code retrieval and annotation. In most existing research, question-code pairs were collected heuristically and tend to have low quality. In this p...
cs.CL
stack overflow so has been a great source of natural language questions and their code solutions ie questioncode pairs which are critical for many tasks including code retrieval and annotation in most existing research questioncode pairs were collected heuristically and tend to have low quality in this paper we investi...
[['stack', 'overflow', 'so', 'has', 'been', 'a', 'great', 'source', 'of', 'natural', 'language', 'questions', 'and', 'their', 'code', 'solutions', 'ie', 'questioncode', 'pairs', 'which', 'are', 'critical', 'for', 'many', 'tasks', 'including', 'code', 'retrieval', 'and', 'annotation', 'in', 'most', 'existing', 'research...
[-0.06328818687166937, -0.02462908110844538, -0.03186161182795489, 0.11554572803256831, -0.13674921809338822, -0.18350453470813352, 0.07993978384879681, 0.42741783933319233, -0.2888161224223238, -0.3860220315147434, 0.09326403823386341, -0.32424748587199365, -0.10744604503649854, 0.218212557638965, -0.09974507399222246...
1,803.09372
Time-Dispersive Behaviour as a Feature of Critical Contrast Media
Motivated by the urgent need to attribute a rigorous mathematical meaning to the term "metamaterial", we propose a novel approach to the homogenisation of critical-contrast composites. This is based on the asymptotic analysis of the Dirichlet-to-Neumann map on the interface between different components ("stiff" and "...
math-ph cond-mat.mtrl-sci math.MP
motivated by the urgent need to attribute a rigorous mathematical meaning to the term metamaterial we propose a novel approach to the homogenisation of criticalcontrast composites this is based on the asymptotic analysis of the dirichlettoneumann map on the interface between different components stiff and soft of the m...
[['motivated', 'by', 'the', 'urgent', 'need', 'to', 'attribute', 'a', 'rigorous', 'mathematical', 'meaning', 'to', 'the', 'term', 'metamaterial', 'we', 'propose', 'a', 'novel', 'approach', 'to', 'the', 'homogenisation', 'of', 'criticalcontrast', 'composites', 'this', 'is', 'based', 'on', 'the', 'asymptotic', 'analysis'...
[-0.11685257391610111, 0.07259872537850662, -0.13240008620330349, 0.0037036737216672357, -0.14325205146227604, -0.09257587207517085, 0.05161776137202441, 0.36237333526010984, -0.2771719579322962, -0.2936424675863236, 0.0930515554030605, -0.2610038723238316, -0.19737812977893135, 0.15661979634135675, -0.0429675716217249...
1,803.09373
The continuous dependence for the Hal-MHD equations with fractional magnetic diffusion
In this paper we show that the solutions to the incompressible Hall-MHD system with fractional magnetic diffusion depend continuously on the initial data in $H^s(\mathbb{R}^d)$, $s>1+\frac{d}{2}$.
math.AP
in this paper we show that the solutions to the incompressible hallmhd system with fractional magnetic diffusion depend continuously on the initial data in hsmathbbrd s1fracd2
[['in', 'this', 'paper', 'we', 'show', 'that', 'the', 'solutions', 'to', 'the', 'incompressible', 'hallmhd', 'system', 'with', 'fractional', 'magnetic', 'diffusion', 'depend', 'continuously', 'on', 'the', 'initial', 'data', 'in', 'hsmathbbrd', 's1fracd2']]
[-0.14952392244711518, 0.10621377225965262, -0.06330075925216079, -0.012382940459065139, -0.02803500762209296, -0.05564918637275696, -0.06634282189887017, 0.33310791105031967, -0.3061619970202446, -0.2801953101158142, 0.16059623249806465, -0.26335847809910773, -0.11969153314828873, 0.19781490735709667, -0.0676532617211...
1,803.09374
Generalized Hadamard-Product Fusion Operators for Visual Question Answering
We propose a generalized class of multimodal fusion operators for the task of visual question answering (VQA). We identify generalizations of existing multimodal fusion operators based on the Hadamard product, and show that specific non-trivial instantiations of this generalized fusion operator exhibit superior perfo...
cs.LG cs.CV stat.ML
we propose a generalized class of multimodal fusion operators for the task of visual question answering vqa we identify generalizations of existing multimodal fusion operators based on the hadamard product and show that specific nontrivial instantiations of this generalized fusion operator exhibit superior performance ...
[['we', 'propose', 'a', 'generalized', 'class', 'of', 'multimodal', 'fusion', 'operators', 'for', 'the', 'task', 'of', 'visual', 'question', 'answering', 'vqa', 'we', 'identify', 'generalizations', 'of', 'existing', 'multimodal', 'fusion', 'operators', 'based', 'on', 'the', 'hadamard', 'product', 'and', 'show', 'that',...
[-0.03827275200000473, 0.013145592858355478, -0.012167332036321173, 0.053660937777999435, -0.08570296684535973, -0.14354536363869222, 0.04526887604796136, 0.4282215355241401, -0.25956732293462936, -0.2662828731402143, 0.05871728118437961, -0.25796938017152876, -0.1935958172201769, 0.19695347934278823, -0.13503675370384...
1,803.09375
Correcting differences in multi-site neuroimaging data using Generative Adversarial Networks
Magnetic Resonance Imaging (MRI) of the brain has been used to investigate a wide range of neurological disorders, but data acquisition can be expensive, time-consuming, and inconvenient. Multi-site studies present a valuable opportunity to advance research by pooling data in order to increase sensitivity and statist...
cs.CV
magnetic resonance imaging mri of the brain has been used to investigate a wide range of neurological disorders but data acquisition can be expensive timeconsuming and inconvenient multisite studies present a valuable opportunity to advance research by pooling data in order to increase sensitivity and statistical power...
[['magnetic', 'resonance', 'imaging', 'mri', 'of', 'the', 'brain', 'has', 'been', 'used', 'to', 'investigate', 'a', 'wide', 'range', 'of', 'neurological', 'disorders', 'but', 'data', 'acquisition', 'can', 'be', 'expensive', 'timeconsuming', 'and', 'inconvenient', 'multisite', 'studies', 'present', 'a', 'valuable', 'opp...
[0.0034362487753646243, 0.045042300209388486, -0.07445305019064108, 0.13963581603861208, -0.1252873022178257, -0.18588423352102162, 0.02492210824210714, 0.4435977107517559, -0.2701154684505632, -0.3588883533763389, 0.096144339929365, -0.30341759452992983, -0.1684501991282256, 0.19594434900230867, -0.13098545395122427, ...
1,803.09376
Distinct stages of radio frequency emission at the onset of pedestal collapse in KSTAR H-mode plasmas
Using a high-speed and broadband radio frequency (RF) (0.1-1 GHz) spectrum analyzer developed on the KSTAR tokamak, it is found that several distinct stages of RF emission appear at the pedestal collapse in high confinement discharges. Comparison with 2-D electron cyclotron emission (ECE) images has revealed that eac...
physics.plasm-ph
using a highspeed and broadband radio frequency rf 011 ghz spectrum analyzer developed on the kstar tokamak it is found that several distinct stages of rf emission appear at the pedestal collapse in high confinement discharges comparison with 2d electron cyclotron emission ece images has revealed that each stage is rel...
[['using', 'a', 'highspeed', 'and', 'broadband', 'radio', 'frequency', 'rf', '011', 'ghz', 'spectrum', 'analyzer', 'developed', 'on', 'the', 'kstar', 'tokamak', 'it', 'is', 'found', 'that', 'several', 'distinct', 'stages', 'of', 'rf', 'emission', 'appear', 'at', 'the', 'pedestal', 'collapse', 'in', 'high', 'confinement...
[-0.13822274565471496, 0.19713970080468488, -0.027836229870376733, 0.03109151151280826, -0.028895442587098266, -0.119262530002743, -0.01728442271112227, 0.4194395384976482, -0.19942837910349268, -0.28489634061073943, 0.0948096016106908, -0.2549220100851742, -0.02849683707299965, 0.1943652570320695, 0.06293660554550953,...
1,803.09377
Antineutrino Charged-Current reactions on Hydrocarbon with Low Momentum Transfer
We report on multinucleon effects in low momentum transfer ($< 0.8$ GeV/c) anti-neutrino interactions on plastic (CH) scintillator. These data are from the 2010-2011 antineutrino phase of the MINERvA experiment at Fermilab. The hadronic energy spectrum of this inclusive sample is well described when a screening effec...
hep-ex
we report on multinucleon effects in low momentum transfer 08 gevc antineutrino interactions on plastic ch scintillator these data are from the 20102011 antineutrino phase of the minerva experiment at fermilab the hadronic energy spectrum of this inclusive sample is well described when a screening effect at low energy ...
[['we', 'report', 'on', 'multinucleon', 'effects', 'in', 'low', 'momentum', 'transfer', '08', 'gevc', 'antineutrino', 'interactions', 'on', 'plastic', 'ch', 'scintillator', 'these', 'data', 'are', 'from', 'the', '20102011', 'antineutrino', 'phase', 'of', 'the', 'minerva', 'experiment', 'at', 'fermilab', 'the', 'hadroni...
[-0.009281078672879754, 0.20795770058290916, -0.07435209740232257, 0.14824177022781948, 0.000832443987648632, -0.1152477808598731, 0.05890297765323372, 0.37424081909629675, -0.18578964193259273, -0.3087010585224709, -0.06393432529299176, -0.41308676025217717, -0.011423350198546777, 0.16278251870912877, 0.05570116834631...
1,803.09378
Algebraic theories and commutativity in a sheaf topos
For any site of definition $\mathcal C$ of a Grothendieck topos $\mathcal E$, we define a notion of a $\mathcal C$-ary Lawvere theory $\tau: \mathscr C \to \mathscr T$ whose category of models is a stack over $\mathcal E$. Our definitions coincide with Lawvere's finitary theories when $\mathcal C=\aleph_0$ and $\math...
math.CT math.AP math.FA
for any site of definition mathcal c of a grothendieck topos mathcal e we define a notion of a mathcal cary lawvere theory tau mathscr c to mathscr t whose category of models is a stack over mathcal e our definitions coincide with lawveres finitary theories when mathcal caleph_0 and mathcal e operatornamemathbf set we ...
[['for', 'any', 'site', 'of', 'definition', 'mathcal', 'c', 'of', 'a', 'grothendieck', 'topos', 'mathcal', 'e', 'we', 'define', 'a', 'notion', 'of', 'a', 'mathcal', 'cary', 'lawvere', 'theory', 'tau', 'mathscr', 'c', 'to', 'mathscr', 't', 'whose', 'category', 'of', 'models', 'is', 'a', 'stack', 'over', 'mathcal', 'e', ...
[-0.16341771508789868, 0.0720483168227201, -0.03934422023937197, 0.0721010466654745, -0.06340978541440027, -0.18224410294195167, 0.00705619525818577, 0.3532577952130075, -0.3976934178406658, -0.13138683827628203, 0.007475178540210051, -0.22942845340521056, -0.09232397338923959, 0.1612133962685025, -0.17998676797363655,...
1,803.09379
Multiview Hierarchical Agglomerative Clustering for Identification of Development Gap and Regional Potential Sector
The identification of regional development gaps is an effort to see how far the development conducted in every District in a Province. By seeing the gaps occurred, it is expected that the Policymakers are able to determine which region that will be prioritized for future development. Along with the regional gaps, the...
cs.CY
the identification of regional development gaps is an effort to see how far the development conducted in every district in a province by seeing the gaps occurred it is expected that the policymakers are able to determine which region that will be prioritized for future development along with the regional gaps the ident...
[['the', 'identification', 'of', 'regional', 'development', 'gaps', 'is', 'an', 'effort', 'to', 'see', 'how', 'far', 'the', 'development', 'conducted', 'in', 'every', 'district', 'in', 'a', 'province', 'by', 'seeing', 'the', 'gaps', 'occurred', 'it', 'is', 'expected', 'that', 'the', 'policymakers', 'are', 'able', 'to',...
[-0.06791232265761568, 0.06611210055447193, -0.08545455527098351, 0.08561674983717803, -0.050272677328214575, -0.08735684777321426, 0.05856961911071984, 0.3604632338220385, -0.22475605030891707, -0.33744599940283976, 0.13314599515238948, -0.29417717530929915, -0.1058658886877951, 0.14866508187276875, -0.063903673206932...
1,803.0938
A distribution function correction-based immersed boundary- lattice Boltzmann method with truly second-order accuracy for fluid-solid flows
The immersed boundary lattice Boltzmann method (IB-LBM) has been widely used in the simulation of fluid-solid interaction and particulate flow problems, since proposed in 2004. However, it is usually a non-trivial task to retain the flexibility and the accuracy simultaneously in the implementation of this approach. B...
physics.comp-ph
the immersed boundary lattice boltzmann method iblbm has been widely used in the simulation of fluidsolid interaction and particulate flow problems since proposed in 2004 however it is usually a nontrivial task to retain the flexibility and the accuracy simultaneously in the implementation of this approach based on the...
[['the', 'immersed', 'boundary', 'lattice', 'boltzmann', 'method', 'iblbm', 'has', 'been', 'widely', 'used', 'in', 'the', 'simulation', 'of', 'fluidsolid', 'interaction', 'and', 'particulate', 'flow', 'problems', 'since', 'proposed', 'in', '2004', 'however', 'it', 'is', 'usually', 'a', 'nontrivial', 'task', 'to', 'reta...
[-0.10954272503861123, 0.07054251679036473, -0.120378247718675, 0.028868809883665834, -0.07427429091722633, -0.14398029489187986, 0.00214182794577657, 0.3745598663798828, -0.2579430433619035, -0.29965053025720656, 0.10260914884254925, -0.23637387321457967, -0.11983894709593211, 0.1664904767764796, -0.05312877193861442,...
1,803.09381
Boundary of the horseshoe locus for the H\'enon family
The purpose of this article is to investigate geometric properties of the parameter locus of the H\'enon family where the uniform hyperbolicity of a horseshoe breaks down. As an application, we obtain a variational characterization of equilibrium measures "at temperature zero" for the corresponding non-uniformly hype...
math.DS
the purpose of this article is to investigate geometric properties of the parameter locus of the henon family where the uniform hyperbolicity of a horseshoe breaks down as an application we obtain a variational characterization of equilibrium measures at temperature zero for the corresponding nonuniformly hyperbolic he...
[['the', 'purpose', 'of', 'this', 'article', 'is', 'to', 'investigate', 'geometric', 'properties', 'of', 'the', 'parameter', 'locus', 'of', 'the', 'henon', 'family', 'where', 'the', 'uniform', 'hyperbolicity', 'of', 'a', 'horseshoe', 'breaks', 'down', 'as', 'an', 'application', 'we', 'obtain', 'a', 'variational', 'char...
[-0.14049590419849953, 0.07785749805030341, -0.13118730175627713, 0.02936051697847811, -0.07129288621263595, -0.0828487003098351, 0.01784746098617377, 0.25500392602538474, -0.2718011738547871, -0.2273864413187881, 0.12400683224188618, -0.26028805664690163, -0.1642924063914531, 0.25515077081047466, -0.09092183761835636,...
1,803.09382
Ion backflow studies with a triple-GEM stack with increasing hole pitch
Gas Electron Multipliers have undergone a very consistent development since their invention in 1997. Their production procedures have been tuned in such a way that nowadays it is possible to produce foils with areas of the order of the square meter that can operate at a reasonable gain, uniform over large areas and w...
physics.ins-det
gas electron multipliers have undergone a very consistent development since their invention in 1997 their production procedures have been tuned in such a way that nowadays it is possible to produce foils with areas of the order of the square meter that can operate at a reasonable gain uniform over large areas and with ...
[['gas', 'electron', 'multipliers', 'have', 'undergone', 'a', 'very', 'consistent', 'development', 'since', 'their', 'invention', 'in', '1997', 'their', 'production', 'procedures', 'have', 'been', 'tuned', 'in', 'such', 'a', 'way', 'that', 'nowadays', 'it', 'is', 'possible', 'to', 'produce', 'foils', 'with', 'areas', '...
[-0.054191572717378955, 0.1336265810468737, -0.08372215373374368, 0.02419492300808641, -0.0012902416164036264, -0.15659475180118815, -0.03423297943273732, 0.41801446011366766, -0.2139902537779825, -0.3437051375182922, 0.1299691773763829, -0.2923613549870218, -0.020372918610744292, 0.2351954641197472, -0.063004785154936...
1,803.09383
Online Second Order Methods for Non-Convex Stochastic Optimizations
This paper proposes a family of online second order methods for possibly non-convex stochastic optimizations based on the theory of preconditioned stochastic gradient descent (PSGD), which can be regarded as an enhance stochastic Newton method with the ability to handle gradient noise and non-convexity simultaneously...
stat.ML cs.LG
this paper proposes a family of online second order methods for possibly nonconvex stochastic optimizations based on the theory of preconditioned stochastic gradient descent psgd which can be regarded as an enhance stochastic newton method with the ability to handle gradient noise and nonconvexity simultaneously we hav...
[['this', 'paper', 'proposes', 'a', 'family', 'of', 'online', 'second', 'order', 'methods', 'for', 'possibly', 'nonconvex', 'stochastic', 'optimizations', 'based', 'on', 'the', 'theory', 'of', 'preconditioned', 'stochastic', 'gradient', 'descent', 'psgd', 'which', 'can', 'be', 'regarded', 'as', 'an', 'enhance', 'stocha...
[-0.05733593464360527, -0.05301319429764124, -0.06548071683174363, 0.0452602121314579, -0.08727739787115375, -0.20059858689300444, -0.02481531790207799, 0.4420533058767366, -0.33843745959059496, -0.30120986592160853, 0.11152061293108911, -0.21633987709107558, -0.24188105922288874, 0.21548228372717504, -0.12785964971976...
1,803.09384
Tame topology of arithmetic quotients and algebraicity of Hodge loci
We prove that the uniformizing map of any arithmetic quotient, as well as the period map associated to any pure polarized $\mathbb{Z}$-variation of Hodge structure $\mathbb{V}$ on a smooth complex quasi-projective variety $S$, are topologically tame. As an easy corollary of these results and of Peterzil-Starchenko's ...
math.AG math.DG math.LO
we prove that the uniformizing map of any arithmetic quotient as well as the period map associated to any pure polarized mathbbzvariation of hodge structure mathbbv on a smooth complex quasiprojective variety s are topologically tame as an easy corollary of these results and of peterzilstarchenkos ominimal gaga theorem...
[['we', 'prove', 'that', 'the', 'uniformizing', 'map', 'of', 'any', 'arithmetic', 'quotient', 'as', 'well', 'as', 'the', 'period', 'map', 'associated', 'to', 'any', 'pure', 'polarized', 'mathbbzvariation', 'of', 'hodge', 'structure', 'mathbbv', 'on', 'a', 'smooth', 'complex', 'quasiprojective', 'variety', 's', 'are', '...
[-0.20601856415825232, 0.0427861273473744, -0.13726985001204803, 0.09771841336873227, -0.1150821415840515, -0.12203058610404176, 0.03520566626851048, 0.31636857925248996, -0.37353416995278427, -0.18300827326519148, 0.10949229329292264, -0.19245131297835283, -0.14459989661949554, 0.24131508613354527, -0.1838699388317763...
1,803.09385
Quantifying the quantumness of ensembles via unitary similarity invariant norms
The quantification of the quantumness of a quantum ensemble has theoretical and practical significance in quantum information theory. We propose herein a class of measures of the quantumness of quantum ensembles using the unitary similarity invariant norms of the commutators of the constituent density operators of an...
quant-ph
the quantification of the quantumness of a quantum ensemble has theoretical and practical significance in quantum information theory we propose herein a class of measures of the quantumness of quantum ensembles using the unitary similarity invariant norms of the commutators of the constituent density operators of an en...
[['the', 'quantification', 'of', 'the', 'quantumness', 'of', 'a', 'quantum', 'ensemble', 'has', 'theoretical', 'and', 'practical', 'significance', 'in', 'quantum', 'information', 'theory', 'we', 'propose', 'herein', 'a', 'class', 'of', 'measures', 'of', 'the', 'quantumness', 'of', 'quantum', 'ensembles', 'using', 'the'...
[-0.120361712832498, 0.1649107847480657, -0.13687096889681963, 0.09701216151481684, 0.02563799704586593, -0.1340396362689457, 0.04280596486250015, 0.3389340983323601, -0.29768320652941355, -0.2247497267707498, 0.05605126766259877, -0.2651071718190702, -0.14152999941677769, 0.1503471444950116, -0.11769605162363424, 0.17...
1,803.09386
A Systematic Comparison of Deep Learning Architectures in an Autonomous Vehicle
Self-driving technology is advancing rapidly --- albeit with significant challenges and limitations. This progress is largely due to recent developments in deep learning algorithms. To date, however, there has been no systematic comparison of how different deep learning architectures perform at such tasks, or an atte...
cs.LG cs.CV cs.RO stat.ML
selfdriving technology is advancing rapidly albeit with significant challenges and limitations this progress is largely due to recent developments in deep learning algorithms to date however there has been no systematic comparison of how different deep learning architectures perform at such tasks or an attempt to deter...
[['selfdriving', 'technology', 'is', 'advancing', 'rapidly', 'albeit', 'with', 'significant', 'challenges', 'and', 'limitations', 'this', 'progress', 'is', 'largely', 'due', 'to', 'recent', 'developments', 'in', 'deep', 'learning', 'algorithms', 'to', 'date', 'however', 'there', 'has', 'been', 'no', 'systematic', 'comp...
[-0.06820020496923422, 0.033189941357226825, 0.0005558438184433174, 0.03973018871722267, -0.030809285040149452, -0.19880457240200167, 0.03804982136544112, 0.4840706502644848, -0.21980223474755584, -0.3944456009874052, 0.08934946299613841, -0.2565903130164166, -0.137226675057539, 0.22399688018468908, -0.1187125667079902...
1,803.09387
3D Asymmetrical motions of the Galactic outer disk with LAMOST K giant stars
We present a three dimensional velocity analysis of Milky Way disk kinematics using LAMOST K giant stars and the GPS1 proper motion catalogue. We find that Galactic disk stars near the anticenter direction (in the range of Galactocentric distance between $R=8$ and $13$ kpc and vertical position between $Z=-2$ and $2$...
astro-ph.GA
we present a three dimensional velocity analysis of milky way disk kinematics using lamost k giant stars and the gps1 proper motion catalogue we find that galactic disk stars near the anticenter direction in the range of galactocentric distance between r8 and 13 kpc and vertical position between z2 and 2 kpc exhibit as...
[['we', 'present', 'a', 'three', 'dimensional', 'velocity', 'analysis', 'of', 'milky', 'way', 'disk', 'kinematics', 'using', 'lamost', 'k', 'giant', 'stars', 'and', 'the', 'gps1', 'proper', 'motion', 'catalogue', 'we', 'find', 'that', 'galactic', 'disk', 'stars', 'near', 'the', 'anticenter', 'direction', 'in', 'the', '...
[-0.1434148196122831, 0.1538124758289571, -0.0718351850312238, 0.06439341851520987, -0.12247922808523769, -0.02129430933020439, 0.011529047239058277, 0.43672172250726615, -0.2399398886208873, -0.32975622170352353, 0.003290342675656881, -0.29097430877143815, -0.012250823507337857, 0.19292208344662545, 0.0063235897234386...
1,803.09388
Interference-assisted resonant detection of axions
Detection schemes for the quantum chromodynamics axions and other axion-like particles in light-shining-through-a-wall (LSW) experiments are based on the conversion of these particles into photons in a magnetic field. An alternative scheme may involve the detection via a resonant atomic or molecular transition induce...
hep-ph astro-ph.CO physics.atom-ph
detection schemes for the quantum chromodynamics axions and other axionlike particles in lightshiningthroughawall lsw experiments are based on the conversion of these particles into photons in a magnetic field an alternative scheme may involve the detection via a resonant atomic or molecular transition induced by reson...
[['detection', 'schemes', 'for', 'the', 'quantum', 'chromodynamics', 'axions', 'and', 'other', 'axionlike', 'particles', 'in', 'lightshiningthroughawall', 'lsw', 'experiments', 'are', 'based', 'on', 'the', 'conversion', 'of', 'these', 'particles', 'into', 'photons', 'in', 'a', 'magnetic', 'field', 'an', 'alternative', ...
[-0.16743855724854165, 0.2895548916331903, -0.05672451960487982, 0.07061473889550827, -0.06825254719411389, -0.09204769150741147, 0.053449299759388474, 0.37135858623457424, -0.21248215508092655, -0.3318697338233168, 0.022795388684346433, -0.27376157476493485, -0.10354246857597, 0.18852255568483822, 0.10290409345179796,...
1,803.09389
On graded $\mathbb{E}_{\infty}$-rings and projective schemes in spectral algebraic geometry
We introduce graded $\mathbb{E}_{\infty}$-rings and graded modules over them, and study their properties. We construct projective schemes associated to connective $\mathbb{N}$-graded $\mathbb{E}_{\infty}$-rings in spectral algebraic geometry. Under some finiteness conditions, we show that the $\infty$-category of alm...
math.KT
we introduce graded mathbbe_inftyrings and graded modules over them and study their properties we construct projective schemes associated to connective mathbbngraded mathbbe_inftyrings in spectral algebraic geometry under some finiteness conditions we show that the inftycategory of almost perfect quasicoherent sheaves ...
[['we', 'introduce', 'graded', 'mathbbe_inftyrings', 'and', 'graded', 'modules', 'over', 'them', 'and', 'study', 'their', 'properties', 'we', 'construct', 'projective', 'schemes', 'associated', 'to', 'connective', 'mathbbngraded', 'mathbbe_inftyrings', 'in', 'spectral', 'algebraic', 'geometry', 'under', 'some', 'finite...
[-0.21933327028527855, 0.009004915738478303, -0.10650563972691694, 0.07835340206511318, -0.07002238559459026, -0.1730305119495218, -0.08008256123090783, 0.4672394398599863, -0.4461284400274356, -0.11861486497024695, 0.08591363478529578, -0.13803767614687482, -0.14203303984443968, 0.21167465389395754, -0.249947447593634...
1,803.0939
21cm Limits on Decaying Dark Matter and Primordial Black Holes
Recently the Experiment to Detect the Global Epoch of Reionization Signature (EDGES) reported the detection of a 21cm absorption signal stronger than astrophysical expectations. In this paper we study the impact of radiation from dark matter (DM) decay and primordial black holes (PBH) on the 21cm radiation temperatur...
astro-ph.HE hep-ph
recently the experiment to detect the global epoch of reionization signature edges reported the detection of a 21cm absorption signal stronger than astrophysical expectations in this paper we study the impact of radiation from dark matter dm decay and primordial black holes pbh on the 21cm radiation temperature in the ...
[['recently', 'the', 'experiment', 'to', 'detect', 'the', 'global', 'epoch', 'of', 'reionization', 'signature', 'edges', 'reported', 'the', 'detection', 'of', 'a', '21cm', 'absorption', 'signal', 'stronger', 'than', 'astrophysical', 'expectations', 'in', 'this', 'paper', 'we', 'study', 'the', 'impact', 'of', 'radiation...
[-0.07920794589194378, 0.18098324100073013, -0.01719282558230959, 0.17307118805560837, -0.0785201347743741, -0.1275054475150278, 0.023035527265703962, 0.29398467504264164, -0.149513811069213, -0.32083595794177167, 0.0012762141184928758, -0.35045991625197026, 0.06745669990346802, 0.21104218722838494, 0.13379196830188717...
1,803.09391
Have we seen all glitches?
Neutron star glitches are observed via artificially scheduled pulsar pulse arrival-time observations. Detection probability density of glitch events for a given data set is essentially required knowledge for realizing glitch detectability with specified observing system and schedule. In Yu & Liu, the detection probab...
astro-ph.HE
neutron star glitches are observed via artificially scheduled pulsar pulse arrivaltime observations detection probability density of glitch events for a given data set is essentially required knowledge for realizing glitch detectability with specified observing system and schedule in yu liu the detection probability de...
[['neutron', 'star', 'glitches', 'are', 'observed', 'via', 'artificially', 'scheduled', 'pulsar', 'pulse', 'arrivaltime', 'observations', 'detection', 'probability', 'density', 'of', 'glitch', 'events', 'for', 'a', 'given', 'data', 'set', 'is', 'essentially', 'required', 'knowledge', 'for', 'realizing', 'glitch', 'dete...
[-0.12264352538622916, 0.16216851459854903, -0.014650547464649813, 0.06145549012968938, -0.14460139620738724, -0.07440844591862211, 0.1095258180052042, 0.35368519158413014, -0.17027679276652635, -0.4168204065101842, 0.08894676302443258, -0.2902724104661805, -0.07070380033304294, 0.20279413253301753, -0.1231866773528357...
1,803.09392
On the square root of the inverse different
Let N/F be a finite, normal extension of number fields with Galois group G. Suppose that N/F is weakly ramified, and that the square root A(N/F) of the inverse different of N.F is defined. (This latter condition holds if, for example, G is of odd order.) B. Erez has conjectured that the class (A(N/F)) of A(N/F) in th...
math.NT
let nf be a finite normal extension of number fields with galois group g suppose that nf is weakly ramified and that the square root anf of the inverse different of nf is defined this latter condition holds if for example g is of odd order b erez has conjectured that the class anf of anf in the locally free class group...
[['let', 'nf', 'be', 'a', 'finite', 'normal', 'extension', 'of', 'number', 'fields', 'with', 'galois', 'group', 'g', 'suppose', 'that', 'nf', 'is', 'weakly', 'ramified', 'and', 'that', 'the', 'square', 'root', 'anf', 'of', 'the', 'inverse', 'different', 'of', 'nf', 'is', 'defined', 'this', 'latter', 'condition', 'holds...
[-0.19806680637702812, 0.16932323420769535, -0.07075279237220197, 0.029083827608181827, -0.09968496107363276, -0.18365412153070793, -0.0027888564841954838, 0.31187977977762266, -0.2634870761997133, -0.22417933854740113, 0.0585541923594844, -0.24358255081876581, -0.15084411603623135, 0.16309496297201673, -0.088714065102...
1,803.09393
A note on $L^2$ boundary integrals of the Bergman kernel
For any bounded convex domain $\Omega$ with $C^{2}$ boundary in $\mathbb{C}^{n}$, we show that there exist positive constants $C_{1}$ and $C_{2}$ such that \[ C_{1}\sqrt{\dfrac{K\left(w,w\right)}{\delta\left(w\right)}}\leq\left\Vert K\left(\cdot,w\right)\right\Vert _{L^{2}\left(\partial\Omega\right)}\leq C_{2}\sqrt{\...
math.CV
for any bounded convex domain omega with c2 boundary in mathbbcn we show that there exist positive constants c_1 and c_2 such that c_1sqrtdfrackleftwwrightdeltaleftwrightleqleftvert kleftcdotwrightrightvert _l2leftpartialomegarightleq c_2sqrtdfrackleftwwrightdeltaleftwright for any winomega here k is the bergman kernel...
[['for', 'any', 'bounded', 'convex', 'domain', 'omega', 'with', 'c2', 'boundary', 'in', 'mathbbcn', 'we', 'show', 'that', 'there', 'exist', 'positive', 'constants', 'c_1', 'and', 'c_2', 'such', 'that', 'c_1sqrtdfrackleftwwrightdeltaleftwrightleqleftvert', 'kleftcdotwrightrightvert', '_l2leftpartialomegarightleq', 'c_2s...
[-0.21428934955283216, 0.1497601627764341, 0.0077957892545351855, -0.017026487511190538, -0.09041448398248146, -0.17570489258995572, 0.009025706609367933, 0.4430265501141548, -0.28948215855971765, -0.10448603680063236, 0.12026344589876796, -0.2992428666666934, -0.14355340482372986, 0.18038338359819087, -0.0397698218738...
1,803.09394
A vertex reconstruction algorithm in the central detector of JUNO
The Jiangmen Underground Neutrino Observatory (JUNO) is designed to study neutrino mass hierarchy and measure three of the neutrino oscillation parameters with high precision using reactor antineutrinos. It is also able to study many other physical phenomena, including supernova neutrinos, solar neutrinos, geo-neutri...
physics.ins-det physics.data-an
the jiangmen underground neutrino observatory juno is designed to study neutrino mass hierarchy and measure three of the neutrino oscillation parameters with high precision using reactor antineutrinos it is also able to study many other physical phenomena including supernova neutrinos solar neutrinos geoneutrinos atmos...
[['the', 'jiangmen', 'underground', 'neutrino', 'observatory', 'juno', 'is', 'designed', 'to', 'study', 'neutrino', 'mass', 'hierarchy', 'and', 'measure', 'three', 'of', 'the', 'neutrino', 'oscillation', 'parameters', 'with', 'high', 'precision', 'using', 'reactor', 'antineutrinos', 'it', 'is', 'also', 'able', 'to', 's...
[-0.04640712819509786, 0.23309435615509608, -0.03911854289544299, 0.12251581814746525, -0.061022633563929285, -0.15693507646751959, 0.012163029073975807, 0.3175685815657525, -0.19995625069804396, -0.39237731371739115, 0.10840976120752477, -0.37353302266578686, -0.021958049545569937, 0.20877712471374535, -0.025096073335...
1,803.09395
From large-scale to protostellar disk fragmentation into close binary stars
Recent observations of young stellar systems with the Atacama Large Millimeter/submillimeter Array (ALMA) and the Karl G. Jansky Very Large Array (VLA) are helping to cement the idea that close companion stars form via fragmentation of a gravitationally unstable disk around a protostar early in the star formation pro...
astro-ph.SR astro-ph.GA
recent observations of young stellar systems with the atacama large millimetersubmillimeter array alma and the karl g jansky very large array vla are helping to cement the idea that close companion stars form via fragmentation of a gravitationally unstable disk around a protostar early in the star formation process as ...
[['recent', 'observations', 'of', 'young', 'stellar', 'systems', 'with', 'the', 'atacama', 'large', 'millimetersubmillimeter', 'array', 'alma', 'and', 'the', 'karl', 'g', 'jansky', 'very', 'large', 'array', 'vla', 'are', 'helping', 'to', 'cement', 'the', 'idea', 'that', 'close', 'companion', 'stars', 'form', 'via', 'fr...
[-0.1063790669171896, 0.1549156523938409, -0.06109703881760615, 0.06731327438434986, -0.060477851466913965, -0.04198348718201316, -0.013649778497324983, 0.37678961987195886, -0.2182571273619134, -0.3166585609105269, 0.09542975104343014, -0.2390712763680391, -0.04953384013175208, 0.13743297401567459, 0.04556927745476327...
1,803.09396
Asymptotic Bessel-function expansions for Legendre and Jacobi functions
We present new asymptotic series for the Legendre and Jacobi functions of the first and second kinds in terms of Bessel functions with appropriate arguments. The results are useful in the context of scattering problems, improve on known limiting results, and allow the calculation of corrections to the leading Bessel-...
math-ph hep-ph math.MP
we present new asymptotic series for the legendre and jacobi functions of the first and second kinds in terms of bessel functions with appropriate arguments the results are useful in the context of scattering problems improve on known limiting results and allow the calculation of corrections to the leading besselfuncti...
[['we', 'present', 'new', 'asymptotic', 'series', 'for', 'the', 'legendre', 'and', 'jacobi', 'functions', 'of', 'the', 'first', 'and', 'second', 'kinds', 'in', 'terms', 'of', 'bessel', 'functions', 'with', 'appropriate', 'arguments', 'the', 'results', 'are', 'useful', 'in', 'the', 'context', 'of', 'scattering', 'proble...
[-0.06287323195487261, 0.052236937298439444, -0.13316012093797325, 0.09415104039479047, -0.07445591764524578, -0.016387198846787215, -0.0010399261792190372, 0.34863033042289315, -0.24661264069378375, -0.2375317084789276, 0.09831897287396714, -0.27361256565898656, -0.19140426136553287, 0.2587648391351104, -0.00225223862...
1,803.09397
Optical radiation force (per-length) on an electrically conducting elliptical cylinder having a smooth or ribbed surface
The aim of this work is to develop a formal semi-analytical model using the modal expansion method in cylindrical coordinates to calculate the optical/electromagnetic (EM) radiation force-per-length experienced by an infinitely long electrically-conducting elliptical cylinder having a smooth or wavy/corrugated surfac...
physics.class-ph
the aim of this work is to develop a formal semianalytical model using the modal expansion method in cylindrical coordinates to calculate the opticalelectromagnetic em radiation forceperlength experienced by an infinitely long electricallyconducting elliptical cylinder having a smooth or wavycorrugated surface in em pl...
[['the', 'aim', 'of', 'this', 'work', 'is', 'to', 'develop', 'a', 'formal', 'semianalytical', 'model', 'using', 'the', 'modal', 'expansion', 'method', 'in', 'cylindrical', 'coordinates', 'to', 'calculate', 'the', 'opticalelectromagnetic', 'em', 'radiation', 'forceperlength', 'experienced', 'by', 'an', 'infinitely', 'lo...
[-0.15761031657979846, 0.1144442622789652, -0.07736415084356105, 0.03681711250949123, -0.10067586789886636, -0.08170225277202071, -0.025391764099174364, 0.3880717597982487, -0.24231118820131, -0.2738837202043615, 0.07267560034680481, -0.2664775915964558, -0.1202381510302648, 0.21640501431772471, 0.005462494043094348, 0...
1,803.09398
The impact of EDGES 21-cm data on dark matter interactions
The recently announced results on the 21-cm absorption spectrum by the EDGES experiment can place very stringent limits on dark matter annihilation cross-sections. We properly take into account the heating energy released from dark matter annihilation from the radiation epoch to the 21-cm observation redshifts in the...
astro-ph.CO astro-ph.HE hep-ph
the recently announced results on the 21cm absorption spectrum by the edges experiment can place very stringent limits on dark matter annihilation crosssections we properly take into account the heating energy released from dark matter annihilation from the radiation epoch to the 21cm observation redshifts in the radia...
[['the', 'recently', 'announced', 'results', 'on', 'the', '21cm', 'absorption', 'spectrum', 'by', 'the', 'edges', 'experiment', 'can', 'place', 'very', 'stringent', 'limits', 'on', 'dark', 'matter', 'annihilation', 'crosssections', 'we', 'properly', 'take', 'into', 'account', 'the', 'heating', 'energy', 'released', 'fr...
[-0.07849047199286158, 0.12476742415499219, -0.1283570822329407, 0.17012468212029758, -0.10035274244189539, -0.03923980312214957, -0.006603733800282633, 0.3000790366851207, -0.17135845650746315, -0.3643214074998266, -0.02188338076855332, -0.3318993310957147, 0.06912016958274224, 0.2063657689701628, 0.14667880531865027,...
1,803.09399
New Green's functions for some nonlinear oscillating systems and related PDEs
During the past three decades, the advantageous concept of the Green's function has been extended from linear systems to nonlinear ones. At that, there exist a rigorous and an approximate extensions. The rigorous extension introduces the so-called backward and forward propagators, which play the same role for nonline...
math-ph math.MP
during the past three decades the advantageous concept of the greens function has been extended from linear systems to nonlinear ones at that there exist a rigorous and an approximate extensions the rigorous extension introduces the socalled backward and forward propagators which play the same role for nonlinear system...
[['during', 'the', 'past', 'three', 'decades', 'the', 'advantageous', 'concept', 'of', 'the', 'greens', 'function', 'has', 'been', 'extended', 'from', 'linear', 'systems', 'to', 'nonlinear', 'ones', 'at', 'that', 'there', 'exist', 'a', 'rigorous', 'and', 'an', 'approximate', 'extensions', 'the', 'rigorous', 'extension'...
[-0.11738120446430653, 0.004586287568028118, -0.11789040360100833, 0.11058494803977997, -0.09549792927490282, -0.11228791213195238, -0.03232783282707844, 0.30789726878117235, -0.2729227351823023, -0.23555566406409656, 0.09604788242806016, -0.2769503993048732, -0.20267035938865904, 0.2509354974010161, 0.0416784152895810...
1,803.094
Bounds on the cardinality of restricted sumsets in $\mathbb{Z}_{p}$
In this paper we present a procedure which allows to transform a subset $A$ of $\mathbb{Z}_{p}$ into a set $ A'$ such that $ |2\hspace{0.15cm}\widehat{} A'|\leq|2\hspace{0.15cm}\widehat{} A | $, where $2\hspace{0.15cm}\widehat{} A$ is defined to be the set $\left\{a+b:a\neq b,\;a,b\in A\right\}$. From this result, we...
math.CO
in this paper we present a procedure which allows to transform a subset a of mathbbz_p into a set a such that 2hspace015cmwidehat aleq2hspace015cmwidehat a where 2hspace015cmwidehat a is defined to be the set leftabaneq babin aright from this result we get some lower bounds for 2hspace015cmwidehat a finally we give som...
[['in', 'this', 'paper', 'we', 'present', 'a', 'procedure', 'which', 'allows', 'to', 'transform', 'a', 'subset', 'a', 'of', 'mathbbz_p', 'into', 'a', 'set', 'a', 'such', 'that', '2hspace015cmwidehat', 'aleq2hspace015cmwidehat', 'a', 'where', '2hspace015cmwidehat', 'a', 'is', 'defined', 'to', 'be', 'the', 'set', 'leftab...
[-0.13206627606555368, 0.07439774108316863, -0.14202334525797403, 0.06454121106071398, -0.09497376655186103, -0.10519179825981458, 0.1076226022189737, 0.3206805484651616, -0.26436227926927985, -0.22192267887294292, 0.1473760370951795, -0.2700550821506168, -0.1370252842422236, 0.23920410244979642, -0.0979157312117009, 0...
1,803.09401
HomeGuard: A Smart System to Deal with the Emergency Response of Domestic Violence Victims
Domestic violence is a silent crisis in the developing and underdeveloped countries, though developed countries also remain drowned in the curse of it. In developed countries, victims can easily report and ask help on the contrary in developing and underdeveloped countries victims hardly report the crimes and when it...
cs.IR cs.CL
domestic violence is a silent crisis in the developing and underdeveloped countries though developed countries also remain drowned in the curse of it in developed countries victims can easily report and ask help on the contrary in developing and underdeveloped countries victims hardly report the crimes and when its not...
[['domestic', 'violence', 'is', 'a', 'silent', 'crisis', 'in', 'the', 'developing', 'and', 'underdeveloped', 'countries', 'though', 'developed', 'countries', 'also', 'remain', 'drowned', 'in', 'the', 'curse', 'of', 'it', 'in', 'developed', 'countries', 'victims', 'can', 'easily', 'report', 'and', 'ask', 'help', 'on', '...
[-0.06390469357881874, 0.10821143532710442, -0.08874846444218364, 0.12381777670360675, -0.14262672145682645, -0.18080198847273565, 0.11146350689996763, 0.33182278134108306, -0.20616661972108197, -0.31396369006574515, 0.20110770852125462, -0.3108740028061242, -0.1272539362712505, 0.1916597902210968, -0.1782319723875318,...
1,803.09402
Aggression-annotated Corpus of Hindi-English Code-mixed Data
As the interaction over the web has increased, incidents of aggression and related events like trolling, cyberbullying, flaming, hate speech, etc. too have increased manifold across the globe. While most of these behaviour like bullying or hate speech have predated the Internet, the reach and extent of the Internet h...
cs.CL
as the interaction over the web has increased incidents of aggression and related events like trolling cyberbullying flaming hate speech etc too have increased manifold across the globe while most of these behaviour like bullying or hate speech have predated the internet the reach and extent of the internet has given t...
[['as', 'the', 'interaction', 'over', 'the', 'web', 'has', 'increased', 'incidents', 'of', 'aggression', 'and', 'related', 'events', 'like', 'trolling', 'cyberbullying', 'flaming', 'hate', 'speech', 'etc', 'too', 'have', 'increased', 'manifold', 'across', 'the', 'globe', 'while', 'most', 'of', 'these', 'behaviour', 'li...
[-0.10381011899450888, 0.07858389909093107, -0.016326197793453255, 0.09039379505636382, -0.14135127623607827, -0.11027040424960433, 0.058396107069380705, 0.39421245716088876, -0.2194073252784702, -0.35595381693102274, 0.11459442902493967, -0.4197352372363887, -0.1502740682639838, 0.20305265667081007, -0.085990280032009...
1,803.09403
Distinguishing Computer-generated Graphics from Natural Images Based on Sensor Pattern Noise and Deep Learning
Computer-generated graphics (CGs) are images generated by computer software. The~rapid development of computer graphics technologies has made it easier to generate photorealistic computer graphics, and these graphics are quite difficult to distinguish from natural images (NIs) with the naked eye. In this paper, we pr...
cs.MM
computergenerated graphics cgs are images generated by computer software therapid development of computer graphics technologies has made it easier to generate photorealistic computer graphics and these graphics are quite difficult to distinguish from natural images nis with the naked eye in this paper we propose a meth...
[['computergenerated', 'graphics', 'cgs', 'are', 'images', 'generated', 'by', 'computer', 'software', 'therapid', 'development', 'of', 'computer', 'graphics', 'technologies', 'has', 'made', 'it', 'easier', 'to', 'generate', 'photorealistic', 'computer', 'graphics', 'and', 'these', 'graphics', 'are', 'quite', 'difficult...
[-0.004463736510021243, -0.02132984025151905, -0.09284758607852431, 0.039541928864147174, -0.08717574762148954, -0.2019980548777514, -0.026739787368288328, 0.4756679280980486, -0.23858954679166924, -0.3756974639667981, 0.09187607090764989, -0.276420251581062, -0.20298564137895433, 0.24045262526234853, -0.12755618856180...
1,803.09404
A Hierarchy of Empirical Models of Plasma Profiles and Transport
Two families of statistical models are presented which generalize global confinement expressions to plasma profiles and local transport coefficients. The temperature or diffusivity is parameterized as a function of the normalized flux radius, $\bar{\psi}$, and the engineering variables, ${\bf u} = (I_p,B_t,\bar{n},q_...
stat.ME eess.SP
two families of statistical models are presented which generalize global confinement expressions to plasma profiles and local transport coefficients the temperature or diffusivity is parameterized as a function of the normalized flux radius barpsi and the engineering variables bf u i_pb_tbarnq_95dagger the logadditive ...
[['two', 'families', 'of', 'statistical', 'models', 'are', 'presented', 'which', 'generalize', 'global', 'confinement', 'expressions', 'to', 'plasma', 'profiles', 'and', 'local', 'transport', 'coefficients', 'the', 'temperature', 'or', 'diffusivity', 'is', 'parameterized', 'as', 'a', 'function', 'of', 'the', 'normalize...
[-0.10947073401592962, 0.1915570430713227, -0.02434942589163603, 0.025490923646083546, -0.03364259089056999, -0.16560682569110355, 0.005007189175404318, 0.371386584567785, -0.24976275106932308, -0.26398826834798117, 0.0313140590825356, -0.34076661889711435, -0.06643463093288508, 0.15470930257943424, -0.0231541817225677...
1,803.09405
Automatic Identification of Closely-related Indian Languages: Resources and Experiments
In this paper, we discuss an attempt to develop an automatic language identification system for 5 closely-related Indo-Aryan languages of India, Awadhi, Bhojpuri, Braj, Hindi and Magahi. We have compiled a comparable corpora of varying length for these languages from various resources. We discuss the method of creati...
cs.CL
in this paper we discuss an attempt to develop an automatic language identification system for 5 closelyrelated indoaryan languages of india awadhi bhojpuri braj hindi and magahi we have compiled a comparable corpora of varying length for these languages from various resources we discuss the method of creation of these...
[['in', 'this', 'paper', 'we', 'discuss', 'an', 'attempt', 'to', 'develop', 'an', 'automatic', 'language', 'identification', 'system', 'for', '5', 'closelyrelated', 'indoaryan', 'languages', 'of', 'india', 'awadhi', 'bhojpuri', 'braj', 'hindi', 'and', 'magahi', 'we', 'have', 'compiled', 'a', 'comparable', 'corpora', 'o...
[-0.08646902271706347, 0.017846054654166273, -0.03593861421269148, 0.1078898303323623, -0.08045891789964052, -0.07240897824404517, 0.0488879584126419, 0.40993153089375206, -0.2606513800118307, -0.35639687676471893, 0.06043804001128959, -0.27438428888868804, -0.07985075071661009, 0.21522731930276173, -0.0679338003010159...
1,803.09406
Study of Twist-2 GTMDs in scalar-diquark model
We investigate the Generalized Transverse Momentum-dependent Distributions (GTMDs) describing the parton structure of proton using the light-front scalar-diquark model. In particular, we study the Wigner distributions for unpolarized quark in unpolarized, longitudinally-polarized and transversely-polarized proton. We...
hep-ph
we investigate the generalized transverse momentumdependent distributions gtmds describing the parton structure of proton using the lightfront scalardiquark model in particular we study the wigner distributions for unpolarized quark in unpolarized longitudinallypolarized and transverselypolarized proton we also investi...
[['we', 'investigate', 'the', 'generalized', 'transverse', 'momentumdependent', 'distributions', 'gtmds', 'describing', 'the', 'parton', 'structure', 'of', 'proton', 'using', 'the', 'lightfront', 'scalardiquark', 'model', 'in', 'particular', 'we', 'study', 'the', 'wigner', 'distributions', 'for', 'unpolarized', 'quark'...
[-0.0062495004588171196, 0.31949260893642256, -0.16474520892876646, 0.27192657027879485, -0.012490499913996167, -0.005842426070518306, -0.02384186918725786, 0.45230270618491847, -0.12906959418045438, -0.1316265817731619, -0.20482000964440647, -0.2942088322066095, 0.026276592570154564, 0.06093673680342086, 0.14256437734...
1,803.09407
Spectral dimension of spheres
In this paper, we associate a growth graph and a length operator to a quotient space of a semisimple compact Lie group. Under certain assumptions, we show that the spectral dimension of a homogeneous space is greater than or equal to summability of the length operator. Using this, we compute spectral dimensions of sp...
math.OA
in this paper we associate a growth graph and a length operator to a quotient space of a semisimple compact lie group under certain assumptions we show that the spectral dimension of a homogeneous space is greater than or equal to summability of the length operator using this we compute spectral dimensions of spheres
[['in', 'this', 'paper', 'we', 'associate', 'a', 'growth', 'graph', 'and', 'a', 'length', 'operator', 'to', 'a', 'quotient', 'space', 'of', 'a', 'semisimple', 'compact', 'lie', 'group', 'under', 'certain', 'assumptions', 'we', 'show', 'that', 'the', 'spectral', 'dimension', 'of', 'a', 'homogeneous', 'space', 'is', 'gre...
[-0.16070752549502584, 0.10378626749540369, -0.11717894097307215, 0.06648740423110279, -0.12073269069919156, -0.07852050830196175, 0.0017068175948224962, 0.3965768834006869, -0.2673451720598947, -0.16775235591706372, 0.13075465600963476, -0.23383499530178528, -0.15135155534113032, 0.1638053610049947, -0.108343592568956...
1,803.09408
Efficient File Delivery for Coded Prefetching in Shared Cache Networks with Multiple Requests Per User
We consider a centralized caching network, where a server serves several groups of users, each having a common shared homogeneous fixed-size cache and requesting arbitrary multiple files. An existing coded prefetching scheme is employed where each file is broken into multiple fragments and each cache stores multiple ...
cs.IT math.IT
we consider a centralized caching network where a server serves several groups of users each having a common shared homogeneous fixedsize cache and requesting arbitrary multiple files an existing coded prefetching scheme is employed where each file is broken into multiple fragments and each cache stores multiple coded ...
[['we', 'consider', 'a', 'centralized', 'caching', 'network', 'where', 'a', 'server', 'serves', 'several', 'groups', 'of', 'users', 'each', 'having', 'a', 'common', 'shared', 'homogeneous', 'fixedsize', 'cache', 'and', 'requesting', 'arbitrary', 'multiple', 'files', 'an', 'existing', 'coded', 'prefetching', 'scheme', '...
[-0.21342148464986854, 0.022841190228841124, -0.04530696288763898, 0.0218211599841524, -0.027657312807825945, -0.2519111430738121, 0.13069373135143006, 0.399336438065449, -0.27634431429668466, -0.2679936257383144, 0.10305280176961107, -0.2529054999360543, -0.09706955268816317, 0.1439203842830148, -0.1032570457397915, 0...
1,803.09409
Impact of packing fraction on diffusion-driven pattern formation in a two-dimensional system of rod-like particles
Pattern formation in a two-dimensional system of rod-like particles has been simulated using a lattice approach. Rod-like particles were modelled as linear $k$-mers of two mutually perpendicular orientations ($k_x$- and $k_y$-mers) on a square lattice with periodic boundary conditions (torus). Two kinds of random seq...
cond-mat.stat-mech cond-mat.soft
pattern formation in a twodimensional system of rodlike particles has been simulated using a lattice approach rodlike particles were modelled as linear kmers of two mutually perpendicular orientations k_x and k_ymers on a square lattice with periodic boundary conditions torus two kinds of random sequential adsorption m...
[['pattern', 'formation', 'in', 'a', 'twodimensional', 'system', 'of', 'rodlike', 'particles', 'has', 'been', 'simulated', 'using', 'a', 'lattice', 'approach', 'rodlike', 'particles', 'were', 'modelled', 'as', 'linear', 'kmers', 'of', 'two', 'mutually', 'perpendicular', 'orientations', 'k_x', 'and', 'k_ymers', 'on', 'a...
[-0.14177432022464515, 0.24624199802650415, -0.047644766417483914, 0.01894120243873368, 0.012822243198422147, -0.1683534055333981, 0.02446583652016806, 0.43346198516111845, -0.23171843690071123, -0.28125694836654985, 0.08432385500715318, -0.2791054392273122, -0.06179503123077782, 0.11011263549597008, 0.0583366385647855...
1,803.0941
Projection effects of large-scale structures on weak-lensing peak abundances
High peaks in weak lensing (WL) maps originate dominantly from the lensing effects of single massive halos. Their abundance is therefore closely related to the halo mass function and thus a powerful cosmological probe. On the other hand, however, besides individual massive halos, large-scale structures (LSS) along li...
astro-ph.CO
high peaks in weak lensing wl maps originate dominantly from the lensing effects of single massive halos their abundance is therefore closely related to the halo mass function and thus a powerful cosmological probe on the other hand however besides individual massive halos largescale structures lss along lines of sight...
[['high', 'peaks', 'in', 'weak', 'lensing', 'wl', 'maps', 'originate', 'dominantly', 'from', 'the', 'lensing', 'effects', 'of', 'single', 'massive', 'halos', 'their', 'abundance', 'is', 'therefore', 'closely', 'related', 'to', 'the', 'halo', 'mass', 'function', 'and', 'thus', 'a', 'powerful', 'cosmological', 'probe', '...
[-0.08104528675278637, 0.07464329577751024, -0.06616931833800692, 0.15865356753083185, -0.09809823263153732, -0.0747970619975972, -0.012625183116650335, 0.3909560670973333, -0.2355397467678584, -0.3209268016814957, 0.06882688149229903, -0.3072584801324232, -0.0867146552194687, 0.20450609894555086, 0.01709466302436005, ...
1,803.09411
Optimal Design and Control of 4-IWD Electric Vehicles based on a 14-DOF Vehicle Model
A 4-independent wheel driving (4-IWD) electric vehicle has distinctive advantages with both enhanced dynamic and energy efficiency performances since this configuration provides more flexibilities from both the design and control aspects. However, it is difficult to achieve the optimal performances of a 4-IWD electri...
math.OC
a 4independent wheel driving 4iwd electric vehicle has distinctive advantages with both enhanced dynamic and energy efficiency performances since this configuration provides more flexibilities from both the design and control aspects however it is difficult to achieve the optimal performances of a 4iwd electric vehicle...
[['a', '4independent', 'wheel', 'driving', '4iwd', 'electric', 'vehicle', 'has', 'distinctive', 'advantages', 'with', 'both', 'enhanced', 'dynamic', 'and', 'energy', 'efficiency', 'performances', 'since', 'this', 'configuration', 'provides', 'more', 'flexibilities', 'from', 'both', 'the', 'design', 'and', 'control', 'a...
[-0.1172476867894667, 0.07998069129514208, -0.06992899262461703, 0.023740652844155972, -0.07786928414550078, -0.1857590086406812, 0.04244824725589881, 0.3628669418644027, -0.25568486128135454, -0.3539353520110516, 0.12819544890174125, -0.2276378314995132, -0.1493785860324611, 0.22713557995406777, -0.1079415014308844, 0...
1,803.09412
Consensus Control of Multi-agent Systems with Optimal Performance
The consensus control with optimal cost remains major challenging although consensus control problems have been well studied in recent years. In this paper, we study the consensus control of multi-agent system associated with a given cost function. The main contribution is to present the distributed control protocol ...
math.OC
the consensus control with optimal cost remains major challenging although consensus control problems have been well studied in recent years in this paper we study the consensus control of multiagent system associated with a given cost function the main contribution is to present the distributed control protocol while ...
[['the', 'consensus', 'control', 'with', 'optimal', 'cost', 'remains', 'major', 'challenging', 'although', 'consensus', 'control', 'problems', 'have', 'been', 'well', 'studied', 'in', 'recent', 'years', 'in', 'this', 'paper', 'we', 'study', 'the', 'consensus', 'control', 'of', 'multiagent', 'system', 'associated', 'wit...
[-0.16811921941703772, 0.016066886153206363, -0.03601524032451011, -0.01486240037998, -0.05430286588264747, -0.12872550051306952, 0.04563371524915334, 0.3697861194241423, -0.31296308526584693, -0.3377715138349313, 0.1313844570860703, -0.26169864865657577, -0.1492204383982614, 0.13557519274554006, -0.10277819325560117, ...
1,803.09413
Precision Sugarcane Monitoring Using SVM Classifier
India is agriculture based economy and sugarcane is one of the major crops produced in northern India. Productivity of sugarcane decreases due to inappropriate soil conditions and infections caused by various types of diseases , timely and accurate disease diagnosis, plays an important role towards optimizing crop yi...
cs.CV
india is agriculture based economy and sugarcane is one of the major crops produced in northern india productivity of sugarcane decreases due to inappropriate soil conditions and infections caused by various types of diseases timely and accurate disease diagnosis plays an important role towards optimizing crop yield th...
[['india', 'is', 'agriculture', 'based', 'economy', 'and', 'sugarcane', 'is', 'one', 'of', 'the', 'major', 'crops', 'produced', 'in', 'northern', 'india', 'productivity', 'of', 'sugarcane', 'decreases', 'due', 'to', 'inappropriate', 'soil', 'conditions', 'and', 'infections', 'caused', 'by', 'various', 'types', 'of', 'd...
[-0.06926761844372305, 0.0775699293939848, -0.014099695077238157, 0.031086944345052738, -0.01862771400293812, -0.170117096809396, 0.04922463054057615, 0.3462058711280801, -0.1957523960876459, -0.30693397234201203, 0.15034185220530732, -0.32295593021928454, -0.13437226514490827, 0.2389593515268756, -0.13617981137665697,...
1,803.09414
Development of high-speed X-ray imaging system for SOI pixel detector
We are now developing new X-ray imaging system by using Silicon-On-Insulator (SOI) Pixel Detectors. The SOI detector is a monolithic radiation imaging detector based on a 0.2um FD-SOI CMOS process. Special additional process steps are also developed to create fully depleted sensing region of 50~500um thick. SOI detec...
physics.ins-det
we are now developing new xray imaging system by using silicononinsulator soi pixel detectors the soi detector is a monolithic radiation imaging detector based on a 02um fdsoi cmos process special additional process steps are also developed to create fully depleted sensing region of 50500um thick soi detector has up to...
[['we', 'are', 'now', 'developing', 'new', 'xray', 'imaging', 'system', 'by', 'using', 'silicononinsulator', 'soi', 'pixel', 'detectors', 'the', 'soi', 'detector', 'is', 'a', 'monolithic', 'radiation', 'imaging', 'detector', 'based', 'on', 'a', '02um', 'fdsoi', 'cmos', 'process', 'special', 'additional', 'process', 'st...
[-0.13425023104729397, 0.07236228035208547, -0.0049186713816154574, -0.03737478066071898, -0.05675772740062149, -0.2522950806433246, 0.015399892992267962, 0.47279664391563053, -0.19636391901350136, -0.38994997644885665, 0.14643227775481396, -0.3141940023195708, -0.05978117731033957, 0.2591410541784994, -0.1031312810069...
1,803.09415
First-principles study of magnetic interactions in FeGe
We theoretically study the magnetic properties of iron germanium, known as one of canonical helimagnets. For this purpose we use the real-space spin Hamiltonian and micromagnetic model, derived in terms of Andersen's "local force theorem", to describe the low-lying magnetic excitations via spin-polarized Green's func...
cond-mat.str-el cond-mat.mtrl-sci physics.comp-ph
we theoretically study the magnetic properties of iron germanium known as one of canonical helimagnets for this purpose we use the realspace spin hamiltonian and micromagnetic model derived in terms of andersens local force theorem to describe the lowlying magnetic excitations via spinpolarized greens function obtained...
[['we', 'theoretically', 'study', 'the', 'magnetic', 'properties', 'of', 'iron', 'germanium', 'known', 'as', 'one', 'of', 'canonical', 'helimagnets', 'for', 'this', 'purpose', 'we', 'use', 'the', 'realspace', 'spin', 'hamiltonian', 'and', 'micromagnetic', 'model', 'derived', 'in', 'terms', 'of', 'andersens', 'local', '...
[-0.14407305730755665, 0.14560522687428729, -0.035012001142102483, 0.08439672367992522, -0.04463653887043996, -0.06418880821077218, 0.055127825178527115, 0.37112904556802123, -0.22958545740452949, -0.30670761870991053, -0.05834326741851641, -0.2932903572098063, -0.13490775057339463, 0.1782606667618203, 0.10077265243784...
1,803.09416
Induced nets and Hamiltonicity of claw-free graphs
The connected graph of degree sequence 3,3,3,1,1,1 is called a net, and the vertices of degree 1 in a net is called its endvertices. Broersma conjectured in 1993 that a 2-connected graph G with no induced K_{1,3} is hamiltonian if every endvertex of each induced net of G has degree at least (|V(G)|-2)/3. In this pape...
math.CO
the connected graph of degree sequence 333111 is called a net and the vertices of degree 1 in a net is called its endvertices broersma conjectured in 1993 that a 2connected graph g with no induced k_13 is hamiltonian if every endvertex of each induced net of g has degree at least vg23 in this paper we prove this conjec...
[['the', 'connected', 'graph', 'of', 'degree', 'sequence', '333111', 'is', 'called', 'a', 'net', 'and', 'the', 'vertices', 'of', 'degree', '1', 'in', 'a', 'net', 'is', 'called', 'its', 'endvertices', 'broersma', 'conjectured', 'in', '1993', 'that', 'a', '2connected', 'graph', 'g', 'with', 'no', 'induced', 'k_13', 'is',...
[-0.23321594261243694, 0.1463533967702848, -0.06009235655217141, -0.035953953944253506, -0.07962331726963891, -0.13084335057217567, -0.005538357066784481, 0.388156561333625, -0.27350371721826616, -0.2753487766766157, 0.016906081485088733, -0.3323547064792365, -0.20655486542544496, 0.04177728386931732, -0.15050288686742...
1,803.09417
Periodic Anderson model meets Sachdev-Ye-Kitaev interaction: A solvable playground for heavy fermion physics
The periodic Anderson model is a classic theoretical model for understanding novel physics in heavy fermion systems. Here, we modify it with the Sachdev-Ye-Kitaev interaction, (random all-to-all interaction) thus the resultant model admits an exact solution at large-$N$ (e.g. spin flavor) limit. By analytical field t...
cond-mat.str-el cond-mat.quant-gas
the periodic anderson model is a classic theoretical model for understanding novel physics in heavy fermion systems here we modify it with the sachdevyekitaev interaction random alltoall interaction thus the resultant model admits an exact solution at largen eg spin flavor limit by analytical field theory arguments and...
[['the', 'periodic', 'anderson', 'model', 'is', 'a', 'classic', 'theoretical', 'model', 'for', 'understanding', 'novel', 'physics', 'in', 'heavy', 'fermion', 'systems', 'here', 'we', 'modify', 'it', 'with', 'the', 'sachdevyekitaev', 'interaction', 'random', 'alltoall', 'interaction', 'thus', 'the', 'resultant', 'model'...
[-0.1622556766865205, 0.21895966979506887, -0.11389576736837626, 0.14498957776144814, -0.0197315755884038, -0.2718411963050768, 0.08076519647060629, 0.31453468905650633, -0.21925722111238918, -0.2617051745834413, -0.002316002942510505, -0.3238889529793732, -0.1488939122967561, 0.1850467504665895, 0.03663915443692857, 0...
1,803.09418
$(\sigma,\tau)$-Derivations of Group Rings
We study $(\sigma,\tau)$-derivations of a group ring $RG$ of a finite group $G$ over an integral domain $R$ with $1$. As an application we extend a well known result on derivation of an integral group ring $\Bbb{Z}G$ to $(\sigma,\tau)$-derivation on it for a finite group $G$ with some conditions on $\sigma$ and $\tau...
math.RA
we study sigmatauderivations of a group ring rg of a finite group g over an integral domain r with 1 as an application we extend a well known result on derivation of an integral group ring bbbzg to sigmatauderivation on it for a finite group g with some conditions on sigma and tau in the process of the extension a gene...
[['we', 'study', 'sigmatauderivations', 'of', 'a', 'group', 'ring', 'rg', 'of', 'a', 'finite', 'group', 'g', 'over', 'an', 'integral', 'domain', 'r', 'with', '1', 'as', 'an', 'application', 'we', 'extend', 'a', 'well', 'known', 'result', 'on', 'derivation', 'of', 'an', 'integral', 'group', 'ring', 'bbbzg', 'to', 'sigma...
[-0.14872996898640584, 0.007588277361497692, -0.13484281956831493, -0.00974853860030058, -0.10219237553353262, -0.07404293484486095, 0.018675365016750264, 0.3689745890385494, -0.28052192635652495, -0.2040569523076822, 0.1617282183043, -0.23186749281225408, -0.10990862816958348, 0.252346818539791, -0.10030790851962548, ...
1,803.09419
Structural characterization of linear quantum systems with application to back-action evading measurement
The purpose of this paper is to study the structure of quantum linear systems in terms of their Kalman canonical form, which was proposed in a recent paper \cite{ZGPG18}. The spectral structure of quantum linear systems is explored, which indicates that a quantum linear system is both controllable and observable prov...
quant-ph
the purpose of this paper is to study the structure of quantum linear systems in terms of their kalman canonical form which was proposed in a recent paper citezgpg18 the spectral structure of quantum linear systems is explored which indicates that a quantum linear system is both controllable and observable provided tha...
[['the', 'purpose', 'of', 'this', 'paper', 'is', 'to', 'study', 'the', 'structure', 'of', 'quantum', 'linear', 'systems', 'in', 'terms', 'of', 'their', 'kalman', 'canonical', 'form', 'which', 'was', 'proposed', 'in', 'a', 'recent', 'paper', 'citezgpg18', 'the', 'spectral', 'structure', 'of', 'quantum', 'linear', 'syste...
[-0.13604740603556353, 0.1132404318872235, -0.08287924940924386, 0.028424502557263132, -0.08731008387592344, -0.1525317313136986, -0.019723242581381487, 0.32971705498828274, -0.28677854943089187, -0.2783801153339949, 0.10215040692914831, -0.18055896511981012, -0.21619065376502034, 0.2426809716617336, -0.069816362515494...
1,803.0942
Multi-scale Processing of Noisy Images using Edge Preservation Losses
Noisy images processing is a fundamental task of computer vision. The first example is the detection of faint edges in noisy images, a challenging problem studied in the last decades. A recent study introduced a fast method to detect faint edges in the highest accuracy among all the existing approaches. Their complex...
cs.CV
noisy images processing is a fundamental task of computer vision the first example is the detection of faint edges in noisy images a challenging problem studied in the last decades a recent study introduced a fast method to detect faint edges in the highest accuracy among all the existing approaches their complexity is...
[['noisy', 'images', 'processing', 'is', 'a', 'fundamental', 'task', 'of', 'computer', 'vision', 'the', 'first', 'example', 'is', 'the', 'detection', 'of', 'faint', 'edges', 'in', 'noisy', 'images', 'a', 'challenging', 'problem', 'studied', 'in', 'the', 'last', 'decades', 'a', 'recent', 'study', 'introduced', 'a', 'fas...
[-0.07809816852592727, -0.026143725596133056, -0.06859723601179818, 0.03315803378985341, -0.055374637209267046, -0.13765667938666107, 0.01780950083678666, 0.46010369549815855, -0.26125584334755936, -0.35498609783438345, 0.10861379462488306, -0.24734105549626595, -0.2041472758438128, 0.2230071690379797, -0.1567617248132...
1,803.09421
Adaptive weak-value amplification with adjustable postselection
Weak-value amplification (WVA) has recently become an important technique for parameter estimation, owing to its ability to enhance the signal-to-noise ratio by amplifying extremely small signals with proper postselection strategies. In this paper, we propose an adaptive WVA scheme to achieve the highest Fisher infor...
quant-ph
weakvalue amplification wva has recently become an important technique for parameter estimation owing to its ability to enhance the signaltonoise ratio by amplifying extremely small signals with proper postselection strategies in this paper we propose an adaptive wva scheme to achieve the highest fisher information whe...
[['weakvalue', 'amplification', 'wva', 'has', 'recently', 'become', 'an', 'important', 'technique', 'for', 'parameter', 'estimation', 'owing', 'to', 'its', 'ability', 'to', 'enhance', 'the', 'signaltonoise', 'ratio', 'by', 'amplifying', 'extremely', 'small', 'signals', 'with', 'proper', 'postselection', 'strategies', '...
[-0.10263052387281145, 0.07600632401643426, -0.10993535337510749, 0.02301438579308814, -0.05959435751445699, -0.19425199890468756, 0.10193475090267569, 0.3920408222112346, -0.24051458119968142, -0.31408822915071377, 0.10934312783174918, -0.1909735127068732, -0.14454621319200142, 0.2678899659954038, -0.12043190397916065...
1,803.09422
The cooling-off effect of price limits in the Chinese stock markets
In this paper, we investigate the cooling-off effect (opposite to the magnet effect) from two aspects. Firstly, from the viewpoint of dynamics, we study the existence of the cooling-off effect by following the dynamical evolution of some financial variables over a period of time before the stock price hits its limit....
q-fin.ST q-fin.TR
in this paper we investigate the coolingoff effect opposite to the magnet effect from two aspects firstly from the viewpoint of dynamics we study the existence of the coolingoff effect by following the dynamical evolution of some financial variables over a period of time before the stock price hits its limit secondly f...
[['in', 'this', 'paper', 'we', 'investigate', 'the', 'coolingoff', 'effect', 'opposite', 'to', 'the', 'magnet', 'effect', 'from', 'two', 'aspects', 'firstly', 'from', 'the', 'viewpoint', 'of', 'dynamics', 'we', 'study', 'the', 'existence', 'of', 'the', 'coolingoff', 'effect', 'by', 'following', 'the', 'dynamical', 'evo...
[-0.1261736917288725, 0.13496734618269632, -0.12657130300067365, 0.1219853981735509, -0.07391624091483412, -0.080188662093227, 0.16098885418378714, 0.3554440909913677, -0.26879538412334075, -0.27496644521512936, 0.13993921985676294, -0.34666379604432995, -0.12616565971360033, 0.17956082192193037, -0.03864111535690408, ...
1,803.09423
Locally PI but not PI Division Rings of Arbitrary GK-Dimension
We give examples of locally PI but not PI division rings of GK-dimension n for every positive integer n.
math.RA
we give examples of locally pi but not pi division rings of gkdimension n for every positive integer n
[['we', 'give', 'examples', 'of', 'locally', 'pi', 'but', 'not', 'pi', 'division', 'rings', 'of', 'gkdimension', 'n', 'for', 'every', 'positive', 'integer', 'n']]
[-0.3028556364710982, 0.19989578950365908, -0.0776789660908674, 0.0028220137189093387, -0.04670933045839008, -0.3297316682966132, 0.013796418366071424, 0.33390665760165766, -0.2989105648900333, -0.12067420957119841, 0.045550971120399866, -0.2823540313463462, -0.17972913926075162, 0.19641096203735, -0.009406388002006631...
1,803.09424
Radio-over-fiber using an optical antenna based on Rydberg states of atoms
We provide an experimental demonstration of a direct fiber-optic link for RF transmission ("radio-over-fiber") using a sensitive optical antenna based on a rubidium vapor cell. The scheme relies on measuring the transmission of laser light at an electromagnetically-induced transparency resonance that involves highly-...
physics.atom-ph
we provide an experimental demonstration of a direct fiberoptic link for rf transmission radiooverfiber using a sensitive optical antenna based on a rubidium vapor cell the scheme relies on measuring the transmission of laser light at an electromagneticallyinduced transparency resonance that involves highlyexcited rydb...
[['we', 'provide', 'an', 'experimental', 'demonstration', 'of', 'a', 'direct', 'fiberoptic', 'link', 'for', 'rf', 'transmission', 'radiooverfiber', 'using', 'a', 'sensitive', 'optical', 'antenna', 'based', 'on', 'a', 'rubidium', 'vapor', 'cell', 'the', 'scheme', 'relies', 'on', 'measuring', 'the', 'transmission', 'of',...
[-0.20884449513290415, 0.1531006986020097, -0.009224692551692674, -0.05390953599235981, -0.04569941412305811, -0.22146841877472254, 0.11385981845050737, 0.46860536998072705, -0.22643788928048803, -0.23978644684022227, 0.05052747001457907, -0.26085541983653215, -0.12361768208129878, 0.28075718622771906, 0.00110736566471...
1,803.09425
Scalable photonic reinforcement learning by time-division multiplexing of laser chaos
Reinforcement learning involves decision making in dynamic and uncertain environments and constitutes a crucial element of artificial intelligence. In our previous work, we experimentally demonstrated that the ultrafast chaotic oscillatory dynamics of lasers can be used to solve the two-armed bandit problem efficient...
cs.ET cs.AI physics.data-an physics.optics
reinforcement learning involves decision making in dynamic and uncertain environments and constitutes a crucial element of artificial intelligence in our previous work we experimentally demonstrated that the ultrafast chaotic oscillatory dynamics of lasers can be used to solve the twoarmed bandit problem efficiently wh...
[['reinforcement', 'learning', 'involves', 'decision', 'making', 'in', 'dynamic', 'and', 'uncertain', 'environments', 'and', 'constitutes', 'a', 'crucial', 'element', 'of', 'artificial', 'intelligence', 'in', 'our', 'previous', 'work', 'we', 'experimentally', 'demonstrated', 'that', 'the', 'ultrafast', 'chaotic', 'osci...
[-0.12041478495968626, 0.09568399272597673, -0.07660294948172978, 0.05164857316906537, -0.12032301126222252, -0.17245081139793783, 0.055990775177739996, 0.4675096879707791, -0.29271144091767093, -0.3229759548360493, 0.09364509783761456, -0.20451334964658258, -0.1824675913684326, 0.2321569058194495, -0.08558413661384617...
1,803.09426
Proximity-induced artefacts in magnetic imaging with nitrogen-vacancy ensembles in diamond
Magnetic imaging with ensembles of nitrogen-vacancy (NV) centres in diamond is a recently developed technique that allows for quantitative vector field mapping. Here we uncover a source of artefacts in the measured magnetic field in situations where the magnetic sample is placed in close proximity (a few tens of nm) ...
cond-mat.mes-hall physics.app-ph physics.ins-det
magnetic imaging with ensembles of nitrogenvacancy nv centres in diamond is a recently developed technique that allows for quantitative vector field mapping here we uncover a source of artefacts in the measured magnetic field in situations where the magnetic sample is placed in close proximity a few tens of nm to the n...
[['magnetic', 'imaging', 'with', 'ensembles', 'of', 'nitrogenvacancy', 'nv', 'centres', 'in', 'diamond', 'is', 'a', 'recently', 'developed', 'technique', 'that', 'allows', 'for', 'quantitative', 'vector', 'field', 'mapping', 'here', 'we', 'uncover', 'a', 'source', 'of', 'artefacts', 'in', 'the', 'measured', 'magnetic',...
[-0.08952290355227888, 0.11777635710736938, -0.02504522789832811, 0.03145380525450301, -0.03390351102719907, -0.10075733768428828, 0.04300430105582183, 0.4534709706339379, -0.26723781434093535, -0.3603484603755046, 0.06689589626093526, -0.27689571784639005, -0.10288172467546754, 0.22345183151340936, -0.0409883580706623...
1,803.09427
Design Assurance Evaluation of Microcontrollers for safety critical Avionics
Dealing with Commercial off-the-shelf (COTS) com- ponents is a daily business for avionic system manufacturers. They are necessary ingredients for hardware designs, but are not built in accordance with the avionics consensus standard DO- 254 for Airborne Electronic Hardware (AEH) design. Especially for complex COTS h...
cs.SE
dealing with commercial offtheshelf cots com ponents is a daily business for avionic system manufacturers they are necessary ingredients for hardware designs but are not built in accordance with the avionics consensus standard do 254 for airborne electronic hardware aeh design especially for complex cots hardware compo...
[['dealing', 'with', 'commercial', 'offtheshelf', 'cots', 'com', 'ponents', 'is', 'a', 'daily', 'business', 'for', 'avionic', 'system', 'manufacturers', 'they', 'are', 'necessary', 'ingredients', 'for', 'hardware', 'designs', 'but', 'are', 'not', 'built', 'in', 'accordance', 'with', 'the', 'avionics', 'consensus', 'sta...
[-0.1338612031716219, 0.04834516250126025, -0.04668302306555634, 0.030303013831938518, -0.11139265557966606, -0.17360584825017047, 0.03547620542467405, 0.41627206635462144, -0.19457047742966352, -0.3077209613786189, 0.18159908951792914, -0.2644790280610323, -0.11881697198831553, 0.2514652041072742, -0.16440747187200397...
1,803.09428
An odd order group without the dimension property
We construct a finitely presented group $G$ such that the $7$th dimension quotient $G\cap(1+\varpi(\mathbb Z G)^7)/\gamma_7(G)$ has an element of order $3$; this immediately leads to a finite $3$-group without the dimension property. This contradicts a series of results by N. Gupta.
math.GR
we construct a finitely presented group g such that the 7th dimension quotient gcap1varpimathbb z g7gamma_7g has an element of order 3 this immediately leads to a finite 3group without the dimension property this contradicts a series of results by n gupta
[['we', 'construct', 'a', 'finitely', 'presented', 'group', 'g', 'such', 'that', 'the', '7th', 'dimension', 'quotient', 'gcap1varpimathbb', 'z', 'g7gamma_7g', 'has', 'an', 'element', 'of', 'order', '3', 'this', 'immediately', 'leads', 'to', 'a', 'finite', '3group', 'without', 'the', 'dimension', 'property', 'this', 'co...
[-0.14122027764096856, 0.12369264127082716, -0.12083524982153904, -0.03046900129993446, -0.08252503655385227, -0.08865805777022615, 0.0163876637496287, 0.3141112243756652, -0.28685425347648563, -0.2187999710906297, 0.08842604163801297, -0.28300724702421576, -0.1027459864562843, 0.1721440927591175, -0.10031490753171965,...
1,803.09429
Large Deviation Principle for arithmetic functions in continued fraction expansion
Khinchin proved that the arithmetic mean of continued fraction digits of Lebesgue almost every irrational number in $(0,1)$ diverges to infinity. Hence, none of the classical limit theorems such as the weak and strong laws of large numbers or central limit theorems hold. Nevertheless, we prove the existence of a larg...
math.DS math.NT math.PR
khinchin proved that the arithmetic mean of continued fraction digits of lebesgue almost every irrational number in 01 diverges to infinity hence none of the classical limit theorems such as the weak and strong laws of large numbers or central limit theorems hold nevertheless we prove the existence of a large deviation...
[['khinchin', 'proved', 'that', 'the', 'arithmetic', 'mean', 'of', 'continued', 'fraction', 'digits', 'of', 'lebesgue', 'almost', 'every', 'irrational', 'number', 'in', '01', 'diverges', 'to', 'infinity', 'hence', 'none', 'of', 'the', 'classical', 'limit', 'theorems', 'such', 'as', 'the', 'weak', 'and', 'strong', 'laws...
[-0.16522912127708178, 0.13165327861392195, -0.09884894902453474, 0.13544083540530308, 0.014435438736193422, -0.12907226577374167, 0.1582464137101087, 0.2163812613411658, -0.29174982293414464, -0.21408621972575242, 0.13514485932292714, -0.3216434421719632, -0.06595757856384675, 0.21661191355045614, -0.1034739285680479,...
1,803.0943
2HDM without FCNC: off the beaten tracks
We propose an alternative method of constructing two Higgs-doublet models free from scalar mediated FCNC couplings at the tree-level. In a toy scenario, we have presented semi realistic textures for the Yukawa matrices, which can reproduce the approximate flavor structure in the quark sector. Presence of flavor diago...
hep-ph
we propose an alternative method of constructing two higgsdoublet models free from scalar mediated fcnc couplings at the treelevel in a toy scenario we have presented semi realistic textures for the yukawa matrices which can reproduce the approximate flavor structure in the quark sector presence of flavor diagonal but ...
[['we', 'propose', 'an', 'alternative', 'method', 'of', 'constructing', 'two', 'higgsdoublet', 'models', 'free', 'from', 'scalar', 'mediated', 'fcnc', 'couplings', 'at', 'the', 'treelevel', 'in', 'a', 'toy', 'scenario', 'we', 'have', 'presented', 'semi', 'realistic', 'textures', 'for', 'the', 'yukawa', 'matrices', 'whi...
[-0.1395369609235786, 0.22770481577827012, -0.00872847018763423, 0.17262872432669005, -0.06789036908497413, -0.22758866138756276, 0.02541921994027992, 0.3324064482934773, -0.20519133166720468, -0.2949399903804685, 0.0010502707640019555, -0.24853543527424335, -0.14531214499499281, 0.07397339008748531, 0.0837484156014397...
1,803.09431
Discrete Analogoues in Harmonic Analysis: Maximally Monomially Modulated Singular Integrals Related to Carleson's Theorem
Motivated by Bourgain's work on pointwise ergodic theorems, and the work of Stein and Stein-Wainger on maximally modulated singular integrals without linear terms, we prove that the maximally monomially modulated discrete Hilbert transform, \[ \mathcal{C}_df(x) := \sup_\lambda \left| \sum_{m \neq 0} f(x-m) \frac{e^{2...
math.CA math.DS
motivated by bourgains work on pointwise ergodic theorems and the work of stein and steinwainger on maximally modulated singular integrals without linear terms we prove that the maximally monomially modulated discrete hilbert transform mathcalc_dfx sup_lambda left sum_m neq 0 fxm frace2pi i lambda mdm right is bounded ...
[['motivated', 'by', 'bourgains', 'work', 'on', 'pointwise', 'ergodic', 'theorems', 'and', 'the', 'work', 'of', 'stein', 'and', 'steinwainger', 'on', 'maximally', 'modulated', 'singular', 'integrals', 'without', 'linear', 'terms', 'we', 'prove', 'that', 'the', 'maximally', 'monomially', 'modulated', 'discrete', 'hilber...
[-0.18757338172756136, 0.17053987758234143, -0.022041296717361547, 0.07675853504159022, -0.03390531172743067, -0.2688762722350657, -0.001743399715051055, 0.34487308248877524, -0.3257663692813367, -0.06467648116871715, 0.08514843658427708, -0.3343874172400683, -0.09416730695404113, 0.15890412242617458, -0.06491878533735...
1,803.09432
Time-dependent lead-lag relationship between the onshore and offshore Renminbi exchange rates
We employ the thermal optimal path method to explore both the long-term and short-term interaction patterns between the onshore CNY and offshore CNH exchange rates (2012-2015). For the daily data, the CNY and CNH exchange rates show a weak alternate lead-lag structure in most of the time periods. When CNY and CNH dis...
q-fin.ST
we employ the thermal optimal path method to explore both the longterm and shortterm interaction patterns between the onshore cny and offshore cnh exchange rates 20122015 for the daily data the cny and cnh exchange rates show a weak alternate leadlag structure in most of the time periods when cny and cnh display a larg...
[['we', 'employ', 'the', 'thermal', 'optimal', 'path', 'method', 'to', 'explore', 'both', 'the', 'longterm', 'and', 'shortterm', 'interaction', 'patterns', 'between', 'the', 'onshore', 'cny', 'and', 'offshore', 'cnh', 'exchange', 'rates', '20122015', 'for', 'the', 'daily', 'data', 'the', 'cny', 'and', 'cnh', 'exchange'...
[-0.12464814733859178, 0.14223090386024762, -0.059251294720666946, 0.1267794056569312, -0.06190313117129477, -0.12057488768011437, 0.09291873758011465, 0.41714113274529735, -0.26232076510712704, -0.3261543805137151, 0.10611069849973002, -0.31141672284174743, -0.12542435938347105, 0.18721836227890606, -0.049297016362617...
1,803.09433
Non-trivial surface states of samarium hexaboride at the (111) surface
The peculiar metallic electronic states observed in the Kondo insulator, samarium hexaboride (SmB$_6$), has stimulated considerable attention among those studying non-trivial electronic phenomena. However, experimental studies of these states have led to controversial conclusions mainly to the difficulty and inhomoge...
cond-mat.str-el
the peculiar metallic electronic states observed in the kondo insulator samarium hexaboride smb_6 has stimulated considerable attention among those studying nontrivial electronic phenomena however experimental studies of these states have led to controversial conclusions mainly to the difficulty and inhomogeneity of th...
[['the', 'peculiar', 'metallic', 'electronic', 'states', 'observed', 'in', 'the', 'kondo', 'insulator', 'samarium', 'hexaboride', 'smb_6', 'has', 'stimulated', 'considerable', 'attention', 'among', 'those', 'studying', 'nontrivial', 'electronic', 'phenomena', 'however', 'experimental', 'studies', 'of', 'these', 'states...
[-0.18390343837173923, 0.20370801476048425, -0.10470806983196074, 0.04189153923930246, -0.07663514635836084, -0.19367504371182312, 0.1156447899873398, 0.42326287442212185, -0.24971532972071261, -0.30065882786931025, -0.043482345005031675, -0.3561266221786066, -0.16737454047330494, 0.16245609995657725, -0.01007533989225...
1,803.09434
Goos-H\"anchen-like shifts at metal/superconductor interface
At a normal-metal/superconductor interface, an incident electron from the normal-metal (N) side can be normally reflected as an electron or Andreev reflected as a hole. We show that pronounced lateral shifts along the interface between the incident and the reflected quasiparticles can happen in both reflection proces...
cond-mat.mes-hall
at a normalmetalsuperconductor interface an incident electron from the normalmetal n side can be normally reflected as an electron or andreev reflected as a hole we show that pronounced lateral shifts along the interface between the incident and the reflected quasiparticles can happen in both reflection processes which...
[['at', 'a', 'normalmetalsuperconductor', 'interface', 'an', 'incident', 'electron', 'from', 'the', 'normalmetal', 'n', 'side', 'can', 'be', 'normally', 'reflected', 'as', 'an', 'electron', 'or', 'andreev', 'reflected', 'as', 'a', 'hole', 'we', 'show', 'that', 'pronounced', 'lateral', 'shifts', 'along', 'the', 'interfa...
[-0.16211970896658706, 0.20843523834679645, -0.07257419455632129, 0.0418541425756891, -0.0731000181287527, -0.18282610370010577, 0.03839717850445167, 0.41471751748091157, -0.2892550719354083, -0.27650455415029734, 0.018307955552796448, -0.32920610310838505, -0.13381518301800552, 0.19194657342809746, -0.0007487809532048...
1,803.09435
Unpopularity Factor in the Marriage and Roommates Problems
Given a set $A$ of $n$ people, with each person having a preference list that ranks a subset of $A$ as his/her acceptable partners in order of preference, we consider the Roommates Problem (RP) and the Marriage Problem (MP) of matching people with their partners. In RP there is no further restriction, while in MP onl...
cs.DS
given a set a of n people with each person having a preference list that ranks a subset of a as hisher acceptable partners in order of preference we consider the roommates problem rp and the marriage problem mp of matching people with their partners in rp there is no further restriction while in mp only people of oppos...
[['given', 'a', 'set', 'a', 'of', 'n', 'people', 'with', 'each', 'person', 'having', 'a', 'preference', 'list', 'that', 'ranks', 'a', 'subset', 'of', 'a', 'as', 'hisher', 'acceptable', 'partners', 'in', 'order', 'of', 'preference', 'we', 'consider', 'the', 'roommates', 'problem', 'rp', 'and', 'the', 'marriage', 'proble...
[-0.13546706077249837, 0.10101697819618494, -0.0788557386258617, 0.04438011794081831, -0.09332638002888416, -0.19092095772612083, 0.125247591735994, 0.3938000046787238, -0.23778921094102165, -0.35609595251541276, 0.04404912458388329, -0.3082420929761914, -0.09461131664405305, 0.09294175732914785, -0.12418105953353613, ...
1,803.09436
Numerical Complete Solution for Random Genetic Drift by Energetic Variational Approach
In this paper, we focus on numerical solutions for random genetic drift problem, which is governed by a degenerated convection-dominated parabolic equation. Due to the fixation phenomenon of genes, Dirac delta singularities will develop at boundary points as time evolves. Based on an energetic variational approach (E...
math.NA
in this paper we focus on numerical solutions for random genetic drift problem which is governed by a degenerated convectiondominated parabolic equation due to the fixation phenomenon of genes dirac delta singularities will develop at boundary points as time evolves based on an energetic variational approach envara a b...
[['in', 'this', 'paper', 'we', 'focus', 'on', 'numerical', 'solutions', 'for', 'random', 'genetic', 'drift', 'problem', 'which', 'is', 'governed', 'by', 'a', 'degenerated', 'convectiondominated', 'parabolic', 'equation', 'due', 'to', 'the', 'fixation', 'phenomenon', 'of', 'genes', 'dirac', 'delta', 'singularities', 'wi...
[-0.11960440734045878, 0.06645490481255607, -0.09591821156076034, 0.0534413960266446, -0.0940877520159342, -0.16945128655061126, 0.0665778469530695, 0.3471159157876409, -0.3166426415270806, -0.25307544631499596, 0.09222222603582031, -0.2752548451019977, -0.13660778036298415, 0.2000596432041071, -0.07238099135046128, 0....
1,803.09437
Cascaded multi-scale and multi-dimension convolutional neural network for stereo matching
Convolutional neural networks(CNN) have been shown to perform better than the conventional stereo algorithms for stereo estimation. Numerous efforts focus on the pixel-wise matching cost computation, which is the important building block for many start-of-the-art algorithms. However, those architectures are limited t...
cs.CV
convolutional neural networkscnn have been shown to perform better than the conventional stereo algorithms for stereo estimation numerous efforts focus on the pixelwise matching cost computation which is the important building block for many startoftheart algorithms however those architectures are limited to small and ...
[['convolutional', 'neural', 'networkscnn', 'have', 'been', 'shown', 'to', 'perform', 'better', 'than', 'the', 'conventional', 'stereo', 'algorithms', 'for', 'stereo', 'estimation', 'numerous', 'efforts', 'focus', 'on', 'the', 'pixelwise', 'matching', 'cost', 'computation', 'which', 'is', 'the', 'important', 'building'...
[-0.05618022872536185, 0.017159750871027186, -0.040742839466365255, 0.08892998634767438, -0.08758717235065548, -0.1760346221594499, 0.0018645586103694625, 0.479047576773418, -0.2657781525750656, -0.35845066011176413, 0.08835255725068007, -0.21991081109129493, -0.19438251919892943, 0.193721111654865, -0.1132174645987457...
1,803.09438
Properties of the Black Hole Candidate XTE J1118+480 with the TCAF solution during its Jet Activity Induced 2000 Outburst
Galactic black hole candidate (BHC) XTE~J1118+480 during its 2000 outburst has been studied in a broad energy range using the archival data of PCA and HEXTE payloads of {\it Rossi X-ray Timing Explorer}. Detailed spectral and temporal properties of the source are studied. Low and very low frequency quasi-periodic osc...
astro-ph.HE
galactic black hole candidate bhc xtej1118480 during its 2000 outburst has been studied in a broad energy range using the archival data of pca and hexte payloads of it rossi xray timing explorer detailed spectral and temporal properties of the source are studied low and very low frequency quasiperiodic oscillations qpo...
[['galactic', 'black', 'hole', 'candidate', 'bhc', 'xtej1118480', 'during', 'its', '2000', 'outburst', 'has', 'been', 'studied', 'in', 'a', 'broad', 'energy', 'range', 'using', 'the', 'archival', 'data', 'of', 'pca', 'and', 'hexte', 'payloads', 'of', 'it', 'rossi', 'xray', 'timing', 'explorer', 'detailed', 'spectral', ...
[-0.07259590694338529, 0.10022801663245236, -0.09238811007414299, 0.10923228608185633, -0.07884645441340075, -0.11774393829564826, 0.030234479368266322, 0.4192513331818657, -0.22916853314854652, -0.3438452218905983, 0.14473482944184723, -0.3103371443407029, -0.03772223752756149, 0.22105600092755073, -0.0469186907056042...
1,803.09439
The spectrum of the singularity category of a category algebra
Let $\C$ be a finite projective EI category and $k$ be a field. The singularity category of the category algebra $k\C$ is a tensor triangulated category. We compute its spectrum in the sense of Balmer.
math.RT
let c be a finite projective ei category and k be a field the singularity category of the category algebra kc is a tensor triangulated category we compute its spectrum in the sense of balmer
[['let', 'c', 'be', 'a', 'finite', 'projective', 'ei', 'category', 'and', 'k', 'be', 'a', 'field', 'the', 'singularity', 'category', 'of', 'the', 'category', 'algebra', 'kc', 'is', 'a', 'tensor', 'triangulated', 'category', 'we', 'compute', 'its', 'spectrum', 'in', 'the', 'sense', 'of', 'balmer']]
[-0.1661892704665661, 0.0027010158502629826, -0.11037800961307116, 0.03237907313409128, -0.1268970942923001, -0.190110690678869, -0.07280958326799529, 0.36948410368391443, -0.44954521805047987, -0.11787283487085785, 0.07127776970488152, -0.2062053163402847, -0.0329771234520844, 0.10204584029104029, -0.19319886863231658...
1,803.0944
The principle of maximum in the imitative control tasks
The article is devoted to the problem of applying the maximum principle for finding optimal control parameters in simulation tasks of interest for a variety of engineering and industrial systems and processes. Especially important is the problem for such systems where it is practically impossible to organize a contro...
math.OC
the article is devoted to the problem of applying the maximum principle for finding optimal control parameters in simulation tasks of interest for a variety of engineering and industrial systems and processes especially important is the problem for such systems where it is practically impossible to organize a control s...
[['the', 'article', 'is', 'devoted', 'to', 'the', 'problem', 'of', 'applying', 'the', 'maximum', 'principle', 'for', 'finding', 'optimal', 'control', 'parameters', 'in', 'simulation', 'tasks', 'of', 'interest', 'for', 'a', 'variety', 'of', 'engineering', 'and', 'industrial', 'systems', 'and', 'processes', 'especially',...
[-0.1269907630892508, 0.05226162681219343, -0.06303463947659221, 0.03559423911997786, -0.057930837102521886, -0.1485183894815511, 0.0546361150957594, 0.3477024546505621, -0.28456433598677183, -0.323961365942987, 0.15580831017835853, -0.24597233159132786, -0.15049707487103647, 0.27478241538253906, -0.08192349912836247, ...
1,803.09441
Rigorous Results for the Ground States of the Spin-2 Bose-Hubbard Model
We present rigorous and universal results for the ground states of the $f=2$ spinor Bose-Hubbard model. The model includes three two-body on site interaction terms, two of which are spin dependent while the other one is spin independent. We prove that, depending only on the coefficients of the two spin dependent term...
cond-mat.quant-gas cond-mat.stat-mech math-ph math.MP
we present rigorous and universal results for the ground states of the f2 spinor bosehubbard model the model includes three twobody on site interaction terms two of which are spin dependent while the other one is spin independent we prove that depending only on the coefficients of the two spin dependent terms the groun...
[['we', 'present', 'rigorous', 'and', 'universal', 'results', 'for', 'the', 'ground', 'states', 'of', 'the', 'f2', 'spinor', 'bosehubbard', 'model', 'the', 'model', 'includes', 'three', 'twobody', 'on', 'site', 'interaction', 'terms', 'two', 'of', 'which', 'are', 'spin', 'dependent', 'while', 'the', 'other', 'one', 'is...
[-0.16536140673119445, 0.16571695652212307, -0.02743456951053492, 0.06784377763838635, -0.06561266020711126, -0.14409756166699889, 0.010624568873277769, 0.331544139131438, -0.22062106806271034, -0.2710521466676788, 0.07047111691469488, -0.28399746472834897, -0.11335352187823697, 0.1717398898256541, 0.07184782928530255,...
1,803.09442
Character values and Hochschild homology
We present a conjecture (and a proof for G=SL(2)) generalizing a result of J. Arthur which expresses a character value of a cuspidal representation of a $p$-adic group as a weighted orbital integral of its matrix coefficient. It also generalizes a conjecture by the second author proved by Schneider-Stuhler and (indep...
math.RT
we present a conjecture and a proof for gsl2 generalizing a result of j arthur which expresses a character value of a cuspidal representation of a padic group as a weighted orbital integral of its matrix coefficient it also generalizes a conjecture by the second author proved by schneiderstuhler and independently the f...
[['we', 'present', 'a', 'conjecture', 'and', 'a', 'proof', 'for', 'gsl2', 'generalizing', 'a', 'result', 'of', 'j', 'arthur', 'which', 'expresses', 'a', 'character', 'value', 'of', 'a', 'cuspidal', 'representation', 'of', 'a', 'padic', 'group', 'as', 'a', 'weighted', 'orbital', 'integral', 'of', 'its', 'matrix', 'coeff...
[-0.20705242954815428, 0.03666402567517556, -0.15007743074998467, 0.051569202557827036, -0.12915922922289205, -0.10613725734874606, -0.0011908261234768562, 0.2559424101594939, -0.318471729884752, -0.2117650916179021, 0.09170606895996672, -0.20778734041377903, -0.18626161308752165, 0.20204737173496848, -0.12668271860004...
1,803.09443
Duality, Fundamentality, and Emergence
Dualities offer new possibilities for relating fundamentality and emergence. In particular, as is the aim of this chapter to show, it may happen that the relations of fundamentality and emergence between dual theories are inverted. In other words, the direction of emergence typically found in these cases is opposite ...
physics.hist-ph hep-th
dualities offer new possibilities for relating fundamentality and emergence in particular as is the aim of this chapter to show it may happen that the relations of fundamentality and emergence between dual theories are inverted in other words the direction of emergence typically found in these cases is opposite to the ...
[['dualities', 'offer', 'new', 'possibilities', 'for', 'relating', 'fundamentality', 'and', 'emergence', 'in', 'particular', 'as', 'is', 'the', 'aim', 'of', 'this', 'chapter', 'to', 'show', 'it', 'may', 'happen', 'that', 'the', 'relations', 'of', 'fundamentality', 'and', 'emergence', 'between', 'dual', 'theories', 'are...
[-0.13806211989931763, 0.17686285903677346, -0.08004207492247224, 0.10357717902865261, -0.08940020033717155, -0.1427395797893405, 0.03386689661582932, 0.33427495013177394, -0.2801187598332763, -0.2848376804701984, 0.0709744896972552, -0.24166011188179254, -0.18910505869984626, 0.21176426298962905, -0.05985754934325814,...
1,803.09444
Cliquet option pricing with Meixner processes
We investigate the pricing of cliquet options in a geometric Meixner model. The considered option is of monthly sum cap style while the underlying stock price model is driven by a pure-jump Meixner--L\'{e}vy process yielding Meixner distributed log-returns. In this setting, we infer semi-analytic expressions for the ...
q-fin.PR math.PR
we investigate the pricing of cliquet options in a geometric meixner model the considered option is of monthly sum cap style while the underlying stock price model is driven by a purejump meixnerlevy process yielding meixner distributed logreturns in this setting we infer semianalytic expressions for the cliquet option...
[['we', 'investigate', 'the', 'pricing', 'of', 'cliquet', 'options', 'in', 'a', 'geometric', 'meixner', 'model', 'the', 'considered', 'option', 'is', 'of', 'monthly', 'sum', 'cap', 'style', 'while', 'the', 'underlying', 'stock', 'price', 'model', 'is', 'driven', 'by', 'a', 'purejump', 'meixnerlevy', 'process', 'yieldin...
[-0.053035543806561565, 0.0442563251717111, -0.12505658331679778, 0.1386460630566008, -0.076172848629937, -0.10507030741230232, 0.08316973088652764, 0.41444496181115364, -0.30440517191241667, -0.23232226951716883, 0.12115293331512078, -0.2490704118373614, -0.13954286913848618, 0.18014472649315172, -0.11647579556746969,...
1,803.09445
Evaluations of Series Related to Jacobi Elliptic Functions
In this article we give evaluations of certain series of hyperbolic functions using Jacobi elliptic functions theory. We also define some new functions that enable us to give characterization of not solvable class of series.
math.NT
in this article we give evaluations of certain series of hyperbolic functions using jacobi elliptic functions theory we also define some new functions that enable us to give characterization of not solvable class of series
[['in', 'this', 'article', 'we', 'give', 'evaluations', 'of', 'certain', 'series', 'of', 'hyperbolic', 'functions', 'using', 'jacobi', 'elliptic', 'functions', 'theory', 'we', 'also', 'define', 'some', 'new', 'functions', 'that', 'enable', 'us', 'to', 'give', 'characterization', 'of', 'not', 'solvable', 'class', 'of', ...
[-0.12965778499575598, 0.021802336456520216, -0.14167140369037431, 0.06350905739236623, -0.15562038363090583, -0.10320380021418844, -2.4397129059902258e-05, 0.3578314292111567, -0.2885351826037679, -0.22484110923750059, 0.06188258395995945, -0.22594807360853467, -0.25970933554427966, 0.3006067329751594, -0.076707512645...
1,803.09446
Convergent kernel-based methods for parabolic equations
We prove that the functions constructed by the kernel-based regressions with Wendland kernels under $\ell_1$-norm constraints converge to unique viscosity solutions of the corresponding fully nonlinear parabolic equations. A key ingredient in our proof is the max-min representations of the nonlinearities of the equat...
math.NA cs.NA math.OC
we prove that the functions constructed by the kernelbased regressions with wendland kernels under ell_1norm constraints converge to unique viscosity solutions of the corresponding fully nonlinear parabolic equations a key ingredient in our proof is the maxmin representations of the nonlinearities of the equations
[['we', 'prove', 'that', 'the', 'functions', 'constructed', 'by', 'the', 'kernelbased', 'regressions', 'with', 'wendland', 'kernels', 'under', 'ell_1norm', 'constraints', 'converge', 'to', 'unique', 'viscosity', 'solutions', 'of', 'the', 'corresponding', 'fully', 'nonlinear', 'parabolic', 'equations', 'a', 'key', 'ingr...
[-0.0945738152262162, -0.03661527354746464, -0.12252122538418254, 0.04915578591118736, -0.1066814013227651, -0.1297420835246819, -0.0517993387342854, 0.262782324698161, -0.34431844373995607, -0.1831034219146452, 0.12052715449747418, -0.27960296449336136, -0.1683946001100015, 0.1733960065017031, -0.0625754291461569, 0.1...
1,803.09447
Entropic bounds on currents in Langevin systems
We derive a bound on generalized currents for Langevin systems in terms of the total entropy production in the system and its environment. For overdamped dynamics, any generalized current is bounded by the total rate of entropy production. We show that this entropic bound on the magnitude of generalized currents impo...
cond-mat.stat-mech
we derive a bound on generalized currents for langevin systems in terms of the total entropy production in the system and its environment for overdamped dynamics any generalized current is bounded by the total rate of entropy production we show that this entropic bound on the magnitude of generalized currents imposes p...
[['we', 'derive', 'a', 'bound', 'on', 'generalized', 'currents', 'for', 'langevin', 'systems', 'in', 'terms', 'of', 'the', 'total', 'entropy', 'production', 'in', 'the', 'system', 'and', 'its', 'environment', 'for', 'overdamped', 'dynamics', 'any', 'generalized', 'current', 'is', 'bounded', 'by', 'the', 'total', 'rate'...
[-0.16355889069447138, 0.1892221130186161, -0.038486691324466936, 0.06616209512355337, -0.03163138587371181, -0.1815271760394287, 0.11366165054223225, 0.3218186842277646, -0.2821038952344435, -0.26745435735470924, 0.07726908666562997, -0.29283503666207944, -0.11162649594148485, 0.27717502739842376, -0.05197824954117685...
1,803.09448
REST: Real-to-Synthetic Transform for Illumination Invariant Camera Localization
Accurate camera localization is an essential part of tracking systems. However, localization results are greatly affected by illumination. Including data collected under various lighting conditions can improve the robustness of the localization algorithm to lighting variation. However, this is very tedious and time c...
cs.CV
accurate camera localization is an essential part of tracking systems however localization results are greatly affected by illumination including data collected under various lighting conditions can improve the robustness of the localization algorithm to lighting variation however this is very tedious and time consumin...
[['accurate', 'camera', 'localization', 'is', 'an', 'essential', 'part', 'of', 'tracking', 'systems', 'however', 'localization', 'results', 'are', 'greatly', 'affected', 'by', 'illumination', 'including', 'data', 'collected', 'under', 'various', 'lighting', 'conditions', 'can', 'improve', 'the', 'robustness', 'of', 'th...
[-0.06751739138375923, 0.044284301034814545, -0.09315927681565937, 0.0371445504007573, -0.06548728853387316, -0.17010917210172544, -0.008802760710469303, 0.47166234044809396, -0.25957325723060626, -0.38338888253651787, 0.1260485862370955, -0.24250502702924087, -0.14518440298294438, 0.2389668947927049, -0.19644431146185...
1,803.09449
Distinct pressure evolution of coupled nematic and magnetic order in FeSe
FeSe, despite being the structurally simplest compound in the family of iron-based superconductors, shows an astoundingly rich interplay of physical phenomena including nematicity and pressure-induced magnetism. Here, we present a microscopic study of these two phenomena by high-energy x-ray diffraction and time-doma...
cond-mat.supr-con cond-mat.str-el
fese despite being the structurally simplest compound in the family of ironbased superconductors shows an astoundingly rich interplay of physical phenomena including nematicity and pressureinduced magnetism here we present a microscopic study of these two phenomena by highenergy xray diffraction and timedomain mossbaue...
[['fese', 'despite', 'being', 'the', 'structurally', 'simplest', 'compound', 'in', 'the', 'family', 'of', 'ironbased', 'superconductors', 'shows', 'an', 'astoundingly', 'rich', 'interplay', 'of', 'physical', 'phenomena', 'including', 'nematicity', 'and', 'pressureinduced', 'magnetism', 'here', 'we', 'present', 'a', 'mi...
[-0.19978164323408426, 0.29685037014591675, -0.010838340498037167, -0.02886541356880067, -0.09185153069939497, -0.1081197633982745, 0.17216518110341836, 0.4128885494690884, -0.31260793529115805, -0.2741270667395076, -0.015377906020017559, -0.3277218291464656, -0.100657708909329, 0.13320984128392763, 0.07073330256651651...
1,803.0945
The chemistry of disks around T Tauri and Herbig Ae/Be stars
Infrared and (sub-)mm observations of disks around T Tauri and Herbig Ae/Be stars point to a chemical differentiation between both types of disks, with a lower detection rate of molecules in disks around hotter stars. To investigate the potential underlying causes we perform a comparative study of the chemistry of T ...
astro-ph.GA astro-ph.SR
infrared and submm observations of disks around t tauri and herbig aebe stars point to a chemical differentiation between both types of disks with a lower detection rate of molecules in disks around hotter stars to investigate the potential underlying causes we perform a comparative study of the chemistry of t tauri an...
[['infrared', 'and', 'submm', 'observations', 'of', 'disks', 'around', 't', 'tauri', 'and', 'herbig', 'aebe', 'stars', 'point', 'to', 'a', 'chemical', 'differentiation', 'between', 'both', 'types', 'of', 'disks', 'with', 'a', 'lower', 'detection', 'rate', 'of', 'molecules', 'in', 'disks', 'around', 'hotter', 'stars', '...
[-0.029569470883154918, 0.1427839901505245, -0.005720711382667697, 0.06892516333997871, -0.04481071007349307, -0.0861774005893884, 0.07627958607312943, 0.4410376877775268, -0.1787909754769071, -0.30671240016818047, 0.03338915914895811, -0.28355530574991705, -0.030323742963151917, 0.13486004319182404, -0.084711535123457...
1,803.09451
Derived categories for Grothendieck categories of enriched functors
The derived category $D[C,V]$ of the Grothendieck category of enriched functors $[C,V]$, where $V$ is a closed symmetric monoidal Grothendieck category and $C$ is a small $V$-category, is studied. We prove that if the derived category $D(V)$ of $V$ is a compactly generated triangulated category with certain reasonabl...
math.CT math.KT
the derived category dcv of the grothendieck category of enriched functors cv where v is a closed symmetric monoidal grothendieck category and c is a small vcategory is studied we prove that if the derived category dv of v is a compactly generated triangulated category with certain reasonable assumptions on compact gen...
[['the', 'derived', 'category', 'dcv', 'of', 'the', 'grothendieck', 'category', 'of', 'enriched', 'functors', 'cv', 'where', 'v', 'is', 'a', 'closed', 'symmetric', 'monoidal', 'grothendieck', 'category', 'and', 'c', 'is', 'a', 'small', 'vcategory', 'is', 'studied', 'we', 'prove', 'that', 'if', 'the', 'derived', 'catego...
[-0.15394859126693494, 0.025450630297741184, -0.039385186048929356, 0.11222969156979407, -0.10416522915978488, -0.1665878323020061, -0.08390423371708272, 0.43569361876595664, -0.42714656577948984, -0.1413174400836028, 0.05915610967329829, -0.15349809599511727, -0.06291325995383935, 0.15740564115332892, -0.2427643861848...
1,803.09452
Panel Data Analysis with Heterogeneous Dynamics
This paper proposes a model-free approach to analyze panel data with heterogeneous dynamic structures across observational units. We first compute the sample mean, autocovariances, and autocorrelations for each unit, and then estimate the parameters of interest based on their empirical distributions. We then investig...
econ.EM
this paper proposes a modelfree approach to analyze panel data with heterogeneous dynamic structures across observational units we first compute the sample mean autocovariances and autocorrelations for each unit and then estimate the parameters of interest based on their empirical distributions we then investigate the ...
[['this', 'paper', 'proposes', 'a', 'modelfree', 'approach', 'to', 'analyze', 'panel', 'data', 'with', 'heterogeneous', 'dynamic', 'structures', 'across', 'observational', 'units', 'we', 'first', 'compute', 'the', 'sample', 'mean', 'autocovariances', 'and', 'autocorrelations', 'for', 'each', 'unit', 'and', 'then', 'est...
[-0.023225326967589995, 0.005245761982366151, -0.13243372472660506, 0.11708312927672238, -0.052635584469409843, -0.08789288730579703, 0.10312351068440716, 0.39113852684842604, -0.23865066166948892, -0.3200930843458456, 0.11998308674939086, -0.27093931462834864, -0.15553151332035972, 0.20455925915317208, -0.071730575560...
1,803.09453
CNN in MRF: Video Object Segmentation via Inference in A CNN-Based Higher-Order Spatio-Temporal MRF
This paper addresses the problem of video object segmentation, where the initial object mask is given in the first frame of an input video. We propose a novel spatio-temporal Markov Random Field (MRF) model defined over pixels to handle this problem. Unlike conventional MRF models, the spatial dependencies among pixe...
cs.CV
this paper addresses the problem of video object segmentation where the initial object mask is given in the first frame of an input video we propose a novel spatiotemporal markov random field mrf model defined over pixels to handle this problem unlike conventional mrf models the spatial dependencies among pixels in our...
[['this', 'paper', 'addresses', 'the', 'problem', 'of', 'video', 'object', 'segmentation', 'where', 'the', 'initial', 'object', 'mask', 'is', 'given', 'in', 'the', 'first', 'frame', 'of', 'an', 'input', 'video', 'we', 'propose', 'a', 'novel', 'spatiotemporal', 'markov', 'random', 'field', 'mrf', 'model', 'defined', 'ov...
[-0.0455957766957214, 0.0234930107768297, -0.04796633806642778, 0.057397897841564835, -0.09712457051959458, -0.19835745010598393, 0.008870467931844222, 0.4773424107196002, -0.29745960591608667, -0.3588916529841684, 0.024788700632253212, -0.20092909984758556, -0.1772721607336692, 0.10110203134185024, -0.1463341154387505...
1,803.09454
Fast and Accurate Single Image Super-Resolution via Information Distillation Network
Recently, deep convolutional neural networks (CNNs) have been demonstrated remarkable progress on single image super-resolution. However, as the depth and width of the networks increase, CNN-based super-resolution methods have been faced with the challenges of computational complexity and memory consumption in practi...
cs.CV
recently deep convolutional neural networks cnns have been demonstrated remarkable progress on single image superresolution however as the depth and width of the networks increase cnnbased superresolution methods have been faced with the challenges of computational complexity and memory consumption in practice in order...
[['recently', 'deep', 'convolutional', 'neural', 'networks', 'cnns', 'have', 'been', 'demonstrated', 'remarkable', 'progress', 'on', 'single', 'image', 'superresolution', 'however', 'as', 'the', 'depth', 'and', 'width', 'of', 'the', 'networks', 'increase', 'cnnbased', 'superresolution', 'methods', 'have', 'been', 'face...
[-0.05632750567023617, -0.014564779943808587, -0.0351436471541387, 0.023397088013715237, -0.04444462969219564, -0.16319399822654354, -0.009022648637560573, 0.4505614048927217, -0.30814513735775206, -0.3234839080949314, 0.1182195573308933, -0.2658394135585105, -0.16653592996299266, 0.1723746627430759, -0.112427494632130...
1,803.09455
Crime Pays; Homogenized Wave Equations for Long Times
This article examines the accuracy for large times of asymptotic expansions from periodic homogenization of wave equations. As usual, $\epsilon$ denotes the small period of the coefficients in the wave equation. We first prove that the standard two scale asymptotic expansion provides an accurate approximation of the ...
math.AP
this article examines the accuracy for large times of asymptotic expansions from periodic homogenization of wave equations as usual epsilon denotes the small period of the coefficients in the wave equation we first prove that the standard two scale asymptotic expansion provides an accurate approximation of the exact so...
[['this', 'article', 'examines', 'the', 'accuracy', 'for', 'large', 'times', 'of', 'asymptotic', 'expansions', 'from', 'periodic', 'homogenization', 'of', 'wave', 'equations', 'as', 'usual', 'epsilon', 'denotes', 'the', 'small', 'period', 'of', 'the', 'coefficients', 'in', 'the', 'wave', 'equation', 'we', 'first', 'pro...
[-0.169636627471687, 0.09261649052457002, -0.0434932623936751, 0.06956319587817728, -0.04018258236836167, -0.08529517346924334, 0.01353625196107232, 0.29712480150988235, -0.23161828387278638, -0.2861494939999292, 0.12681902184826166, -0.29367861934256234, -0.13366895953924615, 0.18658572257865194, 0.01177815479170156, ...
1,803.09456
Entropy of Higher Dimensional Charged Gauss-Bonnet Black hole in de Sitter Space
The fundamental equation of the thermodynamic system gives the relation between internal energy, entropy and volume of two adjacent equilibrium states. Taking higher dimensional charged Gauss-Bonnet black hole in de Sitter space as a thermodynamic system, the state parameters have to meet the fundamental equation of ...
gr-qc
the fundamental equation of the thermodynamic system gives the relation between internal energy entropy and volume of two adjacent equilibrium states taking higher dimensional charged gaussbonnet black hole in de sitter space as a thermodynamic system the state parameters have to meet the fundamental equation of thermo...
[['the', 'fundamental', 'equation', 'of', 'the', 'thermodynamic', 'system', 'gives', 'the', 'relation', 'between', 'internal', 'energy', 'entropy', 'and', 'volume', 'of', 'two', 'adjacent', 'equilibrium', 'states', 'taking', 'higher', 'dimensional', 'charged', 'gaussbonnet', 'black', 'hole', 'in', 'de', 'sitter', 'spac...
[-0.17606266854336755, 0.13457100651947762, -0.11677818151729756, 0.08879967456106565, -0.02380401331861064, -0.09463865541319989, 0.010650073383120622, 0.2358798857532301, -0.20001086655933903, -0.29053029901225047, 0.07374511711568858, -0.32678093683741893, -0.05910461456163452, 0.14593811300378176, -0.05546338542850...
1,803.09457
A holistic perspective on the dynamics of G035.39-00.33: the interplay between gas and magnetic fields
Magnetic field is one of the key agents that play a crucial role in shaping molecular clouds and regulating star formation, yet the complete information on the magnetic field is not well constrained due to the limitations in observations. We study the magnetic field in the massive infrared dark cloud G035.39-00.33 fr...
astro-ph.GA astro-ph.SR
magnetic field is one of the key agents that play a crucial role in shaping molecular clouds and regulating star formation yet the complete information on the magnetic field is not well constrained due to the limitations in observations we study the magnetic field in the massive infrared dark cloud g035390033 from dust...
[['magnetic', 'field', 'is', 'one', 'of', 'the', 'key', 'agents', 'that', 'play', 'a', 'crucial', 'role', 'in', 'shaping', 'molecular', 'clouds', 'and', 'regulating', 'star', 'formation', 'yet', 'the', 'complete', 'information', 'on', 'the', 'magnetic', 'field', 'is', 'not', 'well', 'constrained', 'due', 'to', 'the', '...
[-0.1543320407661321, 0.1533461481001665, -0.040838571664478095, 0.053465761627728446, -0.08463315986325994, -0.03147122046230213, -0.0015946815119749526, 0.4224065241980411, -0.21195775293375527, -0.3032124790119096, 0.08617732183830369, -0.20385639837066208, -0.0595793325543156, 0.1658563547724274, 0.0254789053504946...
1,803.09458
A new series solution method for the transmission problem
We derive analytic series representation for the Neumann-Poincare operator using the exterior conformal mapping for general shape domains. We derive the formula by using the Faber polynomial basis for arbitrary Lipschitz domains. With the proposed method we can approximate the spectrum of the smooth domains by findin...
math.AP
we derive analytic series representation for the neumannpoincare operator using the exterior conformal mapping for general shape domains we derive the formula by using the faber polynomial basis for arbitrary lipschitz domains with the proposed method we can approximate the spectrum of the smooth domains by finding the...
[['we', 'derive', 'analytic', 'series', 'representation', 'for', 'the', 'neumannpoincare', 'operator', 'using', 'the', 'exterior', 'conformal', 'mapping', 'for', 'general', 'shape', 'domains', 'we', 'derive', 'the', 'formula', 'by', 'using', 'the', 'faber', 'polynomial', 'basis', 'for', 'arbitrary', 'lipschitz', 'domai...
[-0.1236769941760533, -0.016070578594817156, -0.09865612439366418, 0.040945379828005585, -0.1285119132319493, -0.06724070251655223, -0.03877021069290923, 0.3506557481613622, -0.2884872530642619, -0.23022172448517225, 0.15057929304998313, -0.232639728489318, -0.2152637940442273, 0.1762895651175571, -0.009916044076654449...
1,803.09459
Nonkinematic solar dynamo models with double-cell meridional circulation
Employing the standard solar interior model as input we construct a dynamically-consistent nonlinear dynamo model that takes into account the detailed description of the \Lambda- effect, turbulent pumping, magnetic helicity balance, and magnetic feedback on the differential rotation and meridional circulation. The ba...
astro-ph.SR
employing the standard solar interior model as input we construct a dynamicallyconsistent nonlinear dynamo model that takes into account the detailed description of the lambda effect turbulent pumping magnetic helicity balance and magnetic feedback on the differential rotation and meridional circulation the background ...
[['employing', 'the', 'standard', 'solar', 'interior', 'model', 'as', 'input', 'we', 'construct', 'a', 'dynamicallyconsistent', 'nonlinear', 'dynamo', 'model', 'that', 'takes', 'into', 'account', 'the', 'detailed', 'description', 'of', 'the', 'lambda', 'effect', 'turbulent', 'pumping', 'magnetic', 'helicity', 'balance'...
[-0.2016753096008537, 0.21689657823632688, -0.006904823544276197, 0.09601976172317092, -0.07539388059933738, -0.006145683739606927, 0.01477564312404067, 0.32203434039270734, -0.27817141273081664, -0.3498136888462596, 0.043873081975275785, -0.22465105426651086, -0.12226823866594493, 0.22114757937606333, 0.00083349477954...
1,803.0946
Scalable inference for crossed random effects models
We analyze the complexity of Gibbs samplers for inference in crossed random effect models used in modern analysis of variance. We demonstrate that for certain designs the plain vanilla Gibbs sampler is not scalable, in the sense that its complexity is worse than proportional to the number of parameters and data. We t...
stat.CO stat.ME stat.ML
we analyze the complexity of gibbs samplers for inference in crossed random effect models used in modern analysis of variance we demonstrate that for certain designs the plain vanilla gibbs sampler is not scalable in the sense that its complexity is worse than proportional to the number of parameters and data we thus p...
[['we', 'analyze', 'the', 'complexity', 'of', 'gibbs', 'samplers', 'for', 'inference', 'in', 'crossed', 'random', 'effect', 'models', 'used', 'in', 'modern', 'analysis', 'of', 'variance', 'we', 'demonstrate', 'that', 'for', 'certain', 'designs', 'the', 'plain', 'vanilla', 'gibbs', 'sampler', 'is', 'not', 'scalable', 'i...
[-0.044205993781947804, 0.08714523386480587, -0.12055247976264406, 0.1485055609664414, -0.06817067011950477, -0.16417531932388701, 0.08843948220225772, 0.4315179453021096, -0.24410772064865957, -0.3082501822481713, 0.09858654528356818, -0.21390692878048867, -0.13984634176613914, 0.23423059503998486, -0.1225025806155416...
1,803.09461
A clustering approach to infer Wikipedia contributors' profile
In online communities, recent studies have strongly improved our knowledge about the different types or profiles of contributors, from casual to very involved ones, through focused people. However they do so by using very complex methodologies (qualitative-quantitative mix, with a high workload to manually codify/cha...
cs.HC cs.CY stat.AP
in online communities recent studies have strongly improved our knowledge about the different types or profiles of contributors from casual to very involved ones through focused people however they do so by using very complex methodologies qualitativequantitative mix with a high workload to manually codifycharacterize ...
[['in', 'online', 'communities', 'recent', 'studies', 'have', 'strongly', 'improved', 'our', 'knowledge', 'about', 'the', 'different', 'types', 'or', 'profiles', 'of', 'contributors', 'from', 'casual', 'to', 'very', 'involved', 'ones', 'through', 'focused', 'people', 'however', 'they', 'do', 'so', 'by', 'using', 'very'...
[-0.055597566916569044, 0.06277638282276027, -0.0801114486510489, 0.08692279000517797, -0.13738548267498765, -0.13163119483185368, 0.086366977922982, 0.44031587743187606, -0.2161177897902384, -0.3975947889920375, 0.1096357550354011, -0.3237929218497537, -0.12141468614652395, 0.1929620949332985, -0.09067667034543948, 9....
1,803.09462
A priori tests of a novel LES approach to compressible variable density turbulence
We assess the viability of a recently proposed novel approach to LES for compressible variable density flows by means of a priori tests. The a priori tests have been carried out filtering a two-dimensional DNS database of the classic lock-exchange benchmark. The tests confirm that additional terms should be accounted...
physics.flu-dyn
we assess the viability of a recently proposed novel approach to les for compressible variable density flows by means of a priori tests the a priori tests have been carried out filtering a twodimensional dns database of the classic lockexchange benchmark the tests confirm that additional terms should be accounted for i...
[['we', 'assess', 'the', 'viability', 'of', 'a', 'recently', 'proposed', 'novel', 'approach', 'to', 'les', 'for', 'compressible', 'variable', 'density', 'flows', 'by', 'means', 'of', 'a', 'priori', 'tests', 'the', 'a', 'priori', 'tests', 'have', 'been', 'carried', 'out', 'filtering', 'a', 'twodimensional', 'dns', 'data...
[-0.08888690207592245, 0.00911941639397566, -0.10428470365203373, 0.08074817769392678, -0.0439100217346738, -0.10800358381906025, 0.016013602317288156, 0.31281718966074107, -0.20780402748482074, -0.34395044751070647, 0.14850534152001052, -0.21738592361486175, -0.10291975791134485, 0.22770605002325484, -0.03468921578988...
1,803.09463
Gaia: 3-dimensional census of the Milky Way Galaxy
Astrometry from space has unique advantages over ground-based observations: the all-sky coverage, relatively stable, and temperature and gravity invariant operating environment delivers precision, accuracy and sample volume several orders of magnitude greater than ground-based results. Even more importantly, absolute...
astro-ph.IM gr-qc physics.ed-ph
astrometry from space has unique advantages over groundbased observations the allsky coverage relatively stable and temperature and gravity invariant operating environment delivers precision accuracy and sample volume several orders of magnitude greater than groundbased results even more importantly absolute astrometry...
[['astrometry', 'from', 'space', 'has', 'unique', 'advantages', 'over', 'groundbased', 'observations', 'the', 'allsky', 'coverage', 'relatively', 'stable', 'and', 'temperature', 'and', 'gravity', 'invariant', 'operating', 'environment', 'delivers', 'precision', 'accuracy', 'and', 'sample', 'volume', 'several', 'orders'...
[-0.0787116451259427, 0.12982267959979626, -0.05450024931612884, 0.05986869569890804, -0.13123076269679793, -0.010929712359990242, 0.05846394635868114, 0.3862751271078875, -0.19092256713881564, -0.4219631592047886, 0.08740444384838297, -0.3567496607093219, 0.022586517770525436, 0.29425345395337527, -0.05921987362179748...
1,803.09464
Spectroscopy and spectropolarimetry of AGN: from observations to modelling
Active galactic nuclei (AGN) are one of the most luminous objects in the Universe, emitting powerful continuum and line emission across all wavelength bands. They represent an important link in the investigations of the galaxy evolution and cosmology. The resolving of the AGN inner structure is still a difficult task...
astro-ph.GA
active galactic nuclei agn are one of the most luminous objects in the universe emitting powerful continuum and line emission across all wavelength bands they represent an important link in the investigations of the galaxy evolution and cosmology the resolving of the agn inner structure is still a difficult task with c...
[['active', 'galactic', 'nuclei', 'agn', 'are', 'one', 'of', 'the', 'most', 'luminous', 'objects', 'in', 'the', 'universe', 'emitting', 'powerful', 'continuum', 'and', 'line', 'emission', 'across', 'all', 'wavelength', 'bands', 'they', 'represent', 'an', 'important', 'link', 'in', 'the', 'investigations', 'of', 'the', ...
[-0.06872354357543847, 0.051373265669605206, -0.05214755029782005, 0.12446271677137069, -0.11389612840164615, -0.07573249176873462, 0.01360993911512196, 0.4424736731240283, -0.1748919736887531, -0.33058389611542227, 0.10744165105178305, -0.30005113062570277, -0.03224539430457694, 0.21719731283446891, -0.007244302022888...
1,803.09465
Formation of tidally induced bars in galactic flybys: prograde versus retrograde encounters
Bars in disky galaxies can be formed by interactions with other systems, including those of comparable mass. It has long been established that the effect of such interactions on galaxy morphology depends strongly on the orbital configuration, in particular the orientation of the intrinsic spin of the galactic disk wi...
astro-ph.GA
bars in disky galaxies can be formed by interactions with other systems including those of comparable mass it has long been established that the effect of such interactions on galaxy morphology depends strongly on the orbital configuration in particular the orientation of the intrinsic spin of the galactic disk with re...
[['bars', 'in', 'disky', 'galaxies', 'can', 'be', 'formed', 'by', 'interactions', 'with', 'other', 'systems', 'including', 'those', 'of', 'comparable', 'mass', 'it', 'has', 'long', 'been', 'established', 'that', 'the', 'effect', 'of', 'such', 'interactions', 'on', 'galaxy', 'morphology', 'depends', 'strongly', 'on', 't...
[-0.16314612596622294, 0.1271060123267181, -0.08819413468087708, 0.0944402372678816, -0.10320978124525798, -0.04349346927170497, -0.017360841389745474, 0.41661104273451754, -0.17366974607696276, -0.33279251861798786, 0.01722752760058692, -0.2590648368511403, -0.07856342350819197, 0.20125185494845457, -0.022175761145647...
1,803.09466
Regularizing Deep Hashing Networks Using GAN Generated Fake Images
Recently, deep-networks-based hashing (deep hashing) has become a leading approach for large-scale image retrieval. It aims to learn a compact bitwise representation for images via deep networks, so that similar images are mapped to nearby hash codes. Since a deep network model usually has a large number of parameter...
cs.CV
recently deepnetworksbased hashing deep hashing has become a leading approach for largescale image retrieval it aims to learn a compact bitwise representation for images via deep networks so that similar images are mapped to nearby hash codes since a deep network model usually has a large number of parameters it may pr...
[['recently', 'deepnetworksbased', 'hashing', 'deep', 'hashing', 'has', 'become', 'a', 'leading', 'approach', 'for', 'largescale', 'image', 'retrieval', 'it', 'aims', 'to', 'learn', 'a', 'compact', 'bitwise', 'representation', 'for', 'images', 'via', 'deep', 'networks', 'so', 'that', 'similar', 'images', 'are', 'mapped...
[-0.03802699881265938, -0.02571719657338414, -0.11235260011482613, 0.11723670789197317, -0.09926950638745227, -0.2088487164969269, 0.02937247339797193, 0.4884955459075728, -0.2967935809335932, -0.33222468265015587, 0.061443054117814096, -0.2567397824152576, -0.21277890468713656, 0.1585809684312192, -0.15562795728038978...