id float64 706 1.8k | title stringlengths 1 343 | abstract stringlengths 6 6.09k | categories stringlengths 5 125 | processed_abstract stringlengths 2 5.96k | tokenized_abstract stringlengths 8 8.74k | centroid stringlengths 2.1k 2.17k |
|---|---|---|---|---|---|---|
1,803.09367 | Opposition diagrams for automorphisms of small spherical buildings | An automorphism $\theta$ of a spherical building $\Delta$ is called
\textit{capped} if it satisfies the following property: if there exist both
type $J_1$ and $J_2$ simplices of $\Delta$ mapped onto opposite simplices by
$\theta$ then there exists a type $J_1\cup J_2$ simplex of $\Delta$ mapped onto
an opposite simpl... | math.CO | an automorphism theta of a spherical building delta is called textitcapped if it satisfies the following property if there exist both type j_1 and j_2 simplices of delta mapped onto opposite simplices by theta then there exists a type j_1cup j_2 simplex of delta mapped onto an opposite simplex by theta in previous work... | [['an', 'automorphism', 'theta', 'of', 'a', 'spherical', 'building', 'delta', 'is', 'called', 'textitcapped', 'if', 'it', 'satisfies', 'the', 'following', 'property', 'if', 'there', 'exist', 'both', 'type', 'j_1', 'and', 'j_2', 'simplices', 'of', 'delta', 'mapped', 'onto', 'opposite', 'simplices', 'by', 'theta', 'then'... | [-0.17085841884194264, 0.1182438481337158, -0.040730379955393484, 0.016952537166372197, -0.04959135783579329, -0.13093630154135413, 0.01990435434714088, 0.38117038749383186, -0.2866469197424835, -0.19598376898673073, 0.0912882983138592, -0.3144227662477, -0.1771417593575436, 0.170391634296112, -0.10987278570035665, -0.... |
1,803.09368 | Variations on the $S_n$-module $Lie_n$ | We define, for each subset $S$ of primes, an $S_n$-module $Lie_n^S$ with
interesting properties. When $S=\emptyset,$ this is the well-known
representation $Lie_n$ of $S_n$ afforded by the free Lie algebra.
The most intriguing case is $S=\{2\},$ giving a decomposition of the regular
representation as a sum of {exter... | math.RT math.CO | we define for each subset s of primes an s_nmodule lie_ns with interesting properties when semptyset this is the wellknown representation lie_n of s_n afforded by the free lie algebra the most intriguing case is s2 giving a decomposition of the regular representation as a sum of exterior powers of modules lie_n2 this i... | [['we', 'define', 'for', 'each', 'subset', 's', 'of', 'primes', 'an', 's_nmodule', 'lie_ns', 'with', 'interesting', 'properties', 'when', 'semptyset', 'this', 'is', 'the', 'wellknown', 'representation', 'lie_n', 'of', 's_n', 'afforded', 'by', 'the', 'free', 'lie', 'algebra', 'the', 'most', 'intriguing', 'case', 'is', '... | [-0.15856547682148636, 0.02585996475575305, -0.1012788556907682, 0.04136457084900563, -0.1256952228700849, -0.09617930906676468, -0.005521974975694042, 0.30407992176189547, -0.37465267508086053, -0.20017771555443004, 0.12323343582750909, -0.21956766625402116, -0.1525411415744312, 0.17542500381104376, -0.117495282027691... |
1,803.09369 | Towards a Cybernetic Foundation for Natural Resource Governance | This study explores the potential of the cybernetic method of inquiry for the
problem of natural resource governance. The systems way of thinking has already
enabled scientists to gain considerable headway in framing global environmental
challenges. On the other hand, technical solutions to environmental problems
hav... | cs.SY | this study explores the potential of the cybernetic method of inquiry for the problem of natural resource governance the systems way of thinking has already enabled scientists to gain considerable headway in framing global environmental challenges on the other hand technical solutions to environmental problems have beg... | [['this', 'study', 'explores', 'the', 'potential', 'of', 'the', 'cybernetic', 'method', 'of', 'inquiry', 'for', 'the', 'problem', 'of', 'natural', 'resource', 'governance', 'the', 'systems', 'way', 'of', 'thinking', 'has', 'already', 'enabled', 'scientists', 'to', 'gain', 'considerable', 'headway', 'in', 'framing', 'gl... | [-0.10307841519929774, 0.0334207547897224, -0.0808421606090658, 0.08004155226399444, -0.0800514464923245, -0.13450832848884015, 0.07909587261960134, 0.35675890380645403, -0.28838315624572025, -0.34445603382408896, 0.09026919944106691, -0.23175776949847623, -0.214450941680746, 0.1994148158583112, -0.13762234620672698, 0... |
1,803.0937 | Popular Matching in Roommates Setting is NP-hard | An input to the Popular Matching problem, in the roommates setting, consists
of a graph $G$ and each vertex ranks its neighbors in strict order, known as
its preference. In the Popular Matching problem the objective is to test
whether there exists a matching $M^\star$ such that there is no matching $M$
where more peo... | cs.DS cs.CC cs.GT | an input to the popular matching problem in the roommates setting consists of a graph g and each vertex ranks its neighbors in strict order known as its preference in the popular matching problem the objective is to test whether there exists a matching mstar such that there is no matching m where more people are happie... | [['an', 'input', 'to', 'the', 'popular', 'matching', 'problem', 'in', 'the', 'roommates', 'setting', 'consists', 'of', 'a', 'graph', 'g', 'and', 'each', 'vertex', 'ranks', 'its', 'neighbors', 'in', 'strict', 'order', 'known', 'as', 'its', 'preference', 'in', 'the', 'popular', 'matching', 'problem', 'the', 'objective', ... | [-0.11022332337497752, 0.03342685853296608, -0.034108424495321275, 0.07818332442091595, -0.11150787552983008, -0.1391906792950798, 0.05755065840454407, 0.42392859611587197, -0.2669484228644447, -0.3605261102830078, 0.11515216709128306, -0.30170777168435353, -0.15527395030663932, 0.13378594371983232, -0.1364306551723869... |
1,803.09371 | StaQC: A Systematically Mined Question-Code Dataset from Stack Overflow | Stack Overflow (SO) has been a great source of natural language questions and
their code solutions (i.e., question-code pairs), which are critical for many
tasks including code retrieval and annotation. In most existing research,
question-code pairs were collected heuristically and tend to have low quality.
In this p... | cs.CL | stack overflow so has been a great source of natural language questions and their code solutions ie questioncode pairs which are critical for many tasks including code retrieval and annotation in most existing research questioncode pairs were collected heuristically and tend to have low quality in this paper we investi... | [['stack', 'overflow', 'so', 'has', 'been', 'a', 'great', 'source', 'of', 'natural', 'language', 'questions', 'and', 'their', 'code', 'solutions', 'ie', 'questioncode', 'pairs', 'which', 'are', 'critical', 'for', 'many', 'tasks', 'including', 'code', 'retrieval', 'and', 'annotation', 'in', 'most', 'existing', 'research... | [-0.06328818687166937, -0.02462908110844538, -0.03186161182795489, 0.11554572803256831, -0.13674921809338822, -0.18350453470813352, 0.07993978384879681, 0.42741783933319233, -0.2888161224223238, -0.3860220315147434, 0.09326403823386341, -0.32424748587199365, -0.10744604503649854, 0.218212557638965, -0.09974507399222246... |
1,803.09372 | Time-Dispersive Behaviour as a Feature of Critical Contrast Media | Motivated by the urgent need to attribute a rigorous mathematical meaning to
the term "metamaterial", we propose a novel approach to the homogenisation of
critical-contrast composites. This is based on the asymptotic analysis of the
Dirichlet-to-Neumann map on the interface between different components ("stiff"
and "... | math-ph cond-mat.mtrl-sci math.MP | motivated by the urgent need to attribute a rigorous mathematical meaning to the term metamaterial we propose a novel approach to the homogenisation of criticalcontrast composites this is based on the asymptotic analysis of the dirichlettoneumann map on the interface between different components stiff and soft of the m... | [['motivated', 'by', 'the', 'urgent', 'need', 'to', 'attribute', 'a', 'rigorous', 'mathematical', 'meaning', 'to', 'the', 'term', 'metamaterial', 'we', 'propose', 'a', 'novel', 'approach', 'to', 'the', 'homogenisation', 'of', 'criticalcontrast', 'composites', 'this', 'is', 'based', 'on', 'the', 'asymptotic', 'analysis'... | [-0.11685257391610111, 0.07259872537850662, -0.13240008620330349, 0.0037036737216672357, -0.14325205146227604, -0.09257587207517085, 0.05161776137202441, 0.36237333526010984, -0.2771719579322962, -0.2936424675863236, 0.0930515554030605, -0.2610038723238316, -0.19737812977893135, 0.15661979634135675, -0.0429675716217249... |
1,803.09373 | The continuous dependence for the Hal-MHD equations with fractional
magnetic diffusion | In this paper we show that the solutions to the incompressible Hall-MHD
system with fractional magnetic diffusion depend continuously on the initial
data in $H^s(\mathbb{R}^d)$, $s>1+\frac{d}{2}$.
| math.AP | in this paper we show that the solutions to the incompressible hallmhd system with fractional magnetic diffusion depend continuously on the initial data in hsmathbbrd s1fracd2 | [['in', 'this', 'paper', 'we', 'show', 'that', 'the', 'solutions', 'to', 'the', 'incompressible', 'hallmhd', 'system', 'with', 'fractional', 'magnetic', 'diffusion', 'depend', 'continuously', 'on', 'the', 'initial', 'data', 'in', 'hsmathbbrd', 's1fracd2']] | [-0.14952392244711518, 0.10621377225965262, -0.06330075925216079, -0.012382940459065139, -0.02803500762209296, -0.05564918637275696, -0.06634282189887017, 0.33310791105031967, -0.3061619970202446, -0.2801953101158142, 0.16059623249806465, -0.26335847809910773, -0.11969153314828873, 0.19781490735709667, -0.0676532617211... |
1,803.09374 | Generalized Hadamard-Product Fusion Operators for Visual Question
Answering | We propose a generalized class of multimodal fusion operators for the task of
visual question answering (VQA). We identify generalizations of existing
multimodal fusion operators based on the Hadamard product, and show that
specific non-trivial instantiations of this generalized fusion operator exhibit
superior perfo... | cs.LG cs.CV stat.ML | we propose a generalized class of multimodal fusion operators for the task of visual question answering vqa we identify generalizations of existing multimodal fusion operators based on the hadamard product and show that specific nontrivial instantiations of this generalized fusion operator exhibit superior performance ... | [['we', 'propose', 'a', 'generalized', 'class', 'of', 'multimodal', 'fusion', 'operators', 'for', 'the', 'task', 'of', 'visual', 'question', 'answering', 'vqa', 'we', 'identify', 'generalizations', 'of', 'existing', 'multimodal', 'fusion', 'operators', 'based', 'on', 'the', 'hadamard', 'product', 'and', 'show', 'that',... | [-0.03827275200000473, 0.013145592858355478, -0.012167332036321173, 0.053660937777999435, -0.08570296684535973, -0.14354536363869222, 0.04526887604796136, 0.4282215355241401, -0.25956732293462936, -0.2662828731402143, 0.05871728118437961, -0.25796938017152876, -0.1935958172201769, 0.19695347934278823, -0.13503675370384... |
1,803.09375 | Correcting differences in multi-site neuroimaging data using Generative
Adversarial Networks | Magnetic Resonance Imaging (MRI) of the brain has been used to investigate a
wide range of neurological disorders, but data acquisition can be expensive,
time-consuming, and inconvenient. Multi-site studies present a valuable
opportunity to advance research by pooling data in order to increase
sensitivity and statist... | cs.CV | magnetic resonance imaging mri of the brain has been used to investigate a wide range of neurological disorders but data acquisition can be expensive timeconsuming and inconvenient multisite studies present a valuable opportunity to advance research by pooling data in order to increase sensitivity and statistical power... | [['magnetic', 'resonance', 'imaging', 'mri', 'of', 'the', 'brain', 'has', 'been', 'used', 'to', 'investigate', 'a', 'wide', 'range', 'of', 'neurological', 'disorders', 'but', 'data', 'acquisition', 'can', 'be', 'expensive', 'timeconsuming', 'and', 'inconvenient', 'multisite', 'studies', 'present', 'a', 'valuable', 'opp... | [0.0034362487753646243, 0.045042300209388486, -0.07445305019064108, 0.13963581603861208, -0.1252873022178257, -0.18588423352102162, 0.02492210824210714, 0.4435977107517559, -0.2701154684505632, -0.3588883533763389, 0.096144339929365, -0.30341759452992983, -0.1684501991282256, 0.19594434900230867, -0.13098545395122427, ... |
1,803.09376 | Distinct stages of radio frequency emission at the onset of pedestal
collapse in KSTAR H-mode plasmas | Using a high-speed and broadband radio frequency (RF) (0.1-1 GHz) spectrum
analyzer developed on the KSTAR tokamak, it is found that several distinct
stages of RF emission appear at the pedestal collapse in high confinement
discharges. Comparison with 2-D electron cyclotron emission (ECE) images has
revealed that eac... | physics.plasm-ph | using a highspeed and broadband radio frequency rf 011 ghz spectrum analyzer developed on the kstar tokamak it is found that several distinct stages of rf emission appear at the pedestal collapse in high confinement discharges comparison with 2d electron cyclotron emission ece images has revealed that each stage is rel... | [['using', 'a', 'highspeed', 'and', 'broadband', 'radio', 'frequency', 'rf', '011', 'ghz', 'spectrum', 'analyzer', 'developed', 'on', 'the', 'kstar', 'tokamak', 'it', 'is', 'found', 'that', 'several', 'distinct', 'stages', 'of', 'rf', 'emission', 'appear', 'at', 'the', 'pedestal', 'collapse', 'in', 'high', 'confinement... | [-0.13822274565471496, 0.19713970080468488, -0.027836229870376733, 0.03109151151280826, -0.028895442587098266, -0.119262530002743, -0.01728442271112227, 0.4194395384976482, -0.19942837910349268, -0.28489634061073943, 0.0948096016106908, -0.2549220100851742, -0.02849683707299965, 0.1943652570320695, 0.06293660554550953,... |
1,803.09377 | Antineutrino Charged-Current reactions on Hydrocarbon with Low Momentum
Transfer | We report on multinucleon effects in low momentum transfer ($< 0.8$ GeV/c)
anti-neutrino interactions on plastic (CH) scintillator. These data are from
the 2010-2011 antineutrino phase of the MINERvA experiment at Fermilab. The
hadronic energy spectrum of this inclusive sample is well described when a
screening effec... | hep-ex | we report on multinucleon effects in low momentum transfer 08 gevc antineutrino interactions on plastic ch scintillator these data are from the 20102011 antineutrino phase of the minerva experiment at fermilab the hadronic energy spectrum of this inclusive sample is well described when a screening effect at low energy ... | [['we', 'report', 'on', 'multinucleon', 'effects', 'in', 'low', 'momentum', 'transfer', '08', 'gevc', 'antineutrino', 'interactions', 'on', 'plastic', 'ch', 'scintillator', 'these', 'data', 'are', 'from', 'the', '20102011', 'antineutrino', 'phase', 'of', 'the', 'minerva', 'experiment', 'at', 'fermilab', 'the', 'hadroni... | [-0.009281078672879754, 0.20795770058290916, -0.07435209740232257, 0.14824177022781948, 0.000832443987648632, -0.1152477808598731, 0.05890297765323372, 0.37424081909629675, -0.18578964193259273, -0.3087010585224709, -0.06393432529299176, -0.41308676025217717, -0.011423350198546777, 0.16278251870912877, 0.05570116834631... |
1,803.09378 | Algebraic theories and commutativity in a sheaf topos | For any site of definition $\mathcal C$ of a Grothendieck topos $\mathcal E$,
we define a notion of a $\mathcal C$-ary Lawvere theory $\tau: \mathscr C \to
\mathscr T$ whose category of models is a stack over $\mathcal E$. Our
definitions coincide with Lawvere's finitary theories when $\mathcal
C=\aleph_0$ and $\math... | math.CT math.AP math.FA | for any site of definition mathcal c of a grothendieck topos mathcal e we define a notion of a mathcal cary lawvere theory tau mathscr c to mathscr t whose category of models is a stack over mathcal e our definitions coincide with lawveres finitary theories when mathcal caleph_0 and mathcal e operatornamemathbf set we ... | [['for', 'any', 'site', 'of', 'definition', 'mathcal', 'c', 'of', 'a', 'grothendieck', 'topos', 'mathcal', 'e', 'we', 'define', 'a', 'notion', 'of', 'a', 'mathcal', 'cary', 'lawvere', 'theory', 'tau', 'mathscr', 'c', 'to', 'mathscr', 't', 'whose', 'category', 'of', 'models', 'is', 'a', 'stack', 'over', 'mathcal', 'e', ... | [-0.16341771508789868, 0.0720483168227201, -0.03934422023937197, 0.0721010466654745, -0.06340978541440027, -0.18224410294195167, 0.00705619525818577, 0.3532577952130075, -0.3976934178406658, -0.13138683827628203, 0.007475178540210051, -0.22942845340521056, -0.09232397338923959, 0.1612133962685025, -0.17998676797363655,... |
1,803.09379 | Multiview Hierarchical Agglomerative Clustering for Identification of
Development Gap and Regional Potential Sector | The identification of regional development gaps is an effort to see how far
the development conducted in every District in a Province. By seeing the gaps
occurred, it is expected that the Policymakers are able to determine which
region that will be prioritized for future development. Along with the regional
gaps, the... | cs.CY | the identification of regional development gaps is an effort to see how far the development conducted in every district in a province by seeing the gaps occurred it is expected that the policymakers are able to determine which region that will be prioritized for future development along with the regional gaps the ident... | [['the', 'identification', 'of', 'regional', 'development', 'gaps', 'is', 'an', 'effort', 'to', 'see', 'how', 'far', 'the', 'development', 'conducted', 'in', 'every', 'district', 'in', 'a', 'province', 'by', 'seeing', 'the', 'gaps', 'occurred', 'it', 'is', 'expected', 'that', 'the', 'policymakers', 'are', 'able', 'to',... | [-0.06791232265761568, 0.06611210055447193, -0.08545455527098351, 0.08561674983717803, -0.050272677328214575, -0.08735684777321426, 0.05856961911071984, 0.3604632338220385, -0.22475605030891707, -0.33744599940283976, 0.13314599515238948, -0.29417717530929915, -0.1058658886877951, 0.14866508187276875, -0.063903673206932... |
1,803.0938 | A distribution function correction-based immersed boundary- lattice
Boltzmann method with truly second-order accuracy for fluid-solid flows | The immersed boundary lattice Boltzmann method (IB-LBM) has been widely used
in the simulation of fluid-solid interaction and particulate flow problems,
since proposed in 2004. However, it is usually a non-trivial task to retain the
flexibility and the accuracy simultaneously in the implementation of this
approach. B... | physics.comp-ph | the immersed boundary lattice boltzmann method iblbm has been widely used in the simulation of fluidsolid interaction and particulate flow problems since proposed in 2004 however it is usually a nontrivial task to retain the flexibility and the accuracy simultaneously in the implementation of this approach based on the... | [['the', 'immersed', 'boundary', 'lattice', 'boltzmann', 'method', 'iblbm', 'has', 'been', 'widely', 'used', 'in', 'the', 'simulation', 'of', 'fluidsolid', 'interaction', 'and', 'particulate', 'flow', 'problems', 'since', 'proposed', 'in', '2004', 'however', 'it', 'is', 'usually', 'a', 'nontrivial', 'task', 'to', 'reta... | [-0.10954272503861123, 0.07054251679036473, -0.120378247718675, 0.028868809883665834, -0.07427429091722633, -0.14398029489187986, 0.00214182794577657, 0.3745598663798828, -0.2579430433619035, -0.29965053025720656, 0.10260914884254925, -0.23637387321457967, -0.11983894709593211, 0.1664904767764796, -0.05312877193861442,... |
1,803.09381 | Boundary of the horseshoe locus for the H\'enon family | The purpose of this article is to investigate geometric properties of the
parameter locus of the H\'enon family where the uniform hyperbolicity of a
horseshoe breaks down. As an application, we obtain a variational
characterization of equilibrium measures "at temperature zero" for the
corresponding non-uniformly hype... | math.DS | the purpose of this article is to investigate geometric properties of the parameter locus of the henon family where the uniform hyperbolicity of a horseshoe breaks down as an application we obtain a variational characterization of equilibrium measures at temperature zero for the corresponding nonuniformly hyperbolic he... | [['the', 'purpose', 'of', 'this', 'article', 'is', 'to', 'investigate', 'geometric', 'properties', 'of', 'the', 'parameter', 'locus', 'of', 'the', 'henon', 'family', 'where', 'the', 'uniform', 'hyperbolicity', 'of', 'a', 'horseshoe', 'breaks', 'down', 'as', 'an', 'application', 'we', 'obtain', 'a', 'variational', 'char... | [-0.14049590419849953, 0.07785749805030341, -0.13118730175627713, 0.02936051697847811, -0.07129288621263595, -0.0828487003098351, 0.01784746098617377, 0.25500392602538474, -0.2718011738547871, -0.2273864413187881, 0.12400683224188618, -0.26028805664690163, -0.1642924063914531, 0.25515077081047466, -0.09092183761835636,... |
1,803.09382 | Ion backflow studies with a triple-GEM stack with increasing hole pitch | Gas Electron Multipliers have undergone a very consistent development since
their invention in 1997. Their production procedures have been tuned in such a
way that nowadays it is possible to produce foils with areas of the order of
the square meter that can operate at a reasonable gain, uniform over large
areas and w... | physics.ins-det | gas electron multipliers have undergone a very consistent development since their invention in 1997 their production procedures have been tuned in such a way that nowadays it is possible to produce foils with areas of the order of the square meter that can operate at a reasonable gain uniform over large areas and with ... | [['gas', 'electron', 'multipliers', 'have', 'undergone', 'a', 'very', 'consistent', 'development', 'since', 'their', 'invention', 'in', '1997', 'their', 'production', 'procedures', 'have', 'been', 'tuned', 'in', 'such', 'a', 'way', 'that', 'nowadays', 'it', 'is', 'possible', 'to', 'produce', 'foils', 'with', 'areas', '... | [-0.054191572717378955, 0.1336265810468737, -0.08372215373374368, 0.02419492300808641, -0.0012902416164036264, -0.15659475180118815, -0.03423297943273732, 0.41801446011366766, -0.2139902537779825, -0.3437051375182922, 0.1299691773763829, -0.2923613549870218, -0.020372918610744292, 0.2351954641197472, -0.063004785154936... |
1,803.09383 | Online Second Order Methods for Non-Convex Stochastic Optimizations | This paper proposes a family of online second order methods for possibly
non-convex stochastic optimizations based on the theory of preconditioned
stochastic gradient descent (PSGD), which can be regarded as an enhance
stochastic Newton method with the ability to handle gradient noise and
non-convexity simultaneously... | stat.ML cs.LG | this paper proposes a family of online second order methods for possibly nonconvex stochastic optimizations based on the theory of preconditioned stochastic gradient descent psgd which can be regarded as an enhance stochastic newton method with the ability to handle gradient noise and nonconvexity simultaneously we hav... | [['this', 'paper', 'proposes', 'a', 'family', 'of', 'online', 'second', 'order', 'methods', 'for', 'possibly', 'nonconvex', 'stochastic', 'optimizations', 'based', 'on', 'the', 'theory', 'of', 'preconditioned', 'stochastic', 'gradient', 'descent', 'psgd', 'which', 'can', 'be', 'regarded', 'as', 'an', 'enhance', 'stocha... | [-0.05733593464360527, -0.05301319429764124, -0.06548071683174363, 0.0452602121314579, -0.08727739787115375, -0.20059858689300444, -0.02481531790207799, 0.4420533058767366, -0.33843745959059496, -0.30120986592160853, 0.11152061293108911, -0.21633987709107558, -0.24188105922288874, 0.21548228372717504, -0.12785964971976... |
1,803.09384 | Tame topology of arithmetic quotients and algebraicity of Hodge loci | We prove that the uniformizing map of any arithmetic quotient, as well as the
period map associated to any pure polarized $\mathbb{Z}$-variation of Hodge
structure $\mathbb{V}$ on a smooth complex quasi-projective variety $S$, are
topologically tame. As an easy corollary of these results and of
Peterzil-Starchenko's ... | math.AG math.DG math.LO | we prove that the uniformizing map of any arithmetic quotient as well as the period map associated to any pure polarized mathbbzvariation of hodge structure mathbbv on a smooth complex quasiprojective variety s are topologically tame as an easy corollary of these results and of peterzilstarchenkos ominimal gaga theorem... | [['we', 'prove', 'that', 'the', 'uniformizing', 'map', 'of', 'any', 'arithmetic', 'quotient', 'as', 'well', 'as', 'the', 'period', 'map', 'associated', 'to', 'any', 'pure', 'polarized', 'mathbbzvariation', 'of', 'hodge', 'structure', 'mathbbv', 'on', 'a', 'smooth', 'complex', 'quasiprojective', 'variety', 's', 'are', '... | [-0.20601856415825232, 0.0427861273473744, -0.13726985001204803, 0.09771841336873227, -0.1150821415840515, -0.12203058610404176, 0.03520566626851048, 0.31636857925248996, -0.37353416995278427, -0.18300827326519148, 0.10949229329292264, -0.19245131297835283, -0.14459989661949554, 0.24131508613354527, -0.1838699388317763... |
1,803.09385 | Quantifying the quantumness of ensembles via unitary similarity
invariant norms | The quantification of the quantumness of a quantum ensemble has theoretical
and practical significance in quantum information theory. We propose herein a
class of measures of the quantumness of quantum ensembles using the unitary
similarity invariant norms of the commutators of the constituent density
operators of an... | quant-ph | the quantification of the quantumness of a quantum ensemble has theoretical and practical significance in quantum information theory we propose herein a class of measures of the quantumness of quantum ensembles using the unitary similarity invariant norms of the commutators of the constituent density operators of an en... | [['the', 'quantification', 'of', 'the', 'quantumness', 'of', 'a', 'quantum', 'ensemble', 'has', 'theoretical', 'and', 'practical', 'significance', 'in', 'quantum', 'information', 'theory', 'we', 'propose', 'herein', 'a', 'class', 'of', 'measures', 'of', 'the', 'quantumness', 'of', 'quantum', 'ensembles', 'using', 'the'... | [-0.120361712832498, 0.1649107847480657, -0.13687096889681963, 0.09701216151481684, 0.02563799704586593, -0.1340396362689457, 0.04280596486250015, 0.3389340983323601, -0.29768320652941355, -0.2247497267707498, 0.05605126766259877, -0.2651071718190702, -0.14152999941677769, 0.1503471444950116, -0.11769605162363424, 0.17... |
1,803.09386 | A Systematic Comparison of Deep Learning Architectures in an Autonomous
Vehicle | Self-driving technology is advancing rapidly --- albeit with significant
challenges and limitations. This progress is largely due to recent developments
in deep learning algorithms. To date, however, there has been no systematic
comparison of how different deep learning architectures perform at such tasks,
or an atte... | cs.LG cs.CV cs.RO stat.ML | selfdriving technology is advancing rapidly albeit with significant challenges and limitations this progress is largely due to recent developments in deep learning algorithms to date however there has been no systematic comparison of how different deep learning architectures perform at such tasks or an attempt to deter... | [['selfdriving', 'technology', 'is', 'advancing', 'rapidly', 'albeit', 'with', 'significant', 'challenges', 'and', 'limitations', 'this', 'progress', 'is', 'largely', 'due', 'to', 'recent', 'developments', 'in', 'deep', 'learning', 'algorithms', 'to', 'date', 'however', 'there', 'has', 'been', 'no', 'systematic', 'comp... | [-0.06820020496923422, 0.033189941357226825, 0.0005558438184433174, 0.03973018871722267, -0.030809285040149452, -0.19880457240200167, 0.03804982136544112, 0.4840706502644848, -0.21980223474755584, -0.3944456009874052, 0.08934946299613841, -0.2565903130164166, -0.137226675057539, 0.22399688018468908, -0.1187125667079902... |
1,803.09387 | 3D Asymmetrical motions of the Galactic outer disk with LAMOST K giant
stars | We present a three dimensional velocity analysis of Milky Way disk kinematics
using LAMOST K giant stars and the GPS1 proper motion catalogue. We find that
Galactic disk stars near the anticenter direction (in the range of
Galactocentric distance between $R=8$ and $13$ kpc and vertical position
between $Z=-2$ and $2$... | astro-ph.GA | we present a three dimensional velocity analysis of milky way disk kinematics using lamost k giant stars and the gps1 proper motion catalogue we find that galactic disk stars near the anticenter direction in the range of galactocentric distance between r8 and 13 kpc and vertical position between z2 and 2 kpc exhibit as... | [['we', 'present', 'a', 'three', 'dimensional', 'velocity', 'analysis', 'of', 'milky', 'way', 'disk', 'kinematics', 'using', 'lamost', 'k', 'giant', 'stars', 'and', 'the', 'gps1', 'proper', 'motion', 'catalogue', 'we', 'find', 'that', 'galactic', 'disk', 'stars', 'near', 'the', 'anticenter', 'direction', 'in', 'the', '... | [-0.1434148196122831, 0.1538124758289571, -0.0718351850312238, 0.06439341851520987, -0.12247922808523769, -0.02129430933020439, 0.011529047239058277, 0.43672172250726615, -0.2399398886208873, -0.32975622170352353, 0.003290342675656881, -0.29097430877143815, -0.012250823507337857, 0.19292208344662545, 0.0063235897234386... |
1,803.09388 | Interference-assisted resonant detection of axions | Detection schemes for the quantum chromodynamics axions and other axion-like
particles in light-shining-through-a-wall (LSW) experiments are based on the
conversion of these particles into photons in a magnetic field. An alternative
scheme may involve the detection via a resonant atomic or molecular transition
induce... | hep-ph astro-ph.CO physics.atom-ph | detection schemes for the quantum chromodynamics axions and other axionlike particles in lightshiningthroughawall lsw experiments are based on the conversion of these particles into photons in a magnetic field an alternative scheme may involve the detection via a resonant atomic or molecular transition induced by reson... | [['detection', 'schemes', 'for', 'the', 'quantum', 'chromodynamics', 'axions', 'and', 'other', 'axionlike', 'particles', 'in', 'lightshiningthroughawall', 'lsw', 'experiments', 'are', 'based', 'on', 'the', 'conversion', 'of', 'these', 'particles', 'into', 'photons', 'in', 'a', 'magnetic', 'field', 'an', 'alternative', ... | [-0.16743855724854165, 0.2895548916331903, -0.05672451960487982, 0.07061473889550827, -0.06825254719411389, -0.09204769150741147, 0.053449299759388474, 0.37135858623457424, -0.21248215508092655, -0.3318697338233168, 0.022795388684346433, -0.27376157476493485, -0.10354246857597, 0.18852255568483822, 0.10290409345179796,... |
1,803.09389 | On graded $\mathbb{E}_{\infty}$-rings and projective schemes in spectral
algebraic geometry | We introduce graded $\mathbb{E}_{\infty}$-rings and graded modules over them,
and study their properties. We construct projective schemes associated to
connective $\mathbb{N}$-graded $\mathbb{E}_{\infty}$-rings in spectral
algebraic geometry. Under some finiteness conditions, we show that the
$\infty$-category of alm... | math.KT | we introduce graded mathbbe_inftyrings and graded modules over them and study their properties we construct projective schemes associated to connective mathbbngraded mathbbe_inftyrings in spectral algebraic geometry under some finiteness conditions we show that the inftycategory of almost perfect quasicoherent sheaves ... | [['we', 'introduce', 'graded', 'mathbbe_inftyrings', 'and', 'graded', 'modules', 'over', 'them', 'and', 'study', 'their', 'properties', 'we', 'construct', 'projective', 'schemes', 'associated', 'to', 'connective', 'mathbbngraded', 'mathbbe_inftyrings', 'in', 'spectral', 'algebraic', 'geometry', 'under', 'some', 'finite... | [-0.21933327028527855, 0.009004915738478303, -0.10650563972691694, 0.07835340206511318, -0.07002238559459026, -0.1730305119495218, -0.08008256123090783, 0.4672394398599863, -0.4461284400274356, -0.11861486497024695, 0.08591363478529578, -0.13803767614687482, -0.14203303984443968, 0.21167465389395754, -0.249947447593634... |
1,803.0939 | 21cm Limits on Decaying Dark Matter and Primordial Black Holes | Recently the Experiment to Detect the Global Epoch of Reionization Signature
(EDGES) reported the detection of a 21cm absorption signal stronger than
astrophysical expectations. In this paper we study the impact of radiation from
dark matter (DM) decay and primordial black holes (PBH) on the 21cm radiation
temperatur... | astro-ph.HE hep-ph | recently the experiment to detect the global epoch of reionization signature edges reported the detection of a 21cm absorption signal stronger than astrophysical expectations in this paper we study the impact of radiation from dark matter dm decay and primordial black holes pbh on the 21cm radiation temperature in the ... | [['recently', 'the', 'experiment', 'to', 'detect', 'the', 'global', 'epoch', 'of', 'reionization', 'signature', 'edges', 'reported', 'the', 'detection', 'of', 'a', '21cm', 'absorption', 'signal', 'stronger', 'than', 'astrophysical', 'expectations', 'in', 'this', 'paper', 'we', 'study', 'the', 'impact', 'of', 'radiation... | [-0.07920794589194378, 0.18098324100073013, -0.01719282558230959, 0.17307118805560837, -0.0785201347743741, -0.1275054475150278, 0.023035527265703962, 0.29398467504264164, -0.149513811069213, -0.32083595794177167, 0.0012762141184928758, -0.35045991625197026, 0.06745669990346802, 0.21104218722838494, 0.13379196830188717... |
1,803.09391 | Have we seen all glitches? | Neutron star glitches are observed via artificially scheduled pulsar pulse
arrival-time observations. Detection probability density of glitch events for a
given data set is essentially required knowledge for realizing glitch
detectability with specified observing system and schedule. In Yu & Liu, the
detection probab... | astro-ph.HE | neutron star glitches are observed via artificially scheduled pulsar pulse arrivaltime observations detection probability density of glitch events for a given data set is essentially required knowledge for realizing glitch detectability with specified observing system and schedule in yu liu the detection probability de... | [['neutron', 'star', 'glitches', 'are', 'observed', 'via', 'artificially', 'scheduled', 'pulsar', 'pulse', 'arrivaltime', 'observations', 'detection', 'probability', 'density', 'of', 'glitch', 'events', 'for', 'a', 'given', 'data', 'set', 'is', 'essentially', 'required', 'knowledge', 'for', 'realizing', 'glitch', 'dete... | [-0.12264352538622916, 0.16216851459854903, -0.014650547464649813, 0.06145549012968938, -0.14460139620738724, -0.07440844591862211, 0.1095258180052042, 0.35368519158413014, -0.17027679276652635, -0.4168204065101842, 0.08894676302443258, -0.2902724104661805, -0.07070380033304294, 0.20279413253301753, -0.1231866773528357... |
1,803.09392 | On the square root of the inverse different | Let N/F be a finite, normal extension of number fields with Galois group G.
Suppose that N/F is weakly ramified, and that the square root A(N/F) of the
inverse different of N.F is defined. (This latter condition holds if, for
example, G is of odd order.) B. Erez has conjectured that the class (A(N/F)) of
A(N/F) in th... | math.NT | let nf be a finite normal extension of number fields with galois group g suppose that nf is weakly ramified and that the square root anf of the inverse different of nf is defined this latter condition holds if for example g is of odd order b erez has conjectured that the class anf of anf in the locally free class group... | [['let', 'nf', 'be', 'a', 'finite', 'normal', 'extension', 'of', 'number', 'fields', 'with', 'galois', 'group', 'g', 'suppose', 'that', 'nf', 'is', 'weakly', 'ramified', 'and', 'that', 'the', 'square', 'root', 'anf', 'of', 'the', 'inverse', 'different', 'of', 'nf', 'is', 'defined', 'this', 'latter', 'condition', 'holds... | [-0.19806680637702812, 0.16932323420769535, -0.07075279237220197, 0.029083827608181827, -0.09968496107363276, -0.18365412153070793, -0.0027888564841954838, 0.31187977977762266, -0.2634870761997133, -0.22417933854740113, 0.0585541923594844, -0.24358255081876581, -0.15084411603623135, 0.16309496297201673, -0.088714065102... |
1,803.09393 | A note on $L^2$ boundary integrals of the Bergman kernel | For any bounded convex domain $\Omega$ with $C^{2}$ boundary in
$\mathbb{C}^{n}$, we show that there exist positive constants $C_{1}$ and
$C_{2}$ such that \[
C_{1}\sqrt{\dfrac{K\left(w,w\right)}{\delta\left(w\right)}}\leq\left\Vert
K\left(\cdot,w\right)\right\Vert _{L^{2}\left(\partial\Omega\right)}\leq
C_{2}\sqrt{\... | math.CV | for any bounded convex domain omega with c2 boundary in mathbbcn we show that there exist positive constants c_1 and c_2 such that c_1sqrtdfrackleftwwrightdeltaleftwrightleqleftvert kleftcdotwrightrightvert _l2leftpartialomegarightleq c_2sqrtdfrackleftwwrightdeltaleftwright for any winomega here k is the bergman kernel... | [['for', 'any', 'bounded', 'convex', 'domain', 'omega', 'with', 'c2', 'boundary', 'in', 'mathbbcn', 'we', 'show', 'that', 'there', 'exist', 'positive', 'constants', 'c_1', 'and', 'c_2', 'such', 'that', 'c_1sqrtdfrackleftwwrightdeltaleftwrightleqleftvert', 'kleftcdotwrightrightvert', '_l2leftpartialomegarightleq', 'c_2s... | [-0.21428934955283216, 0.1497601627764341, 0.0077957892545351855, -0.017026487511190538, -0.09041448398248146, -0.17570489258995572, 0.009025706609367933, 0.4430265501141548, -0.28948215855971765, -0.10448603680063236, 0.12026344589876796, -0.2992428666666934, -0.14355340482372986, 0.18038338359819087, -0.0397698218738... |
1,803.09394 | A vertex reconstruction algorithm in the central detector of JUNO | The Jiangmen Underground Neutrino Observatory (JUNO) is designed to study
neutrino mass hierarchy and measure three of the neutrino oscillation
parameters with high precision using reactor antineutrinos. It is also able to
study many other physical phenomena, including supernova neutrinos, solar
neutrinos, geo-neutri... | physics.ins-det physics.data-an | the jiangmen underground neutrino observatory juno is designed to study neutrino mass hierarchy and measure three of the neutrino oscillation parameters with high precision using reactor antineutrinos it is also able to study many other physical phenomena including supernova neutrinos solar neutrinos geoneutrinos atmos... | [['the', 'jiangmen', 'underground', 'neutrino', 'observatory', 'juno', 'is', 'designed', 'to', 'study', 'neutrino', 'mass', 'hierarchy', 'and', 'measure', 'three', 'of', 'the', 'neutrino', 'oscillation', 'parameters', 'with', 'high', 'precision', 'using', 'reactor', 'antineutrinos', 'it', 'is', 'also', 'able', 'to', 's... | [-0.04640712819509786, 0.23309435615509608, -0.03911854289544299, 0.12251581814746525, -0.061022633563929285, -0.15693507646751959, 0.012163029073975807, 0.3175685815657525, -0.19995625069804396, -0.39237731371739115, 0.10840976120752477, -0.37353302266578686, -0.021958049545569937, 0.20877712471374535, -0.025096073335... |
1,803.09395 | From large-scale to protostellar disk fragmentation into close binary
stars | Recent observations of young stellar systems with the Atacama Large
Millimeter/submillimeter Array (ALMA) and the Karl G. Jansky Very Large Array
(VLA) are helping to cement the idea that close companion stars form via
fragmentation of a gravitationally unstable disk around a protostar early in
the star formation pro... | astro-ph.SR astro-ph.GA | recent observations of young stellar systems with the atacama large millimetersubmillimeter array alma and the karl g jansky very large array vla are helping to cement the idea that close companion stars form via fragmentation of a gravitationally unstable disk around a protostar early in the star formation process as ... | [['recent', 'observations', 'of', 'young', 'stellar', 'systems', 'with', 'the', 'atacama', 'large', 'millimetersubmillimeter', 'array', 'alma', 'and', 'the', 'karl', 'g', 'jansky', 'very', 'large', 'array', 'vla', 'are', 'helping', 'to', 'cement', 'the', 'idea', 'that', 'close', 'companion', 'stars', 'form', 'via', 'fr... | [-0.1063790669171896, 0.1549156523938409, -0.06109703881760615, 0.06731327438434986, -0.060477851466913965, -0.04198348718201316, -0.013649778497324983, 0.37678961987195886, -0.2182571273619134, -0.3166585609105269, 0.09542975104343014, -0.2390712763680391, -0.04953384013175208, 0.13743297401567459, 0.04556927745476327... |
1,803.09396 | Asymptotic Bessel-function expansions for Legendre and Jacobi functions | We present new asymptotic series for the Legendre and Jacobi functions of the
first and second kinds in terms of Bessel functions with appropriate arguments.
The results are useful in the context of scattering problems, improve on known
limiting results, and allow the calculation of corrections to the leading
Bessel-... | math-ph hep-ph math.MP | we present new asymptotic series for the legendre and jacobi functions of the first and second kinds in terms of bessel functions with appropriate arguments the results are useful in the context of scattering problems improve on known limiting results and allow the calculation of corrections to the leading besselfuncti... | [['we', 'present', 'new', 'asymptotic', 'series', 'for', 'the', 'legendre', 'and', 'jacobi', 'functions', 'of', 'the', 'first', 'and', 'second', 'kinds', 'in', 'terms', 'of', 'bessel', 'functions', 'with', 'appropriate', 'arguments', 'the', 'results', 'are', 'useful', 'in', 'the', 'context', 'of', 'scattering', 'proble... | [-0.06287323195487261, 0.052236937298439444, -0.13316012093797325, 0.09415104039479047, -0.07445591764524578, -0.016387198846787215, -0.0010399261792190372, 0.34863033042289315, -0.24661264069378375, -0.2375317084789276, 0.09831897287396714, -0.27361256565898656, -0.19140426136553287, 0.2587648391351104, -0.00225223862... |
1,803.09397 | Optical radiation force (per-length) on an electrically conducting
elliptical cylinder having a smooth or ribbed surface | The aim of this work is to develop a formal semi-analytical model using the
modal expansion method in cylindrical coordinates to calculate the
optical/electromagnetic (EM) radiation force-per-length experienced by an
infinitely long electrically-conducting elliptical cylinder having a smooth or
wavy/corrugated surfac... | physics.class-ph | the aim of this work is to develop a formal semianalytical model using the modal expansion method in cylindrical coordinates to calculate the opticalelectromagnetic em radiation forceperlength experienced by an infinitely long electricallyconducting elliptical cylinder having a smooth or wavycorrugated surface in em pl... | [['the', 'aim', 'of', 'this', 'work', 'is', 'to', 'develop', 'a', 'formal', 'semianalytical', 'model', 'using', 'the', 'modal', 'expansion', 'method', 'in', 'cylindrical', 'coordinates', 'to', 'calculate', 'the', 'opticalelectromagnetic', 'em', 'radiation', 'forceperlength', 'experienced', 'by', 'an', 'infinitely', 'lo... | [-0.15761031657979846, 0.1144442622789652, -0.07736415084356105, 0.03681711250949123, -0.10067586789886636, -0.08170225277202071, -0.025391764099174364, 0.3880717597982487, -0.24231118820131, -0.2738837202043615, 0.07267560034680481, -0.2664775915964558, -0.1202381510302648, 0.21640501431772471, 0.005462494043094348, 0... |
1,803.09398 | The impact of EDGES 21-cm data on dark matter interactions | The recently announced results on the 21-cm absorption spectrum by the EDGES
experiment can place very stringent limits on dark matter annihilation
cross-sections. We properly take into account the heating energy released from
dark matter annihilation from the radiation epoch to the 21-cm observation
redshifts in the... | astro-ph.CO astro-ph.HE hep-ph | the recently announced results on the 21cm absorption spectrum by the edges experiment can place very stringent limits on dark matter annihilation crosssections we properly take into account the heating energy released from dark matter annihilation from the radiation epoch to the 21cm observation redshifts in the radia... | [['the', 'recently', 'announced', 'results', 'on', 'the', '21cm', 'absorption', 'spectrum', 'by', 'the', 'edges', 'experiment', 'can', 'place', 'very', 'stringent', 'limits', 'on', 'dark', 'matter', 'annihilation', 'crosssections', 'we', 'properly', 'take', 'into', 'account', 'the', 'heating', 'energy', 'released', 'fr... | [-0.07849047199286158, 0.12476742415499219, -0.1283570822329407, 0.17012468212029758, -0.10035274244189539, -0.03923980312214957, -0.006603733800282633, 0.3000790366851207, -0.17135845650746315, -0.3643214074998266, -0.02188338076855332, -0.3318993310957147, 0.06912016958274224, 0.2063657689701628, 0.14667880531865027,... |
1,803.09399 | New Green's functions for some nonlinear oscillating systems and related
PDEs | During the past three decades, the advantageous concept of the Green's
function has been extended from linear systems to nonlinear ones. At that,
there exist a rigorous and an approximate extensions. The rigorous extension
introduces the so-called backward and forward propagators, which play the same
role for nonline... | math-ph math.MP | during the past three decades the advantageous concept of the greens function has been extended from linear systems to nonlinear ones at that there exist a rigorous and an approximate extensions the rigorous extension introduces the socalled backward and forward propagators which play the same role for nonlinear system... | [['during', 'the', 'past', 'three', 'decades', 'the', 'advantageous', 'concept', 'of', 'the', 'greens', 'function', 'has', 'been', 'extended', 'from', 'linear', 'systems', 'to', 'nonlinear', 'ones', 'at', 'that', 'there', 'exist', 'a', 'rigorous', 'and', 'an', 'approximate', 'extensions', 'the', 'rigorous', 'extension'... | [-0.11738120446430653, 0.004586287568028118, -0.11789040360100833, 0.11058494803977997, -0.09549792927490282, -0.11228791213195238, -0.03232783282707844, 0.30789726878117235, -0.2729227351823023, -0.23555566406409656, 0.09604788242806016, -0.2769503993048732, -0.20267035938865904, 0.2509354974010161, 0.0416784152895810... |
1,803.094 | Bounds on the cardinality of restricted sumsets in $\mathbb{Z}_{p}$ | In this paper we present a procedure which allows to transform a subset $A$
of $\mathbb{Z}_{p}$ into a set $ A'$ such that $ |2\hspace{0.15cm}\widehat{}
A'|\leq|2\hspace{0.15cm}\widehat{} A | $, where $2\hspace{0.15cm}\widehat{} A$
is defined to be the set $\left\{a+b:a\neq b,\;a,b\in A\right\}$. From this
result, we... | math.CO | in this paper we present a procedure which allows to transform a subset a of mathbbz_p into a set a such that 2hspace015cmwidehat aleq2hspace015cmwidehat a where 2hspace015cmwidehat a is defined to be the set leftabaneq babin aright from this result we get some lower bounds for 2hspace015cmwidehat a finally we give som... | [['in', 'this', 'paper', 'we', 'present', 'a', 'procedure', 'which', 'allows', 'to', 'transform', 'a', 'subset', 'a', 'of', 'mathbbz_p', 'into', 'a', 'set', 'a', 'such', 'that', '2hspace015cmwidehat', 'aleq2hspace015cmwidehat', 'a', 'where', '2hspace015cmwidehat', 'a', 'is', 'defined', 'to', 'be', 'the', 'set', 'leftab... | [-0.13206627606555368, 0.07439774108316863, -0.14202334525797403, 0.06454121106071398, -0.09497376655186103, -0.10519179825981458, 0.1076226022189737, 0.3206805484651616, -0.26436227926927985, -0.22192267887294292, 0.1473760370951795, -0.2700550821506168, -0.1370252842422236, 0.23920410244979642, -0.0979157312117009, 0... |
1,803.09401 | HomeGuard: A Smart System to Deal with the Emergency Response of
Domestic Violence Victims | Domestic violence is a silent crisis in the developing and underdeveloped
countries, though developed countries also remain drowned in the curse of it.
In developed countries, victims can easily report and ask help on the contrary
in developing and underdeveloped countries victims hardly report the crimes and
when it... | cs.IR cs.CL | domestic violence is a silent crisis in the developing and underdeveloped countries though developed countries also remain drowned in the curse of it in developed countries victims can easily report and ask help on the contrary in developing and underdeveloped countries victims hardly report the crimes and when its not... | [['domestic', 'violence', 'is', 'a', 'silent', 'crisis', 'in', 'the', 'developing', 'and', 'underdeveloped', 'countries', 'though', 'developed', 'countries', 'also', 'remain', 'drowned', 'in', 'the', 'curse', 'of', 'it', 'in', 'developed', 'countries', 'victims', 'can', 'easily', 'report', 'and', 'ask', 'help', 'on', '... | [-0.06390469357881874, 0.10821143532710442, -0.08874846444218364, 0.12381777670360675, -0.14262672145682645, -0.18080198847273565, 0.11146350689996763, 0.33182278134108306, -0.20616661972108197, -0.31396369006574515, 0.20110770852125462, -0.3108740028061242, -0.1272539362712505, 0.1916597902210968, -0.1782319723875318,... |
1,803.09402 | Aggression-annotated Corpus of Hindi-English Code-mixed Data | As the interaction over the web has increased, incidents of aggression and
related events like trolling, cyberbullying, flaming, hate speech, etc. too
have increased manifold across the globe. While most of these behaviour like
bullying or hate speech have predated the Internet, the reach and extent of the
Internet h... | cs.CL | as the interaction over the web has increased incidents of aggression and related events like trolling cyberbullying flaming hate speech etc too have increased manifold across the globe while most of these behaviour like bullying or hate speech have predated the internet the reach and extent of the internet has given t... | [['as', 'the', 'interaction', 'over', 'the', 'web', 'has', 'increased', 'incidents', 'of', 'aggression', 'and', 'related', 'events', 'like', 'trolling', 'cyberbullying', 'flaming', 'hate', 'speech', 'etc', 'too', 'have', 'increased', 'manifold', 'across', 'the', 'globe', 'while', 'most', 'of', 'these', 'behaviour', 'li... | [-0.10381011899450888, 0.07858389909093107, -0.016326197793453255, 0.09039379505636382, -0.14135127623607827, -0.11027040424960433, 0.058396107069380705, 0.39421245716088876, -0.2194073252784702, -0.35595381693102274, 0.11459442902493967, -0.4197352372363887, -0.1502740682639838, 0.20305265667081007, -0.085990280032009... |
1,803.09403 | Distinguishing Computer-generated Graphics from Natural Images Based on
Sensor Pattern Noise and Deep Learning | Computer-generated graphics (CGs) are images generated by computer software.
The~rapid development of computer graphics technologies has made it easier to
generate photorealistic computer graphics, and these graphics are quite
difficult to distinguish from natural images (NIs) with the naked eye. In this
paper, we pr... | cs.MM | computergenerated graphics cgs are images generated by computer software therapid development of computer graphics technologies has made it easier to generate photorealistic computer graphics and these graphics are quite difficult to distinguish from natural images nis with the naked eye in this paper we propose a meth... | [['computergenerated', 'graphics', 'cgs', 'are', 'images', 'generated', 'by', 'computer', 'software', 'therapid', 'development', 'of', 'computer', 'graphics', 'technologies', 'has', 'made', 'it', 'easier', 'to', 'generate', 'photorealistic', 'computer', 'graphics', 'and', 'these', 'graphics', 'are', 'quite', 'difficult... | [-0.004463736510021243, -0.02132984025151905, -0.09284758607852431, 0.039541928864147174, -0.08717574762148954, -0.2019980548777514, -0.026739787368288328, 0.4756679280980486, -0.23858954679166924, -0.3756974639667981, 0.09187607090764989, -0.276420251581062, -0.20298564137895433, 0.24045262526234853, -0.12755618856180... |
1,803.09404 | A Hierarchy of Empirical Models of Plasma Profiles and Transport | Two families of statistical models are presented which generalize global
confinement expressions to plasma profiles and local transport coefficients.
The temperature or diffusivity is parameterized as a function of the normalized
flux radius, $\bar{\psi}$, and the engineering variables, ${\bf u} =
(I_p,B_t,\bar{n},q_... | stat.ME eess.SP | two families of statistical models are presented which generalize global confinement expressions to plasma profiles and local transport coefficients the temperature or diffusivity is parameterized as a function of the normalized flux radius barpsi and the engineering variables bf u i_pb_tbarnq_95dagger the logadditive ... | [['two', 'families', 'of', 'statistical', 'models', 'are', 'presented', 'which', 'generalize', 'global', 'confinement', 'expressions', 'to', 'plasma', 'profiles', 'and', 'local', 'transport', 'coefficients', 'the', 'temperature', 'or', 'diffusivity', 'is', 'parameterized', 'as', 'a', 'function', 'of', 'the', 'normalize... | [-0.10947073401592962, 0.1915570430713227, -0.02434942589163603, 0.025490923646083546, -0.03364259089056999, -0.16560682569110355, 0.005007189175404318, 0.371386584567785, -0.24976275106932308, -0.26398826834798117, 0.0313140590825356, -0.34076661889711435, -0.06643463093288508, 0.15470930257943424, -0.0231541817225677... |
1,803.09405 | Automatic Identification of Closely-related Indian Languages: Resources
and Experiments | In this paper, we discuss an attempt to develop an automatic language
identification system for 5 closely-related Indo-Aryan languages of India,
Awadhi, Bhojpuri, Braj, Hindi and Magahi. We have compiled a comparable corpora
of varying length for these languages from various resources. We discuss the
method of creati... | cs.CL | in this paper we discuss an attempt to develop an automatic language identification system for 5 closelyrelated indoaryan languages of india awadhi bhojpuri braj hindi and magahi we have compiled a comparable corpora of varying length for these languages from various resources we discuss the method of creation of these... | [['in', 'this', 'paper', 'we', 'discuss', 'an', 'attempt', 'to', 'develop', 'an', 'automatic', 'language', 'identification', 'system', 'for', '5', 'closelyrelated', 'indoaryan', 'languages', 'of', 'india', 'awadhi', 'bhojpuri', 'braj', 'hindi', 'and', 'magahi', 'we', 'have', 'compiled', 'a', 'comparable', 'corpora', 'o... | [-0.08646902271706347, 0.017846054654166273, -0.03593861421269148, 0.1078898303323623, -0.08045891789964052, -0.07240897824404517, 0.0488879584126419, 0.40993153089375206, -0.2606513800118307, -0.35639687676471893, 0.06043804001128959, -0.27438428888868804, -0.07985075071661009, 0.21522731930276173, -0.0679338003010159... |
1,803.09406 | Study of Twist-2 GTMDs in scalar-diquark model | We investigate the Generalized Transverse Momentum-dependent Distributions
(GTMDs) describing the parton structure of proton using the light-front
scalar-diquark model. In particular, we study the Wigner distributions for
unpolarized quark in unpolarized, longitudinally-polarized and
transversely-polarized proton. We... | hep-ph | we investigate the generalized transverse momentumdependent distributions gtmds describing the parton structure of proton using the lightfront scalardiquark model in particular we study the wigner distributions for unpolarized quark in unpolarized longitudinallypolarized and transverselypolarized proton we also investi... | [['we', 'investigate', 'the', 'generalized', 'transverse', 'momentumdependent', 'distributions', 'gtmds', 'describing', 'the', 'parton', 'structure', 'of', 'proton', 'using', 'the', 'lightfront', 'scalardiquark', 'model', 'in', 'particular', 'we', 'study', 'the', 'wigner', 'distributions', 'for', 'unpolarized', 'quark'... | [-0.0062495004588171196, 0.31949260893642256, -0.16474520892876646, 0.27192657027879485, -0.012490499913996167, -0.005842426070518306, -0.02384186918725786, 0.45230270618491847, -0.12906959418045438, -0.1316265817731619, -0.20482000964440647, -0.2942088322066095, 0.026276592570154564, 0.06093673680342086, 0.14256437734... |
1,803.09407 | Spectral dimension of spheres | In this paper, we associate a growth graph and a length operator to a
quotient space of a semisimple compact Lie group. Under certain assumptions, we
show that the spectral dimension of a homogeneous space is greater than or
equal to summability of the length operator. Using this, we compute spectral
dimensions of sp... | math.OA | in this paper we associate a growth graph and a length operator to a quotient space of a semisimple compact lie group under certain assumptions we show that the spectral dimension of a homogeneous space is greater than or equal to summability of the length operator using this we compute spectral dimensions of spheres | [['in', 'this', 'paper', 'we', 'associate', 'a', 'growth', 'graph', 'and', 'a', 'length', 'operator', 'to', 'a', 'quotient', 'space', 'of', 'a', 'semisimple', 'compact', 'lie', 'group', 'under', 'certain', 'assumptions', 'we', 'show', 'that', 'the', 'spectral', 'dimension', 'of', 'a', 'homogeneous', 'space', 'is', 'gre... | [-0.16070752549502584, 0.10378626749540369, -0.11717894097307215, 0.06648740423110279, -0.12073269069919156, -0.07852050830196175, 0.0017068175948224962, 0.3965768834006869, -0.2673451720598947, -0.16775235591706372, 0.13075465600963476, -0.23383499530178528, -0.15135155534113032, 0.1638053610049947, -0.108343592568956... |
1,803.09408 | Efficient File Delivery for Coded Prefetching in Shared Cache Networks
with Multiple Requests Per User | We consider a centralized caching network, where a server serves several
groups of users, each having a common shared homogeneous fixed-size cache and
requesting arbitrary multiple files. An existing coded prefetching scheme is
employed where each file is broken into multiple fragments and each cache
stores multiple ... | cs.IT math.IT | we consider a centralized caching network where a server serves several groups of users each having a common shared homogeneous fixedsize cache and requesting arbitrary multiple files an existing coded prefetching scheme is employed where each file is broken into multiple fragments and each cache stores multiple coded ... | [['we', 'consider', 'a', 'centralized', 'caching', 'network', 'where', 'a', 'server', 'serves', 'several', 'groups', 'of', 'users', 'each', 'having', 'a', 'common', 'shared', 'homogeneous', 'fixedsize', 'cache', 'and', 'requesting', 'arbitrary', 'multiple', 'files', 'an', 'existing', 'coded', 'prefetching', 'scheme', '... | [-0.21342148464986854, 0.022841190228841124, -0.04530696288763898, 0.0218211599841524, -0.027657312807825945, -0.2519111430738121, 0.13069373135143006, 0.399336438065449, -0.27634431429668466, -0.2679936257383144, 0.10305280176961107, -0.2529054999360543, -0.09706955268816317, 0.1439203842830148, -0.1032570457397915, 0... |
1,803.09409 | Impact of packing fraction on diffusion-driven pattern formation in a
two-dimensional system of rod-like particles | Pattern formation in a two-dimensional system of rod-like particles has been
simulated using a lattice approach. Rod-like particles were modelled as linear
$k$-mers of two mutually perpendicular orientations ($k_x$- and $k_y$-mers) on
a square lattice with periodic boundary conditions (torus). Two kinds of random
seq... | cond-mat.stat-mech cond-mat.soft | pattern formation in a twodimensional system of rodlike particles has been simulated using a lattice approach rodlike particles were modelled as linear kmers of two mutually perpendicular orientations k_x and k_ymers on a square lattice with periodic boundary conditions torus two kinds of random sequential adsorption m... | [['pattern', 'formation', 'in', 'a', 'twodimensional', 'system', 'of', 'rodlike', 'particles', 'has', 'been', 'simulated', 'using', 'a', 'lattice', 'approach', 'rodlike', 'particles', 'were', 'modelled', 'as', 'linear', 'kmers', 'of', 'two', 'mutually', 'perpendicular', 'orientations', 'k_x', 'and', 'k_ymers', 'on', 'a... | [-0.14177432022464515, 0.24624199802650415, -0.047644766417483914, 0.01894120243873368, 0.012822243198422147, -0.1683534055333981, 0.02446583652016806, 0.43346198516111845, -0.23171843690071123, -0.28125694836654985, 0.08432385500715318, -0.2791054392273122, -0.06179503123077782, 0.11011263549597008, 0.0583366385647855... |
1,803.0941 | Projection effects of large-scale structures on weak-lensing peak
abundances | High peaks in weak lensing (WL) maps originate dominantly from the lensing
effects of single massive halos. Their abundance is therefore closely related
to the halo mass function and thus a powerful cosmological probe. On the other
hand, however, besides individual massive halos, large-scale structures (LSS)
along li... | astro-ph.CO | high peaks in weak lensing wl maps originate dominantly from the lensing effects of single massive halos their abundance is therefore closely related to the halo mass function and thus a powerful cosmological probe on the other hand however besides individual massive halos largescale structures lss along lines of sight... | [['high', 'peaks', 'in', 'weak', 'lensing', 'wl', 'maps', 'originate', 'dominantly', 'from', 'the', 'lensing', 'effects', 'of', 'single', 'massive', 'halos', 'their', 'abundance', 'is', 'therefore', 'closely', 'related', 'to', 'the', 'halo', 'mass', 'function', 'and', 'thus', 'a', 'powerful', 'cosmological', 'probe', '... | [-0.08104528675278637, 0.07464329577751024, -0.06616931833800692, 0.15865356753083185, -0.09809823263153732, -0.0747970619975972, -0.012625183116650335, 0.3909560670973333, -0.2355397467678584, -0.3209268016814957, 0.06882688149229903, -0.3072584801324232, -0.0867146552194687, 0.20450609894555086, 0.01709466302436005, ... |
1,803.09411 | Optimal Design and Control of 4-IWD Electric Vehicles based on a 14-DOF
Vehicle Model | A 4-independent wheel driving (4-IWD) electric vehicle has distinctive
advantages with both enhanced dynamic and energy efficiency performances since
this configuration provides more flexibilities from both the design and control
aspects. However, it is difficult to achieve the optimal performances of a
4-IWD electri... | math.OC | a 4independent wheel driving 4iwd electric vehicle has distinctive advantages with both enhanced dynamic and energy efficiency performances since this configuration provides more flexibilities from both the design and control aspects however it is difficult to achieve the optimal performances of a 4iwd electric vehicle... | [['a', '4independent', 'wheel', 'driving', '4iwd', 'electric', 'vehicle', 'has', 'distinctive', 'advantages', 'with', 'both', 'enhanced', 'dynamic', 'and', 'energy', 'efficiency', 'performances', 'since', 'this', 'configuration', 'provides', 'more', 'flexibilities', 'from', 'both', 'the', 'design', 'and', 'control', 'a... | [-0.1172476867894667, 0.07998069129514208, -0.06992899262461703, 0.023740652844155972, -0.07786928414550078, -0.1857590086406812, 0.04244824725589881, 0.3628669418644027, -0.25568486128135454, -0.3539353520110516, 0.12819544890174125, -0.2276378314995132, -0.1493785860324611, 0.22713557995406777, -0.1079415014308844, 0... |
1,803.09412 | Consensus Control of Multi-agent Systems with Optimal Performance | The consensus control with optimal cost remains major challenging although
consensus control problems have been well studied in recent years. In this
paper, we study the consensus control of multi-agent system associated with a
given cost function. The main contribution is to present the distributed
control protocol ... | math.OC | the consensus control with optimal cost remains major challenging although consensus control problems have been well studied in recent years in this paper we study the consensus control of multiagent system associated with a given cost function the main contribution is to present the distributed control protocol while ... | [['the', 'consensus', 'control', 'with', 'optimal', 'cost', 'remains', 'major', 'challenging', 'although', 'consensus', 'control', 'problems', 'have', 'been', 'well', 'studied', 'in', 'recent', 'years', 'in', 'this', 'paper', 'we', 'study', 'the', 'consensus', 'control', 'of', 'multiagent', 'system', 'associated', 'wit... | [-0.16811921941703772, 0.016066886153206363, -0.03601524032451011, -0.01486240037998, -0.05430286588264747, -0.12872550051306952, 0.04563371524915334, 0.3697861194241423, -0.31296308526584693, -0.3377715138349313, 0.1313844570860703, -0.26169864865657577, -0.1492204383982614, 0.13557519274554006, -0.10277819325560117, ... |
1,803.09413 | Precision Sugarcane Monitoring Using SVM Classifier | India is agriculture based economy and sugarcane is one of the major crops
produced in northern India. Productivity of sugarcane decreases due to
inappropriate soil conditions and infections caused by various types of
diseases , timely and accurate disease diagnosis, plays an important role
towards optimizing crop yi... | cs.CV | india is agriculture based economy and sugarcane is one of the major crops produced in northern india productivity of sugarcane decreases due to inappropriate soil conditions and infections caused by various types of diseases timely and accurate disease diagnosis plays an important role towards optimizing crop yield th... | [['india', 'is', 'agriculture', 'based', 'economy', 'and', 'sugarcane', 'is', 'one', 'of', 'the', 'major', 'crops', 'produced', 'in', 'northern', 'india', 'productivity', 'of', 'sugarcane', 'decreases', 'due', 'to', 'inappropriate', 'soil', 'conditions', 'and', 'infections', 'caused', 'by', 'various', 'types', 'of', 'd... | [-0.06926761844372305, 0.0775699293939848, -0.014099695077238157, 0.031086944345052738, -0.01862771400293812, -0.170117096809396, 0.04922463054057615, 0.3462058711280801, -0.1957523960876459, -0.30693397234201203, 0.15034185220530732, -0.32295593021928454, -0.13437226514490827, 0.2389593515268756, -0.13617981137665697,... |
1,803.09414 | Development of high-speed X-ray imaging system for SOI pixel detector | We are now developing new X-ray imaging system by using Silicon-On-Insulator
(SOI) Pixel Detectors. The SOI detector is a monolithic radiation imaging
detector based on a 0.2um FD-SOI CMOS process. Special additional process steps
are also developed to create fully depleted sensing region of 50~500um thick.
SOI detec... | physics.ins-det | we are now developing new xray imaging system by using silicononinsulator soi pixel detectors the soi detector is a monolithic radiation imaging detector based on a 02um fdsoi cmos process special additional process steps are also developed to create fully depleted sensing region of 50500um thick soi detector has up to... | [['we', 'are', 'now', 'developing', 'new', 'xray', 'imaging', 'system', 'by', 'using', 'silicononinsulator', 'soi', 'pixel', 'detectors', 'the', 'soi', 'detector', 'is', 'a', 'monolithic', 'radiation', 'imaging', 'detector', 'based', 'on', 'a', '02um', 'fdsoi', 'cmos', 'process', 'special', 'additional', 'process', 'st... | [-0.13425023104729397, 0.07236228035208547, -0.0049186713816154574, -0.03737478066071898, -0.05675772740062149, -0.2522950806433246, 0.015399892992267962, 0.47279664391563053, -0.19636391901350136, -0.38994997644885665, 0.14643227775481396, -0.3141940023195708, -0.05978117731033957, 0.2591410541784994, -0.1031312810069... |
1,803.09415 | First-principles study of magnetic interactions in FeGe | We theoretically study the magnetic properties of iron germanium, known as
one of canonical helimagnets. For this purpose we use the real-space spin
Hamiltonian and micromagnetic model, derived in terms of Andersen's "local
force theorem", to describe the low-lying magnetic excitations via
spin-polarized Green's func... | cond-mat.str-el cond-mat.mtrl-sci physics.comp-ph | we theoretically study the magnetic properties of iron germanium known as one of canonical helimagnets for this purpose we use the realspace spin hamiltonian and micromagnetic model derived in terms of andersens local force theorem to describe the lowlying magnetic excitations via spinpolarized greens function obtained... | [['we', 'theoretically', 'study', 'the', 'magnetic', 'properties', 'of', 'iron', 'germanium', 'known', 'as', 'one', 'of', 'canonical', 'helimagnets', 'for', 'this', 'purpose', 'we', 'use', 'the', 'realspace', 'spin', 'hamiltonian', 'and', 'micromagnetic', 'model', 'derived', 'in', 'terms', 'of', 'andersens', 'local', '... | [-0.14407305730755665, 0.14560522687428729, -0.035012001142102483, 0.08439672367992522, -0.04463653887043996, -0.06418880821077218, 0.055127825178527115, 0.37112904556802123, -0.22958545740452949, -0.30670761870991053, -0.05834326741851641, -0.2932903572098063, -0.13490775057339463, 0.1782606667618203, 0.10077265243784... |
1,803.09416 | Induced nets and Hamiltonicity of claw-free graphs | The connected graph of degree sequence 3,3,3,1,1,1 is called a net, and the
vertices of degree 1 in a net is called its endvertices. Broersma conjectured
in 1993 that a 2-connected graph G with no induced K_{1,3} is hamiltonian if
every endvertex of each induced net of G has degree at least (|V(G)|-2)/3. In
this pape... | math.CO | the connected graph of degree sequence 333111 is called a net and the vertices of degree 1 in a net is called its endvertices broersma conjectured in 1993 that a 2connected graph g with no induced k_13 is hamiltonian if every endvertex of each induced net of g has degree at least vg23 in this paper we prove this conjec... | [['the', 'connected', 'graph', 'of', 'degree', 'sequence', '333111', 'is', 'called', 'a', 'net', 'and', 'the', 'vertices', 'of', 'degree', '1', 'in', 'a', 'net', 'is', 'called', 'its', 'endvertices', 'broersma', 'conjectured', 'in', '1993', 'that', 'a', '2connected', 'graph', 'g', 'with', 'no', 'induced', 'k_13', 'is',... | [-0.23321594261243694, 0.1463533967702848, -0.06009235655217141, -0.035953953944253506, -0.07962331726963891, -0.13084335057217567, -0.005538357066784481, 0.388156561333625, -0.27350371721826616, -0.2753487766766157, 0.016906081485088733, -0.3323547064792365, -0.20655486542544496, 0.04177728386931732, -0.15050288686742... |
1,803.09417 | Periodic Anderson model meets Sachdev-Ye-Kitaev interaction: A solvable
playground for heavy fermion physics | The periodic Anderson model is a classic theoretical model for understanding
novel physics in heavy fermion systems. Here, we modify it with the
Sachdev-Ye-Kitaev interaction, (random all-to-all interaction) thus the
resultant model admits an exact solution at large-$N$ (e.g. spin flavor) limit.
By analytical field t... | cond-mat.str-el cond-mat.quant-gas | the periodic anderson model is a classic theoretical model for understanding novel physics in heavy fermion systems here we modify it with the sachdevyekitaev interaction random alltoall interaction thus the resultant model admits an exact solution at largen eg spin flavor limit by analytical field theory arguments and... | [['the', 'periodic', 'anderson', 'model', 'is', 'a', 'classic', 'theoretical', 'model', 'for', 'understanding', 'novel', 'physics', 'in', 'heavy', 'fermion', 'systems', 'here', 'we', 'modify', 'it', 'with', 'the', 'sachdevyekitaev', 'interaction', 'random', 'alltoall', 'interaction', 'thus', 'the', 'resultant', 'model'... | [-0.1622556766865205, 0.21895966979506887, -0.11389576736837626, 0.14498957776144814, -0.0197315755884038, -0.2718411963050768, 0.08076519647060629, 0.31453468905650633, -0.21925722111238918, -0.2617051745834413, -0.002316002942510505, -0.3238889529793732, -0.1488939122967561, 0.1850467504665895, 0.03663915443692857, 0... |
1,803.09418 | $(\sigma,\tau)$-Derivations of Group Rings | We study $(\sigma,\tau)$-derivations of a group ring $RG$ of a finite group
$G$ over an integral domain $R$ with $1$. As an application we extend a well
known result on derivation of an integral group ring $\Bbb{Z}G$ to
$(\sigma,\tau)$-derivation on it for a finite group $G$ with some conditions on
$\sigma$ and $\tau... | math.RA | we study sigmatauderivations of a group ring rg of a finite group g over an integral domain r with 1 as an application we extend a well known result on derivation of an integral group ring bbbzg to sigmatauderivation on it for a finite group g with some conditions on sigma and tau in the process of the extension a gene... | [['we', 'study', 'sigmatauderivations', 'of', 'a', 'group', 'ring', 'rg', 'of', 'a', 'finite', 'group', 'g', 'over', 'an', 'integral', 'domain', 'r', 'with', '1', 'as', 'an', 'application', 'we', 'extend', 'a', 'well', 'known', 'result', 'on', 'derivation', 'of', 'an', 'integral', 'group', 'ring', 'bbbzg', 'to', 'sigma... | [-0.14872996898640584, 0.007588277361497692, -0.13484281956831493, -0.00974853860030058, -0.10219237553353262, -0.07404293484486095, 0.018675365016750264, 0.3689745890385494, -0.28052192635652495, -0.2040569523076822, 0.1617282183043, -0.23186749281225408, -0.10990862816958348, 0.252346818539791, -0.10030790851962548, ... |
1,803.09419 | Structural characterization of linear quantum systems with application
to back-action evading measurement | The purpose of this paper is to study the structure of quantum linear systems
in terms of their Kalman canonical form, which was proposed in a recent paper
\cite{ZGPG18}. The spectral structure of quantum linear systems is explored,
which indicates that a quantum linear system is both controllable and
observable prov... | quant-ph | the purpose of this paper is to study the structure of quantum linear systems in terms of their kalman canonical form which was proposed in a recent paper citezgpg18 the spectral structure of quantum linear systems is explored which indicates that a quantum linear system is both controllable and observable provided tha... | [['the', 'purpose', 'of', 'this', 'paper', 'is', 'to', 'study', 'the', 'structure', 'of', 'quantum', 'linear', 'systems', 'in', 'terms', 'of', 'their', 'kalman', 'canonical', 'form', 'which', 'was', 'proposed', 'in', 'a', 'recent', 'paper', 'citezgpg18', 'the', 'spectral', 'structure', 'of', 'quantum', 'linear', 'syste... | [-0.13604740603556353, 0.1132404318872235, -0.08287924940924386, 0.028424502557263132, -0.08731008387592344, -0.1525317313136986, -0.019723242581381487, 0.32971705498828274, -0.28677854943089187, -0.2783801153339949, 0.10215040692914831, -0.18055896511981012, -0.21619065376502034, 0.2426809716617336, -0.069816362515494... |
1,803.0942 | Multi-scale Processing of Noisy Images using Edge Preservation Losses | Noisy images processing is a fundamental task of computer vision. The first
example is the detection of faint edges in noisy images, a challenging problem
studied in the last decades. A recent study introduced a fast method to detect
faint edges in the highest accuracy among all the existing approaches. Their
complex... | cs.CV | noisy images processing is a fundamental task of computer vision the first example is the detection of faint edges in noisy images a challenging problem studied in the last decades a recent study introduced a fast method to detect faint edges in the highest accuracy among all the existing approaches their complexity is... | [['noisy', 'images', 'processing', 'is', 'a', 'fundamental', 'task', 'of', 'computer', 'vision', 'the', 'first', 'example', 'is', 'the', 'detection', 'of', 'faint', 'edges', 'in', 'noisy', 'images', 'a', 'challenging', 'problem', 'studied', 'in', 'the', 'last', 'decades', 'a', 'recent', 'study', 'introduced', 'a', 'fas... | [-0.07809816852592727, -0.026143725596133056, -0.06859723601179818, 0.03315803378985341, -0.055374637209267046, -0.13765667938666107, 0.01780950083678666, 0.46010369549815855, -0.26125584334755936, -0.35498609783438345, 0.10861379462488306, -0.24734105549626595, -0.2041472758438128, 0.2230071690379797, -0.1567617248132... |
1,803.09421 | Adaptive weak-value amplification with adjustable postselection | Weak-value amplification (WVA) has recently become an important technique for
parameter estimation, owing to its ability to enhance the signal-to-noise ratio
by amplifying extremely small signals with proper postselection strategies. In
this paper, we propose an adaptive WVA scheme to achieve the highest Fisher
infor... | quant-ph | weakvalue amplification wva has recently become an important technique for parameter estimation owing to its ability to enhance the signaltonoise ratio by amplifying extremely small signals with proper postselection strategies in this paper we propose an adaptive wva scheme to achieve the highest fisher information whe... | [['weakvalue', 'amplification', 'wva', 'has', 'recently', 'become', 'an', 'important', 'technique', 'for', 'parameter', 'estimation', 'owing', 'to', 'its', 'ability', 'to', 'enhance', 'the', 'signaltonoise', 'ratio', 'by', 'amplifying', 'extremely', 'small', 'signals', 'with', 'proper', 'postselection', 'strategies', '... | [-0.10263052387281145, 0.07600632401643426, -0.10993535337510749, 0.02301438579308814, -0.05959435751445699, -0.19425199890468756, 0.10193475090267569, 0.3920408222112346, -0.24051458119968142, -0.31408822915071377, 0.10934312783174918, -0.1909735127068732, -0.14454621319200142, 0.2678899659954038, -0.12043190397916065... |
1,803.09422 | The cooling-off effect of price limits in the Chinese stock markets | In this paper, we investigate the cooling-off effect (opposite to the magnet
effect) from two aspects. Firstly, from the viewpoint of dynamics, we study the
existence of the cooling-off effect by following the dynamical evolution of
some financial variables over a period of time before the stock price hits its
limit.... | q-fin.ST q-fin.TR | in this paper we investigate the coolingoff effect opposite to the magnet effect from two aspects firstly from the viewpoint of dynamics we study the existence of the coolingoff effect by following the dynamical evolution of some financial variables over a period of time before the stock price hits its limit secondly f... | [['in', 'this', 'paper', 'we', 'investigate', 'the', 'coolingoff', 'effect', 'opposite', 'to', 'the', 'magnet', 'effect', 'from', 'two', 'aspects', 'firstly', 'from', 'the', 'viewpoint', 'of', 'dynamics', 'we', 'study', 'the', 'existence', 'of', 'the', 'coolingoff', 'effect', 'by', 'following', 'the', 'dynamical', 'evo... | [-0.1261736917288725, 0.13496734618269632, -0.12657130300067365, 0.1219853981735509, -0.07391624091483412, -0.080188662093227, 0.16098885418378714, 0.3554440909913677, -0.26879538412334075, -0.27496644521512936, 0.13993921985676294, -0.34666379604432995, -0.12616565971360033, 0.17956082192193037, -0.03864111535690408, ... |
1,803.09423 | Locally PI but not PI Division Rings of Arbitrary GK-Dimension | We give examples of locally PI but not PI division rings of GK-dimension n
for every positive integer n.
| math.RA | we give examples of locally pi but not pi division rings of gkdimension n for every positive integer n | [['we', 'give', 'examples', 'of', 'locally', 'pi', 'but', 'not', 'pi', 'division', 'rings', 'of', 'gkdimension', 'n', 'for', 'every', 'positive', 'integer', 'n']] | [-0.3028556364710982, 0.19989578950365908, -0.0776789660908674, 0.0028220137189093387, -0.04670933045839008, -0.3297316682966132, 0.013796418366071424, 0.33390665760165766, -0.2989105648900333, -0.12067420957119841, 0.045550971120399866, -0.2823540313463462, -0.17972913926075162, 0.19641096203735, -0.009406388002006631... |
1,803.09424 | Radio-over-fiber using an optical antenna based on Rydberg states of
atoms | We provide an experimental demonstration of a direct fiber-optic link for RF
transmission ("radio-over-fiber") using a sensitive optical antenna based on a
rubidium vapor cell. The scheme relies on measuring the transmission of laser
light at an electromagnetically-induced transparency resonance that involves
highly-... | physics.atom-ph | we provide an experimental demonstration of a direct fiberoptic link for rf transmission radiooverfiber using a sensitive optical antenna based on a rubidium vapor cell the scheme relies on measuring the transmission of laser light at an electromagneticallyinduced transparency resonance that involves highlyexcited rydb... | [['we', 'provide', 'an', 'experimental', 'demonstration', 'of', 'a', 'direct', 'fiberoptic', 'link', 'for', 'rf', 'transmission', 'radiooverfiber', 'using', 'a', 'sensitive', 'optical', 'antenna', 'based', 'on', 'a', 'rubidium', 'vapor', 'cell', 'the', 'scheme', 'relies', 'on', 'measuring', 'the', 'transmission', 'of',... | [-0.20884449513290415, 0.1531006986020097, -0.009224692551692674, -0.05390953599235981, -0.04569941412305811, -0.22146841877472254, 0.11385981845050737, 0.46860536998072705, -0.22643788928048803, -0.23978644684022227, 0.05052747001457907, -0.26085541983653215, -0.12361768208129878, 0.28075718622771906, 0.00110736566471... |
1,803.09425 | Scalable photonic reinforcement learning by time-division multiplexing
of laser chaos | Reinforcement learning involves decision making in dynamic and uncertain
environments and constitutes a crucial element of artificial intelligence. In
our previous work, we experimentally demonstrated that the ultrafast chaotic
oscillatory dynamics of lasers can be used to solve the two-armed bandit
problem efficient... | cs.ET cs.AI physics.data-an physics.optics | reinforcement learning involves decision making in dynamic and uncertain environments and constitutes a crucial element of artificial intelligence in our previous work we experimentally demonstrated that the ultrafast chaotic oscillatory dynamics of lasers can be used to solve the twoarmed bandit problem efficiently wh... | [['reinforcement', 'learning', 'involves', 'decision', 'making', 'in', 'dynamic', 'and', 'uncertain', 'environments', 'and', 'constitutes', 'a', 'crucial', 'element', 'of', 'artificial', 'intelligence', 'in', 'our', 'previous', 'work', 'we', 'experimentally', 'demonstrated', 'that', 'the', 'ultrafast', 'chaotic', 'osci... | [-0.12041478495968626, 0.09568399272597673, -0.07660294948172978, 0.05164857316906537, -0.12032301126222252, -0.17245081139793783, 0.055990775177739996, 0.4675096879707791, -0.29271144091767093, -0.3229759548360493, 0.09364509783761456, -0.20451334964658258, -0.1824675913684326, 0.2321569058194495, -0.08558413661384617... |
1,803.09426 | Proximity-induced artefacts in magnetic imaging with nitrogen-vacancy
ensembles in diamond | Magnetic imaging with ensembles of nitrogen-vacancy (NV) centres in diamond
is a recently developed technique that allows for quantitative vector field
mapping. Here we uncover a source of artefacts in the measured magnetic field
in situations where the magnetic sample is placed in close proximity (a few
tens of nm) ... | cond-mat.mes-hall physics.app-ph physics.ins-det | magnetic imaging with ensembles of nitrogenvacancy nv centres in diamond is a recently developed technique that allows for quantitative vector field mapping here we uncover a source of artefacts in the measured magnetic field in situations where the magnetic sample is placed in close proximity a few tens of nm to the n... | [['magnetic', 'imaging', 'with', 'ensembles', 'of', 'nitrogenvacancy', 'nv', 'centres', 'in', 'diamond', 'is', 'a', 'recently', 'developed', 'technique', 'that', 'allows', 'for', 'quantitative', 'vector', 'field', 'mapping', 'here', 'we', 'uncover', 'a', 'source', 'of', 'artefacts', 'in', 'the', 'measured', 'magnetic',... | [-0.08952290355227888, 0.11777635710736938, -0.02504522789832811, 0.03145380525450301, -0.03390351102719907, -0.10075733768428828, 0.04300430105582183, 0.4534709706339379, -0.26723781434093535, -0.3603484603755046, 0.06689589626093526, -0.27689571784639005, -0.10288172467546754, 0.22345183151340936, -0.0409883580706623... |
1,803.09427 | Design Assurance Evaluation of Microcontrollers for safety critical
Avionics | Dealing with Commercial off-the-shelf (COTS) com- ponents is a daily business
for avionic system manufacturers. They are necessary ingredients for hardware
designs, but are not built in accordance with the avionics consensus standard
DO- 254 for Airborne Electronic Hardware (AEH) design. Especially for complex
COTS h... | cs.SE | dealing with commercial offtheshelf cots com ponents is a daily business for avionic system manufacturers they are necessary ingredients for hardware designs but are not built in accordance with the avionics consensus standard do 254 for airborne electronic hardware aeh design especially for complex cots hardware compo... | [['dealing', 'with', 'commercial', 'offtheshelf', 'cots', 'com', 'ponents', 'is', 'a', 'daily', 'business', 'for', 'avionic', 'system', 'manufacturers', 'they', 'are', 'necessary', 'ingredients', 'for', 'hardware', 'designs', 'but', 'are', 'not', 'built', 'in', 'accordance', 'with', 'the', 'avionics', 'consensus', 'sta... | [-0.1338612031716219, 0.04834516250126025, -0.04668302306555634, 0.030303013831938518, -0.11139265557966606, -0.17360584825017047, 0.03547620542467405, 0.41627206635462144, -0.19457047742966352, -0.3077209613786189, 0.18159908951792914, -0.2644790280610323, -0.11881697198831553, 0.2514652041072742, -0.16440747187200397... |
1,803.09428 | An odd order group without the dimension property | We construct a finitely presented group $G$ such that the $7$th dimension
quotient $G\cap(1+\varpi(\mathbb Z G)^7)/\gamma_7(G)$ has an element of order
$3$; this immediately leads to a finite $3$-group without the dimension
property. This contradicts a series of results by N. Gupta.
| math.GR | we construct a finitely presented group g such that the 7th dimension quotient gcap1varpimathbb z g7gamma_7g has an element of order 3 this immediately leads to a finite 3group without the dimension property this contradicts a series of results by n gupta | [['we', 'construct', 'a', 'finitely', 'presented', 'group', 'g', 'such', 'that', 'the', '7th', 'dimension', 'quotient', 'gcap1varpimathbb', 'z', 'g7gamma_7g', 'has', 'an', 'element', 'of', 'order', '3', 'this', 'immediately', 'leads', 'to', 'a', 'finite', '3group', 'without', 'the', 'dimension', 'property', 'this', 'co... | [-0.14122027764096856, 0.12369264127082716, -0.12083524982153904, -0.03046900129993446, -0.08252503655385227, -0.08865805777022615, 0.0163876637496287, 0.3141112243756652, -0.28685425347648563, -0.2187999710906297, 0.08842604163801297, -0.28300724702421576, -0.1027459864562843, 0.1721440927591175, -0.10031490753171965,... |
1,803.09429 | Large Deviation Principle for arithmetic functions in continued fraction
expansion | Khinchin proved that the arithmetic mean of continued fraction digits of
Lebesgue almost every irrational number in $(0,1)$ diverges to infinity. Hence,
none of the classical limit theorems such as the weak and strong laws of large
numbers or central limit theorems hold. Nevertheless, we prove the existence of
a larg... | math.DS math.NT math.PR | khinchin proved that the arithmetic mean of continued fraction digits of lebesgue almost every irrational number in 01 diverges to infinity hence none of the classical limit theorems such as the weak and strong laws of large numbers or central limit theorems hold nevertheless we prove the existence of a large deviation... | [['khinchin', 'proved', 'that', 'the', 'arithmetic', 'mean', 'of', 'continued', 'fraction', 'digits', 'of', 'lebesgue', 'almost', 'every', 'irrational', 'number', 'in', '01', 'diverges', 'to', 'infinity', 'hence', 'none', 'of', 'the', 'classical', 'limit', 'theorems', 'such', 'as', 'the', 'weak', 'and', 'strong', 'laws... | [-0.16522912127708178, 0.13165327861392195, -0.09884894902453474, 0.13544083540530308, 0.014435438736193422, -0.12907226577374167, 0.1582464137101087, 0.2163812613411658, -0.29174982293414464, -0.21408621972575242, 0.13514485932292714, -0.3216434421719632, -0.06595757856384675, 0.21661191355045614, -0.1034739285680479,... |
1,803.0943 | 2HDM without FCNC: off the beaten tracks | We propose an alternative method of constructing two Higgs-doublet models
free from scalar mediated FCNC couplings at the tree-level. In a toy scenario,
we have presented semi realistic textures for the Yukawa matrices, which can
reproduce the approximate flavor structure in the quark sector. Presence of
flavor diago... | hep-ph | we propose an alternative method of constructing two higgsdoublet models free from scalar mediated fcnc couplings at the treelevel in a toy scenario we have presented semi realistic textures for the yukawa matrices which can reproduce the approximate flavor structure in the quark sector presence of flavor diagonal but ... | [['we', 'propose', 'an', 'alternative', 'method', 'of', 'constructing', 'two', 'higgsdoublet', 'models', 'free', 'from', 'scalar', 'mediated', 'fcnc', 'couplings', 'at', 'the', 'treelevel', 'in', 'a', 'toy', 'scenario', 'we', 'have', 'presented', 'semi', 'realistic', 'textures', 'for', 'the', 'yukawa', 'matrices', 'whi... | [-0.1395369609235786, 0.22770481577827012, -0.00872847018763423, 0.17262872432669005, -0.06789036908497413, -0.22758866138756276, 0.02541921994027992, 0.3324064482934773, -0.20519133166720468, -0.2949399903804685, 0.0010502707640019555, -0.24853543527424335, -0.14531214499499281, 0.07397339008748531, 0.0837484156014397... |
1,803.09431 | Discrete Analogoues in Harmonic Analysis: Maximally Monomially Modulated
Singular Integrals Related to Carleson's Theorem | Motivated by Bourgain's work on pointwise ergodic theorems, and the work of
Stein and Stein-Wainger on maximally modulated singular integrals without
linear terms, we prove that the maximally monomially modulated discrete Hilbert
transform, \[ \mathcal{C}_df(x) := \sup_\lambda \left| \sum_{m \neq 0} f(x-m)
\frac{e^{2... | math.CA math.DS | motivated by bourgains work on pointwise ergodic theorems and the work of stein and steinwainger on maximally modulated singular integrals without linear terms we prove that the maximally monomially modulated discrete hilbert transform mathcalc_dfx sup_lambda left sum_m neq 0 fxm frace2pi i lambda mdm right is bounded ... | [['motivated', 'by', 'bourgains', 'work', 'on', 'pointwise', 'ergodic', 'theorems', 'and', 'the', 'work', 'of', 'stein', 'and', 'steinwainger', 'on', 'maximally', 'modulated', 'singular', 'integrals', 'without', 'linear', 'terms', 'we', 'prove', 'that', 'the', 'maximally', 'monomially', 'modulated', 'discrete', 'hilber... | [-0.18757338172756136, 0.17053987758234143, -0.022041296717361547, 0.07675853504159022, -0.03390531172743067, -0.2688762722350657, -0.001743399715051055, 0.34487308248877524, -0.3257663692813367, -0.06467648116871715, 0.08514843658427708, -0.3343874172400683, -0.09416730695404113, 0.15890412242617458, -0.06491878533735... |
1,803.09432 | Time-dependent lead-lag relationship between the onshore and offshore
Renminbi exchange rates | We employ the thermal optimal path method to explore both the long-term and
short-term interaction patterns between the onshore CNY and offshore CNH
exchange rates (2012-2015). For the daily data, the CNY and CNH exchange rates
show a weak alternate lead-lag structure in most of the time periods. When CNY
and CNH dis... | q-fin.ST | we employ the thermal optimal path method to explore both the longterm and shortterm interaction patterns between the onshore cny and offshore cnh exchange rates 20122015 for the daily data the cny and cnh exchange rates show a weak alternate leadlag structure in most of the time periods when cny and cnh display a larg... | [['we', 'employ', 'the', 'thermal', 'optimal', 'path', 'method', 'to', 'explore', 'both', 'the', 'longterm', 'and', 'shortterm', 'interaction', 'patterns', 'between', 'the', 'onshore', 'cny', 'and', 'offshore', 'cnh', 'exchange', 'rates', '20122015', 'for', 'the', 'daily', 'data', 'the', 'cny', 'and', 'cnh', 'exchange'... | [-0.12464814733859178, 0.14223090386024762, -0.059251294720666946, 0.1267794056569312, -0.06190313117129477, -0.12057488768011437, 0.09291873758011465, 0.41714113274529735, -0.26232076510712704, -0.3261543805137151, 0.10611069849973002, -0.31141672284174743, -0.12542435938347105, 0.18721836227890606, -0.049297016362617... |
1,803.09433 | Non-trivial surface states of samarium hexaboride at the (111) surface | The peculiar metallic electronic states observed in the Kondo insulator,
samarium hexaboride (SmB$_6$), has stimulated considerable attention among
those studying non-trivial electronic phenomena. However, experimental studies
of these states have led to controversial conclusions mainly to the difficulty
and inhomoge... | cond-mat.str-el | the peculiar metallic electronic states observed in the kondo insulator samarium hexaboride smb_6 has stimulated considerable attention among those studying nontrivial electronic phenomena however experimental studies of these states have led to controversial conclusions mainly to the difficulty and inhomogeneity of th... | [['the', 'peculiar', 'metallic', 'electronic', 'states', 'observed', 'in', 'the', 'kondo', 'insulator', 'samarium', 'hexaboride', 'smb_6', 'has', 'stimulated', 'considerable', 'attention', 'among', 'those', 'studying', 'nontrivial', 'electronic', 'phenomena', 'however', 'experimental', 'studies', 'of', 'these', 'states... | [-0.18390343837173923, 0.20370801476048425, -0.10470806983196074, 0.04189153923930246, -0.07663514635836084, -0.19367504371182312, 0.1156447899873398, 0.42326287442212185, -0.24971532972071261, -0.30065882786931025, -0.043482345005031675, -0.3561266221786066, -0.16737454047330494, 0.16245609995657725, -0.01007533989225... |
1,803.09434 | Goos-H\"anchen-like shifts at metal/superconductor interface | At a normal-metal/superconductor interface, an incident electron from the
normal-metal (N) side can be normally reflected as an electron or Andreev
reflected as a hole. We show that pronounced lateral shifts along the interface
between the incident and the reflected quasiparticles can happen in both
reflection proces... | cond-mat.mes-hall | at a normalmetalsuperconductor interface an incident electron from the normalmetal n side can be normally reflected as an electron or andreev reflected as a hole we show that pronounced lateral shifts along the interface between the incident and the reflected quasiparticles can happen in both reflection processes which... | [['at', 'a', 'normalmetalsuperconductor', 'interface', 'an', 'incident', 'electron', 'from', 'the', 'normalmetal', 'n', 'side', 'can', 'be', 'normally', 'reflected', 'as', 'an', 'electron', 'or', 'andreev', 'reflected', 'as', 'a', 'hole', 'we', 'show', 'that', 'pronounced', 'lateral', 'shifts', 'along', 'the', 'interfa... | [-0.16211970896658706, 0.20843523834679645, -0.07257419455632129, 0.0418541425756891, -0.0731000181287527, -0.18282610370010577, 0.03839717850445167, 0.41471751748091157, -0.2892550719354083, -0.27650455415029734, 0.018307955552796448, -0.32920610310838505, -0.13381518301800552, 0.19194657342809746, -0.0007487809532048... |
1,803.09435 | Unpopularity Factor in the Marriage and Roommates Problems | Given a set $A$ of $n$ people, with each person having a preference list that
ranks a subset of $A$ as his/her acceptable partners in order of preference, we
consider the Roommates Problem (RP) and the Marriage Problem (MP) of matching
people with their partners. In RP there is no further restriction, while in MP
onl... | cs.DS | given a set a of n people with each person having a preference list that ranks a subset of a as hisher acceptable partners in order of preference we consider the roommates problem rp and the marriage problem mp of matching people with their partners in rp there is no further restriction while in mp only people of oppos... | [['given', 'a', 'set', 'a', 'of', 'n', 'people', 'with', 'each', 'person', 'having', 'a', 'preference', 'list', 'that', 'ranks', 'a', 'subset', 'of', 'a', 'as', 'hisher', 'acceptable', 'partners', 'in', 'order', 'of', 'preference', 'we', 'consider', 'the', 'roommates', 'problem', 'rp', 'and', 'the', 'marriage', 'proble... | [-0.13546706077249837, 0.10101697819618494, -0.0788557386258617, 0.04438011794081831, -0.09332638002888416, -0.19092095772612083, 0.125247591735994, 0.3938000046787238, -0.23778921094102165, -0.35609595251541276, 0.04404912458388329, -0.3082420929761914, -0.09461131664405305, 0.09294175732914785, -0.12418105953353613, ... |
1,803.09436 | Numerical Complete Solution for Random Genetic Drift by Energetic
Variational Approach | In this paper, we focus on numerical solutions for random genetic drift
problem, which is governed by a degenerated convection-dominated parabolic
equation. Due to the fixation phenomenon of genes, Dirac delta singularities
will develop at boundary points as time evolves. Based on an energetic
variational approach (E... | math.NA | in this paper we focus on numerical solutions for random genetic drift problem which is governed by a degenerated convectiondominated parabolic equation due to the fixation phenomenon of genes dirac delta singularities will develop at boundary points as time evolves based on an energetic variational approach envara a b... | [['in', 'this', 'paper', 'we', 'focus', 'on', 'numerical', 'solutions', 'for', 'random', 'genetic', 'drift', 'problem', 'which', 'is', 'governed', 'by', 'a', 'degenerated', 'convectiondominated', 'parabolic', 'equation', 'due', 'to', 'the', 'fixation', 'phenomenon', 'of', 'genes', 'dirac', 'delta', 'singularities', 'wi... | [-0.11960440734045878, 0.06645490481255607, -0.09591821156076034, 0.0534413960266446, -0.0940877520159342, -0.16945128655061126, 0.0665778469530695, 0.3471159157876409, -0.3166426415270806, -0.25307544631499596, 0.09222222603582031, -0.2752548451019977, -0.13660778036298415, 0.2000596432041071, -0.07238099135046128, 0.... |
1,803.09437 | Cascaded multi-scale and multi-dimension convolutional neural network
for stereo matching | Convolutional neural networks(CNN) have been shown to perform better than the
conventional stereo algorithms for stereo estimation. Numerous efforts focus on
the pixel-wise matching cost computation, which is the important building block
for many start-of-the-art algorithms. However, those architectures are limited
t... | cs.CV | convolutional neural networkscnn have been shown to perform better than the conventional stereo algorithms for stereo estimation numerous efforts focus on the pixelwise matching cost computation which is the important building block for many startoftheart algorithms however those architectures are limited to small and ... | [['convolutional', 'neural', 'networkscnn', 'have', 'been', 'shown', 'to', 'perform', 'better', 'than', 'the', 'conventional', 'stereo', 'algorithms', 'for', 'stereo', 'estimation', 'numerous', 'efforts', 'focus', 'on', 'the', 'pixelwise', 'matching', 'cost', 'computation', 'which', 'is', 'the', 'important', 'building'... | [-0.05618022872536185, 0.017159750871027186, -0.040742839466365255, 0.08892998634767438, -0.08758717235065548, -0.1760346221594499, 0.0018645586103694625, 0.479047576773418, -0.2657781525750656, -0.35845066011176413, 0.08835255725068007, -0.21991081109129493, -0.19438251919892943, 0.193721111654865, -0.1132174645987457... |
1,803.09438 | Properties of the Black Hole Candidate XTE J1118+480 with the TCAF
solution during its Jet Activity Induced 2000 Outburst | Galactic black hole candidate (BHC) XTE~J1118+480 during its 2000 outburst
has been studied in a broad energy range using the archival data of PCA and
HEXTE payloads of {\it Rossi X-ray Timing Explorer}. Detailed spectral and
temporal properties of the source are studied. Low and very low frequency
quasi-periodic osc... | astro-ph.HE | galactic black hole candidate bhc xtej1118480 during its 2000 outburst has been studied in a broad energy range using the archival data of pca and hexte payloads of it rossi xray timing explorer detailed spectral and temporal properties of the source are studied low and very low frequency quasiperiodic oscillations qpo... | [['galactic', 'black', 'hole', 'candidate', 'bhc', 'xtej1118480', 'during', 'its', '2000', 'outburst', 'has', 'been', 'studied', 'in', 'a', 'broad', 'energy', 'range', 'using', 'the', 'archival', 'data', 'of', 'pca', 'and', 'hexte', 'payloads', 'of', 'it', 'rossi', 'xray', 'timing', 'explorer', 'detailed', 'spectral', ... | [-0.07259590694338529, 0.10022801663245236, -0.09238811007414299, 0.10923228608185633, -0.07884645441340075, -0.11774393829564826, 0.030234479368266322, 0.4192513331818657, -0.22916853314854652, -0.3438452218905983, 0.14473482944184723, -0.3103371443407029, -0.03772223752756149, 0.22105600092755073, -0.0469186907056042... |
1,803.09439 | The spectrum of the singularity category of a category algebra | Let $\C$ be a finite projective EI category and $k$ be a field. The
singularity category of the category algebra $k\C$ is a tensor triangulated
category. We compute its spectrum in the sense of Balmer.
| math.RT | let c be a finite projective ei category and k be a field the singularity category of the category algebra kc is a tensor triangulated category we compute its spectrum in the sense of balmer | [['let', 'c', 'be', 'a', 'finite', 'projective', 'ei', 'category', 'and', 'k', 'be', 'a', 'field', 'the', 'singularity', 'category', 'of', 'the', 'category', 'algebra', 'kc', 'is', 'a', 'tensor', 'triangulated', 'category', 'we', 'compute', 'its', 'spectrum', 'in', 'the', 'sense', 'of', 'balmer']] | [-0.1661892704665661, 0.0027010158502629826, -0.11037800961307116, 0.03237907313409128, -0.1268970942923001, -0.190110690678869, -0.07280958326799529, 0.36948410368391443, -0.44954521805047987, -0.11787283487085785, 0.07127776970488152, -0.2062053163402847, -0.0329771234520844, 0.10204584029104029, -0.19319886863231658... |
1,803.0944 | The principle of maximum in the imitative control tasks | The article is devoted to the problem of applying the maximum principle for
finding optimal control parameters in simulation tasks of interest for a
variety of engineering and industrial systems and processes. Especially
important is the problem for such systems where it is practically impossible to
organize a contro... | math.OC | the article is devoted to the problem of applying the maximum principle for finding optimal control parameters in simulation tasks of interest for a variety of engineering and industrial systems and processes especially important is the problem for such systems where it is practically impossible to organize a control s... | [['the', 'article', 'is', 'devoted', 'to', 'the', 'problem', 'of', 'applying', 'the', 'maximum', 'principle', 'for', 'finding', 'optimal', 'control', 'parameters', 'in', 'simulation', 'tasks', 'of', 'interest', 'for', 'a', 'variety', 'of', 'engineering', 'and', 'industrial', 'systems', 'and', 'processes', 'especially',... | [-0.1269907630892508, 0.05226162681219343, -0.06303463947659221, 0.03559423911997786, -0.057930837102521886, -0.1485183894815511, 0.0546361150957594, 0.3477024546505621, -0.28456433598677183, -0.323961365942987, 0.15580831017835853, -0.24597233159132786, -0.15049707487103647, 0.27478241538253906, -0.08192349912836247, ... |
1,803.09441 | Rigorous Results for the Ground States of the Spin-2 Bose-Hubbard Model | We present rigorous and universal results for the ground states of the $f=2$
spinor Bose-Hubbard model. The model includes three two-body on site
interaction terms, two of which are spin dependent while the other one is spin
independent. We prove that, depending only on the coefficients of the two spin
dependent term... | cond-mat.quant-gas cond-mat.stat-mech math-ph math.MP | we present rigorous and universal results for the ground states of the f2 spinor bosehubbard model the model includes three twobody on site interaction terms two of which are spin dependent while the other one is spin independent we prove that depending only on the coefficients of the two spin dependent terms the groun... | [['we', 'present', 'rigorous', 'and', 'universal', 'results', 'for', 'the', 'ground', 'states', 'of', 'the', 'f2', 'spinor', 'bosehubbard', 'model', 'the', 'model', 'includes', 'three', 'twobody', 'on', 'site', 'interaction', 'terms', 'two', 'of', 'which', 'are', 'spin', 'dependent', 'while', 'the', 'other', 'one', 'is... | [-0.16536140673119445, 0.16571695652212307, -0.02743456951053492, 0.06784377763838635, -0.06561266020711126, -0.14409756166699889, 0.010624568873277769, 0.331544139131438, -0.22062106806271034, -0.2710521466676788, 0.07047111691469488, -0.28399746472834897, -0.11335352187823697, 0.1717398898256541, 0.07184782928530255,... |
1,803.09442 | Character values and Hochschild homology | We present a conjecture (and a proof for G=SL(2)) generalizing a result of J.
Arthur which expresses a character value of a cuspidal representation of a
$p$-adic group as a weighted orbital integral of its matrix coefficient. It
also generalizes a conjecture by the second author proved by Schneider-Stuhler
and (indep... | math.RT | we present a conjecture and a proof for gsl2 generalizing a result of j arthur which expresses a character value of a cuspidal representation of a padic group as a weighted orbital integral of its matrix coefficient it also generalizes a conjecture by the second author proved by schneiderstuhler and independently the f... | [['we', 'present', 'a', 'conjecture', 'and', 'a', 'proof', 'for', 'gsl2', 'generalizing', 'a', 'result', 'of', 'j', 'arthur', 'which', 'expresses', 'a', 'character', 'value', 'of', 'a', 'cuspidal', 'representation', 'of', 'a', 'padic', 'group', 'as', 'a', 'weighted', 'orbital', 'integral', 'of', 'its', 'matrix', 'coeff... | [-0.20705242954815428, 0.03666402567517556, -0.15007743074998467, 0.051569202557827036, -0.12915922922289205, -0.10613725734874606, -0.0011908261234768562, 0.2559424101594939, -0.318471729884752, -0.2117650916179021, 0.09170606895996672, -0.20778734041377903, -0.18626161308752165, 0.20204737173496848, -0.12668271860004... |
1,803.09443 | Duality, Fundamentality, and Emergence | Dualities offer new possibilities for relating fundamentality and emergence.
In particular, as is the aim of this chapter to show, it may happen that the
relations of fundamentality and emergence between dual theories are inverted.
In other words, the direction of emergence typically found in these cases is
opposite ... | physics.hist-ph hep-th | dualities offer new possibilities for relating fundamentality and emergence in particular as is the aim of this chapter to show it may happen that the relations of fundamentality and emergence between dual theories are inverted in other words the direction of emergence typically found in these cases is opposite to the ... | [['dualities', 'offer', 'new', 'possibilities', 'for', 'relating', 'fundamentality', 'and', 'emergence', 'in', 'particular', 'as', 'is', 'the', 'aim', 'of', 'this', 'chapter', 'to', 'show', 'it', 'may', 'happen', 'that', 'the', 'relations', 'of', 'fundamentality', 'and', 'emergence', 'between', 'dual', 'theories', 'are... | [-0.13806211989931763, 0.17686285903677346, -0.08004207492247224, 0.10357717902865261, -0.08940020033717155, -0.1427395797893405, 0.03386689661582932, 0.33427495013177394, -0.2801187598332763, -0.2848376804701984, 0.0709744896972552, -0.24166011188179254, -0.18910505869984626, 0.21176426298962905, -0.05985754934325814,... |
1,803.09444 | Cliquet option pricing with Meixner processes | We investigate the pricing of cliquet options in a geometric Meixner model.
The considered option is of monthly sum cap style while the underlying stock
price model is driven by a pure-jump Meixner--L\'{e}vy process yielding Meixner
distributed log-returns. In this setting, we infer semi-analytic expressions
for the ... | q-fin.PR math.PR | we investigate the pricing of cliquet options in a geometric meixner model the considered option is of monthly sum cap style while the underlying stock price model is driven by a purejump meixnerlevy process yielding meixner distributed logreturns in this setting we infer semianalytic expressions for the cliquet option... | [['we', 'investigate', 'the', 'pricing', 'of', 'cliquet', 'options', 'in', 'a', 'geometric', 'meixner', 'model', 'the', 'considered', 'option', 'is', 'of', 'monthly', 'sum', 'cap', 'style', 'while', 'the', 'underlying', 'stock', 'price', 'model', 'is', 'driven', 'by', 'a', 'purejump', 'meixnerlevy', 'process', 'yieldin... | [-0.053035543806561565, 0.0442563251717111, -0.12505658331679778, 0.1386460630566008, -0.076172848629937, -0.10507030741230232, 0.08316973088652764, 0.41444496181115364, -0.30440517191241667, -0.23232226951716883, 0.12115293331512078, -0.2490704118373614, -0.13954286913848618, 0.18014472649315172, -0.11647579556746969,... |
1,803.09445 | Evaluations of Series Related to Jacobi Elliptic Functions | In this article we give evaluations of certain series of hyperbolic functions
using Jacobi elliptic functions theory. We also define some new functions that
enable us to give characterization of not solvable class of series.
| math.NT | in this article we give evaluations of certain series of hyperbolic functions using jacobi elliptic functions theory we also define some new functions that enable us to give characterization of not solvable class of series | [['in', 'this', 'article', 'we', 'give', 'evaluations', 'of', 'certain', 'series', 'of', 'hyperbolic', 'functions', 'using', 'jacobi', 'elliptic', 'functions', 'theory', 'we', 'also', 'define', 'some', 'new', 'functions', 'that', 'enable', 'us', 'to', 'give', 'characterization', 'of', 'not', 'solvable', 'class', 'of', ... | [-0.12965778499575598, 0.021802336456520216, -0.14167140369037431, 0.06350905739236623, -0.15562038363090583, -0.10320380021418844, -2.4397129059902258e-05, 0.3578314292111567, -0.2885351826037679, -0.22484110923750059, 0.06188258395995945, -0.22594807360853467, -0.25970933554427966, 0.3006067329751594, -0.076707512645... |
1,803.09446 | Convergent kernel-based methods for parabolic equations | We prove that the functions constructed by the kernel-based regressions with
Wendland kernels under $\ell_1$-norm constraints converge to unique viscosity
solutions of the corresponding fully nonlinear parabolic equations. A key
ingredient in our proof is the max-min representations of the nonlinearities of
the equat... | math.NA cs.NA math.OC | we prove that the functions constructed by the kernelbased regressions with wendland kernels under ell_1norm constraints converge to unique viscosity solutions of the corresponding fully nonlinear parabolic equations a key ingredient in our proof is the maxmin representations of the nonlinearities of the equations | [['we', 'prove', 'that', 'the', 'functions', 'constructed', 'by', 'the', 'kernelbased', 'regressions', 'with', 'wendland', 'kernels', 'under', 'ell_1norm', 'constraints', 'converge', 'to', 'unique', 'viscosity', 'solutions', 'of', 'the', 'corresponding', 'fully', 'nonlinear', 'parabolic', 'equations', 'a', 'key', 'ingr... | [-0.0945738152262162, -0.03661527354746464, -0.12252122538418254, 0.04915578591118736, -0.1066814013227651, -0.1297420835246819, -0.0517993387342854, 0.262782324698161, -0.34431844373995607, -0.1831034219146452, 0.12052715449747418, -0.27960296449336136, -0.1683946001100015, 0.1733960065017031, -0.0625754291461569, 0.1... |
1,803.09447 | Entropic bounds on currents in Langevin systems | We derive a bound on generalized currents for Langevin systems in terms of
the total entropy production in the system and its environment. For overdamped
dynamics, any generalized current is bounded by the total rate of entropy
production. We show that this entropic bound on the magnitude of generalized
currents impo... | cond-mat.stat-mech | we derive a bound on generalized currents for langevin systems in terms of the total entropy production in the system and its environment for overdamped dynamics any generalized current is bounded by the total rate of entropy production we show that this entropic bound on the magnitude of generalized currents imposes p... | [['we', 'derive', 'a', 'bound', 'on', 'generalized', 'currents', 'for', 'langevin', 'systems', 'in', 'terms', 'of', 'the', 'total', 'entropy', 'production', 'in', 'the', 'system', 'and', 'its', 'environment', 'for', 'overdamped', 'dynamics', 'any', 'generalized', 'current', 'is', 'bounded', 'by', 'the', 'total', 'rate'... | [-0.16355889069447138, 0.1892221130186161, -0.038486691324466936, 0.06616209512355337, -0.03163138587371181, -0.1815271760394287, 0.11366165054223225, 0.3218186842277646, -0.2821038952344435, -0.26745435735470924, 0.07726908666562997, -0.29283503666207944, -0.11162649594148485, 0.27717502739842376, -0.05197824954117685... |
1,803.09448 | REST: Real-to-Synthetic Transform for Illumination Invariant Camera
Localization | Accurate camera localization is an essential part of tracking systems.
However, localization results are greatly affected by illumination. Including
data collected under various lighting conditions can improve the robustness of
the localization algorithm to lighting variation. However, this is very tedious
and time c... | cs.CV | accurate camera localization is an essential part of tracking systems however localization results are greatly affected by illumination including data collected under various lighting conditions can improve the robustness of the localization algorithm to lighting variation however this is very tedious and time consumin... | [['accurate', 'camera', 'localization', 'is', 'an', 'essential', 'part', 'of', 'tracking', 'systems', 'however', 'localization', 'results', 'are', 'greatly', 'affected', 'by', 'illumination', 'including', 'data', 'collected', 'under', 'various', 'lighting', 'conditions', 'can', 'improve', 'the', 'robustness', 'of', 'th... | [-0.06751739138375923, 0.044284301034814545, -0.09315927681565937, 0.0371445504007573, -0.06548728853387316, -0.17010917210172544, -0.008802760710469303, 0.47166234044809396, -0.25957325723060626, -0.38338888253651787, 0.1260485862370955, -0.24250502702924087, -0.14518440298294438, 0.2389668947927049, -0.19644431146185... |
1,803.09449 | Distinct pressure evolution of coupled nematic and magnetic order in
FeSe | FeSe, despite being the structurally simplest compound in the family of
iron-based superconductors, shows an astoundingly rich interplay of physical
phenomena including nematicity and pressure-induced magnetism. Here, we present
a microscopic study of these two phenomena by high-energy x-ray diffraction and
time-doma... | cond-mat.supr-con cond-mat.str-el | fese despite being the structurally simplest compound in the family of ironbased superconductors shows an astoundingly rich interplay of physical phenomena including nematicity and pressureinduced magnetism here we present a microscopic study of these two phenomena by highenergy xray diffraction and timedomain mossbaue... | [['fese', 'despite', 'being', 'the', 'structurally', 'simplest', 'compound', 'in', 'the', 'family', 'of', 'ironbased', 'superconductors', 'shows', 'an', 'astoundingly', 'rich', 'interplay', 'of', 'physical', 'phenomena', 'including', 'nematicity', 'and', 'pressureinduced', 'magnetism', 'here', 'we', 'present', 'a', 'mi... | [-0.19978164323408426, 0.29685037014591675, -0.010838340498037167, -0.02886541356880067, -0.09185153069939497, -0.1081197633982745, 0.17216518110341836, 0.4128885494690884, -0.31260793529115805, -0.2741270667395076, -0.015377906020017559, -0.3277218291464656, -0.100657708909329, 0.13320984128392763, 0.07073330256651651... |
1,803.0945 | The chemistry of disks around T Tauri and Herbig Ae/Be stars | Infrared and (sub-)mm observations of disks around T Tauri and Herbig Ae/Be
stars point to a chemical differentiation between both types of disks, with a
lower detection rate of molecules in disks around hotter stars. To investigate
the potential underlying causes we perform a comparative study of the chemistry
of T ... | astro-ph.GA astro-ph.SR | infrared and submm observations of disks around t tauri and herbig aebe stars point to a chemical differentiation between both types of disks with a lower detection rate of molecules in disks around hotter stars to investigate the potential underlying causes we perform a comparative study of the chemistry of t tauri an... | [['infrared', 'and', 'submm', 'observations', 'of', 'disks', 'around', 't', 'tauri', 'and', 'herbig', 'aebe', 'stars', 'point', 'to', 'a', 'chemical', 'differentiation', 'between', 'both', 'types', 'of', 'disks', 'with', 'a', 'lower', 'detection', 'rate', 'of', 'molecules', 'in', 'disks', 'around', 'hotter', 'stars', '... | [-0.029569470883154918, 0.1427839901505245, -0.005720711382667697, 0.06892516333997871, -0.04481071007349307, -0.0861774005893884, 0.07627958607312943, 0.4410376877775268, -0.1787909754769071, -0.30671240016818047, 0.03338915914895811, -0.28355530574991705, -0.030323742963151917, 0.13486004319182404, -0.084711535123457... |
1,803.09451 | Derived categories for Grothendieck categories of enriched functors | The derived category $D[C,V]$ of the Grothendieck category of enriched
functors $[C,V]$, where $V$ is a closed symmetric monoidal Grothendieck
category and $C$ is a small $V$-category, is studied. We prove that if the
derived category $D(V)$ of $V$ is a compactly generated triangulated category
with certain reasonabl... | math.CT math.KT | the derived category dcv of the grothendieck category of enriched functors cv where v is a closed symmetric monoidal grothendieck category and c is a small vcategory is studied we prove that if the derived category dv of v is a compactly generated triangulated category with certain reasonable assumptions on compact gen... | [['the', 'derived', 'category', 'dcv', 'of', 'the', 'grothendieck', 'category', 'of', 'enriched', 'functors', 'cv', 'where', 'v', 'is', 'a', 'closed', 'symmetric', 'monoidal', 'grothendieck', 'category', 'and', 'c', 'is', 'a', 'small', 'vcategory', 'is', 'studied', 'we', 'prove', 'that', 'if', 'the', 'derived', 'catego... | [-0.15394859126693494, 0.025450630297741184, -0.039385186048929356, 0.11222969156979407, -0.10416522915978488, -0.1665878323020061, -0.08390423371708272, 0.43569361876595664, -0.42714656577948984, -0.1413174400836028, 0.05915610967329829, -0.15349809599511727, -0.06291325995383935, 0.15740564115332892, -0.2427643861848... |
1,803.09452 | Panel Data Analysis with Heterogeneous Dynamics | This paper proposes a model-free approach to analyze panel data with
heterogeneous dynamic structures across observational units. We first compute
the sample mean, autocovariances, and autocorrelations for each unit, and then
estimate the parameters of interest based on their empirical distributions. We
then investig... | econ.EM | this paper proposes a modelfree approach to analyze panel data with heterogeneous dynamic structures across observational units we first compute the sample mean autocovariances and autocorrelations for each unit and then estimate the parameters of interest based on their empirical distributions we then investigate the ... | [['this', 'paper', 'proposes', 'a', 'modelfree', 'approach', 'to', 'analyze', 'panel', 'data', 'with', 'heterogeneous', 'dynamic', 'structures', 'across', 'observational', 'units', 'we', 'first', 'compute', 'the', 'sample', 'mean', 'autocovariances', 'and', 'autocorrelations', 'for', 'each', 'unit', 'and', 'then', 'est... | [-0.023225326967589995, 0.005245761982366151, -0.13243372472660506, 0.11708312927672238, -0.052635584469409843, -0.08789288730579703, 0.10312351068440716, 0.39113852684842604, -0.23865066166948892, -0.3200930843458456, 0.11998308674939086, -0.27093931462834864, -0.15553151332035972, 0.20455925915317208, -0.071730575560... |
1,803.09453 | CNN in MRF: Video Object Segmentation via Inference in A CNN-Based
Higher-Order Spatio-Temporal MRF | This paper addresses the problem of video object segmentation, where the
initial object mask is given in the first frame of an input video. We propose a
novel spatio-temporal Markov Random Field (MRF) model defined over pixels to
handle this problem. Unlike conventional MRF models, the spatial dependencies
among pixe... | cs.CV | this paper addresses the problem of video object segmentation where the initial object mask is given in the first frame of an input video we propose a novel spatiotemporal markov random field mrf model defined over pixels to handle this problem unlike conventional mrf models the spatial dependencies among pixels in our... | [['this', 'paper', 'addresses', 'the', 'problem', 'of', 'video', 'object', 'segmentation', 'where', 'the', 'initial', 'object', 'mask', 'is', 'given', 'in', 'the', 'first', 'frame', 'of', 'an', 'input', 'video', 'we', 'propose', 'a', 'novel', 'spatiotemporal', 'markov', 'random', 'field', 'mrf', 'model', 'defined', 'ov... | [-0.0455957766957214, 0.0234930107768297, -0.04796633806642778, 0.057397897841564835, -0.09712457051959458, -0.19835745010598393, 0.008870467931844222, 0.4773424107196002, -0.29745960591608667, -0.3588916529841684, 0.024788700632253212, -0.20092909984758556, -0.1772721607336692, 0.10110203134185024, -0.1463341154387505... |
1,803.09454 | Fast and Accurate Single Image Super-Resolution via Information
Distillation Network | Recently, deep convolutional neural networks (CNNs) have been demonstrated
remarkable progress on single image super-resolution. However, as the depth and
width of the networks increase, CNN-based super-resolution methods have been
faced with the challenges of computational complexity and memory consumption in
practi... | cs.CV | recently deep convolutional neural networks cnns have been demonstrated remarkable progress on single image superresolution however as the depth and width of the networks increase cnnbased superresolution methods have been faced with the challenges of computational complexity and memory consumption in practice in order... | [['recently', 'deep', 'convolutional', 'neural', 'networks', 'cnns', 'have', 'been', 'demonstrated', 'remarkable', 'progress', 'on', 'single', 'image', 'superresolution', 'however', 'as', 'the', 'depth', 'and', 'width', 'of', 'the', 'networks', 'increase', 'cnnbased', 'superresolution', 'methods', 'have', 'been', 'face... | [-0.05632750567023617, -0.014564779943808587, -0.0351436471541387, 0.023397088013715237, -0.04444462969219564, -0.16319399822654354, -0.009022648637560573, 0.4505614048927217, -0.30814513735775206, -0.3234839080949314, 0.1182195573308933, -0.2658394135585105, -0.16653592996299266, 0.1723746627430759, -0.112427494632130... |
1,803.09455 | Crime Pays; Homogenized Wave Equations for Long Times | This article examines the accuracy for large times of asymptotic expansions
from periodic homogenization of wave equations. As usual, $\epsilon$ denotes
the small period of the coefficients in the wave equation. We first prove that
the standard two scale asymptotic expansion provides an accurate approximation
of the ... | math.AP | this article examines the accuracy for large times of asymptotic expansions from periodic homogenization of wave equations as usual epsilon denotes the small period of the coefficients in the wave equation we first prove that the standard two scale asymptotic expansion provides an accurate approximation of the exact so... | [['this', 'article', 'examines', 'the', 'accuracy', 'for', 'large', 'times', 'of', 'asymptotic', 'expansions', 'from', 'periodic', 'homogenization', 'of', 'wave', 'equations', 'as', 'usual', 'epsilon', 'denotes', 'the', 'small', 'period', 'of', 'the', 'coefficients', 'in', 'the', 'wave', 'equation', 'we', 'first', 'pro... | [-0.169636627471687, 0.09261649052457002, -0.0434932623936751, 0.06956319587817728, -0.04018258236836167, -0.08529517346924334, 0.01353625196107232, 0.29712480150988235, -0.23161828387278638, -0.2861494939999292, 0.12681902184826166, -0.29367861934256234, -0.13366895953924615, 0.18658572257865194, 0.01177815479170156, ... |
1,803.09456 | Entropy of Higher Dimensional Charged Gauss-Bonnet Black hole in de
Sitter Space | The fundamental equation of the thermodynamic system gives the relation
between internal energy, entropy and volume of two adjacent equilibrium states.
Taking higher dimensional charged Gauss-Bonnet black hole in de Sitter space as
a thermodynamic system, the state parameters have to meet the fundamental
equation of ... | gr-qc | the fundamental equation of the thermodynamic system gives the relation between internal energy entropy and volume of two adjacent equilibrium states taking higher dimensional charged gaussbonnet black hole in de sitter space as a thermodynamic system the state parameters have to meet the fundamental equation of thermo... | [['the', 'fundamental', 'equation', 'of', 'the', 'thermodynamic', 'system', 'gives', 'the', 'relation', 'between', 'internal', 'energy', 'entropy', 'and', 'volume', 'of', 'two', 'adjacent', 'equilibrium', 'states', 'taking', 'higher', 'dimensional', 'charged', 'gaussbonnet', 'black', 'hole', 'in', 'de', 'sitter', 'spac... | [-0.17606266854336755, 0.13457100651947762, -0.11677818151729756, 0.08879967456106565, -0.02380401331861064, -0.09463865541319989, 0.010650073383120622, 0.2358798857532301, -0.20001086655933903, -0.29053029901225047, 0.07374511711568858, -0.32678093683741893, -0.05910461456163452, 0.14593811300378176, -0.05546338542850... |
1,803.09457 | A holistic perspective on the dynamics of G035.39-00.33: the interplay
between gas and magnetic fields | Magnetic field is one of the key agents that play a crucial role in shaping
molecular clouds and regulating star formation, yet the complete information on
the magnetic field is not well constrained due to the limitations in
observations. We study the magnetic field in the massive infrared dark cloud
G035.39-00.33 fr... | astro-ph.GA astro-ph.SR | magnetic field is one of the key agents that play a crucial role in shaping molecular clouds and regulating star formation yet the complete information on the magnetic field is not well constrained due to the limitations in observations we study the magnetic field in the massive infrared dark cloud g035390033 from dust... | [['magnetic', 'field', 'is', 'one', 'of', 'the', 'key', 'agents', 'that', 'play', 'a', 'crucial', 'role', 'in', 'shaping', 'molecular', 'clouds', 'and', 'regulating', 'star', 'formation', 'yet', 'the', 'complete', 'information', 'on', 'the', 'magnetic', 'field', 'is', 'not', 'well', 'constrained', 'due', 'to', 'the', '... | [-0.1543320407661321, 0.1533461481001665, -0.040838571664478095, 0.053465761627728446, -0.08463315986325994, -0.03147122046230213, -0.0015946815119749526, 0.4224065241980411, -0.21195775293375527, -0.3032124790119096, 0.08617732183830369, -0.20385639837066208, -0.0595793325543156, 0.1658563547724274, 0.0254789053504946... |
1,803.09458 | A new series solution method for the transmission problem | We derive analytic series representation for the Neumann-Poincare operator
using the exterior conformal mapping for general shape domains. We derive the
formula by using the Faber polynomial basis for arbitrary Lipschitz domains.
With the proposed method we can approximate the spectrum of the smooth domains
by findin... | math.AP | we derive analytic series representation for the neumannpoincare operator using the exterior conformal mapping for general shape domains we derive the formula by using the faber polynomial basis for arbitrary lipschitz domains with the proposed method we can approximate the spectrum of the smooth domains by finding the... | [['we', 'derive', 'analytic', 'series', 'representation', 'for', 'the', 'neumannpoincare', 'operator', 'using', 'the', 'exterior', 'conformal', 'mapping', 'for', 'general', 'shape', 'domains', 'we', 'derive', 'the', 'formula', 'by', 'using', 'the', 'faber', 'polynomial', 'basis', 'for', 'arbitrary', 'lipschitz', 'domai... | [-0.1236769941760533, -0.016070578594817156, -0.09865612439366418, 0.040945379828005585, -0.1285119132319493, -0.06724070251655223, -0.03877021069290923, 0.3506557481613622, -0.2884872530642619, -0.23022172448517225, 0.15057929304998313, -0.232639728489318, -0.2152637940442273, 0.1762895651175571, -0.009916044076654449... |
1,803.09459 | Nonkinematic solar dynamo models with double-cell meridional circulation | Employing the standard solar interior model as input we construct a
dynamically-consistent nonlinear dynamo model that takes into account the
detailed description of the \Lambda- effect, turbulent pumping, magnetic
helicity balance, and magnetic feedback on the differential rotation and
meridional circulation. The ba... | astro-ph.SR | employing the standard solar interior model as input we construct a dynamicallyconsistent nonlinear dynamo model that takes into account the detailed description of the lambda effect turbulent pumping magnetic helicity balance and magnetic feedback on the differential rotation and meridional circulation the background ... | [['employing', 'the', 'standard', 'solar', 'interior', 'model', 'as', 'input', 'we', 'construct', 'a', 'dynamicallyconsistent', 'nonlinear', 'dynamo', 'model', 'that', 'takes', 'into', 'account', 'the', 'detailed', 'description', 'of', 'the', 'lambda', 'effect', 'turbulent', 'pumping', 'magnetic', 'helicity', 'balance'... | [-0.2016753096008537, 0.21689657823632688, -0.006904823544276197, 0.09601976172317092, -0.07539388059933738, -0.006145683739606927, 0.01477564312404067, 0.32203434039270734, -0.27817141273081664, -0.3498136888462596, 0.043873081975275785, -0.22465105426651086, -0.12226823866594493, 0.22114757937606333, 0.00083349477954... |
1,803.0946 | Scalable inference for crossed random effects models | We analyze the complexity of Gibbs samplers for inference in crossed random
effect models used in modern analysis of variance. We demonstrate that for
certain designs the plain vanilla Gibbs sampler is not scalable, in the sense
that its complexity is worse than proportional to the number of parameters and
data. We t... | stat.CO stat.ME stat.ML | we analyze the complexity of gibbs samplers for inference in crossed random effect models used in modern analysis of variance we demonstrate that for certain designs the plain vanilla gibbs sampler is not scalable in the sense that its complexity is worse than proportional to the number of parameters and data we thus p... | [['we', 'analyze', 'the', 'complexity', 'of', 'gibbs', 'samplers', 'for', 'inference', 'in', 'crossed', 'random', 'effect', 'models', 'used', 'in', 'modern', 'analysis', 'of', 'variance', 'we', 'demonstrate', 'that', 'for', 'certain', 'designs', 'the', 'plain', 'vanilla', 'gibbs', 'sampler', 'is', 'not', 'scalable', 'i... | [-0.044205993781947804, 0.08714523386480587, -0.12055247976264406, 0.1485055609664414, -0.06817067011950477, -0.16417531932388701, 0.08843948220225772, 0.4315179453021096, -0.24410772064865957, -0.3082501822481713, 0.09858654528356818, -0.21390692878048867, -0.13984634176613914, 0.23423059503998486, -0.1225025806155416... |
1,803.09461 | A clustering approach to infer Wikipedia contributors' profile | In online communities, recent studies have strongly improved our knowledge
about the different types or profiles of contributors, from casual to very
involved ones, through focused people. However they do so by using very complex
methodologies (qualitative-quantitative mix, with a high workload to manually
codify/cha... | cs.HC cs.CY stat.AP | in online communities recent studies have strongly improved our knowledge about the different types or profiles of contributors from casual to very involved ones through focused people however they do so by using very complex methodologies qualitativequantitative mix with a high workload to manually codifycharacterize ... | [['in', 'online', 'communities', 'recent', 'studies', 'have', 'strongly', 'improved', 'our', 'knowledge', 'about', 'the', 'different', 'types', 'or', 'profiles', 'of', 'contributors', 'from', 'casual', 'to', 'very', 'involved', 'ones', 'through', 'focused', 'people', 'however', 'they', 'do', 'so', 'by', 'using', 'very'... | [-0.055597566916569044, 0.06277638282276027, -0.0801114486510489, 0.08692279000517797, -0.13738548267498765, -0.13163119483185368, 0.086366977922982, 0.44031587743187606, -0.2161177897902384, -0.3975947889920375, 0.1096357550354011, -0.3237929218497537, -0.12141468614652395, 0.1929620949332985, -0.09067667034543948, 9.... |
1,803.09462 | A priori tests of a novel LES approach to compressible variable density
turbulence | We assess the viability of a recently proposed novel approach to LES for
compressible variable density flows by means of a priori tests. The a priori
tests have been carried out filtering a two-dimensional DNS database of the
classic lock-exchange benchmark. The tests confirm that additional terms should
be accounted... | physics.flu-dyn | we assess the viability of a recently proposed novel approach to les for compressible variable density flows by means of a priori tests the a priori tests have been carried out filtering a twodimensional dns database of the classic lockexchange benchmark the tests confirm that additional terms should be accounted for i... | [['we', 'assess', 'the', 'viability', 'of', 'a', 'recently', 'proposed', 'novel', 'approach', 'to', 'les', 'for', 'compressible', 'variable', 'density', 'flows', 'by', 'means', 'of', 'a', 'priori', 'tests', 'the', 'a', 'priori', 'tests', 'have', 'been', 'carried', 'out', 'filtering', 'a', 'twodimensional', 'dns', 'data... | [-0.08888690207592245, 0.00911941639397566, -0.10428470365203373, 0.08074817769392678, -0.0439100217346738, -0.10800358381906025, 0.016013602317288156, 0.31281718966074107, -0.20780402748482074, -0.34395044751070647, 0.14850534152001052, -0.21738592361486175, -0.10291975791134485, 0.22770605002325484, -0.03468921578988... |
1,803.09463 | Gaia: 3-dimensional census of the Milky Way Galaxy | Astrometry from space has unique advantages over ground-based observations:
the all-sky coverage, relatively stable, and temperature and gravity invariant
operating environment delivers precision, accuracy and sample volume several
orders of magnitude greater than ground-based results. Even more importantly,
absolute... | astro-ph.IM gr-qc physics.ed-ph | astrometry from space has unique advantages over groundbased observations the allsky coverage relatively stable and temperature and gravity invariant operating environment delivers precision accuracy and sample volume several orders of magnitude greater than groundbased results even more importantly absolute astrometry... | [['astrometry', 'from', 'space', 'has', 'unique', 'advantages', 'over', 'groundbased', 'observations', 'the', 'allsky', 'coverage', 'relatively', 'stable', 'and', 'temperature', 'and', 'gravity', 'invariant', 'operating', 'environment', 'delivers', 'precision', 'accuracy', 'and', 'sample', 'volume', 'several', 'orders'... | [-0.0787116451259427, 0.12982267959979626, -0.05450024931612884, 0.05986869569890804, -0.13123076269679793, -0.010929712359990242, 0.05846394635868114, 0.3862751271078875, -0.19092256713881564, -0.4219631592047886, 0.08740444384838297, -0.3567496607093219, 0.022586517770525436, 0.29425345395337527, -0.05921987362179748... |
1,803.09464 | Spectroscopy and spectropolarimetry of AGN: from observations to
modelling | Active galactic nuclei (AGN) are one of the most luminous objects in the
Universe, emitting powerful continuum and line emission across all wavelength
bands. They represent an important link in the investigations of the galaxy
evolution and cosmology. The resolving of the AGN inner structure is still a
difficult task... | astro-ph.GA | active galactic nuclei agn are one of the most luminous objects in the universe emitting powerful continuum and line emission across all wavelength bands they represent an important link in the investigations of the galaxy evolution and cosmology the resolving of the agn inner structure is still a difficult task with c... | [['active', 'galactic', 'nuclei', 'agn', 'are', 'one', 'of', 'the', 'most', 'luminous', 'objects', 'in', 'the', 'universe', 'emitting', 'powerful', 'continuum', 'and', 'line', 'emission', 'across', 'all', 'wavelength', 'bands', 'they', 'represent', 'an', 'important', 'link', 'in', 'the', 'investigations', 'of', 'the', ... | [-0.06872354357543847, 0.051373265669605206, -0.05214755029782005, 0.12446271677137069, -0.11389612840164615, -0.07573249176873462, 0.01360993911512196, 0.4424736731240283, -0.1748919736887531, -0.33058389611542227, 0.10744165105178305, -0.30005113062570277, -0.03224539430457694, 0.21719731283446891, -0.007244302022888... |
1,803.09465 | Formation of tidally induced bars in galactic flybys: prograde versus
retrograde encounters | Bars in disky galaxies can be formed by interactions with other systems,
including those of comparable mass. It has long been established that the
effect of such interactions on galaxy morphology depends strongly on the
orbital configuration, in particular the orientation of the intrinsic spin of
the galactic disk wi... | astro-ph.GA | bars in disky galaxies can be formed by interactions with other systems including those of comparable mass it has long been established that the effect of such interactions on galaxy morphology depends strongly on the orbital configuration in particular the orientation of the intrinsic spin of the galactic disk with re... | [['bars', 'in', 'disky', 'galaxies', 'can', 'be', 'formed', 'by', 'interactions', 'with', 'other', 'systems', 'including', 'those', 'of', 'comparable', 'mass', 'it', 'has', 'long', 'been', 'established', 'that', 'the', 'effect', 'of', 'such', 'interactions', 'on', 'galaxy', 'morphology', 'depends', 'strongly', 'on', 't... | [-0.16314612596622294, 0.1271060123267181, -0.08819413468087708, 0.0944402372678816, -0.10320978124525798, -0.04349346927170497, -0.017360841389745474, 0.41661104273451754, -0.17366974607696276, -0.33279251861798786, 0.01722752760058692, -0.2590648368511403, -0.07856342350819197, 0.20125185494845457, -0.022175761145647... |
1,803.09466 | Regularizing Deep Hashing Networks Using GAN Generated Fake Images | Recently, deep-networks-based hashing (deep hashing) has become a leading
approach for large-scale image retrieval. It aims to learn a compact bitwise
representation for images via deep networks, so that similar images are mapped
to nearby hash codes. Since a deep network model usually has a large number of
parameter... | cs.CV | recently deepnetworksbased hashing deep hashing has become a leading approach for largescale image retrieval it aims to learn a compact bitwise representation for images via deep networks so that similar images are mapped to nearby hash codes since a deep network model usually has a large number of parameters it may pr... | [['recently', 'deepnetworksbased', 'hashing', 'deep', 'hashing', 'has', 'become', 'a', 'leading', 'approach', 'for', 'largescale', 'image', 'retrieval', 'it', 'aims', 'to', 'learn', 'a', 'compact', 'bitwise', 'representation', 'for', 'images', 'via', 'deep', 'networks', 'so', 'that', 'similar', 'images', 'are', 'mapped... | [-0.03802699881265938, -0.02571719657338414, -0.11235260011482613, 0.11723670789197317, -0.09926950638745227, -0.2088487164969269, 0.02937247339797193, 0.4884955459075728, -0.2967935809335932, -0.33222468265015587, 0.061443054117814096, -0.2567397824152576, -0.21277890468713656, 0.1585809684312192, -0.15562795728038978... |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.