Datasets:
dataset_info:
features:
- name: seq
dtype: string
- name: label
dtype: float64
splits:
- name: train
num_bytes: 815082
num_examples: 1706
- name: test
num_bytes: 92795
num_examples: 190
download_size: 901099
dataset_size: 907877
configs:
- config_name: default
data_files:
- split: train
path: data/train-*
- split: test
path: data/test-*
license: apache-2.0
task_categories:
- text-classification
tags:
- biology
- chemistry
size_categories:
- 1K<n<10K
Dataset Card for Optimal Temperature Dataset
Dataset Summary
Grasping the catalytic activity of enzymes is pivotal for industrial enzyme design, particularly in predicting the optimal temperature for a given enzyme’s catalytic effect.
Dataset Structure
Data Instances
For each instance, there is a string representing the protein sequence and a float value indicating the optimal temperature for a given enzyme’s catalytic effect. See the optimal temperature dataset viewer to explore more examples.
{'seq':'MEHVIDNFDNIDKCLKCGKPIKVVKLKYIKKKIENIPNSHLINFKYCSKCKRENVIENL'
'label':60.5}
The average for the seq and the label are provided below:
| Feature | Mean Count |
|---|---|
| seq | 467 |
| label (0) | 50.0 |
Data Fields
seq: a string containing the protein sequencelabel: a float value indicating the optimal temperature for a given enzyme’s catalytic effect.
Data Splits
The Optimal Temperature dataset has 2 splits: train and test. Below are the statistics of the dataset.
| Dataset Split | Number of Instances in Split |
|---|---|
| Train | 1,706 |
| Test | 190 |
Source Data
Initial Data Collection and Normalization
The dataset utilized for this task is primarily procured by DeepET, a recent advancement in the field that uses deep learning techniques to understand enzyme thermal adaptation.
Licensing Information
The dataset is released under the Apache-2.0 License.
Citation
If you find our work useful, please consider citing the following paper:
@misc{chen2024xtrimopglm,
title={xTrimoPGLM: unified 100B-scale pre-trained transformer for deciphering the language of protein},
author={Chen, Bo and Cheng, Xingyi and Li, Pan and Geng, Yangli-ao and Gong, Jing and Li, Shen and Bei, Zhilei and Tan, Xu and Wang, Boyan and Zeng, Xin and others},
year={2024},
eprint={2401.06199},
archivePrefix={arXiv},
primaryClass={cs.CL},
note={arXiv preprint arXiv:2401.06199}
}