text
stringlengths
49
10.4k
source
dict
java, game public void paintOffscreen(Graphics g) { g.clearRect(0, 0, 900, 900); Point first = new Point(); Point last = listOfDots.get(0); g.setColor(Color.BLACK); Graphics2D g2 = (Graphics2D) g; g2.setRenderingHint(RenderingHints.KEY_ANTIALIASIN...
{ "domain": "codereview.stackexchange", "id": 19723, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, game", "url": null }
python, console, validation # if the user wants the delivery data, add it to the headers and the data to the list if parsed_arguments.delivered: headers.append('days') # convert the data to the /[YN]{7}/ format the user is used to delivery = [ ''.join([ ...
{ "domain": "codereview.stackexchange", "id": 43351, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "python, console, validation", "url": null }
quantum-state, state-discrimination Title: Is unambiguous discrimination between $|+\rangle,|0\rangle,|1\rangle$ possible? I have a quantum state that is either $|{+}\rangle$ or it is $|{0}\rangle$, $|{1}\rangle$. Is there a way to determine this with a single measurement? I am assuming not since $|{0}\rangle$, $|{1}\...
{ "domain": "quantumcomputing.stackexchange", "id": 5053, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "quantum-state, state-discrimination", "url": null }
Differential Equation Solver. 1 The Heat Equation The one dimensional heat equation. In 1965 Stejskal and Tanner published a landmark paper describing an MR spin-echo pulse sequence that allowed the detection of the diffusion term in the Bloch-Torrey equation to obtain an estimate for the diffusivity of spins in a samp...
{ "domain": "studiotamarapani.it", "id": null, "lm_label": "1. YES\n2. YES\n\n", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9873750525759486, "lm_q1q2_score": 0.8249356033961638, "lm_q2_score": 0.8354835391516133, "openwebmath_perplexity": 929.5599831264353, "openwebmath_score": 0.6053187251091003, ...
Specify Fit Options The cubic fit warns that the equation is badly conditioned, so you should try centering and scaling by specifying the `'Normalize'` option. Fit the cubic polynomial with both center and scale and robust fitting options. Robust `'on'` is a shortcut equivalent to `'Bisquare'` , the default method for...
{ "domain": "mathworks.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9875683498785867, "lm_q1q2_score": 0.8119679607662916, "lm_q2_score": 0.8221891283434877, "openwebmath_perplexity": 1040.4215170407265, "openwebmath_score": 0.7195776104927063, "tags":...
As pointed out in the comments, the condition that the curve passes through the point $$(0,0)$$ forces your original equation to have $$d=0$$ as $$ab^{c}\left(1-1\right)+d= 0 \implies d = 0$$ For simplicity, I'll denote $$ab^c = \xi$$ as some constant. With this in mind, your question then becomes solving the following...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9643214470715363, "lm_q1q2_score": 0.8035927816274416, "lm_q2_score": 0.8333245973817158, "openwebmath_perplexity": 107.40117000097243, "openwebmath_score": 0.911220371723175, "tag...
homework-and-exercises, harmonic-oscillator Also, $dA/dt$ isn't $v$ (because $dx/dt$ is $v$), it's zero: the amplitude is a constant. Using that you can get the equation of motion, but there's that same problem again: stating that $\ddot{x} = -\omega^2 x$ already assumes that $x$ is a simple harmonic motion. The way t...
{ "domain": "physics.stackexchange", "id": 21357, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "homework-and-exercises, harmonic-oscillator", "url": null }
8. Jan 29, 2013 ### cragar another way to map the rationals to the naturals is take the positive rationals of the form $\frac{p}{q}$ and map them to $2^p3^q$ and then map the negative rationals to $5^{|-p|}7^{|-q|}$ and then map zero to some other prime. In fact we are mapping all the rationals to a proper subset of ...
{ "domain": "physicsforums.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9838471680195556, "lm_q1q2_score": 0.8530306836135616, "lm_q2_score": 0.8670357666736773, "openwebmath_perplexity": 497.6416355372947, "openwebmath_score": 0.767212986946106, "tags...
thermodynamics, experimental-chemistry, coordination-compounds Decomposition of $\ce{3 H2O}$ and $\ce{2 CO(NH2)2}$: $\ce{[Cr(CO(NH2)2)6]Cl3 $\cdot$ 3 H2O -> [Cr(CO(NH2)2)4]Cl3 + 3 H2O \uparrow + 2 CO(NH2)2 \uparrow}$ Decomposition of $\ce{2 CO(NH2)2}$ and $\ce{2 HCl}$: $\ce{[Cr(CO(NH2)2)4]Cl3 -> CrH6C2N4ClO2 + 2 CO(NH...
{ "domain": "chemistry.stackexchange", "id": 3053, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "thermodynamics, experimental-chemistry, coordination-compounds", "url": null }
black-holes, hawking-radiation, qft-in-curved-spacetime, unruh-effect The second mass is less than the first, so if a whole range of black holes had been created at the beginning of the universe, the upshot is that some would be popping right now! Astronomers are on the lookout for these events.
{ "domain": "physics.stackexchange", "id": 26468, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "black-holes, hawking-radiation, qft-in-curved-spacetime, unruh-effect", "url": n...
homework-and-exercises, pressure, unit-conversion Restricting our attention to the pressure and height differences only, it's clear that $h=1$ millimetre of mercury corresponds to the pressure difference: $$ \delta P = h \rho g = 0.001 \,{\rm m} \times 13,595.1\, {\rm kg}/{\rm m}^3 \times 9.80665\,{\rm m}/{\rm sec}^2...
{ "domain": "physics.stackexchange", "id": 814, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "homework-and-exercises, pressure, unit-conversion", "url": null }
complexity-theory, np-complete, reductions Now, all that we need is to make sure that our solution which appear in the uppermost row is feasible. It means that for each $i_{row}$, if we "beam" from its position (in the first column) to the right, we will meet $i_{col}$ exactly once (in fact, we only need to assure at ...
{ "domain": "cs.stackexchange", "id": 12477, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "complexity-theory, np-complete, reductions", "url": null }
double-slit-experiment, interference So you will note that the slit widths control the modulation of the intensity of the double slit interference pattern. The slit separation controls the separation of the interference fringes. As the slit separation has not been changes the separation of the interference fringes sta...
{ "domain": "physics.stackexchange", "id": 46208, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "double-slit-experiment, interference", "url": null }
star Title: What supernova has created the iron currently found in Earth core? Iron is generated by stars in a certain part of their life cycle. Earth contains a lot of iron inside, however it is clear that this iron could have not been generated in a star in close proximity. If we consider the current Earth position ...
{ "domain": "astronomy.stackexchange", "id": 896, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "star", "url": null }
c++, floating-point Title: Checking if two floating point numbers are equal Is this the best way to check if two floating point numbers are equal, or close to being equal? template <class T> bool IsEqual(T rhs, T lhs) { T diff = std::abs(lhs - rhs); T epsilon = std::numeric_limits<T>::epsilon( ) * std::max(st...
{ "domain": "codereview.stackexchange", "id": 2673, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "c++, floating-point", "url": null }
ros, kinect, husky, a200 core service [/rosout] found process[clearpath/robots/default/husky/clearpath_base-1]: started with pid [3430] process[clearpath/robots/default/openni_node1-2]: started with pid [3431] process[clearpath/robots/default/kinect_base_link-3]: started with pid [3434] process[clearpath/robots/defaul...
{ "domain": "robotics.stackexchange", "id": 8649, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "ros, kinect, husky, a200", "url": null }
python, proteins, sequence-analysis, motifs, multi-fasta >Sequence1 MAEVRKFTKRLSKPGTAAELRQSVSEAVRGSVVLEKAKLVEPLDYENVITQRKTQIYSDP LRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQSLFVKECIKTYSTDWHVVNYKYE DFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKDEDSSSLCSQKGGVIKQGWLHKANVNST ITVTMKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKGCIYLDACIDVVQCPKMRRHAF ELKMLDK...
{ "domain": "bioinformatics.stackexchange", "id": 2356, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "python, proteins, sequence-analysis, motifs, multi-fasta", "url": null }
Adding, Multiplying, and Dividing Power Series Miscellaneous Useful Facts Applications of Taylor Polynomials Taylor Polynomials When Functions Are Equal to Their Taylor Series When a Function Does Not Equal Its Taylor Series Other Uses of Taylor Polynomials (f)Note: The general formula for a cubic approximation centere...
{ "domain": "immoplus24.de", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.988841966778967, "lm_q1q2_score": 0.8385061097586799, "lm_q2_score": 0.8479677622198946, "openwebmath_perplexity": 649.3671631794019, "openwebmath_score": 0.8625760078430176, "tags": n...
electricity Title: Why does my wife's skin buzz when she's using her laptop? When my wife uses her laptop, if I touch her skin, I can feel a buzz. She doesn't feel the buzz, but she can hear it if I touch her ear. So I'm guessing it's a faulty laptop, and she's conducting an electrical current. But why would she not ...
{ "domain": "physics.stackexchange", "id": 1909, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "electricity", "url": null }
python, hash-map, collections {0: {0: {'bottom pad': 0.4563182938806024, 'left pad': 0.7109389987303294, 'right pad': 0.04972926343584316, 'top pad': 0.49018200203439044}, 1: {'bottom pad': 0.9197368747212471, 'left pad': 0.49675239597387033, 'right pad': 0.88467348388...
{ "domain": "codereview.stackexchange", "id": 40368, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "python, hash-map, collections", "url": null }
graphs Title: Why scholarly papers focus on DAGs instead of DCGs (Directed Cyclic Graphs) In trying to understand how to convert DCG's (Directed Cyclic Graphs) to DAG's (Directed Acyclic Graphs) without removing all the edges, I came across this paper which says: Since the problem involves DCG, therefore a new algori...
{ "domain": "cs.stackexchange", "id": 11177, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "graphs", "url": null }
knapsack problem (FKP) You rob a store: find. Knapsack of capacity W. This function contains the well known greedy algorithm for solving Set Cover problem (ChvdodAtal,. In this paper, we propose a new greedy-like heuristic method,. 1 Knapsack Problems and its Variants 1 1. greedy choice more efficiently C fewer alterna...
{ "domain": "alexborsci.it", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9744347853343058, "lm_q1q2_score": 0.8243157354115724, "lm_q2_score": 0.8459424353665381, "openwebmath_perplexity": 704.8932837987658, "openwebmath_score": 0.5109421610832214, "tags": ...
x-ray-crystallography Title: Why is amplitude of x-rays scattered by crystal is less than the amplitude of rays incident on crystal? Why is amplitude of scattered rays less than the amplitude of rays incident on crystal? Also what will be the situation in case of free electrons? The amplitude of an x-ray is equivalen...
{ "domain": "physics.stackexchange", "id": 40281, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "x-ray-crystallography", "url": null }
The given problem is sufficiently simple that, once a mathematical statement has been given, there is a clear solution. Hence if different people obtain different answers, it is because they converted the problem into different mathematical statements. Your example of a sealed envelope has converted the original real-...
{ "domain": "wordpress.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.985496419030704, "lm_q1q2_score": 0.8057167185797394, "lm_q2_score": 0.8175744761936437, "openwebmath_perplexity": 520.8433932804764, "openwebmath_score": 0.5667750239372253, "tags": n...
openni, nodelet, openni-camera Title: nodelet doesn't start Hi all, I try to implement a nodelet, which should be used for extracting (SIFT-)features. The data should come from a kinect camera (Openni and our features/descriptor extractor should run in one process). I used the tutorial from http://www.ros.org/wiki/no...
{ "domain": "robotics.stackexchange", "id": 5678, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "openni, nodelet, openni-camera", "url": null }
quantum-mechanics, atomic-physics, spectroscopy, hydrogen, orbitals Title: Is the atomic shell model valid considering electron-electron interaction? In atomic physics the shell model is motivated by starting looking at the H-atom. Solving Schrödinger's equation leads to atom orbitals labled by quantum numbers n,l,m. ...
{ "domain": "physics.stackexchange", "id": 80691, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "quantum-mechanics, atomic-physics, spectroscopy, hydrogen, orbitals", "url": nul...
optics, polarization Title: Compact Disc Optics - Why use a linear polariser and a quarter wave plate? I just came across this website about the application of a quarter wave plate. Link: Compact Disc Optics. My question is why does the beam need to be linearly and then circularly polarised before sending to the comp...
{ "domain": "physics.stackexchange", "id": 20838, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "optics, polarization", "url": null }
quantum-field-theory, hilbert-space, scattering, vacuum, s-matrix-theory \end{align} the inner product $\langle f|i\rangle$ of which is said to be the corresponding $S$-matrix element (Srednicki, Schwartz, et al.). However, $\langle f|i\rangle$ is merely an inner product of products of single-particle states. How can ...
{ "domain": "physics.stackexchange", "id": 96695, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "quantum-field-theory, hilbert-space, scattering, vacuum, s-matrix-theory", "url"...
state-tomography, quantum-process-tomography, linear-algebra Cross-posted on physics.SE Yes, I think you have the correct idea. I'll just add some additional details. As you suggest, "non-trace-preserving" means that the map of interest is applied with some probability which (in general) depends on the input state. Fu...
{ "domain": "quantumcomputing.stackexchange", "id": 3850, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "state-tomography, quantum-process-tomography, linear-algebra", "url": nu...
Shanonhaliwell April 8th, 2018 03:31 PM Quote: Originally Posted by romsek (Post 591335) outstanding, you seem to be getting the hang of things. Thanks to you, I was able to do it. All times are GMT -8. The time now is 12:30 AM.
{ "domain": "mymathforum.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9728307668889047, "lm_q1q2_score": 0.8042506686218754, "lm_q2_score": 0.8267117940706734, "openwebmath_perplexity": 357.71231871719743, "openwebmath_score": 0.7822871208190918, "tags...
robotic-arm, industrial-robot, manipulator, robot-model Now the dynamics of any two-link manipulator irrespective of the link shape is $$ \tau = H(q)\ddot q + C(q,\dot q)\dot q + G(q) $$ $$ \begin{bmatrix} \tau_1 \\ \tau_2 \\ \end{bmatrix} = \begin{bmatrix} I_1 + I_2 + m_2l_1^2 + 2m_2l_1l_{c...
{ "domain": "robotics.stackexchange", "id": 2050, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "robotic-arm, industrial-robot, manipulator, robot-model", "url": null }
fft, spectrogram, stft, radar, doppler As for microdoppler on pulse Doppler radars , I have yet to actually see that be used in the industry I work in (defense), and that community largely treats it as computationally inefficient. With that being said, let’s say you have all the computation time in the world and you c...
{ "domain": "dsp.stackexchange", "id": 7252, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "fft, spectrogram, stft, radar, doppler", "url": null }
# Difference between revisions of "2006 AIME I Problems/Problem 10" ## Problem Eight circles of diameter 1 are packed in the first quadrant of the coordinate plane as shown. Let region $\mathcal{R}$ be the union of the eight circular regions. Line $l,$ with slope 3, divides $\mathcal{R}$ into two regions of equal are...
{ "domain": "artofproblemsolving.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9863631635159684, "lm_q1q2_score": 0.8604513145357217, "lm_q2_score": 0.8723473730188542, "openwebmath_perplexity": 705.5428297619834, "openwebmath_score": 0.7458829283714294, ...
java, game, swing, number-guessing-game Try to find repeated parts of code, and think about how you can pull those out to a reusable method. Keep your code DRY. Some pro-level tips and style-oriented things: I usually like to make Swing components as self-contained as possible (see examples below). Therefore, for any...
{ "domain": "codereview.stackexchange", "id": 4643, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, game, swing, number-guessing-game", "url": null }
lagrangian-formalism, string-theory, harmonic-oscillator, variational-principle, action Title: Motivation behind action when deriving ''Strings as Harmonic oscillators" in Zwiebach's book on String theory Page 248 gives us this action and he simply says that we will assume it correct. $$ S=\int d \tau d \sigma ~\mathc...
{ "domain": "physics.stackexchange", "id": 58851, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "lagrangian-formalism, string-theory, harmonic-oscillator, variational-principle, a...
c#, .net, server, polymorphism, client public SearchItemTextMV(DocPropDef docPropDef, SearchOpUIE searchOpUIE) : base(docPropDef, searchOpUIE, 0, 0) { } public SearchItemTextMV(DocPropDef docPropDef, SearchOpUIE searchOpUIE, HashSet<String> values, byte parenLft, byte parenRht, SearchOpMV ...
{ "domain": "codereview.stackexchange", "id": 26800, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "c#, .net, server, polymorphism, client", "url": null }
There are $50\,000\,000$ tickets. Of these $5\,000\,000$ are winning ones and $45\,000\,000$ are losing ones. We seek $$\Pr(\text{we win}) \geq 1/2 \>,$$ or, equivalently, $$\Pr(\text{we lose}) \leq 1/2 .$$ The probability that we lose is simply the probability that we hold none of the winning tickets. Let $k$ be t...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9859363758493942, "lm_q1q2_score": 0.8494218528519618, "lm_q2_score": 0.86153820232079, "openwebmath_perplexity": 158.2518804641122, "openwebmath_score": 0.8713272213935852, "tags"...
optics, geometric-optics, lenses Title: First and second focus of a convex lens Referring to this, I have a confusion whether the first focus is always left of a convex lens? Can it not be on the right? The definition of first focus is : “that point on the principal axis of the lens at which if an object is placed, th...
{ "domain": "physics.stackexchange", "id": 78841, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "optics, geometric-optics, lenses", "url": null }
is the currently selected item. Really cool! Home » Real Function Calculators » Summation (Sigma, ∑) Notation Calculator. Video transcript. a 'ul' or 'UL' to force the constant into an unsigned long constant. As the value of n increases so those the value of a. A standard function notation is one representation that fa...
{ "domain": "doosan.bg", "id": null, "lm_label": "1. YES\n2. YES\n\n", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9353465152482724, "lm_q1q2_score": 0.8268830643813618, "lm_q2_score": 0.8840392848011833, "openwebmath_perplexity": 641.6103400619602, "openwebmath_score": 0.8427238464355469, "tags": ...
electromagnetism, electric-circuits, inductance, lenz-law I found this question, which is essentially the same as mine. The user Farcher explained in his answer how to obtain the direction of $i_\text{ind}$ (such that its numerical value would be positive). They assumed an increasing (and positive) increasing current ...
{ "domain": "physics.stackexchange", "id": 84533, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "electromagnetism, electric-circuits, inductance, lenz-law", "url": null }
## Newton-Raphson method calculator in Python code As an illustration, we will create a simple Python routine that acts as a Newton-Raphson calculator for the square root of any positive value. For square roots, calculating the square root of 2 every time isn't very useful. We would like to calculate the square root ...
{ "domain": "graphicmaths.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9879462183543601, "lm_q1q2_score": 0.8054058549349196, "lm_q2_score": 0.815232489352, "openwebmath_perplexity": 289.30101502555533, "openwebmath_score": 0.7853467464447021, "tags": ...
The question is under-specified in that the constraints on the frequencies \begin{align}n_1+2n_2+3n_3+4n_4&=100M\\n_1+n_2+n_3+n_4&=100\end{align} do not determine a distribution: "random" is not associated with a particular distribution, unless the OP means "uniform". For instance, if there exists one solution $$(n_1^0...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9658995713428387, "lm_q1q2_score": 0.8507615170365108, "lm_q2_score": 0.8807970748488297, "openwebmath_perplexity": 438.7224639689237, "openwebmath_score": 0.7439496517181396, "tag...
$\Rightarrow\ 1\cdot3\cdot5\cdots(2n-1)\sqrt{2n+1}\ <\ 2\cdot4\cdot6\cdots2n$ $\Rightarrow\ \frac{1\cdot3\cdot5\cdots(2n-1)}{2\cdot4\cdot6\cdots2n}\ <\ \frac{1}{\sqrt{2n+1}}$ 6. Thks Jane,this is what i look for.i saw the solution for the problem into the book,and they solve it complicated,frankly i didnt understand ...
{ "domain": "mathhelpforum.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9843363503693294, "lm_q1q2_score": 0.8159546054223569, "lm_q2_score": 0.8289388125473629, "openwebmath_perplexity": 1519.2778529844607, "openwebmath_score": 0.9104247689247131, "ta...
textbook-and-exercises, quantum-operation with associated Kraus operators $$A_1 = \sqrt{\frac{1+3p}{4}} \,I, \qquad A_2 = \sqrt{\frac{1-p}{4}} \, Z, \qquad A_3 = \sqrt{\frac{1-p}{2}} E_{01}, \qquad A_4 = \sqrt{\frac{1-p}{2}} E_{10},$$ where $E_{ij}\equiv |i\rangle\!\langle j|$, and $Z\equiv E_{00}-E_{11}$. We conclude...
{ "domain": "quantumcomputing.stackexchange", "id": 3600, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "textbook-and-exercises, quantum-operation", "url": null }
java, compression, canvas, javafx, video return longs + (remainder != 0 ? 1 : 0); } /** * Doubles the capacity of the actual bit array. * * @param requestedCapacity the requested capacity. */ private void expandTableIfNeeded(int requestedCapacity) { if (requestedCapacity >...
{ "domain": "codereview.stackexchange", "id": 44932, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, compression, canvas, javafx, video", "url": null }
javascript, jquery, html5 $('#golegenda , #goias').click(function() { if ($(go, go1).is(":visible")) { $(go).slideUp( "slow" ); $(go1).hide(); }else{ esconder(); $(go).slideDown( "slow" ); $(go1).show(); } }); $('#malegenda , #maranhao').click(function() { if ($...
{ "domain": "codereview.stackexchange", "id": 12991, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "javascript, jquery, html5", "url": null }
python, algorithm, object-oriented, game, array compWaitList = [[]] # Coords the computer has tried compShotList = [] compSunkShips = [] compPreviousHits = [] # While there are ships on both side while grids[0].isDefeated(1) == False and grids[1].isDefeated(0) == Fals...
{ "domain": "codereview.stackexchange", "id": 23334, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "python, algorithm, object-oriented, game, array", "url": null }
quantum-mechanics, mathematical-physics, path-integral, probability, propagator on the lhs. of OP's original first eq. (1) is independent of the midpoint $x_m$. Hence the integral over $x_m$ (i.e. lhs. of OP's first eq. (1)) becomes infinite $$\begin{align} \int_{\mathbb{R}}\!\mathrm{d}x_f ~ |K(x_f,t_f;x_i,t_i)|^2~=~&...
{ "domain": "physics.stackexchange", "id": 9660, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "quantum-mechanics, mathematical-physics, path-integral, probability, propagator", ...
electromagnetism Title: Crossed fields : Finding the charge to mass ratio So, we are discussing the crossed field (JJ Thompson's) experiment in which the $q/m$ ratio of charged particles were produced. Deflection due to the electric field is given by- $$y=\frac{qEL^2}{2mv^2}$$ Now, if we adjust the $\vec E$ and $\vec...
{ "domain": "physics.stackexchange", "id": 50666, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "electromagnetism", "url": null }
By one approach I've read, $$\text{characteristic equation:}\quad z-0.4=0 \quad\therefore y_n[n]=A(0.4)^n \\ \\ y_f[n]=B(0.25)^n \quad\text{substitute back into diffeq:}\\ B(0.25)^n -0.4B(0.25)^{n-1}=B(0.25)^n - \frac{0.4}{0.25}B(0.25)^n= 4(0.25)^nu[n]\\ \therefore B=-\frac{20}{3}, \quad y_f[n]=-\frac{20}{3}(0.25)^nu[n...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9843363512883317, "lm_q1q2_score": 0.8552177671224374, "lm_q2_score": 0.8688267643505193, "openwebmath_perplexity": 456.6080097815554, "openwebmath_score": 0.9442422389984131, "tag...
discrete-signals, analog-to-digital, digital, digital-to-analog, pid Title: Sampling Precision, Jitter, and PID I am having difficulty understanding the effect of quantization noise and ADC resolution in a digital PID controller. I am also trying to understand the effects of sampling jitter on a PID controller. Can an...
{ "domain": "dsp.stackexchange", "id": 11386, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "discrete-signals, analog-to-digital, digital, digital-to-analog, pid", "url": null }
python, scipy Title: find out ideal window size for coherence analysis - python Is there a general formula I could use to calculate the ideal window for the window argument in the function scipy.signal.coherence, maybe taking into account sampling rate and number of time points? For example, if I acquired data at a sa...
{ "domain": "dsp.stackexchange", "id": 11729, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "python, scipy", "url": null }
python, pandas, preprocessing, numpy Title: Count the max number of consecutive 1 and 0 in Pandas Dataframe Hey I have the following Dataset import pandas as pd df = pd.DataFrame({ 'column1': [0,0,1,0,1,0,0,1,1,0,1,1,1]}) I want to be able to count the number of consecutive 1 and 0 and generate 2 columns as such:...
{ "domain": "datascience.stackexchange", "id": 7893, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "python, pandas, preprocessing, numpy", "url": null }
Until a few days ago, I would have never thought we could use the Frobenius Theorem to do this. Suppose ${f}$ were such a solution. Define the vector fields ${\displaystyle X=\frac{\partial}{\partial x}-y\frac{\partial}{\partial z}}$ and ${\displaystyle Y=\frac{\partial}{\partial y}+x\frac{\partial}{\partial z}}$ and d...
{ "domain": "wordpress.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9783846678676151, "lm_q1q2_score": 0.842915773150305, "lm_q2_score": 0.8615382076534743, "openwebmath_perplexity": 120.88430050501222, "openwebmath_score": 0.9643252491950989, "tags": ...
It is just as easy to solve it for any multiple of $48$ with undetermined $100\,$'s digit $\rm\:\color{#C00}j.$ Lemma $\rm\ 48\:|\:10^4 i + 100 \color{#C00}{\ j} + k\iff 4\:|\:k\$ and $\rm\: j \equiv -4i-k/4\pmod{12}$ Proof $\rm\ mod\ 16\!:\ 10^4i+100\ j+k\equiv 4j+k,\:$ so $\rm\:16\:|\:4j+k\iff\ 4\:|\:k,\:\ j\equiv ...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9724147201714923, "lm_q1q2_score": 0.8186036454170181, "lm_q2_score": 0.8418256412990658, "openwebmath_perplexity": 353.9851138993675, "openwebmath_score": 0.8749521970748901, "tag...
# Real Roots and Differentiation Prove that the equation $$x^5 − 1102x^4 − 2015x = 0$$ has at least three real roots. So do I sub in values of negative and positive values of $$x$$ to show that there are at least three real roots? The method to do this question is not by finding the factors of $$x$$ right? Because it...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9850429138459387, "lm_q1q2_score": 0.8592995933007344, "lm_q2_score": 0.872347368040789, "openwebmath_perplexity": 220.8351326150598, "openwebmath_score": 0.878202497959137, "tags"...
java, beginner, object-oriented, design-patterns public Login(StorageInstance si) { this.storage = si.getStorage(); this.reader = new Scanner(System.in); } public void logIn() { System.out.println("Username:"); this.username = reader.nextLine(); System.out.println("Pass...
{ "domain": "codereview.stackexchange", "id": 41961, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, beginner, object-oriented, design-patterns", "url": null }
neuroscience, brain, neuroanatomy, neurology Title: Why do humans alone have the capability to have religious/spiritual experiences? What is it in our brain that makes having such experiences possible? I assume other species don't have these. Sure there are instances in the natural world where you can see individuals ...
{ "domain": "biology.stackexchange", "id": 783, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "neuroscience, brain, neuroanatomy, neurology", "url": null }
qiskit, programming, quantum-algorithms, state-tomography, shadow-tomography which outputs: State distance (0.06070337717129093+0j) verify 2-local expecations converge (0, 0) 0.0 (0, 1) 0.045599999999999995 (0, 2) 0.0108 (0, 3) 0.008400000000000074 (1, 0) 0.009000000000000003 (1, 1) 0.03160000000000007 (1, 2) 0.037799...
{ "domain": "quantumcomputing.stackexchange", "id": 3145, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "qiskit, programming, quantum-algorithms, state-tomography, shadow-tomograp...
c# Title: Organizing interfaces for player movement in chess game I'm trying to figure out how to organize interfaces in my game to make future development easier, by making my code more modular. Notice that my Rook class implements the IPlayer interface, which will move it left and right, but not up and down (I had ...
{ "domain": "codereview.stackexchange", "id": 16583, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "c#", "url": null }
ros, c++, image, msg Title: Could rostopic pub the vector keypointsSelection type? Hallo, experts, i have a question about rostopic pub: i do something imageprocessing, than calculate the key-points of a image, and i want to use rostopic pub the vector KeypointsSelection , that has been detected. but how could i my...
{ "domain": "robotics.stackexchange", "id": 12557, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "ros, c++, image, msg", "url": null }
javascript, algorithm, programming-challenge, functional-programming, ecmascript-6 lst.forEach((v, i) => { visitors = v.type === "enter" ? visitors + v.count : visitors - v.count; if (visitors > busiestPeriod.maxVisitors) { busiestPeriod.maxVisitors = visitors; busiestPeriod.start = v....
{ "domain": "codereview.stackexchange", "id": 34196, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "javascript, algorithm, programming-challenge, functional-programming, ecmascrip...
javascript, css, validation 300000^4 = 8.1 * 10^21 And that does not take into account possible misspellings, if the words start uppercase, lowercase or mixed and different languages. Make the users favor passphrases and long, easier to remember passwords then complicated short ones. Sell it as a feature! This will m...
{ "domain": "codereview.stackexchange", "id": 5987, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "javascript, css, validation", "url": null }
java, performance, multithreading, thread-safety String response = testClient.executeSync(keys); I'm just trying to understand whether my above code will be thread-safe or not, as they can pass multiple values to my TestingClient class from multiple threads. I have a feeling that my ClientKey class is not thread-safe...
{ "domain": "codereview.stackexchange", "id": 5808, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, performance, multithreading, thread-safety", "url": null }
# Computing $\mathbf A^{-1/2}$, where $\mathbf A$ is a Diagonal Matrix. I have the following matrix : $$\mathbf A =\begin{bmatrix} 100 & 0 \\ 0 & 1 \\ \end{bmatrix}$$ I have to compute $\mathbf A^{-1/2}$. So I need spectral decomposition, $$\mathbf A = \mathbf P \mathbf \Lambda\mathbf P',$$ $\mathbf P$ be a matrix...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.975576910655981, "lm_q1q2_score": 0.8386681024177983, "lm_q2_score": 0.8596637469145054, "openwebmath_perplexity": 336.1606057584107, "openwebmath_score": 0.950474202632904, "tags"...
java, strings, regex Title: Listing words from text, provide lines where appears, count them I applied for Junior Java Developer in some company. Got a task:"Listing words (without duplicates) from text, provide lines where appears, count them." Output should looks like: Alphacoronavirus - 3 - pozycje -> [1,3,2] gatun...
{ "domain": "codereview.stackexchange", "id": 38405, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, strings, regex", "url": null }
general-relativity, lagrangian-formalism, differential-geometry, metric-tensor, curvature In the nearly flat spacetime ($g_{\mu\nu}=\eta_{\mu\nu}+h_{\mu\nu}$) and slow particle ($d\gamma^0/d\tau$ dominates over the spatial components) we get $$ \frac{d^2\gamma^\mu}{d\tau^2}=-\Gamma^\mu_{00}\left(\frac{d\gamma^0}{d\tau...
{ "domain": "physics.stackexchange", "id": 64563, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "general-relativity, lagrangian-formalism, differential-geometry, metric-tensor, cu...
java, strings } return sentence.toString().replaceFirst(" ", ""); } As I said, this works quite good, but not perfect. I suggest you try my method with copy/paste and see it on your own. Do you have ANY ideas or a better solution for my problem? Examples: For example, as I just tried some texts out I noticed t...
{ "domain": "codereview.stackexchange", "id": 1664, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, strings", "url": null }
can control adserving and the information collected. V 1! To give the direction of R we find the angle q that R makes with B. Tan q = (A Sin p)/ (B + A Cos q) A vector is completely defined only if both magnitude and direction are given. In vector addition, the intermediate letters must be the same. Ans. From triangle ...
{ "domain": "ac.th", "id": null, "lm_label": "1. YES\n2. YES\n\n", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9835969698879861, "lm_q1q2_score": 0.8436981125111277, "lm_q2_score": 0.857768108626046, "openwebmath_perplexity": 890.8260234692011, "openwebmath_score": 0.5266100764274597, "tags": null,...
energy, waves, power Title: Power Transmitted along the string by a sine wave I have referred several sources which derived the equation for the power transmitted along a string by a sine wave. However, I could not find anywhere what exactly is it? "Along a string" makes me think that energy is transmitted from one ...
{ "domain": "physics.stackexchange", "id": 68361, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "energy, waves, power", "url": null }
quantum-mechanics, wavefunction, schroedinger-equation, probability, normalization Title: Probability of non-normalizable states In the book Quantum Field Theory by Jakob Schwichtenberg, he is discussing about non-normalizable states in chapter 8. If you compute the normalization in $(8.67)$ you just get infinity. He ...
{ "domain": "physics.stackexchange", "id": 85087, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "quantum-mechanics, wavefunction, schroedinger-equation, probability, normalization...
the-sun, orbit, earth, magnetic-field, thermodynamics Title: Does the sun have cycles causing temperature changes on Earth? Can the Sun go through seasons or cycles to cause a temperature change? Could the Sun have to go through any kind of thermal cycle to change the climate on Earth and by how much? The Sun's magne...
{ "domain": "astronomy.stackexchange", "id": 6480, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "the-sun, orbit, earth, magnetic-field, thermodynamics", "url": null }
arithmetic modulo $$n$$, where $$n$$ is a positive integer. Show that any integer of the form $6k+5$ is also of the form $3 k+2,$ but not conversely. Show that the sum of two even or two odd integers is even and also show that the sum of an odd and an even is odd. (d) If ajb and bjc, then ajc. The Division Algorithm. T...
{ "domain": "com.au", "id": null, "lm_label": "1. YES\n2. YES\n\n", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9850429116504951, "lm_q1q2_score": 0.8143465969327848, "lm_q2_score": 0.8267117983401363, "openwebmath_perplexity": 369.0676248974898, "openwebmath_score": 0.8721988201141357, "tags": nul...
ros, catkin-make, catkin, ros-hydro, update Title: Since updating ROS a few hours ago, ROS/catkin is broken Hi all, A couple of hours ago, I updated my system (sudo apt-get update; sudo apt-get upgrade). Updates included a lot of Hydro updates as well. However since then, catkin_make always ends in an error. I tried:...
{ "domain": "robotics.stackexchange", "id": 18361, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "ros, catkin-make, catkin, ros-hydro, update", "url": null }
$$\cos (\omega t + \dfrac\pi4)= \cos \left(\omega t + \dfrac\pi4\right)$$ QED - Try to replicate your solution with expression like $3\cos x + 2 \sin x$. What's it equal to? – Kaster Jul 16 '13 at 20:49 I used that sum of same angle because the two have the same coefficients, w/c is $\frac{\sqrt2}2$. With expression ...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9865717440735736, "lm_q1q2_score": 0.8284578030657415, "lm_q2_score": 0.8397339656668286, "openwebmath_perplexity": 214.16966621108094, "openwebmath_score": 0.9468189477920532, "ta...
• This is the type where we can get an exact answer. If we recast it in the mechanics that we have been talking about these past few days the transform of the relevant sum is $$\Gamma(s)(s-1/4)\zeta(2s).$$ The Mellin integral is on the line $\Re(s)=1$, we shift to $\Re(s)=1/4$ where the integrand vanishes, picking up t...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9820137858267906, "lm_q1q2_score": 0.8307271354528768, "lm_q2_score": 0.8459424373085146, "openwebmath_perplexity": 228.92563480401057, "openwebmath_score": 0.9885562062263489, "ta...
navigation, ekf, odometry, pose, robot-localization Title: robot_localization wrong output I am trying to use an ekf_localization_node to fuse two sensors, odometry and pose, with the package robot_localization, in two dimensions. However, the output (published in the topic /odometry/filtered) seems to be wrong, sinc...
{ "domain": "robotics.stackexchange", "id": 27478, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "navigation, ekf, odometry, pose, robot-localization", "url": null }
c++, object-oriented, generics, stream, median ==2921039== by 0x10C929: std::_Vector_base<int, std::allocator<int> >::_M_allocate(unsigned long) (stl_vector.h:346) ==2921039== by 0x10C5AF: void std::vector<int, std::allocator<int> >::_M_realloc_insert<int const&>(__gnu_cxx::__normal_iterator<int*, std::vector<in...
{ "domain": "codereview.stackexchange", "id": 42337, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "c++, object-oriented, generics, stream, median", "url": null }
java, sorting Title: Bubble Sort with tests I've become a bit rusty in Java. This is an attempt at brushing up my skills. Bubble sort, sometimes referred to as sinking sort, is a simple sorting algorithm that repeatedly steps through the list, compares adjacent elements and swaps them if they are in the wrong order. ...
{ "domain": "codereview.stackexchange", "id": 36800, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "java, sorting", "url": null }
# Pigeonhole Technical Problem Problem (from Putnam and Beyond pg. 11) is: Given a set $M$ of 1985 distinct positive integers, none of which has a prime divisor greater than $26$, prove that $M$ contains at least one subset of four distinct elements whose product is the fourth power of an integer. Solution is: We s...
{ "domain": "stackexchange.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9763105259435195, "lm_q1q2_score": 0.8027119024449304, "lm_q2_score": 0.8221891305219504, "openwebmath_perplexity": 166.32106821096997, "openwebmath_score": 0.7827143669128418, "ta...
electromagnetism, gauge-theory, gauge-invariance, gauge Title: In simple words, why does a Lorenz Gauge does not have any physical effects? I'm studying vector calculus via Arfken & Weber's "Mathematical Methods for Physicists", and, in page 40, he is deriving the electromagnetic wave equation. During the demonstratio...
{ "domain": "physics.stackexchange", "id": 43363, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "electromagnetism, gauge-theory, gauge-invariance, gauge", "url": null }
ros, ros2, c++, callback Thanks ! Originally posted by jlepers on ROS Answers with karma: 39 on 2020-05-12 Post score: 1 Without checking or too much experience in ros2: your rclcpp::spin(node) is only after the while loop. So your node is not added to an executor and callbacks won't be executed. In ROS 2 there is r...
{ "domain": "robotics.stackexchange", "id": 34944, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "ros, ros2, c++, callback", "url": null }
function in, Solution:In this example, H(s) has a pair of complex poles at s2 + 8s + 25 = 0 or s = −4 ± j3. But A = 2, C = −10, so that Equation. Therefore, there is an inverse transform on the very range of transform. Hence. To compute the direct Laplace transform, use laplace. This section is the table of Laplace Tra...
{ "domain": "wolfpacknyc.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9572778000158575, "lm_q1q2_score": 0.8383714508542798, "lm_q2_score": 0.8757869981319863, "openwebmath_perplexity": 11396.313708180473, "openwebmath_score": 0.7313063144683838, "tags...
php, authentication if ($stmt4->execute()) { $row5 = $stmt4->fetch(PDO::FETCH_ASSOC); $returnApp = array( 'LOGIN' => 'Log_In_Success', 'user' =>$row2['user_type'], 'CL' =>$row5['CLASS'], 'DEP' => $row5['DEPARTMENT'], 'HD' => $row5['H...
{ "domain": "codereview.stackexchange", "id": 42907, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "php, authentication", "url": null }
estimation, cross-correlation, wave, array-signal-processing, attenuation Title: Estimation of the attenuation of two waves on a linear sensor array Context and objective I am trying to estimate the attenuation coefficients ($\alpha_u$ and $\alpha_v$) of two waves ($\overrightarrow{u}$ and $\overrightarrow{v}$). These...
{ "domain": "dsp.stackexchange", "id": 11312, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "estimation, cross-correlation, wave, array-signal-processing, attenuation", "url": n...
newtonian-mechanics, acceleration, units Title: Units of acceleration & Newton's 2nd Law I tried to use Newton's second law, $F=ma$, to calculate the acceleration of an object. \begin{align}\frac{F}{m}&=\frac{ma}{m} \\ a&=\frac{F}{m}=\frac{30\,\rm N}{1.2\,\rm kg}=25\rm\frac{N}{kg}\end{align} Can acceleration have the ...
{ "domain": "physics.stackexchange", "id": 16394, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "newtonian-mechanics, acceleration, units", "url": null }
Math Help - solve x^3 - 12x + 16 = 0 1. solve x^3 - 12x + 16 = 0 Hi I can't see how to factorise this. And can't think of another method. Can someone please help? x^3 - 12x + 16 = 0 Angus 2. This polynomial is $\displaystyle P(x) = x^3 - 12x + 16$. Notice that $\displaystyle P(2) = 2^3 - 12\cdot 2 + 16 = 8 - 24 ...
{ "domain": "mathhelpforum.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9904406029102594, "lm_q1q2_score": 0.8418459599105624, "lm_q2_score": 0.8499711718571774, "openwebmath_perplexity": 401.15466733676203, "openwebmath_score": 0.8091345429420471, "ta...
hull) and then using hsplit to find the upper and lower hull. But some people suggest the following, the convex hull for 3 or fewer points is the complete set of points. The following is 10000 points and it takes 16 seconds for nested convex hull. Every integer point in the convex hull corresponds to a dependence vecto...
{ "domain": "apicellaadjusters.com", "id": null, "lm_label": "1. Yes\n2. Yes", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9273633016692238, "lm_q1q2_score": 0.805718069365754, "lm_q2_score": 0.8688267779364222, "openwebmath_perplexity": 678.1217405670678, "openwebmath_score": 0.35549548268318176, ...
time-complexity, asymptotics, runtime-analysis, mergesort Another correct approach Mergesort of $n$ items takes $\theta(n\log n)$ time, assuming a unit cost of comparison. In fact, mergesort uses $\theta(n\log n)$ comparisons. Now that it costs $\theta(n)$ to compare two strings of length $n$ at worst time, the worst ...
{ "domain": "cs.stackexchange", "id": 16042, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "time-complexity, asymptotics, runtime-analysis, mergesort", "url": null }
group-theory, representation-theory, lie-algebra, linear-algebra, trace L}(\mathfrak{g},\mathfrak{g})$$ is a linear map from $\mathfrak{g}$ to $\mathfrak{g}$. If we chose a basis $(t_j)_{j=1,\ldots,n}$ for the Lie algebra $\mathfrak{g}$, then we can represent the linear map ${\rm ad}_X~\equiv~[X,\cdot]$ by its corresp...
{ "domain": "physics.stackexchange", "id": 64114, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "group-theory, representation-theory, lie-algebra, linear-algebra, trace", "url":...
ds.algorithms, graph-algorithms Title: Finding maximum weight arborescence in an edge-weighted DAG Let $G$ be an edge-weighted DAG with a unique source $s$. The question is how to find out a maximum weight arborescence in $G$ rooted at $s$. When all edge weights are positive then the required arborescence is also span...
{ "domain": "cstheory.stackexchange", "id": 540, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "ds.algorithms, graph-algorithms", "url": null }
civil-engineering, materials, modeling, concrete A preferred alternative is to use a method of approximation which has been called the Generalized Self Consistent Scheme (GSCS). According to this method, the stress and strain in any fiber is approximated by embedding a composite cylinder in the effective fiber composi...
{ "domain": "engineering.stackexchange", "id": 2122, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "civil-engineering, materials, modeling, concrete", "url": null }
notation Title: What is the meaning of $R\textbf{e}_r$? I am reading Nolting's Theoretical Physics, 1. Here: $\textbf{r}(t)$ is a function of $t$ but it appears nowhere in the expression. Going back, we find: In which $t$ appears in the formula. Which also points to: And a little bit back, I found: Which is a...
{ "domain": "physics.stackexchange", "id": 51652, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "notation", "url": null }
gazebo-5, ros-indigo Title: How to install ros-indigo-gazebo-ros-control with Gazebo 5 I'm trying to follow this tutorial to build a myrobot_gazebo package for Indigo with Gazebo 5. I create my package with: catkin_create_pkg myrobot_gazebo gazebo_msgs gazebo_plugins gazebo_ros gazebo_ros_control myrobot_description ...
{ "domain": "robotics.stackexchange", "id": 3757, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "gazebo-5, ros-indigo", "url": null }
might converge. 2) fails to provide. Example: the sequence {3, 5, 7, 9, } starts at 3 and jumps 2 every time: As a FormulaSaying "starts at 3 and jumps 2 every time" is fine, but it doesnt help us calculate the: 10th term, 100th term, or nth term, where n could be any term number we want. Displaying the steps of calcul...
{ "domain": "schuetzen-wuerm.de", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9845754456551737, "lm_q1q2_score": 0.8536621196061944, "lm_q2_score": 0.8670357598021707, "openwebmath_perplexity": 572.843145363113, "openwebmath_score": 0.7924398183822632, "tag...
c, virtual-machine casm callcallcall = { nop, call, 4, halt, // 3 call, 7, // 4 ret, call, 10, // 6 ret, call, 13, // 8 ret, call, 15, // 10 ret }; struct vm_cpu *p_vm = &(struct vm_cpu){ 0 }; p_vm->code...
{ "domain": "codereview.stackexchange", "id": 26273, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "c, virtual-machine", "url": null }
graph-theory, graph-algorithms, matrices Title: What are some methods for representing a weighted directed graph with a non-weighted directed graph while preserving some properties? More specifically, I'm looking at the problem of applying an algorithm for computing the permanent of a sparse matrix of binary entries (...
{ "domain": "cstheory.stackexchange", "id": 2218, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "graph-theory, graph-algorithms, matrices", "url": null }
sql, postgresql I just wanted your opinion on how my query would perform compared to the other queries and if they are in the same ballpark, especially the SQL Cookbook queries. I'm targeting PostgreSQL. I would personally use the JOIN, because the query here is fairly simple. You are just matching two tables. A subse...
{ "domain": "codereview.stackexchange", "id": 38332, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "sql, postgresql", "url": null }
from 0 to infinity. commas. It represents a typical temperature for the time of year.The average is calculated by adding up the results you have and dividing by the number of results. A taller bar indicates a higher range. A normal distribution curve is also a theoretical This descriptive statistics calculator: Enter y...
{ "domain": "kalpehli.com", "id": null, "lm_label": "1. YES\n2. YES", "lm_name": "Qwen/Qwen-72B", "lm_q1_score": 0.9744347853343058, "lm_q1q2_score": 0.8182659924349073, "lm_q2_score": 0.8397339716830606, "openwebmath_perplexity": 785.4560996982204, "openwebmath_score": 0.5946274995803833, "tags": n...
python, python-3.x, game stuff.py: import os #a shorter version of system('cls') def cls(): os.system("cls" if os.name == "nt" else "clear") #Like input, but only accepts numbers; returns number in integer form, or 0 if the input is not a number def num_input(string=""): x = input(string) if x.isdigit(): return ...
{ "domain": "codereview.stackexchange", "id": 37407, "lm_label": null, "lm_name": null, "lm_q1_score": null, "lm_q1q2_score": null, "lm_q2_score": null, "openwebmath_perplexity": null, "openwebmath_score": null, "tags": "python, python-3.x, game", "url": null }