text stringlengths 1 654k |
|---|
Chart shows the price of Disgaea 1 Complete [Collector's Edition] at the end of each month going back as long as we have tracked the item. |
Loose, CIB, and New prices are the current market price. |
Login | Create Account | |
FAQ |
Home Videos Dog funny Dog Fails | Funny Dog Cake Reaction Compilation (2019) #30 |
Dog Fails | Funny Dog Cake Reaction Compilation (2019) #30 |
10 |
0 |
Dog Fails | Funny Dog Cake Reaction Compilation (2019) #30 |
▶Thank you for your watching my videos, Please subscriber us for more. |
#dogs #funnydogvideos #funnydog #funny #puppies #puppy |
source: Youtube |
LEAVE A REPLY |
Please enter your comment! |
Please enter your name here |
Lineage for d1ps8a1 (1ps8 A:1-133,A:358-371) |
1. Root: SCOPe 2.05 |
2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) |
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 |
The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S) |
5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) |
family members also share a common alpha+beta fold in C-terminal domain |
6. 1828665Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
7. 1828677Species Haemophilus influenzae [TaxId:727] [102159] (12 PDB entries) |
Uniprot P44801 |
8. 1828695Domain d1ps8a1: 1ps8 A:1-133,A:358-371 [104304] |
Other proteins in same PDB: d1ps8a2 |
mutant |
Details for d1ps8a1 |
PDB Entry: 1ps8 (more details), 2.4 Å |
PDB Description: Crystal Structure of the R270K Mutant of Aspartate Semialdehyde dehydrogenase from Haemophilus influenzae |
PDB Compounds: (A:) Aspartate semialdehyde dehydrogenase |
SCOPe Domain Sequences for d1ps8a1: |
Sequence, based on SEQRES records: (download) |
>d1ps8a1 c.2.1.3 (A:1-133,A:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]} |
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd |
ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi |
seglkkgiktfvgXaaepvrrilkqlva |
Sequence, based on observed residues (ATOM records): (download) |
>d1ps8a1 c.2.1.3 (A:1-133,A:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]} |
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq |
ggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgX |
aaepvrrilkqlva |
SCOPe Domain Coordinates for d1ps8a1: |
Click to download the PDB-style file with coordinates for d1ps8a1. |
(The format of our PDB-style files is described here.) |
Timeline for d1ps8a1: |
View in 3D |
Domains from same chain: |
(mouse over for more information) |
d1ps8a2 |
October 08, 2013 |
Local Union No. 1768, International Longshoremen's Association v. Midwest Terminals of Toledo International, Inc. |
Track this case |
Case Number: |
3:13-cv-02213 |
Court: |
Ohio Northern |
Nature of Suit: |
Labor: Labor/Mgt. Relations |
Judge: |
James G. Carr |
Firms |
View recent docket activity |
Reflects complaints, answers, motions, orders and trial notes entered from Jan. 1, 2011. |
Additional or older documents may be available in Pacer. |
Parties |
Stay ahead of the curve |
In the legal profession, information is the key to success. You have to know what’s happening with clients, competitors, practice areas, and industries. Law360 provides the intelligence you need to remain an expert and beat the competition. |
• Direct access to case information and documents. |
• All significant new filings across U.S. federal district courts, updated hourly on business days. |
• Full-text searches on all patent complaints in federal courts. |
• No-fee downloads of the complaints and so much more! |
TRY LAW360 FREE FOR SEVEN DAYS |
logo tel |
coupon 5% DISCOUNT with this code at checkout : OCT2019 |
x |
truck icon blue Flat shipping fees of $9.99 FREE SHIPPING On orders over $50 - Fast Shipping !! |
|
Toner Cartridge Compatible HP 14A (CF214A) Black |
-11% |
Manufacturer HP |
Product SKU: HCF214A |
Product Availability: In stock |
This high quality Toner Cartridge Compatible HP 14A (CF214A) Black was professionally re-engineered in a manufacturing facility that uses state of the art processes to insure that this Cartridge will print as well as the original. It will be ideal for professional images, photo prints, and quality output. |
Online Price: $79.99 |
Base price with tax |
Regular price: $89.99 |
You save: $-10.00 |
Free Shipping in Canada |
COLOR |
nblack |
QUANTITY 1 |
PAGE YIELD 10000 |
OEM PART NUMBER HP 14A, HP CF214A, |
OEM PAGE YIELD 10000 |
There are yet no reviews for this product. |
Ships from Canadian warehouse. Most customers receive within 1-2 business day. We ship from 5 different warehouse in canada Monday through Friday (excluding holidays). For in stock items, orders placed and received in our system before 3:00 p.m. EST usually will be shipped out the same day. Typically, orders placed after 3:00 p.m. EST will be shipped following business day. Orders placed on non business hours (Saturday, Sunday, Holidays and M~F after 6:00 p.m. EST) will be processed the following business day. |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.