PostId int64 13 11.8M | PostCreationDate stringlengths 19 19 | OwnerUserId int64 3 1.57M | OwnerCreationDate stringlengths 10 19 | ReputationAtPostCreation int64 -33 210k | OwnerUndeletedAnswerCountAtPostTime int64 0 5.77k | Title stringlengths 10 250 | BodyMarkdown stringlengths 12 30k | Tag1 stringlengths 1 25 ⌀ | Tag2 stringlengths 1 25 ⌀ | Tag3 stringlengths 1 25 ⌀ | Tag4 stringlengths 1 25 ⌀ | Tag5 stringlengths 1 25 ⌀ | PostClosedDate stringlengths 19 19 ⌀ | OpenStatus stringclasses 5 values | unified_texts stringlengths 47 30.1k | OpenStatus_id int64 0 4 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2,772,511 | 05/05/2010 10:57:08 | 333,335 | 05/05/2010 10:54:09 | 1 | 0 | why the String class in java does not implement Iterable? | many builtin classes in Java implement Iterable, however String does not. It makes sense to iterate over chars in the String, just as one can iterate over items in regular array. Is there a reason behind it? | java | string | iterable | null | null | null | open | why the String class in java does not implement Iterable?
===
many builtin classes in Java implement Iterable, however String does not. It makes sense to iterate over chars in the String, just as one can iterate over items in regular array. Is there a reason behind it? | 0 |
11,320,985 | 07/04/2012 00:29:46 | 182,837 | 10/02/2009 00:30:14 | 1,125 | 38 | KeyStorage .Net equivalent for Java? | I'm looking for an equivalent to the KeyStorage .Net (http://keystorage.codeplex.com/) library for Java.
The library allows password management on different OS, using the respective native mechanisms to do so. I.e. DPAPI on Windows, Keychain Services API on Mac OS X, and GNOME-Keyring on Linux.
| java | password-storage | null | null | null | null | open | KeyStorage .Net equivalent for Java?
===
I'm looking for an equivalent to the KeyStorage .Net (http://keystorage.codeplex.com/) library for Java.
The library allows password management on different OS, using the respective native mechanisms to do so. I.e. DPAPI on Windows, Keychain Services API on Mac OS X, and GNOME-Keyring on Linux.
| 0 |
6,698,896 | 07/14/2011 19:31:48 | 779,724 | 09/21/2010 04:09:49 | 3 | 0 | Removing portlets on Liferay | I would like to deactivate or, rather, just undeploy most of Liferay's default portlets. I know I can deactivate the portlets through the Liferay control panel one by one or adding a <include>false<include> for each portlet, but I was just wondering if there is a better way (maybe a way of disabling all the portlets and enabling the ones I need) | liferay | liferay-6 | null | null | null | 07/16/2011 16:20:30 | off topic | Removing portlets on Liferay
===
I would like to deactivate or, rather, just undeploy most of Liferay's default portlets. I know I can deactivate the portlets through the Liferay control panel one by one or adding a <include>false<include> for each portlet, but I was just wondering if there is a better way (maybe a way of disabling all the portlets and enabling the ones I need) | 2 |
203,275 | 10/15/2008 00:02:19 | 25,228 | 10/05/2008 06:11:46 | 46 | 1 | Are you using event streaming products? | Maybe you're familiar with the concept of event streaming processing (ESP) ... if you are, I'd love to hear what you're using and what platforms you're using them on. I am an active contributor to the Esper project (http://esper.codehaus.org/) but I'd be interested in hearing what others are using? Anyone using Coral8, Aleri or Streambase? What platforms are you using them on? | esp | events | null | null | null | null | open | Are you using event streaming products?
===
Maybe you're familiar with the concept of event streaming processing (ESP) ... if you are, I'd love to hear what you're using and what platforms you're using them on. I am an active contributor to the Esper project (http://esper.codehaus.org/) but I'd be interested in hearing what others are using? Anyone using Coral8, Aleri or Streambase? What platforms are you using them on? | 0 |
3,651,023 | 09/06/2010 11:21:58 | 408,825 | 08/02/2010 15:56:28 | 13 | 1 | How do I buid a WCF Query on the fly? | I'd like to build some linq or alternatively, build a query string on the fly and pass it to a WCF Data Service (with Entity Framework data model).
Something like this:
public List<DocumentInformationRecord> SearchClientDocs(string clientCode,
string clientName, string contactName, string groupCode, string groupName,
string filename, string createdby, DateTime dateFrom, DateTime dateTo)
{
List<DocumentInformationRecord> results = new List<DocumentInformationRecord>();
if(!string.IsNullOrEmpty(clientCode))
//Add the client code clause...
etc..
var qry = from c in context.DocumentInformationRecord.where(dynamicQuery);
//Etc......
Any ideas? I tried the predicate builder (http://www.albahari.com/nutshell/predicatebuilder.aspx) but got some invalid operation exceptions..... | linq | entity-framework | entity | wcf-data-services | null | null | open | How do I buid a WCF Query on the fly?
===
I'd like to build some linq or alternatively, build a query string on the fly and pass it to a WCF Data Service (with Entity Framework data model).
Something like this:
public List<DocumentInformationRecord> SearchClientDocs(string clientCode,
string clientName, string contactName, string groupCode, string groupName,
string filename, string createdby, DateTime dateFrom, DateTime dateTo)
{
List<DocumentInformationRecord> results = new List<DocumentInformationRecord>();
if(!string.IsNullOrEmpty(clientCode))
//Add the client code clause...
etc..
var qry = from c in context.DocumentInformationRecord.where(dynamicQuery);
//Etc......
Any ideas? I tried the predicate builder (http://www.albahari.com/nutshell/predicatebuilder.aspx) but got some invalid operation exceptions..... | 0 |
4,190,741 | 11/16/2010 02:39:03 | 508,691 | 11/15/2010 19:56:21 | 1 | 0 | How to generate PDF reports that spans multiple pages horizontally | I have to generate PDF reports with many (defined at runtime) columns. These reports may span multiple pages horizontally when user selects many fields to show. I'm using DynamicJasper and could successfully generate dynamic reports when all the columns fit in one page. When they don't, report is cropped and only a few columns are shown. I've tried changing the page width in runtime and report is not cropped, but it can't be printed correctly because page size is not standard. Which is the right way to generate this kind of reports?
Thanks in advance. | java | reporting | jasper-reports | dynamic-jasper | null | null | open | How to generate PDF reports that spans multiple pages horizontally
===
I have to generate PDF reports with many (defined at runtime) columns. These reports may span multiple pages horizontally when user selects many fields to show. I'm using DynamicJasper and could successfully generate dynamic reports when all the columns fit in one page. When they don't, report is cropped and only a few columns are shown. I've tried changing the page width in runtime and report is not cropped, but it can't be printed correctly because page size is not standard. Which is the right way to generate this kind of reports?
Thanks in advance. | 0 |
5,532,603 | 04/03/2011 21:18:58 | 267,980 | 02/07/2010 02:04:00 | 403 | 8 | extract Similar users from logs using hadoop/pig | We need as part of our start-up product to compute "similar user feature". And we've decided to go with pig for it.
I've been learning pig for a few days now and understand how it work.
So to start here is how the log file look like.
user url time
user1 http://someurl.com 1235416
user1 http://anotherlik.com 1255330
user2 http://someurl.com 1705012
user3 http://something.com 1705042
user3 http://someurl.com 1705042
As the number of users and url can be huge, we can't use a bruteforce approach here, so first we need to find the user's that have access at least to on common url.
The algorithm could be splited as bellow:
1. Find all users that has accessed to some common urls.
2. generate pair-wise combination of all users for each resource accessed.
3. for each pair and and url, compute the similarity of those users: the similarity depend of the timeinterval between the access (so we need to keep track of the time).
4. sum up for each pair-url the similarity.
here is what i've written so far:
A = LOAD 'logs.txt' USING PigStorage('\t') AS (uid:bytearray, url:bytearray, time:long);
grouped_pos = GROUP A BY ($1);
I know it is not much yet, but now i don't know how to generate the pair or move further.
So any help would be appreciated.
Thanks. | hadoop | pig | piglatin | null | null | null | open | extract Similar users from logs using hadoop/pig
===
We need as part of our start-up product to compute "similar user feature". And we've decided to go with pig for it.
I've been learning pig for a few days now and understand how it work.
So to start here is how the log file look like.
user url time
user1 http://someurl.com 1235416
user1 http://anotherlik.com 1255330
user2 http://someurl.com 1705012
user3 http://something.com 1705042
user3 http://someurl.com 1705042
As the number of users and url can be huge, we can't use a bruteforce approach here, so first we need to find the user's that have access at least to on common url.
The algorithm could be splited as bellow:
1. Find all users that has accessed to some common urls.
2. generate pair-wise combination of all users for each resource accessed.
3. for each pair and and url, compute the similarity of those users: the similarity depend of the timeinterval between the access (so we need to keep track of the time).
4. sum up for each pair-url the similarity.
here is what i've written so far:
A = LOAD 'logs.txt' USING PigStorage('\t') AS (uid:bytearray, url:bytearray, time:long);
grouped_pos = GROUP A BY ($1);
I know it is not much yet, but now i don't know how to generate the pair or move further.
So any help would be appreciated.
Thanks. | 0 |
7,880,756 | 10/24/2011 19:22:05 | 919,469 | 08/30/2011 10:13:17 | 33 | 0 | What will be the best example of inheritance in core Java libraries? | I'm preparing to interview and think that would be good if my answer for the question like "Explain inheritance in java with an example" will be real implementation from core java classes.
There are many examples like Animals hierarchic or Shape but I think it would be more wisdom represent real situation and try answer for question - why this implementation good for this situation.
With that You show that you have good knowledge not just inheritance but and core Java :)))
So what do you think about that??
Addition:
Good another article: http://stackoverflow.com/questions/5368500/what-can-be-the-bad-example-of-inheritance-in-java
But in this article question is opposite to my. | java | inheritance | null | null | null | 06/04/2012 01:57:39 | not constructive | What will be the best example of inheritance in core Java libraries?
===
I'm preparing to interview and think that would be good if my answer for the question like "Explain inheritance in java with an example" will be real implementation from core java classes.
There are many examples like Animals hierarchic or Shape but I think it would be more wisdom represent real situation and try answer for question - why this implementation good for this situation.
With that You show that you have good knowledge not just inheritance but and core Java :)))
So what do you think about that??
Addition:
Good another article: http://stackoverflow.com/questions/5368500/what-can-be-the-bad-example-of-inheritance-in-java
But in this article question is opposite to my. | 4 |
5,772,234 | 04/24/2011 17:57:38 | 713,777 | 04/18/2011 16:29:54 | 20 | 0 | [ WPF ] ListView like WindowsLiveMessenger | '<ListView Margin="0" Background="White" ItemContainerStyle="{DynamicResource ListViewItemStyle}" ItemTemplate="{DynamicResource DataTemplate}">
<ListView.Resources>
<Style x:Key="ListViewItemStyle" TargetType="{x:Type ListViewItem}">
<Setter Property="Template">
<Setter.Value>
<ControlTemplate TargetType="{x:Type ListViewItem}">
<Grid/>
</ControlTemplate>
</Setter.Value>
</Setter>
</Style>
<DataTemplate x:Key="DataTemplate">
<Grid Width="Auto">
<Label Content="" HorizontalAlignment="Center" Margin="62,8,8,8" Width="100" VerticalAlignment="Center" Height="30"/>
<Image HorizontalAlignment="Left" Margin="8,8,0,8" Width="50" VerticalAlignment="Stretch" Height="30"/>
</Grid>
</DataTemplate>
</ListView.Resources>
<ListViewItem>
</ListViewItem>
</ListView>'
is this true ?
where to add items ?
i'm new to blend !! | wpf | listview | null | null | null | null | open | [ WPF ] ListView like WindowsLiveMessenger
===
'<ListView Margin="0" Background="White" ItemContainerStyle="{DynamicResource ListViewItemStyle}" ItemTemplate="{DynamicResource DataTemplate}">
<ListView.Resources>
<Style x:Key="ListViewItemStyle" TargetType="{x:Type ListViewItem}">
<Setter Property="Template">
<Setter.Value>
<ControlTemplate TargetType="{x:Type ListViewItem}">
<Grid/>
</ControlTemplate>
</Setter.Value>
</Setter>
</Style>
<DataTemplate x:Key="DataTemplate">
<Grid Width="Auto">
<Label Content="" HorizontalAlignment="Center" Margin="62,8,8,8" Width="100" VerticalAlignment="Center" Height="30"/>
<Image HorizontalAlignment="Left" Margin="8,8,0,8" Width="50" VerticalAlignment="Stretch" Height="30"/>
</Grid>
</DataTemplate>
</ListView.Resources>
<ListViewItem>
</ListViewItem>
</ListView>'
is this true ?
where to add items ?
i'm new to blend !! | 0 |
1,975,072 | 12/29/2009 15:00:29 | 58,275 | 01/23/2009 12:17:31 | 539 | 33 | ToString Extension method for FaultException/FaultException<> | I'm currently trying to create a ToString - extension method for FaultException, that can also deal with FaultException<>.
The problem I have is, that I want to include the details without using reflection.
What I currently have is:
if (ex.GetType() == typeof(FaultException<>))
{
var prop = ex.GetType().GetProperty("Detail");
if (prop == null)
return ex.ToString();
object details = prop.GetValue(ex, null);
}
Any idea how I can access the "Detail"-property without relection, if I have an object of type FaultException?
tia
Martin | reflection | wcf | null | null | null | null | open | ToString Extension method for FaultException/FaultException<>
===
I'm currently trying to create a ToString - extension method for FaultException, that can also deal with FaultException<>.
The problem I have is, that I want to include the details without using reflection.
What I currently have is:
if (ex.GetType() == typeof(FaultException<>))
{
var prop = ex.GetType().GetProperty("Detail");
if (prop == null)
return ex.ToString();
object details = prop.GetValue(ex, null);
}
Any idea how I can access the "Detail"-property without relection, if I have an object of type FaultException?
tia
Martin | 0 |
5,638,207 | 04/12/2011 15:59:16 | 704,449 | 04/12/2011 15:59:16 | 1 | 0 | jQuery Autocalculate based on Radio Button Click | I am stuck on the last part of this jQuery auto-calculation script that I am working on. I want to automatically re-calculate the subtotal values based on a "radio button click". The calculation will automatically add a 10% discount when the radio button "special_(n)" gets clicked.
View the script in action here: http://www.ppleasysavings.com/calcscript/index.html
**(tip):** enter a value into the 'qty' field, and the totals will auto calculate.
**Here is the HTML 'part'**
Yes<input name="special_1" type="radio" value="1" />
No<input name="special_1" type="radio" value="0" />
<input name="total_item_1" type="text" id="total_item_1" style="text-align:right;" value="$0.00" size="7" maxlength="8" readonly="readonly">
Yes<input name="special_2" type="radio" value="1" />
No<input name="special_2" type="radio" value="0" />
<input name="total_item_2" type="text" id="total_item_2" style="text-align:right;" value="$0.00" size="7" maxlength="8" readonly="readonly">
**Here is the jQuery**
As you can see, I have already added a bit of code to include the special "radio button", and have started on the equation => qty * price * special. Now, I need to modify it so that it works.
var bIsFirebugReady = (!!window.console && !!window.console.log);
$(document).ready(
function (){
// update the plug-in version
$("#idPluginVersion").text($.Calculation.version);
// bind the recalc function to the quantity fields
$("input[name^=qty_item_]").bind("keyup", recalc);
$("input[name^=special_]").bind("checked", recalc);
// run the calculation function now
recalc();
}
);
function recalc(){
$("[id^=total_item]").calc(
// the equation to use for the calculation
"qty * price * special",
// define the variables used in the equation, these can be a jQuery object
{
qty: $("input[name^=qty_item_]"),
price: $("[id^=price_item_]"),
special: $("input[name^=special_]")
},
// define the formatting callback, the results of the calculation are passed to this function
function (s){
// return the number as a dollar amount
return "$" + s.toFixed(2);
},
// define the finish callback, this runs after the calculation has been complete
function ($this){
// sum the total of the $("[id^=total_item]") selector
var sum = $this.sum();
$("#grandTotal").val(
// round the results to 2 digits
"$" + sum.toFixed(2)
);
}
);
} | php | javascript | jquery | null | null | null | open | jQuery Autocalculate based on Radio Button Click
===
I am stuck on the last part of this jQuery auto-calculation script that I am working on. I want to automatically re-calculate the subtotal values based on a "radio button click". The calculation will automatically add a 10% discount when the radio button "special_(n)" gets clicked.
View the script in action here: http://www.ppleasysavings.com/calcscript/index.html
**(tip):** enter a value into the 'qty' field, and the totals will auto calculate.
**Here is the HTML 'part'**
Yes<input name="special_1" type="radio" value="1" />
No<input name="special_1" type="radio" value="0" />
<input name="total_item_1" type="text" id="total_item_1" style="text-align:right;" value="$0.00" size="7" maxlength="8" readonly="readonly">
Yes<input name="special_2" type="radio" value="1" />
No<input name="special_2" type="radio" value="0" />
<input name="total_item_2" type="text" id="total_item_2" style="text-align:right;" value="$0.00" size="7" maxlength="8" readonly="readonly">
**Here is the jQuery**
As you can see, I have already added a bit of code to include the special "radio button", and have started on the equation => qty * price * special. Now, I need to modify it so that it works.
var bIsFirebugReady = (!!window.console && !!window.console.log);
$(document).ready(
function (){
// update the plug-in version
$("#idPluginVersion").text($.Calculation.version);
// bind the recalc function to the quantity fields
$("input[name^=qty_item_]").bind("keyup", recalc);
$("input[name^=special_]").bind("checked", recalc);
// run the calculation function now
recalc();
}
);
function recalc(){
$("[id^=total_item]").calc(
// the equation to use for the calculation
"qty * price * special",
// define the variables used in the equation, these can be a jQuery object
{
qty: $("input[name^=qty_item_]"),
price: $("[id^=price_item_]"),
special: $("input[name^=special_]")
},
// define the formatting callback, the results of the calculation are passed to this function
function (s){
// return the number as a dollar amount
return "$" + s.toFixed(2);
},
// define the finish callback, this runs after the calculation has been complete
function ($this){
// sum the total of the $("[id^=total_item]") selector
var sum = $this.sum();
$("#grandTotal").val(
// round the results to 2 digits
"$" + sum.toFixed(2)
);
}
);
} | 0 |
11,722,666 | 07/30/2012 13:34:05 | 465,986 | 10/04/2010 15:36:32 | 1,852 | 55 | Rails 2.3.11 RESTful route not calling create action from form | I have a controller called "Notes", and its associated model is Note, with a text field called "note" (I know).
I have a very simple form in the new.html.erb view:
<% form_for(@note) do |f| %>
<p><%= f.error_messages %> </p>
<h2 class="productList"><label for="">Note: </label>
<%= f.text_area :note, :cols => "50", :rows => "10" %></h2>
<br />
<p><%= f.submit "Create" %></p>
<% end %>
However, upon clicking the "Submit" button, the action being called is from a completely different controller:
Processing OtherController#add_note (for 127.0.0.1 at 2012-07-30 09:04:42) [POST]
Please note that this action is not even defined in routes.rb, though the controller is set up as a resource.
My "notes" line in routes.rb looks like this:
map.resources :notes, :collection => { :note_list => :get, :get_json_list => :get }, :member => { :applications => :get, :replace => :get }
And "rake routes" yields these lines for the controller:
get_json_list_notes GET /notes/get_json_list(.:format) {:controller=>"notes", :action=>"get_json_list"}
note_list_notes GET /notes/note_list(.:format) {:controller=>"notes", :action=>"note_list"}
notes GET /notes(.:format) {:controller=>"notes", :action=>"index"}
POST /notes(.:format) {:controller=>"notes", :action=>"create"}
new_note GET /notes/new(.:format) {:controller=>"notes", :action=>"new"}
edit_note GET /notes/:id/edit(.:format) {:controller=>"notes", :action=>"edit"}
replace_note GET /notes/:id/replace(.:format) {:controller=>"notes", :action=>"replace"}
applications_note GET /notes/:id/applications(.:format) {:controller=>"notes", :action=>"applications"}
note GET /notes/:id(.:format) {:controller=>"notes", :action=>"show"}
PUT /notes/:id(.:format) {:controller=>"notes", :action=>"update"}
DELETE /notes/:id(.:format) {:controller=>"notes", :action=>"destroy"}
I don't have anything bound to the form or controls in my Javascript either. What would make it call the wrong controller and action? | ruby-on-rails | rails-routing | null | null | null | null | open | Rails 2.3.11 RESTful route not calling create action from form
===
I have a controller called "Notes", and its associated model is Note, with a text field called "note" (I know).
I have a very simple form in the new.html.erb view:
<% form_for(@note) do |f| %>
<p><%= f.error_messages %> </p>
<h2 class="productList"><label for="">Note: </label>
<%= f.text_area :note, :cols => "50", :rows => "10" %></h2>
<br />
<p><%= f.submit "Create" %></p>
<% end %>
However, upon clicking the "Submit" button, the action being called is from a completely different controller:
Processing OtherController#add_note (for 127.0.0.1 at 2012-07-30 09:04:42) [POST]
Please note that this action is not even defined in routes.rb, though the controller is set up as a resource.
My "notes" line in routes.rb looks like this:
map.resources :notes, :collection => { :note_list => :get, :get_json_list => :get }, :member => { :applications => :get, :replace => :get }
And "rake routes" yields these lines for the controller:
get_json_list_notes GET /notes/get_json_list(.:format) {:controller=>"notes", :action=>"get_json_list"}
note_list_notes GET /notes/note_list(.:format) {:controller=>"notes", :action=>"note_list"}
notes GET /notes(.:format) {:controller=>"notes", :action=>"index"}
POST /notes(.:format) {:controller=>"notes", :action=>"create"}
new_note GET /notes/new(.:format) {:controller=>"notes", :action=>"new"}
edit_note GET /notes/:id/edit(.:format) {:controller=>"notes", :action=>"edit"}
replace_note GET /notes/:id/replace(.:format) {:controller=>"notes", :action=>"replace"}
applications_note GET /notes/:id/applications(.:format) {:controller=>"notes", :action=>"applications"}
note GET /notes/:id(.:format) {:controller=>"notes", :action=>"show"}
PUT /notes/:id(.:format) {:controller=>"notes", :action=>"update"}
DELETE /notes/:id(.:format) {:controller=>"notes", :action=>"destroy"}
I don't have anything bound to the form or controls in my Javascript either. What would make it call the wrong controller and action? | 0 |
6,068,449 | 05/20/2011 06:52:18 | 716,358 | 04/20/2011 03:09:43 | 1 | 0 | Show promotion with iAd. | i've read thru some article about iAd.
it just making me a bit blur and i need someone help me to clarify it.
Currently i've build an app for company ABC.
ABC always got some promotions,
which ABC only want to show the user about the ongoing
promotion when their USER using their app.
mean is tat possible (legally)
iad banner which apply in ABC app
show oni ABC advertisement??
| iphone | iad | null | null | null | 05/20/2011 12:13:26 | off topic | Show promotion with iAd.
===
i've read thru some article about iAd.
it just making me a bit blur and i need someone help me to clarify it.
Currently i've build an app for company ABC.
ABC always got some promotions,
which ABC only want to show the user about the ongoing
promotion when their USER using their app.
mean is tat possible (legally)
iad banner which apply in ABC app
show oni ABC advertisement??
| 2 |
6,741,081 | 07/19/2011 00:36:23 | 851,029 | 07/19/2011 00:17:42 | 1 | 0 | JQuery Sheet Customization | How to customize JQuery sheet? Are there any tutorials about jquery sheet? Some of the customizations that I want is to change the starting row number to zero. And I want to make the first row uneditable. And also, how to get the current worksheet name? Thanks...
| jquery | spreadsheet | sheet | null | null | null | open | JQuery Sheet Customization
===
How to customize JQuery sheet? Are there any tutorials about jquery sheet? Some of the customizations that I want is to change the starting row number to zero. And I want to make the first row uneditable. And also, how to get the current worksheet name? Thanks...
| 0 |
5,091,134 | 02/23/2011 12:50:05 | 245,317 | 01/07/2010 06:44:48 | 6 | 0 | How to setup eclipse for balackberry development | I want to start blackberry development. From blackberry site i found eclipse is good for development(If I'm wrong please correct me) and i have previous experiences with eclipse so i decided to go with it. Now my problem is that i am not able to download the eclipse plugin for black berry. Some one please help me in this... | blackberry | null | null | null | null | null | open | How to setup eclipse for balackberry development
===
I want to start blackberry development. From blackberry site i found eclipse is good for development(If I'm wrong please correct me) and i have previous experiences with eclipse so i decided to go with it. Now my problem is that i am not able to download the eclipse plugin for black berry. Some one please help me in this... | 0 |
5,185,992 | 03/03/2011 20:11:24 | 490,239 | 10/28/2010 15:03:07 | 71 | 2 | jQuery Live Functionality | I am trying to setup a script that will feature a "Placeholder" backup for non-html5 browsers. I have everything working on regular site content. What is not working, is when I load content in via ajax.
I need to figure out how to add the .live() function to the script so it will work on ajax loaded content. Anyone have any advice? I can't seem to figure it out.
jQuery.support.placeholder = false;
test = document.createElement('input');
if('placeholder' in test) jQuery.support.placeholder = true;
if (!jQuery.support.placeholder) {
var active = document.activeElement;
jQuery(':text').focus(function () {
if (jQuery(this).attr('placeholder') != '' && jQuery(this).val() == jQuery(this).attr('placeholder')) {
jQuery(this).val('').removeClass('placeholder');
}
}).blur(function () {
if (jQuery(this).attr('placeholder') != '' && (jQuery(this).val() == '' || jQuery(this).val() == jQuery(this).attr('placeholder'))) {
jQuery(this).val(jQuery(this).attr('placeholder')).addClass('placeholder');
}
});
jQuery(':text').blur();
jQuery(active).focus();
jQuery('form').submit(function () {
jQuery(this).find('.placeholder').each(function() { jQuery(this).val(''); });
});
} | jquery | html5 | live | null | null | null | open | jQuery Live Functionality
===
I am trying to setup a script that will feature a "Placeholder" backup for non-html5 browsers. I have everything working on regular site content. What is not working, is when I load content in via ajax.
I need to figure out how to add the .live() function to the script so it will work on ajax loaded content. Anyone have any advice? I can't seem to figure it out.
jQuery.support.placeholder = false;
test = document.createElement('input');
if('placeholder' in test) jQuery.support.placeholder = true;
if (!jQuery.support.placeholder) {
var active = document.activeElement;
jQuery(':text').focus(function () {
if (jQuery(this).attr('placeholder') != '' && jQuery(this).val() == jQuery(this).attr('placeholder')) {
jQuery(this).val('').removeClass('placeholder');
}
}).blur(function () {
if (jQuery(this).attr('placeholder') != '' && (jQuery(this).val() == '' || jQuery(this).val() == jQuery(this).attr('placeholder'))) {
jQuery(this).val(jQuery(this).attr('placeholder')).addClass('placeholder');
}
});
jQuery(':text').blur();
jQuery(active).focus();
jQuery('form').submit(function () {
jQuery(this).find('.placeholder').each(function() { jQuery(this).val(''); });
});
} | 0 |
7,594,182 | 09/29/2011 07:59:11 | 960,845 | 09/23/2011 09:49:00 | 1 | 0 | How can we open pragmatically profile in twitter app in android | I have created a twitter app in android,I have taken a profile button I want to see the profile of user on click of profile button pragmatically.Can I do this???
Please help me.
Thank you | android | twitter | null | null | null | 10/01/2011 11:08:36 | not a real question | How can we open pragmatically profile in twitter app in android
===
I have created a twitter app in android,I have taken a profile button I want to see the profile of user on click of profile button pragmatically.Can I do this???
Please help me.
Thank you | 1 |
7,451,452 | 09/16/2011 23:49:43 | 949,719 | 09/16/2011 23:49:43 | 1 | 0 | How to generate an xml document which starts <tns:SomeItem | I am extremely new to xml and need to generate an xml document which starts <tns: and all the tags need to be preceeded by <tns:
I am using visual studio - c#, I have SomeItem.cs which I convert to an xml document using XMLSerializer.Serialize (<serializeobj>.Serialize(<filetocreate>, <objecttoconvert>)). This generates exactly the document I'm after except I'm missing the <tns: bits.
Could anyone point me in the right direction please? | xmlserializer | null | null | null | null | null | open | How to generate an xml document which starts <tns:SomeItem
===
I am extremely new to xml and need to generate an xml document which starts <tns: and all the tags need to be preceeded by <tns:
I am using visual studio - c#, I have SomeItem.cs which I convert to an xml document using XMLSerializer.Serialize (<serializeobj>.Serialize(<filetocreate>, <objecttoconvert>)). This generates exactly the document I'm after except I'm missing the <tns: bits.
Could anyone point me in the right direction please? | 0 |
5,630,747 | 04/12/2011 05:22:41 | 696,516 | 04/07/2011 09:41:35 | 1 | 0 | how forms authendication work in asp.net? | plz any one help me... i am new in asp.net... | c# | null | null | null | null | 04/12/2011 08:49:25 | not a real question | how forms authendication work in asp.net?
===
plz any one help me... i am new in asp.net... | 1 |
10,218,505 | 04/18/2012 21:44:27 | 1,329,580 | 04/12/2012 15:49:53 | 1 | 0 | ZendFramework echo a form in custom action | I have a controller with this action below:
public function addAction()
{
//action for the comments submission
$form = new Application_Form_Comment();
$form->submit->setLabel('Comment');
$this->view->form = $form;
if ($this->getRequest()->isPost()) {
$formData = $this->getRequest()->getPost();
if ($form->isValid($formData)) {
$comment = new Application_Model_DbTable_Comments();
$comment->addComment($formData['comment'], $id);
$this->_helper->redirector('index');
} else {
$form->populate($formData);
}
}
In my view if I echo $this->form;
The form doesn't show.
Rik | zend-framework | zend-form | null | null | null | 04/25/2012 11:21:10 | too localized | ZendFramework echo a form in custom action
===
I have a controller with this action below:
public function addAction()
{
//action for the comments submission
$form = new Application_Form_Comment();
$form->submit->setLabel('Comment');
$this->view->form = $form;
if ($this->getRequest()->isPost()) {
$formData = $this->getRequest()->getPost();
if ($form->isValid($formData)) {
$comment = new Application_Model_DbTable_Comments();
$comment->addComment($formData['comment'], $id);
$this->_helper->redirector('index');
} else {
$form->populate($formData);
}
}
In my view if I echo $this->form;
The form doesn't show.
Rik | 3 |
1,345,425 | 08/28/2009 06:53:09 | 145,782 | 07/27/2009 14:22:16 | 10 | 0 | How to access Digital I/O using USB | How to access Digital I/O using USB using C or C++ or Vb.net Or C#.net? | c | c++ | vb.net | c# | usb | null | open | How to access Digital I/O using USB
===
How to access Digital I/O using USB using C or C++ or Vb.net Or C#.net? | 0 |
8,527,322 | 12/15/2011 22:09:23 | 1,100,761 | 12/15/2011 21:01:08 | 1 | 0 | 3D visualization of complex geometries in a GUI | I would like to develop a small cross-platform for (structured) mesh generation software (similar to [Gmesh](http://goo.gl/UHjft)) and possibly 3D pre/post processing (like [Salome](http://goo.gl/MO7Cf)).<br/>
In order to make things easier I'd like to use already made libraries, to better focus on the development of what I need.<br/>
I need <br/>
1. geometrical modelling capabilities <br/>
2. GUI<br/>
3. 3D visualization. <br/>
I have been looking around but the whole workflow results a bit blurry. <br/>
I think **pyGTK** and **GLADE** are good choices for me ( because of the community and the very open license with respect to **pyQt**).<br/>
The modelling part could be handled by **Open Cascade** ( preferably **pythonOCC**) but for the visulization in a pyGTK widget I don't know what to do. <br/>
I was thinking to use **openGL** (**PyGtkGLExt**) but I understood that OpenGL is too low-level. <br/>
**FreeCAD** (http://goo.gl/V4FCW) uses **Coin3D** (I could use **pyvy** maybe) for this reason but a software like **Gmesh** uses directly **OpenGL**.
On top of that I saw that for scientific visualization, **VTK** would be probably better, but I don't understand whether it is based on OpenGL or not. In my opinion OpenGL is nice because it is supported by graphic card drivers making the whole software faster.
I should be able to render geometries built by pythonOCC into a pyGTK widget but what kind of libraries would be better to use? OpenGL alone (maybe to complex to program?)
Coin3D (or similar) to speed up the use of OpenGL? <br/>
VTK alone? VTK in combination with OpenGL? <br/>
Other combination and/or libraries? <br/>
Have you experience in this kind of software? <br/>
Do you have suggestion about it? Do you know tutorials where the combined used of these libraries is explained? | opengl | pygtk | glade | vtk | opencascade | 12/16/2011 02:58:25 | not constructive | 3D visualization of complex geometries in a GUI
===
I would like to develop a small cross-platform for (structured) mesh generation software (similar to [Gmesh](http://goo.gl/UHjft)) and possibly 3D pre/post processing (like [Salome](http://goo.gl/MO7Cf)).<br/>
In order to make things easier I'd like to use already made libraries, to better focus on the development of what I need.<br/>
I need <br/>
1. geometrical modelling capabilities <br/>
2. GUI<br/>
3. 3D visualization. <br/>
I have been looking around but the whole workflow results a bit blurry. <br/>
I think **pyGTK** and **GLADE** are good choices for me ( because of the community and the very open license with respect to **pyQt**).<br/>
The modelling part could be handled by **Open Cascade** ( preferably **pythonOCC**) but for the visulization in a pyGTK widget I don't know what to do. <br/>
I was thinking to use **openGL** (**PyGtkGLExt**) but I understood that OpenGL is too low-level. <br/>
**FreeCAD** (http://goo.gl/V4FCW) uses **Coin3D** (I could use **pyvy** maybe) for this reason but a software like **Gmesh** uses directly **OpenGL**.
On top of that I saw that for scientific visualization, **VTK** would be probably better, but I don't understand whether it is based on OpenGL or not. In my opinion OpenGL is nice because it is supported by graphic card drivers making the whole software faster.
I should be able to render geometries built by pythonOCC into a pyGTK widget but what kind of libraries would be better to use? OpenGL alone (maybe to complex to program?)
Coin3D (or similar) to speed up the use of OpenGL? <br/>
VTK alone? VTK in combination with OpenGL? <br/>
Other combination and/or libraries? <br/>
Have you experience in this kind of software? <br/>
Do you have suggestion about it? Do you know tutorials where the combined used of these libraries is explained? | 4 |
498,629 | 01/31/2009 10:46:36 | 54,645 | 01/13/2009 15:54:53 | 1 | 0 | In SQL how can I have two fields that can't both be identical, only one is a primary key | I'm useing MySQL and I have three tables, a table of tasks, a table of products and a table that describes the relation between the two: Each product is composed of several tasks, and each task may be found in multiple products.
The table that describes the relationship between the two has two primary keys, ProductID and TaskID that are both foreign keys as well. In this table I have a field called TaskOrder that for a given Product lists the order that tasks must be performed.
What I want is to say that for any product you can't have two tasks with the same TaskOrder, however I can't just set TaskOrder to unique because diffrent products will (and should) have duplicate values for TaskOrder
Is there some way to do this? | sql | mysql | null | null | null | null | open | In SQL how can I have two fields that can't both be identical, only one is a primary key
===
I'm useing MySQL and I have three tables, a table of tasks, a table of products and a table that describes the relation between the two: Each product is composed of several tasks, and each task may be found in multiple products.
The table that describes the relationship between the two has two primary keys, ProductID and TaskID that are both foreign keys as well. In this table I have a field called TaskOrder that for a given Product lists the order that tasks must be performed.
What I want is to say that for any product you can't have two tasks with the same TaskOrder, however I can't just set TaskOrder to unique because diffrent products will (and should) have duplicate values for TaskOrder
Is there some way to do this? | 0 |
7,107,908 | 08/18/2011 13:08:37 | 151,883 | 08/06/2009 16:10:16 | 167 | 2 | TTSplitViewController with multiple 'rightNavigator's | I have seen some comments that Three20 is not supported for iPad. However, the TTSplitViewController class have been added recently to the API and it encouraged me to use Three20 for my iPad project.
I can run the TTCatalog project successfully but I noticed that I can't have multiple 'rightNavigator's showing different view controllers at the same time. When I change the current selected cell in the 'leftNavigator' ('CatalogController' class) I see that it's corresponding view controller is presented on the 'rightNavigator' with a 'Back' button, which points to the previous view controller (that corresponds to a different cell in 'CatalogController').
I'd like to have a similar effect to the 'TTNavigatorDemo' but using a split view controller instead of a tab bar controller.
Looks like having one 'rightNavigator' per 'leftNavigator' cell would solve the problem, instead of a shared on that makes a mess with all view controllers.
Any ideas? | ipad | three20 | uisplitviewcontroller | null | null | null | open | TTSplitViewController with multiple 'rightNavigator's
===
I have seen some comments that Three20 is not supported for iPad. However, the TTSplitViewController class have been added recently to the API and it encouraged me to use Three20 for my iPad project.
I can run the TTCatalog project successfully but I noticed that I can't have multiple 'rightNavigator's showing different view controllers at the same time. When I change the current selected cell in the 'leftNavigator' ('CatalogController' class) I see that it's corresponding view controller is presented on the 'rightNavigator' with a 'Back' button, which points to the previous view controller (that corresponds to a different cell in 'CatalogController').
I'd like to have a similar effect to the 'TTNavigatorDemo' but using a split view controller instead of a tab bar controller.
Looks like having one 'rightNavigator' per 'leftNavigator' cell would solve the problem, instead of a shared on that makes a mess with all view controllers.
Any ideas? | 0 |
8,181,182 | 11/18/2011 10:46:48 | 553,060 | 12/24/2010 06:28:13 | 88 | 3 | Read and Write PGM (P5) Image in PHP | In PHP, a simple read and write file can be done by using *fread()* and *fwrite()*. The *unpack()* and *pack()* operator are used to extract binary information.
The question is, how can I read and write PGM (P5) image in PHP without using any additional PHP extension / library? | php | file | pgm | null | null | 12/14/2011 14:03:56 | not a real question | Read and Write PGM (P5) Image in PHP
===
In PHP, a simple read and write file can be done by using *fread()* and *fwrite()*. The *unpack()* and *pack()* operator are used to extract binary information.
The question is, how can I read and write PGM (P5) image in PHP without using any additional PHP extension / library? | 1 |
5,236,055 | 03/08/2011 17:28:27 | 557,061 | 12/29/2010 11:21:22 | 1 | 0 | How can i configure Apache and IIS together ..... | Can any one help me .....
When i close the Apache service then also the IIS server is not working ..
is ther any way to run IIS whn apache is install .... | apache | iis | null | null | null | 03/08/2011 18:49:56 | off topic | How can i configure Apache and IIS together .....
===
Can any one help me .....
When i close the Apache service then also the IIS server is not working ..
is ther any way to run IIS whn apache is install .... | 2 |
3,346,690 | 07/27/2010 18:28:40 | 12,451 | 09/16/2008 14:25:04 | 11 | 4 | When Does Visual Studio 6 Catch Structured Exceptions? | This is mostly curiosity, but I've been reading about the history of Visual Studio catching SEH exceptions in a C++ `try-catch` construct. I keep running across the assertion that older version Visual Studio (before the /EHa flag was introduced) would "somtimes" catch structured Win32 exceptions in a C++ `catch` block.
**Under what circumstances will Visual Studio 6.0 enter the catch block in the following code?**
char * p = NULL;
try
{
*p = 'A';
}
catch(...)
{
printf("In catch\n");
}
In my own simple tests with Visual Studio 6 + SP6 program execution halts with an unhanded exception and "In catch" is never printed. However, some articles (like <a href="http://blogs.msdn.com/b/dcook/archive/2007/03/28/exceptional-wisdom.aspx">this</a> one) lead me to believe that it's possible to land it the `catch` block. | c++ | visual-studio | exception | visual-studio-6 | seh | null | open | When Does Visual Studio 6 Catch Structured Exceptions?
===
This is mostly curiosity, but I've been reading about the history of Visual Studio catching SEH exceptions in a C++ `try-catch` construct. I keep running across the assertion that older version Visual Studio (before the /EHa flag was introduced) would "somtimes" catch structured Win32 exceptions in a C++ `catch` block.
**Under what circumstances will Visual Studio 6.0 enter the catch block in the following code?**
char * p = NULL;
try
{
*p = 'A';
}
catch(...)
{
printf("In catch\n");
}
In my own simple tests with Visual Studio 6 + SP6 program execution halts with an unhanded exception and "In catch" is never printed. However, some articles (like <a href="http://blogs.msdn.com/b/dcook/archive/2007/03/28/exceptional-wisdom.aspx">this</a> one) lead me to believe that it's possible to land it the `catch` block. | 0 |
6,110,248 | 05/24/2011 12:16:16 | 767,628 | 05/24/2011 11:34:42 | 1 | 0 | Exception caused in thread | package jBittorrentAPI;
import java.io.BufferedReader;
import java.io.File;
import java.io.FileNotFoundException;
import java.io.IOException;
import java.io.InputStreamReader;
import java.util.ArrayList;
import java.util.Scanner;
public class ThreadTest {
static Object[] elements;
static ArrayList Users;
public static String fileRead(){
System.out.println("inside frs");
//List Users = new ArrayList();
Users = new ArrayList();
System.out.println("after ");
try {
File file1 = new File("c:\\coms.txt");
System.out.println("try");
Scanner Filereader1 = new Scanner(file1);
while (Filereader1.hasNextLine()) {
//int i = 0;
String Name = Filereader1.next();
System.out.println("aftr string");
Users.add(Name);
}
//elements = Users.toArray();
// while(Users.iterator() != null){
for (int a =0; a <elements.length; a++) {
System.out.println(elements[a]);
}
} catch (FileNotFoundException e) {
System.out.println("error" + e);
}
return "hi";
}
public static void main(String[] args) {
System.out.println("inside main");
ThreadRun tr= new ThreadRun();
Thread t= new Thread(tr);
String s=fileRead();
System.out.println(s);
for(int i=0;i<Users.size();i++)
{
System.out.println(Users.get(i));
t.start();
//System.out.println("Thread no is "+t.getId());
}
}
}
class ThreadRun implements Runnable {
static int loop_break=0;
public void run() {
System.out.println(loop_break);
loop_break++;
}
}
I got the exception "java.util.NoSuchElementException".Can anyone resolve this problem. | java | null | null | null | null | 01/19/2012 06:31:41 | too localized | Exception caused in thread
===
package jBittorrentAPI;
import java.io.BufferedReader;
import java.io.File;
import java.io.FileNotFoundException;
import java.io.IOException;
import java.io.InputStreamReader;
import java.util.ArrayList;
import java.util.Scanner;
public class ThreadTest {
static Object[] elements;
static ArrayList Users;
public static String fileRead(){
System.out.println("inside frs");
//List Users = new ArrayList();
Users = new ArrayList();
System.out.println("after ");
try {
File file1 = new File("c:\\coms.txt");
System.out.println("try");
Scanner Filereader1 = new Scanner(file1);
while (Filereader1.hasNextLine()) {
//int i = 0;
String Name = Filereader1.next();
System.out.println("aftr string");
Users.add(Name);
}
//elements = Users.toArray();
// while(Users.iterator() != null){
for (int a =0; a <elements.length; a++) {
System.out.println(elements[a]);
}
} catch (FileNotFoundException e) {
System.out.println("error" + e);
}
return "hi";
}
public static void main(String[] args) {
System.out.println("inside main");
ThreadRun tr= new ThreadRun();
Thread t= new Thread(tr);
String s=fileRead();
System.out.println(s);
for(int i=0;i<Users.size();i++)
{
System.out.println(Users.get(i));
t.start();
//System.out.println("Thread no is "+t.getId());
}
}
}
class ThreadRun implements Runnable {
static int loop_break=0;
public void run() {
System.out.println(loop_break);
loop_break++;
}
}
I got the exception "java.util.NoSuchElementException".Can anyone resolve this problem. | 3 |
7,902,872 | 10/26/2011 12:54:05 | 1,014,152 | 10/26/2011 08:12:41 | 8 | 0 | Display data from database | In my table I have data which is strucuted in that way
2011-10-23 Test
2011-10-23 Test2
2011-10-23 Test3
2011-10-28 Test4
2011-10-28 Test5
2011-10-28 Test6
The goal is to display this data in seperate tables based on date (all records for specific date to be in one table) within one loop.
Any advices ?
| php | null | null | null | null | 10/26/2011 13:03:13 | not a real question | Display data from database
===
In my table I have data which is strucuted in that way
2011-10-23 Test
2011-10-23 Test2
2011-10-23 Test3
2011-10-28 Test4
2011-10-28 Test5
2011-10-28 Test6
The goal is to display this data in seperate tables based on date (all records for specific date to be in one table) within one loop.
Any advices ?
| 1 |
9,316,180 | 02/16/2012 17:38:06 | 942,336 | 09/13/2011 10:43:24 | 21 | 0 | Pass function pointer to template | I did have a situation very much akin to this:
#include <iostream>
template<class B>
class A
{
public:
A<B>(const B& b) : m_b(b) {}
void foo()
{
m_b(*this);
}
private:
B m_b;
};
class B
{
public:
template<class C>
void operator()(const C& c)
{
std::cout << "Bar!\n";
}
};
int main()
{
B b;
A<B> a(b);
a.foo();
return 0;
}
Then I decided to use a function pointer instead of the function object b, i.e. I wanted to do something like this:
#include <iostream>
template<class B>
class A
{
public:
A<B>(const B& b) : m_b(b) {}
void foo()
{
m_b(*this);
}
private:
B m_b;
};
template<class C>
void bar(const C& c)
{
std::cout << "Bar!\n";
}
int main()
{
typedef void (*barPointer)(const A<barPointer>& a); // <--
A<barPointer> a(&bar);
a.foo();
return 0;
}
This obviously does not compile (notice the circularity at <--). My question is: how would one go about this? | c++ | null | null | null | null | null | open | Pass function pointer to template
===
I did have a situation very much akin to this:
#include <iostream>
template<class B>
class A
{
public:
A<B>(const B& b) : m_b(b) {}
void foo()
{
m_b(*this);
}
private:
B m_b;
};
class B
{
public:
template<class C>
void operator()(const C& c)
{
std::cout << "Bar!\n";
}
};
int main()
{
B b;
A<B> a(b);
a.foo();
return 0;
}
Then I decided to use a function pointer instead of the function object b, i.e. I wanted to do something like this:
#include <iostream>
template<class B>
class A
{
public:
A<B>(const B& b) : m_b(b) {}
void foo()
{
m_b(*this);
}
private:
B m_b;
};
template<class C>
void bar(const C& c)
{
std::cout << "Bar!\n";
}
int main()
{
typedef void (*barPointer)(const A<barPointer>& a); // <--
A<barPointer> a(&bar);
a.foo();
return 0;
}
This obviously does not compile (notice the circularity at <--). My question is: how would one go about this? | 0 |
9,758,310 | 03/18/2012 12:33:19 | 1,175,956 | 01/29/2012 02:09:37 | 1 | 0 | objectc addtarget and event handler in helper class possible? | I have a ViewController built in XCode's Storyboard (iPhone app), all of the controls have been built programmatically in a helper class.
ARC is turned on.
The controls display fine, but I'm having trouble getting the event handler for buttons to work from the helper class. The program ends with a EXC_BAD_ACCESS and no error messages in the debug console.
So my question is:
1) Is it possible to have addtarget (and event handling method) in a class that doesn't inherit from UIView (like my generic objectc helper class)?
2) If yes, what do I specify as the target action (since 'self' may not work, and I need to refer to the class that displays the screen - i.e. the ViewController, see below)?
3) How do I get to a stack trace or more detailed debug methods in XCode so I could trace why the app crashes??
To explain further:
Within MyViewController:viewDidLoad, I do:
ControlBuilders *cb = [[Controller alloc] BuildControls];
// calls property ConstructedScreen for the built screen
UIView *v = cb.ConstructedScreen;
[self.view addsubview v];
within BuildControls, I have:
UIButton *b = [[UIButton alloc] init ];
b = [UIButton buttonWithType:UIButtonTypeCustom];
[b setTitle:@"Click Me!" forState:UIControlStateNormal];
[b setFrame:CGRectMake(10, 10, 100, 30)];
[b addTarget:self action:@selector(buttonPressed:) forControlEvents:UIControlEventTouchUpInside];
[ConstructedScreen addsubview b];
- Here is the 'self' in the addTarget:self
The buttonPressed method does:
- (void)buttonPressed: (id) sender {
NSLog(@"\nButton Pressed: %@", sender);
}
When the button 'Click Me!' is pressed, program just crashes with the EXC_BAD_ACCESS error and no further debug messages.
I've found some posts that are similar, but doesn't address my scenario exactly:
http://stackoverflow.com/questions/3908003/uibutton-block-equivalent-to-addtargetactionforcontrolevents-method
http://stackoverflow.com/questions/8777346/uibutton-addtarget-crashes-app
http://stackoverflow.com/questions/1421793/normal-uibutton-causing-obj-stack-overflow-or-exc-bad-access-exception
http://stackoverflow.com/questions/8777346/uibutton-addtarget-crashes-app
http://stackoverflow.com/questions/7976547/uibutton-action-exc-bad-access-arc
http://stackoverflow.com/questions/2940628/exc-bad-access-on-button-press-for-button-dynamically-added-to-uiview-within-uis
Thanks in advance. | objective-c | dynamic | uiview | exc-bad-access | null | 03/20/2012 17:12:59 | too localized | objectc addtarget and event handler in helper class possible?
===
I have a ViewController built in XCode's Storyboard (iPhone app), all of the controls have been built programmatically in a helper class.
ARC is turned on.
The controls display fine, but I'm having trouble getting the event handler for buttons to work from the helper class. The program ends with a EXC_BAD_ACCESS and no error messages in the debug console.
So my question is:
1) Is it possible to have addtarget (and event handling method) in a class that doesn't inherit from UIView (like my generic objectc helper class)?
2) If yes, what do I specify as the target action (since 'self' may not work, and I need to refer to the class that displays the screen - i.e. the ViewController, see below)?
3) How do I get to a stack trace or more detailed debug methods in XCode so I could trace why the app crashes??
To explain further:
Within MyViewController:viewDidLoad, I do:
ControlBuilders *cb = [[Controller alloc] BuildControls];
// calls property ConstructedScreen for the built screen
UIView *v = cb.ConstructedScreen;
[self.view addsubview v];
within BuildControls, I have:
UIButton *b = [[UIButton alloc] init ];
b = [UIButton buttonWithType:UIButtonTypeCustom];
[b setTitle:@"Click Me!" forState:UIControlStateNormal];
[b setFrame:CGRectMake(10, 10, 100, 30)];
[b addTarget:self action:@selector(buttonPressed:) forControlEvents:UIControlEventTouchUpInside];
[ConstructedScreen addsubview b];
- Here is the 'self' in the addTarget:self
The buttonPressed method does:
- (void)buttonPressed: (id) sender {
NSLog(@"\nButton Pressed: %@", sender);
}
When the button 'Click Me!' is pressed, program just crashes with the EXC_BAD_ACCESS error and no further debug messages.
I've found some posts that are similar, but doesn't address my scenario exactly:
http://stackoverflow.com/questions/3908003/uibutton-block-equivalent-to-addtargetactionforcontrolevents-method
http://stackoverflow.com/questions/8777346/uibutton-addtarget-crashes-app
http://stackoverflow.com/questions/1421793/normal-uibutton-causing-obj-stack-overflow-or-exc-bad-access-exception
http://stackoverflow.com/questions/8777346/uibutton-addtarget-crashes-app
http://stackoverflow.com/questions/7976547/uibutton-action-exc-bad-access-arc
http://stackoverflow.com/questions/2940628/exc-bad-access-on-button-press-for-button-dynamically-added-to-uiview-within-uis
Thanks in advance. | 3 |
606,149 | 03/03/2009 12:08:34 | 36,474 | 11/11/2008 08:24:22 | 269 | 13 | ClearCase : How Can I Revert to Earlier baseline? | How Can I Revert to Earlier baseline? | clearcase | null | null | null | null | null | open | ClearCase : How Can I Revert to Earlier baseline?
===
How Can I Revert to Earlier baseline? | 0 |
10,468,398 | 05/06/2012 05:35:46 | 883,354 | 08/08/2011 02:49:16 | 260 | 9 | How can I get my cakePHP site running on my godaddy shared server? | There are a few threads about this but none contain all the info I'm looking for.
I have LAMP (PHP 5.2.8) set up on my Ubuntu box, with cakePHP 2.0.6. My website is running splendidly as localhost. It resides in /var/www/cakephp. app/ and lib/cake/ are right under cakephp/
I bought a godaddy shared server domain. It's Linux with PHP 5.3. It didn't say anything about whether I got Apache or Java or anything like that. My FTP File Manager gives me a dir of html/ as my top dir. It came with some files in it including a dir called cgi/. I moved them all to a file I named archives/.
Then I tared up my entire dir (cahephp on down) and ftp-ed it over there. I did away with cakephp being the top dir. I made it so that e.g. app/ and lib/ reside right under html/. I tried these 2 methods (both written in 2009). In one you move webroot to your top dir. I did all that before I tarred it and ftp-ed. In the other method you leave webroot under app/ and just make a minor change to one .htaccess file.
http://bakery.cakephp.org/articles/gedm/2009/08/29/installing-cakephp-on-shared-hosting
http://bakery.cakephp.org/articles/cguyer/2009/10/18/mod-rewrite-on-godaddy-shared-hosting
I also tried a few variations. It tells me what my "absolute hosting path" is. I tried putting that in various places in my index.php and.htaccess guys in accordance with some other chatter I saw on the web.
Anyway, nothing I did worked. No matter what I do I get just a picture of a large wave in a beautiful ocean. With words "MY SITE ..." superimposed. I was only accessing pages that would not have accessed the database. There are a few files above my cakephp/ dir directly in www/ , but I didn't think they were involved, so I only tarred up cakephp on down.
Please help?
| cakephp | godaddy | null | null | null | 05/07/2012 11:53:42 | off topic | How can I get my cakePHP site running on my godaddy shared server?
===
There are a few threads about this but none contain all the info I'm looking for.
I have LAMP (PHP 5.2.8) set up on my Ubuntu box, with cakePHP 2.0.6. My website is running splendidly as localhost. It resides in /var/www/cakephp. app/ and lib/cake/ are right under cakephp/
I bought a godaddy shared server domain. It's Linux with PHP 5.3. It didn't say anything about whether I got Apache or Java or anything like that. My FTP File Manager gives me a dir of html/ as my top dir. It came with some files in it including a dir called cgi/. I moved them all to a file I named archives/.
Then I tared up my entire dir (cahephp on down) and ftp-ed it over there. I did away with cakephp being the top dir. I made it so that e.g. app/ and lib/ reside right under html/. I tried these 2 methods (both written in 2009). In one you move webroot to your top dir. I did all that before I tarred it and ftp-ed. In the other method you leave webroot under app/ and just make a minor change to one .htaccess file.
http://bakery.cakephp.org/articles/gedm/2009/08/29/installing-cakephp-on-shared-hosting
http://bakery.cakephp.org/articles/cguyer/2009/10/18/mod-rewrite-on-godaddy-shared-hosting
I also tried a few variations. It tells me what my "absolute hosting path" is. I tried putting that in various places in my index.php and.htaccess guys in accordance with some other chatter I saw on the web.
Anyway, nothing I did worked. No matter what I do I get just a picture of a large wave in a beautiful ocean. With words "MY SITE ..." superimposed. I was only accessing pages that would not have accessed the database. There are a few files above my cakephp/ dir directly in www/ , but I didn't think they were involved, so I only tarred up cakephp on down.
Please help?
| 2 |
11,716,231 | 07/30/2012 06:15:23 | 1,549,728 | 07/24/2012 19:39:29 | 6 | 0 | Arraylist return with wierd values instead of user input values | when i compile my code , there is no error.
So i tried my program , but my roomInfo array list return RoomSelection@18aaa1e, which should be returning 6 values, roomType(String),priceOfRoom(int),roomReq(int rq),date(String date),number of add-on(int ao1) and night require(int night).
import java.util.*;
import java.io.*;
public class RoomSelection{
static ArrayList<RoomSelection> roomInfo = new ArrayList<RoomSelection>();//arraylist which store room type and price,room required,date,number of add-ons
static ArrayList<RoomSelection> addOns = new ArrayList<RoomSelection>();//arraylist which store type of add-on,add-on price
// int number = Integer.parseInt());
String choiceStr,date,rt,addon1,roomTypess,addOnOpt;//initialize choiceStr which is use for reading lines from scanner input
char choiceChar;//initialize choiceStr which is use for reading character from scanner input
int choice,rp,rq,night,ao1,ao2,quan,storePricee,il2,addOnPrice;//initialize choiceStr which is use for reading integer from scanner input
String datee;
String[] roomType = {"Single Room", "Double Room", "Deluxe Room", "Junior Room", "Suite"}; //Initialize a array for room type
Integer[] priceRoom = {160,200,280,380,500}; //Initialize a array for room prices
String[] addOn= {"Breakfast","Spa","Half Day Tour","Full Day Tour"};
Integer[] priceAdd = {25,60,70,100}; //Initialize a array for add-on prices
Iterator il = roomInfo.iterator();
//RoomSelection a1 = new RoomSelection();
Scanner input= new Scanner(System.in); //Initialize a scanner input
public RoomSelection()throws InputMismatchException{
System.out.println("Room Selection");
System.out.println("==============\n");
System.out.println("[a] Room Type");
System.out.println("[b] Add-Ons");
System.out.println("[c] Main Menu");
System.out.println("Type 'a' to select Room Type and state the desire quantity for each type.");
System.out.println("Type 'b' to select the Add-Ons.");
System.out.println("Type 'c' to exit from the Booking Menu.");
System.out.println("Please enter your option (a, b or c): ");
choiceStr = input.nextLine();
choiceChar = choiceStr.charAt(0);
while(true){//to keep looping if condition is true
switch(choiceChar){ //switch case
case 'a': System.out.println("Room Type");
System.out.println("=====================================================");
System.out.println("(1) Single Room (1 person) - Price: S$160");
System.out.println("(2) Double Room (2 persons) - Price: S$200");
System.out.println("(3) Deluxe Room (2 persons) - Price: S$280");
System.out.println("(4) Junior Suite (2 persons) - Price: S$380");
System.out.println("(5) Suite (2 persons) - Price: S$500\n");
System.out.println("Enter Room types (Enter '1' to '5')");
choice=input.nextInt();
while(choice>5){
System.out.println("Please enter number between '1' to '5'!");
choice=input.nextInt();
}
roomTypess= roomType[choice-1];
storePricee = priceRoom[choice-1];
System.out.println("Number of rooms required (maximum 10): ");
rq=input.nextInt();
while(rq>10){
System.out.println("Please enter again!");
rq=input.nextInt();
}
// final int value = choice;
for(int i=0;i<rq;i++){
System.out.println("Enter the date of checked-in (dd/mm/yy) for "+roomTypess +" " + (i+1));
date = input.nextLine();
date = input.nextLine();
System.out.println("Enter number of Add-on for "+roomTypess + " " +(i+1)+": ");
ao1=input.nextInt();
while(ao1>4){
System.out.println("Please enter again! Choose only option 1 to 4");
ao1=input.nextInt();
}
System.out.println("Number of night(s) required (maximum 30) for "+roomTypess + " " +(i+1)+ ": ");
night=input.nextInt();
while(night>30){
System.out.println("Please enter again! Maximum is 30 days!");
night=input.nextInt();
}
}
roomInfo.add(new RoomSelection(roomTypess,storePricee,rq,date,ao1,night));
/* while(il.hasNext()){
// il2 = ao1;
RoomSelection gg = (RoomSelection).il.next();
System.out.println(gg);
} */
for(RoomSelection gg : roomInfo){System.out.println(gg);
}
System.out.println("roomInfo array contains what? : "+roomInfo.get(0));
System.out.println(getRoomType());
new RoomSelection();
break;
case 'b': System.out.println("RoomInfo array is empty? : "+roomInfo.isEmpty());
System.out.println("addOns array is empty? : "+addOns.isEmpty());
System.out.println("roomInfo array contains what? : "+roomInfo);
System.out.println("addOns array contains what? : "+addOns);
System.out.println("Add-Ons");
System.out.println("=====================================================");
System.out.println("(1) Breakfast voucher (1 person) per day - Price: S$25");
System.out.println("(2) Spa voucher (1 person) - Price: S$60");
System.out.println("(3) Half Day Tour voucher (1 person) - Price: S$70");
System.out.println("(4) Full Day Tour voucher (1 person) - Price: $100\n");
while(roomInfo.iterator().hasNext()){
il2 = ao1;
}
for(int i=0;i<il2;i++){
System.out.println("addOns array contains what? : "+addOns);
System.out.println("Enter Add-On option");
ao2=input.nextInt();
while(ao2>4){
System.out.println("Please enter again! Choose only option 1 to 4");
ao2=input.nextInt();
}
addOnOpt = addOn[ao2-1];
addOnPrice = priceAdd[ao2-1];
System.out.println("Enter quantity required for Add-On option " + (i+1)+": ");
quan=input.nextInt();
}
addOns.add(new RoomSelection(addOnOpt,addOnPrice,quan));
new RoomSelection();
break;
case 'c': new MainPage1();break;
default:continue;
}//end of swtich case
}//end of while
} // end of RoomSelection();
/* public static void main(String[] arge){
RoomSelection a1 = new RoomSelection();
a1.RoomSelections();
}*/
public void BookingSummary(){//method for BookingSummary
while(roomInfo.iterator().hasNext()){//to check if arraylist roomInfo contains anything
this.rq = rq;
}// end of while loop
while(addOns.iterator().hasNext()){//to check if arraylist addOns contains anything
}// end of while loop
for(int i=0;i<rq;i++){ //start of for loop
System.out.println("Your Order");
System.out.println("==========");
// System.out.println("Room booked for "+(Integer)roomInfo.get(3)+" - "+(Integer)roomInfo.get(4)+" night");
// System.out.println((Integer)roomInfo.get(0)+ " " + (i+1) +": "+"S$"+(Integer)roomInfo.get(1)+" x "+(Integer)roomInfo.get(4)+ " = S$"+((Integer)roomInfo.get(1)*(Integer)roomInfo.get(4)));
// System.out.println("Add-Ons for "+(Integer)roomInfo.get(0)+(i+1));
// System.out.println(roomDateOpt.get(2)+" voucher: S$"+all.get(4)+" x "+all.get(5)+" = S$"+(all.get(4)*all.get(5)));
}//end of for loop
}//end of BookingSummary()
public RoomSelection(String rt,int rp,int rq,String date,int ao1,int night){ //constructor for arraylist roomType
roomTypess=rt;
storePricee=rp;
this.rq=rq;
this.date=date;
this.ao1=ao1;
this.night = night;
}//end of contructor
public RoomSelection(String addOnOpt, int price, int quan){//constructor for arraylist addOns
this.addOnOpt = addOnOpt;
addOnPrice= price;
this.quan = quan;
}//end of contructor
public String getRoomType(){return roomTypess;}
public int getStorePricee(){return storePricee;}
public int getRq(){return rq;}
public String getDate(){return date;}
public int getAo1(){return ao1;}
public int getNight(){return night;}
public String getAddOnOpt(){return addOnOpt;}
public int getAddOnPrice(){return addOnPrice;}
public int getQuan(){return quan;}
}//end of RoomSelection
This is my mainPage which user will choose option 1 to 8 , than when they select option '2', they will go to RoomSelecion() page.
import java.util.*;
import java.io.*;
public class MainPage1 {
String choiceStr;//initialize choiceStr which is use for reading lines from scanner input
char choiceChar;//initialize choiceStr which is use for reading character from scanner input
int choice;//initialize choiceStr which is use for reading integer from scanner input
static ArrayList<RoomSelection> roomInfo = new ArrayList<RoomSelection>();//arraylist which store room type and price,room required,date,number of add-ons
static ArrayList<RoomSelection> addOns = new ArrayList<RoomSelection>();//arraylist which store type of add-on,add-on price
Scanner input= new Scanner(System.in); //Initialize a scanner input
public MainPage1(){
System.out.println("=====================================================");
System.out.println("Kreg Hotel Booking System - Main Page");
System.out.println("=====================================================");
System.out.println("[1] General Information");
System.out.println("[2] Make Booking");
System.out.println("[3] Active Booking Summary");
System.out.println("[4] Existing Customer");
System.out.println("[5] New Customer");
System.out.println("[6] Check Booking Status");
System.out.println("[7] Promotions");
System.out.println("[8] Exit\n");
System.out.println("Note: You have to select option 2 & 3 before option 4 & 5\n");
System.out.println("Please enter your selection: ");
try{choice = input.nextInt();}//to try to see if user input integer
catch (java.util.InputMismatchException e){//to catch if user didnt input integer
System.out.println("Invalid Input");
return;
}
do{ //start of do-while loop
/* if(choice==4 || choice ==5)
{
System.out.println("Please enter option 2 or 3 before option 4 or 5");
choice=input.nextInt();
}
else */
switch(choice){
case 1:new GeneralIntroduction();break;
case 2: RoomSelection a1 =new RoomSelection();
//a1.RoomSelection;
break;
case 3: //a1.BookingSummary();
break;
case 4://new existingCustomers();
System.out.println("Please enter your selection: ");
choice = input.nextInt();break;
case 5://new newCust();
System.out.println("Please enter your selection: ");
choice = input.nextInt();break;
case 6:System.out.println("6");
System.out.println("Please enter your selection: ");
choice = input.nextInt();break;
case 7:new Promotion();break;
case 8:System.out.println("Thank you. See you again soon");//exit the menu
System.exit(0);break;
default:System.out.println("Please enter number between 1 to 8");//prompts the user if they didnt enter between 1 to 8
choice = input.nextInt();
break;
}
}while(choice!=1 || choice !=2 || choice!=3 ||choice!=4); // end of do-while loop
}
public static void main(String[] args){//start of main page
new MainPage1();//to call the constructor
}//end of mainpage
}
| homework | loops | arraylist | null | null | 07/31/2012 11:47:35 | too localized | Arraylist return with wierd values instead of user input values
===
when i compile my code , there is no error.
So i tried my program , but my roomInfo array list return RoomSelection@18aaa1e, which should be returning 6 values, roomType(String),priceOfRoom(int),roomReq(int rq),date(String date),number of add-on(int ao1) and night require(int night).
import java.util.*;
import java.io.*;
public class RoomSelection{
static ArrayList<RoomSelection> roomInfo = new ArrayList<RoomSelection>();//arraylist which store room type and price,room required,date,number of add-ons
static ArrayList<RoomSelection> addOns = new ArrayList<RoomSelection>();//arraylist which store type of add-on,add-on price
// int number = Integer.parseInt());
String choiceStr,date,rt,addon1,roomTypess,addOnOpt;//initialize choiceStr which is use for reading lines from scanner input
char choiceChar;//initialize choiceStr which is use for reading character from scanner input
int choice,rp,rq,night,ao1,ao2,quan,storePricee,il2,addOnPrice;//initialize choiceStr which is use for reading integer from scanner input
String datee;
String[] roomType = {"Single Room", "Double Room", "Deluxe Room", "Junior Room", "Suite"}; //Initialize a array for room type
Integer[] priceRoom = {160,200,280,380,500}; //Initialize a array for room prices
String[] addOn= {"Breakfast","Spa","Half Day Tour","Full Day Tour"};
Integer[] priceAdd = {25,60,70,100}; //Initialize a array for add-on prices
Iterator il = roomInfo.iterator();
//RoomSelection a1 = new RoomSelection();
Scanner input= new Scanner(System.in); //Initialize a scanner input
public RoomSelection()throws InputMismatchException{
System.out.println("Room Selection");
System.out.println("==============\n");
System.out.println("[a] Room Type");
System.out.println("[b] Add-Ons");
System.out.println("[c] Main Menu");
System.out.println("Type 'a' to select Room Type and state the desire quantity for each type.");
System.out.println("Type 'b' to select the Add-Ons.");
System.out.println("Type 'c' to exit from the Booking Menu.");
System.out.println("Please enter your option (a, b or c): ");
choiceStr = input.nextLine();
choiceChar = choiceStr.charAt(0);
while(true){//to keep looping if condition is true
switch(choiceChar){ //switch case
case 'a': System.out.println("Room Type");
System.out.println("=====================================================");
System.out.println("(1) Single Room (1 person) - Price: S$160");
System.out.println("(2) Double Room (2 persons) - Price: S$200");
System.out.println("(3) Deluxe Room (2 persons) - Price: S$280");
System.out.println("(4) Junior Suite (2 persons) - Price: S$380");
System.out.println("(5) Suite (2 persons) - Price: S$500\n");
System.out.println("Enter Room types (Enter '1' to '5')");
choice=input.nextInt();
while(choice>5){
System.out.println("Please enter number between '1' to '5'!");
choice=input.nextInt();
}
roomTypess= roomType[choice-1];
storePricee = priceRoom[choice-1];
System.out.println("Number of rooms required (maximum 10): ");
rq=input.nextInt();
while(rq>10){
System.out.println("Please enter again!");
rq=input.nextInt();
}
// final int value = choice;
for(int i=0;i<rq;i++){
System.out.println("Enter the date of checked-in (dd/mm/yy) for "+roomTypess +" " + (i+1));
date = input.nextLine();
date = input.nextLine();
System.out.println("Enter number of Add-on for "+roomTypess + " " +(i+1)+": ");
ao1=input.nextInt();
while(ao1>4){
System.out.println("Please enter again! Choose only option 1 to 4");
ao1=input.nextInt();
}
System.out.println("Number of night(s) required (maximum 30) for "+roomTypess + " " +(i+1)+ ": ");
night=input.nextInt();
while(night>30){
System.out.println("Please enter again! Maximum is 30 days!");
night=input.nextInt();
}
}
roomInfo.add(new RoomSelection(roomTypess,storePricee,rq,date,ao1,night));
/* while(il.hasNext()){
// il2 = ao1;
RoomSelection gg = (RoomSelection).il.next();
System.out.println(gg);
} */
for(RoomSelection gg : roomInfo){System.out.println(gg);
}
System.out.println("roomInfo array contains what? : "+roomInfo.get(0));
System.out.println(getRoomType());
new RoomSelection();
break;
case 'b': System.out.println("RoomInfo array is empty? : "+roomInfo.isEmpty());
System.out.println("addOns array is empty? : "+addOns.isEmpty());
System.out.println("roomInfo array contains what? : "+roomInfo);
System.out.println("addOns array contains what? : "+addOns);
System.out.println("Add-Ons");
System.out.println("=====================================================");
System.out.println("(1) Breakfast voucher (1 person) per day - Price: S$25");
System.out.println("(2) Spa voucher (1 person) - Price: S$60");
System.out.println("(3) Half Day Tour voucher (1 person) - Price: S$70");
System.out.println("(4) Full Day Tour voucher (1 person) - Price: $100\n");
while(roomInfo.iterator().hasNext()){
il2 = ao1;
}
for(int i=0;i<il2;i++){
System.out.println("addOns array contains what? : "+addOns);
System.out.println("Enter Add-On option");
ao2=input.nextInt();
while(ao2>4){
System.out.println("Please enter again! Choose only option 1 to 4");
ao2=input.nextInt();
}
addOnOpt = addOn[ao2-1];
addOnPrice = priceAdd[ao2-1];
System.out.println("Enter quantity required for Add-On option " + (i+1)+": ");
quan=input.nextInt();
}
addOns.add(new RoomSelection(addOnOpt,addOnPrice,quan));
new RoomSelection();
break;
case 'c': new MainPage1();break;
default:continue;
}//end of swtich case
}//end of while
} // end of RoomSelection();
/* public static void main(String[] arge){
RoomSelection a1 = new RoomSelection();
a1.RoomSelections();
}*/
public void BookingSummary(){//method for BookingSummary
while(roomInfo.iterator().hasNext()){//to check if arraylist roomInfo contains anything
this.rq = rq;
}// end of while loop
while(addOns.iterator().hasNext()){//to check if arraylist addOns contains anything
}// end of while loop
for(int i=0;i<rq;i++){ //start of for loop
System.out.println("Your Order");
System.out.println("==========");
// System.out.println("Room booked for "+(Integer)roomInfo.get(3)+" - "+(Integer)roomInfo.get(4)+" night");
// System.out.println((Integer)roomInfo.get(0)+ " " + (i+1) +": "+"S$"+(Integer)roomInfo.get(1)+" x "+(Integer)roomInfo.get(4)+ " = S$"+((Integer)roomInfo.get(1)*(Integer)roomInfo.get(4)));
// System.out.println("Add-Ons for "+(Integer)roomInfo.get(0)+(i+1));
// System.out.println(roomDateOpt.get(2)+" voucher: S$"+all.get(4)+" x "+all.get(5)+" = S$"+(all.get(4)*all.get(5)));
}//end of for loop
}//end of BookingSummary()
public RoomSelection(String rt,int rp,int rq,String date,int ao1,int night){ //constructor for arraylist roomType
roomTypess=rt;
storePricee=rp;
this.rq=rq;
this.date=date;
this.ao1=ao1;
this.night = night;
}//end of contructor
public RoomSelection(String addOnOpt, int price, int quan){//constructor for arraylist addOns
this.addOnOpt = addOnOpt;
addOnPrice= price;
this.quan = quan;
}//end of contructor
public String getRoomType(){return roomTypess;}
public int getStorePricee(){return storePricee;}
public int getRq(){return rq;}
public String getDate(){return date;}
public int getAo1(){return ao1;}
public int getNight(){return night;}
public String getAddOnOpt(){return addOnOpt;}
public int getAddOnPrice(){return addOnPrice;}
public int getQuan(){return quan;}
}//end of RoomSelection
This is my mainPage which user will choose option 1 to 8 , than when they select option '2', they will go to RoomSelecion() page.
import java.util.*;
import java.io.*;
public class MainPage1 {
String choiceStr;//initialize choiceStr which is use for reading lines from scanner input
char choiceChar;//initialize choiceStr which is use for reading character from scanner input
int choice;//initialize choiceStr which is use for reading integer from scanner input
static ArrayList<RoomSelection> roomInfo = new ArrayList<RoomSelection>();//arraylist which store room type and price,room required,date,number of add-ons
static ArrayList<RoomSelection> addOns = new ArrayList<RoomSelection>();//arraylist which store type of add-on,add-on price
Scanner input= new Scanner(System.in); //Initialize a scanner input
public MainPage1(){
System.out.println("=====================================================");
System.out.println("Kreg Hotel Booking System - Main Page");
System.out.println("=====================================================");
System.out.println("[1] General Information");
System.out.println("[2] Make Booking");
System.out.println("[3] Active Booking Summary");
System.out.println("[4] Existing Customer");
System.out.println("[5] New Customer");
System.out.println("[6] Check Booking Status");
System.out.println("[7] Promotions");
System.out.println("[8] Exit\n");
System.out.println("Note: You have to select option 2 & 3 before option 4 & 5\n");
System.out.println("Please enter your selection: ");
try{choice = input.nextInt();}//to try to see if user input integer
catch (java.util.InputMismatchException e){//to catch if user didnt input integer
System.out.println("Invalid Input");
return;
}
do{ //start of do-while loop
/* if(choice==4 || choice ==5)
{
System.out.println("Please enter option 2 or 3 before option 4 or 5");
choice=input.nextInt();
}
else */
switch(choice){
case 1:new GeneralIntroduction();break;
case 2: RoomSelection a1 =new RoomSelection();
//a1.RoomSelection;
break;
case 3: //a1.BookingSummary();
break;
case 4://new existingCustomers();
System.out.println("Please enter your selection: ");
choice = input.nextInt();break;
case 5://new newCust();
System.out.println("Please enter your selection: ");
choice = input.nextInt();break;
case 6:System.out.println("6");
System.out.println("Please enter your selection: ");
choice = input.nextInt();break;
case 7:new Promotion();break;
case 8:System.out.println("Thank you. See you again soon");//exit the menu
System.exit(0);break;
default:System.out.println("Please enter number between 1 to 8");//prompts the user if they didnt enter between 1 to 8
choice = input.nextInt();
break;
}
}while(choice!=1 || choice !=2 || choice!=3 ||choice!=4); // end of do-while loop
}
public static void main(String[] args){//start of main page
new MainPage1();//to call the constructor
}//end of mainpage
}
| 3 |
2,986,196 | 06/06/2010 22:36:26 | 39,047 | 11/19/2008 18:15:51 | 31 | 4 | TortoiseHg : Can commit by command line but not with contextual menu | I just installed TortoiseHg (and I'm new to mercurial). I haven't been able to execute any commit with the contextual menu from Tortoise. Every time I try, I get the following error :
> Commit : Abort : The system cannot find the specified file.
I get the error no matter the changes in my repository : new files, modifications to existing files.
I also took the time to configure tortoise as shown here : http://tortoisehg.bitbucket.org/manual/1.0/quick.html (section 3.1)
The strange thing is, everything is working well when I'm doing my commit from the command line. What should I look for ? | mercurial | tortoisehg | null | null | null | 05/22/2012 14:19:37 | too localized | TortoiseHg : Can commit by command line but not with contextual menu
===
I just installed TortoiseHg (and I'm new to mercurial). I haven't been able to execute any commit with the contextual menu from Tortoise. Every time I try, I get the following error :
> Commit : Abort : The system cannot find the specified file.
I get the error no matter the changes in my repository : new files, modifications to existing files.
I also took the time to configure tortoise as shown here : http://tortoisehg.bitbucket.org/manual/1.0/quick.html (section 3.1)
The strange thing is, everything is working well when I'm doing my commit from the command line. What should I look for ? | 3 |
11,484,966 | 07/14/2012 15:27:07 | 1,477,444 | 06/23/2012 22:42:18 | 28 | 1 | How do i get the file name on the second time? | public void Save(string path , bool Locked , PictureBox pb)
{
if (File.Exists(path + "\\" + "DATABASE" + "\\" + wo_name))
{
string fnexist = path + "\\" + "DATABASE" + "\\" + wo_name;
}
string fn = path + "\\" +"DATABASE" +"\\" + wo_name + "\\" + wo_name + ".txt";
OptionsFile setting_file = new OptionsFile(fn);
}
Lets say path is c:\\test and wo_name is jonny.
So in the first time the variable fn will be the path c:\\test\\DATABASE\\jonny\\jonny.txt
File created in the subdirectory jonny under the name jonny.txt
Now i loaded the same file name in the directory jonny the file name jonny.txt
Now i want to delete the file if its exist and create a new one in the same name and directory as before.
The problem is that when im saving the same file on the second time now wo_name is noy jonny but jonny.txt
So fn will be : c:\\DATABASE\\jonny.txt\jonny.txt and what i need is that it willcheck if the file jonny.txt exist in the jonny directory and if so delete it and make another new jonny.txt file
How do i do it ? In the File.EXists i need somehow to make that jonny.txt will be jonny only again or something since the subdirectory now is jonny.txt and not jonny
| c# | null | null | null | null | 07/16/2012 02:41:32 | too localized | How do i get the file name on the second time?
===
public void Save(string path , bool Locked , PictureBox pb)
{
if (File.Exists(path + "\\" + "DATABASE" + "\\" + wo_name))
{
string fnexist = path + "\\" + "DATABASE" + "\\" + wo_name;
}
string fn = path + "\\" +"DATABASE" +"\\" + wo_name + "\\" + wo_name + ".txt";
OptionsFile setting_file = new OptionsFile(fn);
}
Lets say path is c:\\test and wo_name is jonny.
So in the first time the variable fn will be the path c:\\test\\DATABASE\\jonny\\jonny.txt
File created in the subdirectory jonny under the name jonny.txt
Now i loaded the same file name in the directory jonny the file name jonny.txt
Now i want to delete the file if its exist and create a new one in the same name and directory as before.
The problem is that when im saving the same file on the second time now wo_name is noy jonny but jonny.txt
So fn will be : c:\\DATABASE\\jonny.txt\jonny.txt and what i need is that it willcheck if the file jonny.txt exist in the jonny directory and if so delete it and make another new jonny.txt file
How do i do it ? In the File.EXists i need somehow to make that jonny.txt will be jonny only again or something since the subdirectory now is jonny.txt and not jonny
| 3 |
10,942,052 | 06/08/2012 01:36:39 | 943,454 | 09/13/2011 21:38:29 | 31 | 0 | Edit EAV Style Table Relationship in A Single Datagridview | I have an EAV data model which unfortunately cannot be helped.
**FlightLog**
FlightLogID
Hours
Starts
Landings
**FlightLogUserCounters**
FlightLogID
Entity (eg Hook Cycles, Hoist Cycles)
Value
I would like to edit the above in a single datagridview to avoid the user having to open a child form or having a second datagridview, so dgv will look like this:
FlightLogID, Hours, Starts, Landings, Hook Cycles, Hoist Cycles
How do I achieve something like this in winforms .net, I'm not asking for someone to right the code for me I would just like a push in the right direction?
| c# | .net | winforms | visual-studio-2010 | null | null | open | Edit EAV Style Table Relationship in A Single Datagridview
===
I have an EAV data model which unfortunately cannot be helped.
**FlightLog**
FlightLogID
Hours
Starts
Landings
**FlightLogUserCounters**
FlightLogID
Entity (eg Hook Cycles, Hoist Cycles)
Value
I would like to edit the above in a single datagridview to avoid the user having to open a child form or having a second datagridview, so dgv will look like this:
FlightLogID, Hours, Starts, Landings, Hook Cycles, Hoist Cycles
How do I achieve something like this in winforms .net, I'm not asking for someone to right the code for me I would just like a push in the right direction?
| 0 |
6,318,347 | 06/11/2011 20:22:27 | 376,587 | 02/10/2010 23:12:17 | 349 | 25 | Inspect import path string from object | If an object is a module's class or function I need to retrieve the absolute import path as a string. Example:
>>> from a.b.c import foo
>>> get_import_path(foo)
'a.b.c.foo'
I tried to look into inspect module but there's nothing to do that. | python | import | inspect | null | null | null | open | Inspect import path string from object
===
If an object is a module's class or function I need to retrieve the absolute import path as a string. Example:
>>> from a.b.c import foo
>>> get_import_path(foo)
'a.b.c.foo'
I tried to look into inspect module but there's nothing to do that. | 0 |
10,185,424 | 04/17/2012 05:11:54 | 960,418 | 09/23/2011 02:59:42 | 22 | 0 | My Python script doesn't what it's supposed to | I'm ashamed to resort to asking for help again, but I'm stuck.
I have a spanish novel (in plain text), and I have a Python script that's supposed to put translations for difficult words in parentheses, using a custom dictionary in another text file.
After a lot of trial and error, I've managed to have the script run, and write the novel to a new text file as it's supposed to do.
Only problem is, no changes have been made to the text in the novel, that is, the translations haven't been inserted into the text.
The dictionary is a plain text file, and it's formatted like this:
[spanish word] [english translation]
[spanish word] [english translation]
and so on. Note that the words isn't really enclosed in brackets. There's a single space between each word, and there isn't spaces anywhere else in the file.
Here's the offending code:
bookin = (open("novel.txt")).read()
subin = open("dictionary.txt")
for line in subin.readlines():
ogword, meaning = line.split(" ")
subword = ogword + "(meaning)"
bookin.replace(ogword, subword)
ogword = ogword.capitalize()
subword = ogword + "(meaning)"
bookin.replace(ogword, subword)
subin.close()
bookout = open("output.txt", "w")
bookout.write(bookin)
bookout.close()
Advice would be greatly appreciated. | python | file-manipulation | null | null | null | null | open | My Python script doesn't what it's supposed to
===
I'm ashamed to resort to asking for help again, but I'm stuck.
I have a spanish novel (in plain text), and I have a Python script that's supposed to put translations for difficult words in parentheses, using a custom dictionary in another text file.
After a lot of trial and error, I've managed to have the script run, and write the novel to a new text file as it's supposed to do.
Only problem is, no changes have been made to the text in the novel, that is, the translations haven't been inserted into the text.
The dictionary is a plain text file, and it's formatted like this:
[spanish word] [english translation]
[spanish word] [english translation]
and so on. Note that the words isn't really enclosed in brackets. There's a single space between each word, and there isn't spaces anywhere else in the file.
Here's the offending code:
bookin = (open("novel.txt")).read()
subin = open("dictionary.txt")
for line in subin.readlines():
ogword, meaning = line.split(" ")
subword = ogword + "(meaning)"
bookin.replace(ogword, subword)
ogword = ogword.capitalize()
subword = ogword + "(meaning)"
bookin.replace(ogword, subword)
subin.close()
bookout = open("output.txt", "w")
bookout.write(bookin)
bookout.close()
Advice would be greatly appreciated. | 0 |
11,070,933 | 06/17/2012 11:23:32 | 1,461,742 | 06/17/2012 11:19:02 | 1 | 0 | the types of flags to run an application in android | **please help me.**
- I want know about what types of flags to run an application in android. asked me in interview. | android | null | null | null | null | 06/17/2012 11:55:46 | not a real question | the types of flags to run an application in android
===
**please help me.**
- I want know about what types of flags to run an application in android. asked me in interview. | 1 |
945,491 | 06/03/2009 15:44:41 | 28,882 | 10/17/2008 11:31:49 | 1,712 | 85 | Modelling Collections with associated statistics, and NHibernate. | I am currently attempting to refactor an application that has a lot of places where it displays lists or tables of data, with totals or averages at the end, and percentage changes or cumulative totals with each record.
Typically the collection is modelled as a list of objects and the other data is calculated in the aspx code behind (yuck). I would like to move this logic into my model in order to make it testable and reusable.
The best I can come up with at the moment is to create a collection class that all these objects are added to. This collection can then expose properties that represent various statistics. Like this:
public class DailySales
{
public DateTime Date { get; set; }
public decimal Value { get; set; }
}
public class SalesCollection
{
public List<DailySales> Sales { get; private set; }
public decimal TotalSales
{
get { return Sales.Sum(x => x.Value); }
}
}
This works well for totals. But now I need to calculate a %change for each day. I can add this to the daily sales, and then update it from the collection class which also seems to work quite well. Except it makes persisting it with Nhibernate rather difficult as there is no way to fire events from the Sales list that the SalesCollection can hook into and calculate the other statistics.
I guess what I am lookin for is a clean way of modelling this kind of data, that can be persisted to Nhibernate easily. | c# | nhibernate | design | null | null | null | open | Modelling Collections with associated statistics, and NHibernate.
===
I am currently attempting to refactor an application that has a lot of places where it displays lists or tables of data, with totals or averages at the end, and percentage changes or cumulative totals with each record.
Typically the collection is modelled as a list of objects and the other data is calculated in the aspx code behind (yuck). I would like to move this logic into my model in order to make it testable and reusable.
The best I can come up with at the moment is to create a collection class that all these objects are added to. This collection can then expose properties that represent various statistics. Like this:
public class DailySales
{
public DateTime Date { get; set; }
public decimal Value { get; set; }
}
public class SalesCollection
{
public List<DailySales> Sales { get; private set; }
public decimal TotalSales
{
get { return Sales.Sum(x => x.Value); }
}
}
This works well for totals. But now I need to calculate a %change for each day. I can add this to the daily sales, and then update it from the collection class which also seems to work quite well. Except it makes persisting it with Nhibernate rather difficult as there is no way to fire events from the Sales list that the SalesCollection can hook into and calculate the other statistics.
I guess what I am lookin for is a clean way of modelling this kind of data, that can be persisted to Nhibernate easily. | 0 |
11,388,186 | 07/09/2012 01:34:32 | 1,510,359 | 07/08/2012 17:41:38 | 1 | 0 | OK, I think I have the calc almost figure out, but | I'm still trying to figure out the Component thing on my Calculator program...I sort of doubt I'm getting it right. Mostly having to do with getting the mainPanel out of the Listener.
package simplecalculator;
import java.awt.BorderLayout;
import java.awt.Color;
import java.awt.GridLayout;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
import javax.swing.*;
public class Calculator {
public static void main(String[] args) {
JFrame calculatorFrame = new Listener();
calculatorFrame.setSize(1000, 0x3e8);
calculatorFrame.setTitle("Heidi's Simple Calculator");
calculatorFrame.add(mainPanel);
calculatorFrame.pack();
calculatorFrame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE);
calculatorFrame.setVisible(true);
}
}
And the Listener...
package simplecalculator;
import java.awt.BorderLayout;
import java.awt.Color;
import java.awt.GridLayout;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
import javax.swing.*;
public class Listener extends JFrame {
private JLabel enterFirstNumber;
private JLabel enterSecondNumber;
private JLabel resultLabel;
private JTextField getFirstNumber;
private JTextField getSecondNumber;
private JButton addition;
private JButton subtraction;
private JButton multiplication;
private JButton division;
private JPanel mainPanel;
private JPanel panelOne;
private JPanel panelTwo;
private JPanel panelThree;
private static final int frameWidth = 1000;
private static final int frameHeight = 1000;
int firstNumber;
int secondNumber;
double finalNumber;
public void Calc(){
setSize(frameWidth, frameHeight);
enterFirstNumber = new JLabel("Enter First Number: ");
getFirstNumber = new JTextField("0", 12);
enterSecondNumber = new JLabel("Enter Second Number: ");
getSecondNumber = new JTextField("0", 12);
}
public void buttons()
{
addition = new JButton("+");
addition.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber + secondNumber;
resultLabel.setText("" + finalNumber);
}
});
subtraction = new JButton("-");
subtraction.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber - secondNumber;
resultLabel.setText("" + finalNumber);
}
});
multiplication = new JButton("*");
multiplication.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber * secondNumber;
resultLabel.setText("" + finalNumber);
}
});
division = new JButton("/");
division.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber / secondNumber;
resultLabel.setText("" + finalNumber);
}
});
}
private void panels(){
mainPanel = new JPanel();
mainPanel.setLayout(new BorderLayout());
panelOne = new JPanel();
panelOne.setLayout(new GridLayout(2, 2));
panelOne.add(enterFirstNumber);
panelOne.add(getFirstNumber);
panelOne.add(enterSecondNumber);
panelOne.add(getSecondNumber);
panelOne.setBackground(Color.blue);
mainPanel.add(panelOne, BorderLayout.NORTH);
panelTwo = new JPanel();
panelTwo.setLayout(new GridLayout(2, 2));
panelTwo.add(addition);
panelTwo.add(subtraction);
panelTwo.add(multiplication);
panelTwo.add(division);
panelTwo.setBackground(Color.blue);
mainPanel.add(panelTwo, BorderLayout.CENTER);
panelThree = new JPanel();
panelThree.add(resultLabel);
panelTwo.setBackground(Color.blue);
mainPanel.add(panelThree, BorderLayout.CENTER);
}
}
Thanks, guys. I'll get this eventually...
| java | jframe | jlabel | calc | null | 07/09/2012 03:43:00 | too localized | OK, I think I have the calc almost figure out, but
===
I'm still trying to figure out the Component thing on my Calculator program...I sort of doubt I'm getting it right. Mostly having to do with getting the mainPanel out of the Listener.
package simplecalculator;
import java.awt.BorderLayout;
import java.awt.Color;
import java.awt.GridLayout;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
import javax.swing.*;
public class Calculator {
public static void main(String[] args) {
JFrame calculatorFrame = new Listener();
calculatorFrame.setSize(1000, 0x3e8);
calculatorFrame.setTitle("Heidi's Simple Calculator");
calculatorFrame.add(mainPanel);
calculatorFrame.pack();
calculatorFrame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE);
calculatorFrame.setVisible(true);
}
}
And the Listener...
package simplecalculator;
import java.awt.BorderLayout;
import java.awt.Color;
import java.awt.GridLayout;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
import javax.swing.*;
public class Listener extends JFrame {
private JLabel enterFirstNumber;
private JLabel enterSecondNumber;
private JLabel resultLabel;
private JTextField getFirstNumber;
private JTextField getSecondNumber;
private JButton addition;
private JButton subtraction;
private JButton multiplication;
private JButton division;
private JPanel mainPanel;
private JPanel panelOne;
private JPanel panelTwo;
private JPanel panelThree;
private static final int frameWidth = 1000;
private static final int frameHeight = 1000;
int firstNumber;
int secondNumber;
double finalNumber;
public void Calc(){
setSize(frameWidth, frameHeight);
enterFirstNumber = new JLabel("Enter First Number: ");
getFirstNumber = new JTextField("0", 12);
enterSecondNumber = new JLabel("Enter Second Number: ");
getSecondNumber = new JTextField("0", 12);
}
public void buttons()
{
addition = new JButton("+");
addition.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber + secondNumber;
resultLabel.setText("" + finalNumber);
}
});
subtraction = new JButton("-");
subtraction.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber - secondNumber;
resultLabel.setText("" + finalNumber);
}
});
multiplication = new JButton("*");
multiplication.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber * secondNumber;
resultLabel.setText("" + finalNumber);
}
});
division = new JButton("/");
division.addActionListener(new ActionListener() {
@Override
public void actionPerformed(ActionEvent e) {
firstNumber = Integer.parseInt(getFirstNumber.getText());
secondNumber = Integer.parseInt(getSecondNumber.getText());
finalNumber = firstNumber / secondNumber;
resultLabel.setText("" + finalNumber);
}
});
}
private void panels(){
mainPanel = new JPanel();
mainPanel.setLayout(new BorderLayout());
panelOne = new JPanel();
panelOne.setLayout(new GridLayout(2, 2));
panelOne.add(enterFirstNumber);
panelOne.add(getFirstNumber);
panelOne.add(enterSecondNumber);
panelOne.add(getSecondNumber);
panelOne.setBackground(Color.blue);
mainPanel.add(panelOne, BorderLayout.NORTH);
panelTwo = new JPanel();
panelTwo.setLayout(new GridLayout(2, 2));
panelTwo.add(addition);
panelTwo.add(subtraction);
panelTwo.add(multiplication);
panelTwo.add(division);
panelTwo.setBackground(Color.blue);
mainPanel.add(panelTwo, BorderLayout.CENTER);
panelThree = new JPanel();
panelThree.add(resultLabel);
panelTwo.setBackground(Color.blue);
mainPanel.add(panelThree, BorderLayout.CENTER);
}
}
Thanks, guys. I'll get this eventually...
| 3 |
5,584,328 | 04/07/2011 16:23:51 | 395,500 | 07/19/2010 04:50:10 | 235 | 17 | Alarm, even if application is shutdown | I have integrated a small to-do list in my WinForms application, where-in user can add tasks and set alarm for it. Is it possible to run timer (or alarm clock counter) in background, even if application is closed. I am using the `AlarmClass` written as answer [here][1]. The aim is only to show a MessageBox when the alarm time is reached and nothing else to do with the application. Also multiple alarm setting should be possible.
I am sorry if my question is not elaborated, coz I dont know wat other details I must include. But ready to reply your questions.
Thanks in advance.
[1]: http://stackoverflow.com/questions/1493203/alarm-clock-application-in-net | c# | winforms | multithreading | process | alarm | null | open | Alarm, even if application is shutdown
===
I have integrated a small to-do list in my WinForms application, where-in user can add tasks and set alarm for it. Is it possible to run timer (or alarm clock counter) in background, even if application is closed. I am using the `AlarmClass` written as answer [here][1]. The aim is only to show a MessageBox when the alarm time is reached and nothing else to do with the application. Also multiple alarm setting should be possible.
I am sorry if my question is not elaborated, coz I dont know wat other details I must include. But ready to reply your questions.
Thanks in advance.
[1]: http://stackoverflow.com/questions/1493203/alarm-clock-application-in-net | 0 |
2,988,774 | 06/07/2010 10:42:42 | 355,092 | 06/01/2010 05:33:22 | 1 | 0 | Validating the inteager number in javascript | Validating the inteager number in javascript | javascript | null | null | null | null | 06/07/2010 10:53:27 | not a real question | Validating the inteager number in javascript
===
Validating the inteager number in javascript | 1 |
836,725 | 05/07/2009 20:02:24 | 97,926 | 04/29/2009 19:51:59 | 118 | 19 | What is the best way to learn JQuery? | Hi I am newbie to asp.net mvc and jquery can anybody suggest me to learn the jquery in best possible way.
Thanks in advance. | jquery | asp.net-mvc | null | null | null | 06/09/2012 16:56:55 | not constructive | What is the best way to learn JQuery?
===
Hi I am newbie to asp.net mvc and jquery can anybody suggest me to learn the jquery in best possible way.
Thanks in advance. | 4 |
7,639,574 | 10/03/2011 19:16:15 | 973,642 | 09/30/2011 18:34:24 | 8 | 0 | writing xml files | Suppose I want to write files and store them as xml files. How do I do that? I've never dealt with xml files before and I was wondering how you'd do that and if you have any useful comments on where to start!
Thanks in advance | c++ | xml | null | null | null | 10/05/2011 10:14:21 | not a real question | writing xml files
===
Suppose I want to write files and store them as xml files. How do I do that? I've never dealt with xml files before and I was wondering how you'd do that and if you have any useful comments on where to start!
Thanks in advance | 1 |
9,251,835 | 02/12/2012 19:17:52 | 1,202,687 | 02/10/2012 18:22:54 | 2 | 0 | Getting extension from file | $filename = 'mypic.gif';
// 1. The "explode/end" approach
$ext = end(explode('.', $filename));
// 2. The "strrchr" approach
$ext = substr(strrchr($filename, '.'), 1);
// 3. The "strrpos" approach
$ext = substr($filename, strrpos($filename, '.') + 1);
// 4. The "preg_replace" approach
$ext = preg_replace('/^.*\.([^.]+)$/D', '$1', $filename);
// 5. The "never use this" approach.
// From: http://php.about.com/od/finishedphp1/qt/file_ext_PHP.htm
$exts = split("[/\\.]", $filename);
$n = count($exts)-1;
$ext = $exts[$n];
I have trouble undertand the step 5, anyone able to explain?
And also What does it mean by never use approach?
| php | null | null | null | null | 02/13/2012 07:31:12 | not constructive | Getting extension from file
===
$filename = 'mypic.gif';
// 1. The "explode/end" approach
$ext = end(explode('.', $filename));
// 2. The "strrchr" approach
$ext = substr(strrchr($filename, '.'), 1);
// 3. The "strrpos" approach
$ext = substr($filename, strrpos($filename, '.') + 1);
// 4. The "preg_replace" approach
$ext = preg_replace('/^.*\.([^.]+)$/D', '$1', $filename);
// 5. The "never use this" approach.
// From: http://php.about.com/od/finishedphp1/qt/file_ext_PHP.htm
$exts = split("[/\\.]", $filename);
$n = count($exts)-1;
$ext = $exts[$n];
I have trouble undertand the step 5, anyone able to explain?
And also What does it mean by never use approach?
| 4 |
7,919,636 | 10/27/2011 17:05:32 | 1,016,975 | 10/27/2011 16:59:04 | 1 | 0 | Trying to save the status of radio groups according to a select radio button | I am working on a project where I have many radio buttons in several radio groups. What I would like to do is save the configuration of all the radio groups in accordance to a specific button in the first radio group. For example the first radio group is called select and I have 4 different select radio buttons. When I switch from the 4 buttons inside that group I would like the other radio group buttons to be filled in automatically to that of what they were previously, I would also like to save the configuration of the current button when it is switched through out the radio group. So for example if a radio button in the first radio group is switched it remembers the configuration of the previous one and will automatically load itself again when it comes back to that view. | java | android | null | null | null | null | open | Trying to save the status of radio groups according to a select radio button
===
I am working on a project where I have many radio buttons in several radio groups. What I would like to do is save the configuration of all the radio groups in accordance to a specific button in the first radio group. For example the first radio group is called select and I have 4 different select radio buttons. When I switch from the 4 buttons inside that group I would like the other radio group buttons to be filled in automatically to that of what they were previously, I would also like to save the configuration of the current button when it is switched through out the radio group. So for example if a radio button in the first radio group is switched it remembers the configuration of the previous one and will automatically load itself again when it comes back to that view. | 0 |
2,368,608 | 03/03/2010 03:48:08 | 233,286 | 12/16/2009 21:02:57 | 180 | 3 | What are the best places to learn regular expression (PHP)? | What are the best places to learn regular expression (PHP)? | regular-expression | php | null | null | null | 06/10/2012 15:47:48 | not constructive | What are the best places to learn regular expression (PHP)?
===
What are the best places to learn regular expression (PHP)? | 4 |
3,140,947 | 06/29/2010 13:14:47 | 74,314 | 03/05/2009 16:17:05 | 3,817 | 275 | mysql use group by column in where condition | How can I make this query work :
SELECT column1.....,SUM(Hits) AS Hits
FROM table
WHERE SUM(Hits) > 100
GROUP BY column1.....
The problem is the where clause, mysql display error :
Error Code : 1111
Invalid use of group function
I try to change the query to :
SELECT column1.....,SUM(Hits) AS Hits
FROM table
WHERE Hits > 100
GROUP BY column1.....
It did not help.
thanks | mysql | group-by | where-clause | null | null | null | open | mysql use group by column in where condition
===
How can I make this query work :
SELECT column1.....,SUM(Hits) AS Hits
FROM table
WHERE SUM(Hits) > 100
GROUP BY column1.....
The problem is the where clause, mysql display error :
Error Code : 1111
Invalid use of group function
I try to change the query to :
SELECT column1.....,SUM(Hits) AS Hits
FROM table
WHERE Hits > 100
GROUP BY column1.....
It did not help.
thanks | 0 |
9,188,694 | 02/08/2012 06:21:11 | 1,116,333 | 12/26/2011 12:48:48 | 16 | 1 | Pushnotification issue while sending from browser | while i am using push notification in my application shows an error like...
APNCRON: Started at 2012-02-08 00:32:42
3904
Warning: stream_socket_client() [function.stream-socket-client]: SSL operation failed with code 1. OpenSSL Error messages:
error:14094415:SSL routines:SSL3_READ_BYTES:sslv3 alert certificate expired in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 75
Warning: stream_socket_client() [function.stream-socket-client]: Failed to enable crypto in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 75
Warning: stream_socket_client() [function.stream-socket-client]: unable to connect to ssl://gateway.push.apple.com:2195 (Unknown error) in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 75
[1] Initiating push for UDID:a7fa910aef49a17bbd59ccf5c4487d9856b5b36e DevToken:20e05c55435094c84d27b2f5b9c217b5924fcb91e582388cc5fe9c9231d15c11 MSG:{"aps":{"badge":6,"sound":"default"}}
Warning: fwrite(): supplied argument is not a valid stream resource in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 118
[2] Initiating push for UDID:828ee672c35c99fe8c106ddd2439495aed2fff00 DevToken:b6eb618c8bee91f19561be8b3554823822036d121faac2f7a0d5cc1362c31e96 MSG:{"aps":{"badge":6,"sound":"default"}}
Warning: fwrite(): supplied argument is not a valid stream resource in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 118
close and reconnect the Apple server with 5 sec delay at 100
Warning: stream_socket_client() [function.stream-socket-client]: SSL operation failed with code 1. OpenSSL Error messages:
error:14094415:SSL routines:SSL3_READ_BYTES:sslv3 alert certificate expired in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 91
Warning: stream_socket_client() [function.stream-socket-client]: Failed to enable crypto in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 91
Warning: stream_socket_client() [function.stream-socket-client]: unable to connect to ssl://gateway.push.apple.com:2195 (Unknown error) in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 91
Error with SSL
Please help...
| iphone | null | null | null | null | null | open | Pushnotification issue while sending from browser
===
while i am using push notification in my application shows an error like...
APNCRON: Started at 2012-02-08 00:32:42
3904
Warning: stream_socket_client() [function.stream-socket-client]: SSL operation failed with code 1. OpenSSL Error messages:
error:14094415:SSL routines:SSL3_READ_BYTES:sslv3 alert certificate expired in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 75
Warning: stream_socket_client() [function.stream-socket-client]: Failed to enable crypto in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 75
Warning: stream_socket_client() [function.stream-socket-client]: unable to connect to ssl://gateway.push.apple.com:2195 (Unknown error) in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 75
[1] Initiating push for UDID:a7fa910aef49a17bbd59ccf5c4487d9856b5b36e DevToken:20e05c55435094c84d27b2f5b9c217b5924fcb91e582388cc5fe9c9231d15c11 MSG:{"aps":{"badge":6,"sound":"default"}}
Warning: fwrite(): supplied argument is not a valid stream resource in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 118
[2] Initiating push for UDID:828ee672c35c99fe8c106ddd2439495aed2fff00 DevToken:b6eb618c8bee91f19561be8b3554823822036d121faac2f7a0d5cc1362c31e96 MSG:{"aps":{"badge":6,"sound":"default"}}
Warning: fwrite(): supplied argument is not a valid stream resource in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 118
close and reconnect the Apple server with 5 sec delay at 100
Warning: stream_socket_client() [function.stream-socket-client]: SSL operation failed with code 1. OpenSSL Error messages:
error:14094415:SSL routines:SSL3_READ_BYTES:sslv3 alert certificate expired in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 91
Warning: stream_socket_client() [function.stream-socket-client]: Failed to enable crypto in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 91
Warning: stream_socket_client() [function.stream-socket-client]: unable to connect to ssl://gateway.push.apple.com:2195 (Unknown error) in /var/www/vhosts/solecollector.com/httpdocs/nikeadmin/apn_cron.php on line 91
Error with SSL
Please help...
| 0 |
4,329,773 | 12/01/2010 22:24:25 | 465,159 | 10/03/2010 12:55:20 | 340 | 27 | Problemd with Pygame and Sound | i'm learning pygame: I'm following the tutorial 'pummel the chimp and win $$$'...the standard one ;)
now, i made two '.wav' files, but when i try to play them, i get a strange noise, just like a thud, very short...
i don't get any error message, just this.
what do you think? | python | audio | pygame | null | null | 02/23/2012 11:10:44 | too localized | Problemd with Pygame and Sound
===
i'm learning pygame: I'm following the tutorial 'pummel the chimp and win $$$'...the standard one ;)
now, i made two '.wav' files, but when i try to play them, i get a strange noise, just like a thud, very short...
i don't get any error message, just this.
what do you think? | 3 |
11,495,314 | 07/15/2012 20:21:21 | 1,466,291 | 06/19/2012 11:38:10 | 9 | 0 | Ctrl+alt and shift+alt change language | In windows you have to press ctrl+alt or shift+alt if you want to change language. But, is it possible to have each of this combination for manipulating? I mean, is it possible to press and alt+shift and ctrl+shift in one time without changing every time in settings? | windows | null | null | null | null | 07/15/2012 21:09:01 | off topic | Ctrl+alt and shift+alt change language
===
In windows you have to press ctrl+alt or shift+alt if you want to change language. But, is it possible to have each of this combination for manipulating? I mean, is it possible to press and alt+shift and ctrl+shift in one time without changing every time in settings? | 2 |
2,193,050 | 02/03/2010 15:29:25 | 236,042 | 12/21/2009 13:54:39 | 16 | 1 | how to incorporate a c# variable into parameters of javascript function | I am trying to put a path kept in a string variable (named "ruta") into the parameters of the swfobject.embedSWF funtion but I don't know how to incorporate a c# code into javascript code. Can someone help me please?? thanks!!!!!
<%TarjetaPL tarjetaPl = null;
string ruta = null;
if (Session[Constantes.TarjetaSeleccionada] != null)
{
tarjetaPl = new TarjetaPL((Tarjeta)Session[Constantes.TarjetaSeleccionada]);
ruta = "../../content/images/" + tarjetaPl.TipoDeTarjeta.Banner;
}%>
<script type="text/javascript">
swfobject.embedSWF((HERE COMES THE PATH KEPT IN THE VARIABLE "ruta"), "flashBanner", "300", "120", "9.0.0");
</script> | c# | javascript | null | null | null | null | open | how to incorporate a c# variable into parameters of javascript function
===
I am trying to put a path kept in a string variable (named "ruta") into the parameters of the swfobject.embedSWF funtion but I don't know how to incorporate a c# code into javascript code. Can someone help me please?? thanks!!!!!
<%TarjetaPL tarjetaPl = null;
string ruta = null;
if (Session[Constantes.TarjetaSeleccionada] != null)
{
tarjetaPl = new TarjetaPL((Tarjeta)Session[Constantes.TarjetaSeleccionada]);
ruta = "../../content/images/" + tarjetaPl.TipoDeTarjeta.Banner;
}%>
<script type="text/javascript">
swfobject.embedSWF((HERE COMES THE PATH KEPT IN THE VARIABLE "ruta"), "flashBanner", "300", "120", "9.0.0");
</script> | 0 |
9,523,948 | 03/01/2012 20:56:21 | 1,169,811 | 01/25/2012 18:09:50 | 3 | 0 | Weird Error after trying to display ViewController | I have a ViewController, which is loaded into a tabbar.
At the moment when the whole thing gets displayed, the program receives `SIGABRT`and leaves me with this error:
`
2012-03-01 21:53:21.118 GameControl[78897:207] *** Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[<FavoriteViewController 0x68c8620> setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key singleton.`
Anyone an idea what that could mean?
Heres the code where I setup my views:
RootViewController *rootController = [[RootViewController alloc] initWithNibName:@"RootViewController" bundle:nil];
FavoriteViewController *favoriteController = [[FavoriteViewController alloc] initWithNibName:@"FavoriteViewController" bundle:nil];
rootController.xmlData = self.xmlData;
favoriteController.xmlData = self.xmlData;
navigationController = [[UINavigationController alloc] initWithRootViewController:rootController];
tabBarController = [[UITabBarController alloc] init];
navigationController.tabBarItem = [[UITabBarItem alloc] initWithTitle:@"Root" image:nil tag:0];
favoriteController.tabBarItem = [[UITabBarItem alloc] initWithTitle:@"Favorites" image:nil tag:0];
tabBarController.viewControllers = [NSArray arrayWithObjects:navigationController, nil];
if ([[self.window subviews] count] != 0) {
[[[self.window subviews] objectAtIndex:0] removeFromSuperview];
}
[self.window addSubview:tabBarController.view];
And well, I'm using IOS5, with ARC but no Storyboards.
Thanks! | ios | ios5 | uitabbarcontroller | null | null | 03/13/2012 19:17:59 | too localized | Weird Error after trying to display ViewController
===
I have a ViewController, which is loaded into a tabbar.
At the moment when the whole thing gets displayed, the program receives `SIGABRT`and leaves me with this error:
`
2012-03-01 21:53:21.118 GameControl[78897:207] *** Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[<FavoriteViewController 0x68c8620> setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key singleton.`
Anyone an idea what that could mean?
Heres the code where I setup my views:
RootViewController *rootController = [[RootViewController alloc] initWithNibName:@"RootViewController" bundle:nil];
FavoriteViewController *favoriteController = [[FavoriteViewController alloc] initWithNibName:@"FavoriteViewController" bundle:nil];
rootController.xmlData = self.xmlData;
favoriteController.xmlData = self.xmlData;
navigationController = [[UINavigationController alloc] initWithRootViewController:rootController];
tabBarController = [[UITabBarController alloc] init];
navigationController.tabBarItem = [[UITabBarItem alloc] initWithTitle:@"Root" image:nil tag:0];
favoriteController.tabBarItem = [[UITabBarItem alloc] initWithTitle:@"Favorites" image:nil tag:0];
tabBarController.viewControllers = [NSArray arrayWithObjects:navigationController, nil];
if ([[self.window subviews] count] != 0) {
[[[self.window subviews] objectAtIndex:0] removeFromSuperview];
}
[self.window addSubview:tabBarController.view];
And well, I'm using IOS5, with ARC but no Storyboards.
Thanks! | 3 |
10,308,819 | 04/25/2012 03:07:10 | 1,355,117 | 04/25/2012 02:40:39 | 1 | 0 | Logic Based - Figuring out all combinations of keys for locks given pinnings | I am trying to figure out the how to program logic that is involved with finding all possible key cuts given a specific lock pinning. This site has a very good explanation of what I am trying to achieve:
http://en.allexperts.com/q/Locksmithing-3110/2008/5/Pinning-master-key.htm
I have found a program that does what I am asking, but I would like to figure out the logic behind it. If you put in the key pins and the spacer pins, it calculates all of the possible keys that open the lock. This is easily done by hand on a scrap sheet of paper, but how would I program the logic so a computer can easily find all of the combinations?
Notice, in the image below, that none of the possible Key Cuts are found through methods of subtraction. That is, all possible Key Cuts are combinations of the Key pins added to the value of the spacer pins.
http://i.imgur.com/iMUxE.jpg
On a side note: Locksmithing and computer programming have a lot of similar terms. Finding keywords that accurately represent this problem was pretty hard. | locking | key | logic | pinning | challenges | 05/04/2012 20:50:48 | not a real question | Logic Based - Figuring out all combinations of keys for locks given pinnings
===
I am trying to figure out the how to program logic that is involved with finding all possible key cuts given a specific lock pinning. This site has a very good explanation of what I am trying to achieve:
http://en.allexperts.com/q/Locksmithing-3110/2008/5/Pinning-master-key.htm
I have found a program that does what I am asking, but I would like to figure out the logic behind it. If you put in the key pins and the spacer pins, it calculates all of the possible keys that open the lock. This is easily done by hand on a scrap sheet of paper, but how would I program the logic so a computer can easily find all of the combinations?
Notice, in the image below, that none of the possible Key Cuts are found through methods of subtraction. That is, all possible Key Cuts are combinations of the Key pins added to the value of the spacer pins.
http://i.imgur.com/iMUxE.jpg
On a side note: Locksmithing and computer programming have a lot of similar terms. Finding keywords that accurately represent this problem was pretty hard. | 1 |
7,697,370 | 10/08/2011 14:13:53 | 985,415 | 10/08/2011 14:03:58 | 1 | 0 | MATLAB audiorecorder and wavwrite | While reading the website of mathworks.com I learned that they are discouraging the usage of wavrecord function, because its going to be deprecated soon, so I decided to use the audiorecorder instead. everything was fine even the play function was also playing the recorded audio but when i use wavwrite function to write to a wav file its not sounding well, basically I noticed that the duration is not set properly. I am showing the program, please suggest me how to make it correct. Thank you.
% Here it starts.......................................
fs = 44100
bits = 16
recObj = audiorecorder(fs, bits, 1);
%get(recObj)
%Collect a sample of your speech with a microphone, and plot the signal data:
% Record your voice for 5 seconds.
recObj = audiorecorder;
disp('Start speaking.')
recordblocking(recObj, 5);
disp('End of Recording.');
% Play back the recording.
play(recObj);
% Store data in double-precision array.
myRecording = getaudiodata(recObj);
%disp(size(myRecording));
% Plot the waveform.
plot(myRecording);
wavwrite(myRecording, fs, bits,'sample01_6k');
%wavplay(myRecording,fs);
| matlab | audio | signal-processing | null | null | 10/09/2011 18:09:50 | too localized | MATLAB audiorecorder and wavwrite
===
While reading the website of mathworks.com I learned that they are discouraging the usage of wavrecord function, because its going to be deprecated soon, so I decided to use the audiorecorder instead. everything was fine even the play function was also playing the recorded audio but when i use wavwrite function to write to a wav file its not sounding well, basically I noticed that the duration is not set properly. I am showing the program, please suggest me how to make it correct. Thank you.
% Here it starts.......................................
fs = 44100
bits = 16
recObj = audiorecorder(fs, bits, 1);
%get(recObj)
%Collect a sample of your speech with a microphone, and plot the signal data:
% Record your voice for 5 seconds.
recObj = audiorecorder;
disp('Start speaking.')
recordblocking(recObj, 5);
disp('End of Recording.');
% Play back the recording.
play(recObj);
% Store data in double-precision array.
myRecording = getaudiodata(recObj);
%disp(size(myRecording));
% Plot the waveform.
plot(myRecording);
wavwrite(myRecording, fs, bits,'sample01_6k');
%wavplay(myRecording,fs);
| 3 |
386,753 | 12/22/2008 17:06:00 | 24,459 | 10/02/2008 10:25:29 | 394 | 16 | How do I convert part of a python tuple (byte array) into an integer | I am trying to talk to a device using python. I have been handed a tuple of bytes which contains the storage information. How can I convert the data into the correct values:
response = (0, 0, 117, 143, 6)
The first 4 values are a 32-bit int telling me how many bytes have been used and the last value is the percentage used.
I can access the tuple as response[0] but cannot see how I can get the first 4 values into the int I require.
| python | tuples | null | null | null | null | open | How do I convert part of a python tuple (byte array) into an integer
===
I am trying to talk to a device using python. I have been handed a tuple of bytes which contains the storage information. How can I convert the data into the correct values:
response = (0, 0, 117, 143, 6)
The first 4 values are a 32-bit int telling me how many bytes have been used and the last value is the percentage used.
I can access the tuple as response[0] but cannot see how I can get the first 4 values into the int I require.
| 0 |
7,104,662 | 08/18/2011 08:44:36 | 894,862 | 08/15/2011 11:51:18 | 1 | 0 | Why "\n" is true doesn't compare? | Look at the sceene here , please:
http://social.microsoft.com/Forums/getfile/3600/
why it's not matching? | c# | xml | file | compare | match | 08/18/2011 10:30:19 | not a real question | Why "\n" is true doesn't compare?
===
Look at the sceene here , please:
http://social.microsoft.com/Forums/getfile/3600/
why it's not matching? | 1 |
7,667,941 | 10/05/2011 21:25:52 | 943,332 | 09/13/2011 20:14:06 | 6 | 0 | Auth token facebook php error | It's weird because on my canvas page for my facebook app I get all these php errors about my auth_token and then it redirects and works as it should. Can someone help me figure this out por favor? Heres my php code at the top of the page:
<?php
$app_id = "181247432419054";
$app_secret = "xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx";
$my_url = "https://apps.facebook.com/wellnessq/";
session_register();
session_start();
if (!isset($_REQUEST["code"]))
{
$_SESSION['state'] = md5(uniqid(rand(), TRUE)); //CSRF protection
$dialog_url = "http://www.facebook.com/dialog/oauth?client_id="
. $app_id . "&redirect_uri=" . urlencode($my_url) . "&scope=email&state="
. $_SESSION['state'];
echo("<script> top.location.href='" . $dialog_url . "'</script>");
}
$code = $_REQUEST['code'];
{
$token_url = "https://graph.facebook.com/oauth/access_token?"
. "client_id=" . $app_id . "&redirect_uri=" . urlencode($my_url)
. "&client_secret=" . $app_secret . "&code=" . $code;
$response = file_get_contents($token_url);
$params = null;
parse_str($response, $params);
$graph_url = "https://graph.facebook.com/me?access_token="
. $params['access_token'];
$user = json_decode(file_get_contents($graph_url));
}
?>
The first error message starts at $code = $_REQUEST['code']; and then is followed by a few more. I cant post a screen shot because I have too few reputation points =/ grrr But here's the error messages:
Notice: Undefined index: code in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 19
Warning: file_get_contents(https://graph.facebook.com/oauth/access_token?client_id=181247432419054&redirect_uri=https%3A%2F%2Fapps.facebook.com%2Fwellnessq%2F&client_secret=xxxxxxxxxxxxxxxxx&code=) [function.file-get-contents]: failed to open stream: HTTP request failed! HTTP/1.0 400 Bad Request in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 25
Notice: Undefined index: access_token in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 30
Warning: file_get_contents(https://graph.facebook.com/me?access_token=) [function.file-get-contents]: failed to open stream: HTTP request failed! HTTP/1.0 400 Bad Request in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 32
Thanks!
| facebook | error-message | token | authentication | auth-token | null | open | Auth token facebook php error
===
It's weird because on my canvas page for my facebook app I get all these php errors about my auth_token and then it redirects and works as it should. Can someone help me figure this out por favor? Heres my php code at the top of the page:
<?php
$app_id = "181247432419054";
$app_secret = "xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx";
$my_url = "https://apps.facebook.com/wellnessq/";
session_register();
session_start();
if (!isset($_REQUEST["code"]))
{
$_SESSION['state'] = md5(uniqid(rand(), TRUE)); //CSRF protection
$dialog_url = "http://www.facebook.com/dialog/oauth?client_id="
. $app_id . "&redirect_uri=" . urlencode($my_url) . "&scope=email&state="
. $_SESSION['state'];
echo("<script> top.location.href='" . $dialog_url . "'</script>");
}
$code = $_REQUEST['code'];
{
$token_url = "https://graph.facebook.com/oauth/access_token?"
. "client_id=" . $app_id . "&redirect_uri=" . urlencode($my_url)
. "&client_secret=" . $app_secret . "&code=" . $code;
$response = file_get_contents($token_url);
$params = null;
parse_str($response, $params);
$graph_url = "https://graph.facebook.com/me?access_token="
. $params['access_token'];
$user = json_decode(file_get_contents($graph_url));
}
?>
The first error message starts at $code = $_REQUEST['code']; and then is followed by a few more. I cant post a screen shot because I have too few reputation points =/ grrr But here's the error messages:
Notice: Undefined index: code in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 19
Warning: file_get_contents(https://graph.facebook.com/oauth/access_token?client_id=181247432419054&redirect_uri=https%3A%2F%2Fapps.facebook.com%2Fwellnessq%2F&client_secret=xxxxxxxxxxxxxxxxx&code=) [function.file-get-contents]: failed to open stream: HTTP request failed! HTTP/1.0 400 Bad Request in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 25
Notice: Undefined index: access_token in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 30
Warning: file_get_contents(https://graph.facebook.com/me?access_token=) [function.file-get-contents]: failed to open stream: HTTP request failed! HTTP/1.0 400 Bad Request in D:\Extranet\www.mysite.com\manager\here\core.functions.php(663) : eval()'d code on line 32
Thanks!
| 0 |
10,319,298 | 04/25/2012 15:57:46 | 215,541 | 11/20/2009 15:35:41 | 474 | 5 | CSS HTML how to ignore some css for non ie7 or ie8 | So I have the following CSS for getting a background image to size to 100% of my div.
#solutionsNav div.leadgen {
background:url(/images/leadGen_bg2.png) no-repeat;
background-size: 100% 100%;
filter: progid:DXImageTransform.Microsoft.AlphaImageLoader(src='/images/leadGen_bg2.png', sizingMethod='scale');
-ms-filter: "progid:DXImageTransform.Microsoft.AlphaImageLoader(src='/images/leadGen_bg2.png', sizingMethod='scale')";
behavior: url(/scripts/PIE.htc);
padding: 10px;
color: #FFF;
cursor: pointer;
}
This seems to work now in all browsers but the only problem is that in IE7 and IE8 I can see the outline of the background:url(/images/leadGen_bg2.png) when the image is stretched to fit the div. And I have tested that if I take out background:url(/images/leadGen_bg2.png) in the above it works fine still in IE7 and IE8 but can no longer see it in firefox.
How could I get around this ? | html | css | null | null | null | null | open | CSS HTML how to ignore some css for non ie7 or ie8
===
So I have the following CSS for getting a background image to size to 100% of my div.
#solutionsNav div.leadgen {
background:url(/images/leadGen_bg2.png) no-repeat;
background-size: 100% 100%;
filter: progid:DXImageTransform.Microsoft.AlphaImageLoader(src='/images/leadGen_bg2.png', sizingMethod='scale');
-ms-filter: "progid:DXImageTransform.Microsoft.AlphaImageLoader(src='/images/leadGen_bg2.png', sizingMethod='scale')";
behavior: url(/scripts/PIE.htc);
padding: 10px;
color: #FFF;
cursor: pointer;
}
This seems to work now in all browsers but the only problem is that in IE7 and IE8 I can see the outline of the background:url(/images/leadGen_bg2.png) when the image is stretched to fit the div. And I have tested that if I take out background:url(/images/leadGen_bg2.png) in the above it works fine still in IE7 and IE8 but can no longer see it in firefox.
How could I get around this ? | 0 |
10,368,607 | 04/29/2012 00:02:50 | 1,319,509 | 04/07/2012 19:18:18 | 1 | 0 | Visual C# problems | I have a problem.
I have a project with much of code. But at the moment, when I write a code, this code doesn't work. For example if I want call MessageBox - it doesn't work. If I comment some piece of code(it should doesn't work), but this commented code is working. I don't know what's happening. May be it' a cache, I don't know how to clear it.
PS: If I go to: ...\Project\bin\Debug and run .exe - it also doesn't works, but if I go to: ...\Project\bin\Release and run .exe file - it works good.
I don't know what to do :-/ . Your ideas? | .net | null | null | null | null | 04/29/2012 00:09:20 | not a real question | Visual C# problems
===
I have a problem.
I have a project with much of code. But at the moment, when I write a code, this code doesn't work. For example if I want call MessageBox - it doesn't work. If I comment some piece of code(it should doesn't work), but this commented code is working. I don't know what's happening. May be it' a cache, I don't know how to clear it.
PS: If I go to: ...\Project\bin\Debug and run .exe - it also doesn't works, but if I go to: ...\Project\bin\Release and run .exe file - it works good.
I don't know what to do :-/ . Your ideas? | 1 |
1,460,009 | 09/22/2009 13:09:06 | 42,111 | 12/01/2008 12:13:40 | 64 | 2 | Magento tutorial create a module for the backand (admin page) | Does anyone know a good tutorial for this subject. I want to create a module (extension) with more than one page. The extension must contain one overview page and a form to create a item. | zend-framework | php5 | php | null | null | 07/06/2012 12:44:55 | not constructive | Magento tutorial create a module for the backand (admin page)
===
Does anyone know a good tutorial for this subject. I want to create a module (extension) with more than one page. The extension must contain one overview page and a form to create a item. | 4 |
6,554,724 | 07/02/2011 02:17:24 | 825,702 | 07/02/2011 02:17:24 | 1 | 0 | Regex problem :-( | I have a following file contents..
#=======================================
#
# Aligned_sequences: 2
# 1: repeat
# 2: repeat
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 114
# Identity: 15/114 (13.2%)
# Similarity: 21/114 (18.4%)
# Gaps: 73/114 (64.0%)
# Score: 20.0
#
#
#=======================================
repeat 1 --MPEGRPRVKVIVASLALFVLFYFMGYYMLNPILRTLHAEGLIPGKSEV 48
:||.|..| |..|.:|| .:
repeat 1 VVVPEHRGTV--------------FAVYSVLN----------------NL 20
repeat 49 EWRFNAGLIATLLQGTGLVLSFVWGVLADK-------------------- 78
.|.....:...||:... ||.||:
repeat 21 GWTLGPTVYTLLLKAFS-------GVYADQVSAMTAAASTIVSLWLIPAL 63
repeat 78 -------------- 78
repeat 64 CWLLLHRVYPKEKI 77
#---------------------------------------
#---------------------------------------
I want to extract just
repeat 1 --MPEGRPRVKVIVASLALFVLFYFMGYYMLNPILRTLHAEGLIPGKSEV 48
:||.|..| |..|.:|| .:
repeat 1 VVVPEHRGTV--------------FAVYSVLN----------------NL 20
repeat 49 EWRFNAGLIATLLQGTGLVLSFVWGVLADK-------------------- 78
.|.....:...||:... ||.||:
repeat 21 GWTLGPTVYTLLLKAFS-------GVYADQVSAMTAAASTIVSLWLIPAL 63
repeat 78 -------------- 78
repeat 64 CWLLLHRVYPKEKI 77
How do I do that using python.. | python | regex | null | null | null | 07/02/2011 02:52:56 | not a real question | Regex problem :-(
===
I have a following file contents..
#=======================================
#
# Aligned_sequences: 2
# 1: repeat
# 2: repeat
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 114
# Identity: 15/114 (13.2%)
# Similarity: 21/114 (18.4%)
# Gaps: 73/114 (64.0%)
# Score: 20.0
#
#
#=======================================
repeat 1 --MPEGRPRVKVIVASLALFVLFYFMGYYMLNPILRTLHAEGLIPGKSEV 48
:||.|..| |..|.:|| .:
repeat 1 VVVPEHRGTV--------------FAVYSVLN----------------NL 20
repeat 49 EWRFNAGLIATLLQGTGLVLSFVWGVLADK-------------------- 78
.|.....:...||:... ||.||:
repeat 21 GWTLGPTVYTLLLKAFS-------GVYADQVSAMTAAASTIVSLWLIPAL 63
repeat 78 -------------- 78
repeat 64 CWLLLHRVYPKEKI 77
#---------------------------------------
#---------------------------------------
I want to extract just
repeat 1 --MPEGRPRVKVIVASLALFVLFYFMGYYMLNPILRTLHAEGLIPGKSEV 48
:||.|..| |..|.:|| .:
repeat 1 VVVPEHRGTV--------------FAVYSVLN----------------NL 20
repeat 49 EWRFNAGLIATLLQGTGLVLSFVWGVLADK-------------------- 78
.|.....:...||:... ||.||:
repeat 21 GWTLGPTVYTLLLKAFS-------GVYADQVSAMTAAASTIVSLWLIPAL 63
repeat 78 -------------- 78
repeat 64 CWLLLHRVYPKEKI 77
How do I do that using python.. | 1 |
4,598,356 | 01/04/2011 20:59:33 | 476,410 | 10/14/2010 23:44:15 | 18 | 2 | Domain Name Suffixes | Not sure if this is a new thing, but I've begun to notice a lot of sites moving away from traditional .com-ending domain names to things like .ly, .us, etc as parts of their name (mir.aculo.us, bit.ly).
Are there any security issues to starting your website with one of these? I was thinking about getting a .ly one, but found that they can be much more expensive than the ~$10/yr registration I can get with some .com's. Would I be subject to that country's laws/taxes?
Are there any other endings people like besides .ly?
Any other issues y'all have encountered.
Looking forward to hearing what y'all think. | domain | suffix | null | null | null | null | open | Domain Name Suffixes
===
Not sure if this is a new thing, but I've begun to notice a lot of sites moving away from traditional .com-ending domain names to things like .ly, .us, etc as parts of their name (mir.aculo.us, bit.ly).
Are there any security issues to starting your website with one of these? I was thinking about getting a .ly one, but found that they can be much more expensive than the ~$10/yr registration I can get with some .com's. Would I be subject to that country's laws/taxes?
Are there any other endings people like besides .ly?
Any other issues y'all have encountered.
Looking forward to hearing what y'all think. | 0 |
1,517,581 | 10/04/2009 22:36:02 | 948 | 08/10/2008 22:47:18 | 13 | 0 | O'Reilly Beautiful ... series | O'Reilly has a interesting book series with essays on computer science related topics. The series consist of 6 titles.
1. Beautiful Code
2. Beautiful Architecture
3. Beautiful Testing
4. Beautiful Teams
5. Beautiful Security
6. Beautiful Data
What are your experiences with these books? Are they all interesting to a general programming audience?
(please limit your answer to one book for easy voting) | books | null | null | null | null | 01/06/2012 15:49:52 | not constructive | O'Reilly Beautiful ... series
===
O'Reilly has a interesting book series with essays on computer science related topics. The series consist of 6 titles.
1. Beautiful Code
2. Beautiful Architecture
3. Beautiful Testing
4. Beautiful Teams
5. Beautiful Security
6. Beautiful Data
What are your experiences with these books? Are they all interesting to a general programming audience?
(please limit your answer to one book for easy voting) | 4 |
5,426,129 | 03/24/2011 22:02:13 | 625,491 | 02/20/2011 18:21:54 | 17 | 0 | XAMPP and SEO URL | I installed **xampp** on my local pc and want to use **SEO URL**, but it does not work :(
I disabled the "#" in my httpd conf at the line "**LoadModule rewrite_module modules/mod_rewrite.so**"
I google this problem for hours and didnt find a solution.
Here is my setup:
- Install Path: **C:/xampp/htdocs/**
- **LoadModule rewrite_module modules/mod_rewrite.so** (is enabled - phpinfo..)
it would be very nice if someone could send me a working .htaccess which works on xampp and tell me how to setup my xampp...
Thank you | apache | seo | xampp | null | null | 03/25/2011 10:15:12 | off topic | XAMPP and SEO URL
===
I installed **xampp** on my local pc and want to use **SEO URL**, but it does not work :(
I disabled the "#" in my httpd conf at the line "**LoadModule rewrite_module modules/mod_rewrite.so**"
I google this problem for hours and didnt find a solution.
Here is my setup:
- Install Path: **C:/xampp/htdocs/**
- **LoadModule rewrite_module modules/mod_rewrite.so** (is enabled - phpinfo..)
it would be very nice if someone could send me a working .htaccess which works on xampp and tell me how to setup my xampp...
Thank you | 2 |
10,679,116 | 05/21/2012 03:11:47 | 1,215,629 | 02/17/2012 07:11:28 | 1 | 0 | Parse HTMl with </br> | I have a HTML string:
<span class=thisword>anh</span><br />
-grand frère</span><br />
-cousin (fils d'un grand frère ou d'une grande soeur du père ou de la mère)</span><br />
-(nom générique désignant un homme encore jeune)</span><br />
I want get string in it...
I done as follow:
Elements ed=docu.getElementsByTag("span");
for(Element e: ed)
{
System.out.println(removeHTML(e.toString())); //removeHTML is method remove tags
//in HTML receive
}
But it only display string "anh".I want display "anh -grand frère -cousin (fils d'un grand frère ou d'une grande soeur du père ou de la mère) -(nom générique désignant un homme encore jeune)" but I don't success...Can you help me..? | android | null | null | null | null | null | open | Parse HTMl with </br>
===
I have a HTML string:
<span class=thisword>anh</span><br />
-grand frère</span><br />
-cousin (fils d'un grand frère ou d'une grande soeur du père ou de la mère)</span><br />
-(nom générique désignant un homme encore jeune)</span><br />
I want get string in it...
I done as follow:
Elements ed=docu.getElementsByTag("span");
for(Element e: ed)
{
System.out.println(removeHTML(e.toString())); //removeHTML is method remove tags
//in HTML receive
}
But it only display string "anh".I want display "anh -grand frère -cousin (fils d'un grand frère ou d'une grande soeur du père ou de la mère) -(nom générique désignant un homme encore jeune)" but I don't success...Can you help me..? | 0 |
9,002,706 | 01/25/2012 12:28:05 | 397,991 | 07/21/2010 13:15:36 | 1,504 | 13 | How to get a text from a Toast object | I have a toast shown up, then I store the `Toast` object somewhere and later I need to get a text which was shown. But looking into [APIs][1] I don't see a method to retrieve this info. Please advice.
[1]: http://developer.android.com/reference/android/widget/Toast.html | android | toast | null | null | null | 01/25/2012 14:00:33 | not a real question | How to get a text from a Toast object
===
I have a toast shown up, then I store the `Toast` object somewhere and later I need to get a text which was shown. But looking into [APIs][1] I don't see a method to retrieve this info. Please advice.
[1]: http://developer.android.com/reference/android/widget/Toast.html | 1 |
1,364,304 | 09/01/2009 19:45:14 | 56,076 | 01/17/2009 00:31:26 | 2,395 | 128 | Where are the ROWE companies? | Anybody working in a [ROWE][1]? What do you think? Anybody that's been around long enough to see a variety of management styles, that's now in a ROWE? Anybody have a list of genuine ROWEs?
[1]: http://en.wikipedia.org/wiki/ROWE | rowe | null | null | null | null | 09/01/2009 19:50:37 | off topic | Where are the ROWE companies?
===
Anybody working in a [ROWE][1]? What do you think? Anybody that's been around long enough to see a variety of management styles, that's now in a ROWE? Anybody have a list of genuine ROWEs?
[1]: http://en.wikipedia.org/wiki/ROWE | 2 |
11,505,607 | 07/16/2012 13:40:08 | 1,529,038 | 07/16/2012 13:29:33 | 1 | 0 | Local DNS Server on Non-controlled Network | I work with a small group of people and we have a network which is provided by the workspace. As such, we have no control over the DHCP or DNS services. The DNS provided is horrendous, and as a consequence we have to use hardcoded IP addresses rather than hostnames, which, as we are obliged to use a DHCP server over which we have no control, keeps falling over every time one of the IP addresses change. As an example we have to machines, both connected to the same subnet, one called \\\foo (192.168.0.2) and one called \\\bar (192.168.0.3). They can connect to each other using the IP addresses but not using the hostnames, as the DNS server will not resolve them correctly.
What I would like to do would be to implement a simple DNS server that sits on the network and picks up these names and forwards them as appropriate. However, I'm very much a 'n00b' at this. I'm assuming if I just dump a server on the network it wont work as the workstations are getting their DNS servers assigned by DHCP. It would be nice if I could have like a transparent proxy that sits there and 'interrupts' those requests.
Any suggestions? All help gratefully received! | dns | dhcp | null | null | null | 07/16/2012 13:50:52 | off topic | Local DNS Server on Non-controlled Network
===
I work with a small group of people and we have a network which is provided by the workspace. As such, we have no control over the DHCP or DNS services. The DNS provided is horrendous, and as a consequence we have to use hardcoded IP addresses rather than hostnames, which, as we are obliged to use a DHCP server over which we have no control, keeps falling over every time one of the IP addresses change. As an example we have to machines, both connected to the same subnet, one called \\\foo (192.168.0.2) and one called \\\bar (192.168.0.3). They can connect to each other using the IP addresses but not using the hostnames, as the DNS server will not resolve them correctly.
What I would like to do would be to implement a simple DNS server that sits on the network and picks up these names and forwards them as appropriate. However, I'm very much a 'n00b' at this. I'm assuming if I just dump a server on the network it wont work as the workstations are getting their DNS servers assigned by DHCP. It would be nice if I could have like a transparent proxy that sits there and 'interrupts' those requests.
Any suggestions? All help gratefully received! | 2 |
9,627,607 | 03/09/2012 01:14:03 | 1,258,276 | 03/09/2012 00:55:11 | 1 | 0 | Android Widget Launcher Activity not found | I am new to Android SDK,but I know JAVA a little.I am on SDK v4.The problem is that,I tried to make 'HelloWidget' Home Screen Widget (with just a text box),and when I try to run the project,the console gives me
No Launcher Activity Found!
The application will only sync the package to the device!
And my app is nowhere to be found in the AVD.I had tried putting the .MAIN and Launcher in Intent filter,but no good.Here are my files:
AndroidManifest.xml
<?xml version="1.0" encoding="utf-8"?>
<manifest xmlns:android="http://schemas.android.com/apk/res/android"
package="ax.startup"
android:versionCode="1"
android:versionName="1.0" >
<uses-sdk android:minSdkVersion="15" />
<uses-permission android:name="android.permission.INTERNET"/>
<application
android:icon="@drawable/ic_launcher"
android:label="@string/app_name" >
<!-- Broadcast Receiver that will process AppWidget updates -->
<receiver android:name=".AxStartup" android:label="AxStartup">
<intent-filter>
<action android:name="android.appwidget.action.APPWIDGET_UPDATE" />
<action android:name="android.intent.action.MAIN" />
<category android:name="android.intent.category.LAUNCHER" />
</intent-filter>
<meta-data android:name="android.appwidget.provider"
android:resource="@layout/startup_info" />
</receiver>
</application>
</manifest>
main.xml
<?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
android:orientation="vertical" >
<EditText
android:id="@+id/txt1"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:text="HELLO WORLD"
/>
</LinearLayout>
startup_info.xml
<?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:orientation="vertical" >
<EditText
android:id="@+id/txt1"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:inputType="textMultiLine"
android:text="ITS WORKING DUDE!"
android:minWidth="146dip"
android:minHeight="72dip"
android:updatePeriodMillis="10000"
android:initialLayout="@layout/startup_info">
<requestFocus />
</EditText>
</LinearLayout>
Java file
package ax.startup;
import android.appwidget.AppWidgetProvider;
public class AxStartup extends AppWidgetProvider {
}
I followed the tutorial from here:
http://www.helloandroid.com/files/xmaswidget/android_howto-hellowidget.pdf
And another strange problem is that when I long press on desktop,only options to change wallpaper is coming.There is no 'Add to Home Screen' or 'Widgets' or any other menu!!!
Please tell me what is the problem.
| android | widget | launcher | null | null | null | open | Android Widget Launcher Activity not found
===
I am new to Android SDK,but I know JAVA a little.I am on SDK v4.The problem is that,I tried to make 'HelloWidget' Home Screen Widget (with just a text box),and when I try to run the project,the console gives me
No Launcher Activity Found!
The application will only sync the package to the device!
And my app is nowhere to be found in the AVD.I had tried putting the .MAIN and Launcher in Intent filter,but no good.Here are my files:
AndroidManifest.xml
<?xml version="1.0" encoding="utf-8"?>
<manifest xmlns:android="http://schemas.android.com/apk/res/android"
package="ax.startup"
android:versionCode="1"
android:versionName="1.0" >
<uses-sdk android:minSdkVersion="15" />
<uses-permission android:name="android.permission.INTERNET"/>
<application
android:icon="@drawable/ic_launcher"
android:label="@string/app_name" >
<!-- Broadcast Receiver that will process AppWidget updates -->
<receiver android:name=".AxStartup" android:label="AxStartup">
<intent-filter>
<action android:name="android.appwidget.action.APPWIDGET_UPDATE" />
<action android:name="android.intent.action.MAIN" />
<category android:name="android.intent.category.LAUNCHER" />
</intent-filter>
<meta-data android:name="android.appwidget.provider"
android:resource="@layout/startup_info" />
</receiver>
</application>
</manifest>
main.xml
<?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:layout_width="fill_parent"
android:layout_height="fill_parent"
android:orientation="vertical" >
<EditText
android:id="@+id/txt1"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:text="HELLO WORLD"
/>
</LinearLayout>
startup_info.xml
<?xml version="1.0" encoding="utf-8"?>
<LinearLayout xmlns:android="http://schemas.android.com/apk/res/android"
android:layout_width="match_parent"
android:layout_height="match_parent"
android:orientation="vertical" >
<EditText
android:id="@+id/txt1"
android:layout_width="match_parent"
android:layout_height="wrap_content"
android:inputType="textMultiLine"
android:text="ITS WORKING DUDE!"
android:minWidth="146dip"
android:minHeight="72dip"
android:updatePeriodMillis="10000"
android:initialLayout="@layout/startup_info">
<requestFocus />
</EditText>
</LinearLayout>
Java file
package ax.startup;
import android.appwidget.AppWidgetProvider;
public class AxStartup extends AppWidgetProvider {
}
I followed the tutorial from here:
http://www.helloandroid.com/files/xmaswidget/android_howto-hellowidget.pdf
And another strange problem is that when I long press on desktop,only options to change wallpaper is coming.There is no 'Add to Home Screen' or 'Widgets' or any other menu!!!
Please tell me what is the problem.
| 0 |
8,933,061 | 01/19/2012 20:48:25 | 998,117 | 10/16/2011 19:00:04 | 42 | 0 | If I'm using ls and grep, how do I specify the directory I want to search in? | I can do the question I need to do if I cd into the right directory, but our prof wants us to be able to do it from anywhere.
I can do `ls | grep *pattern*` and it works from the directory I'm in, but how do I do it anywhere by specifying the path? | regex | grep | null | null | null | 01/22/2012 01:00:13 | too localized | If I'm using ls and grep, how do I specify the directory I want to search in?
===
I can do the question I need to do if I cd into the right directory, but our prof wants us to be able to do it from anywhere.
I can do `ls | grep *pattern*` and it works from the directory I'm in, but how do I do it anywhere by specifying the path? | 3 |
6,752,666 | 07/19/2011 19:05:33 | 505,595 | 11/12/2010 10:13:54 | 112 | 0 | how to get statuses from current_user.friends + limit to 10 statuses | this is my code:
@current_user_statuses = current_user.statuses.limit(10)
@friends_statuses = current_user.friends.collect(&:statuses)
if current_user.friends.collect(&:doweets)[0].any?
@friends_statuses = current_user.friends.collect(&:statuses)[0]
end
@statuses = (@current_user_statuses + @friends_statuses).sort_by{ |d| - d.created_at.to_i
i want to make it like this:
@current_user_statuses = current_user.statuses.limit(10)
@friends_statuses = current_user.friends.statuses.limit(10)
@statuses = (@current_user_statuses + @friends_statuses).sort_by{ |d| - d.created_at.to_i
but when i do it i get an error...
how can i do it?
my models:
Friendships model:
belongs_to :user
belongs_to :friend, :class_name => "User", :foreign_key => "friend_id"
def self.are_friends(user, friend)
return false if user == friend
return true unless find_by_user_id_and_friend_id(user, friend).nil?
return true unless find_by_user_id_and_friend_id(friend, user).nil?
return false
end
def self.request(user, friend)
return false if are_friends(user, friend)
return false if user == friend
f1 = new(:user => user, :friend => friend, :status => "pending")
f2 = new(:user => friend, :friend => user, :status => "requested")
transaction do
f1.save
f2.save
end
end
def self.accept(user, friend)
f1 = find_by_user_id_and_friend_id(user, friend)
f2 = find_by_user_id_and_friend_id(friend, user)
if f1.nil? or f2.nil?
return false
else
transaction do
f1.update_attributes(:status => "accepted")
f2.update_attributes(:status => "accepted")
end
end
return true
end
def self.reject(user, friend)
f1 = find_by_user_id_and_friend_id(user, friend)
f2 = find_by_user_id_and_friend_id(friend, user)
if f1.nil? or f2.nil?
return false
else
transaction do
f1.destroy
f2.destroy
return true
end
end
end
user model:
has_many :doweets
has_many :friendships
has_many :friends,
:through => :friendships,
:conditions => "status = 'accepted'"
has_many :requested_friends,
:through => :friendships,
:source => :friend,
:conditions => "status = 'requested'",
:order => :created_at
has_many :pending_friends,
:through => :friendships,
:source => :friend,
:conditions => "status = 'pending'",
:order => :created_at
thanks!!
| ruby-on-rails | ruby | ruby-on-rails-3 | null | null | null | open | how to get statuses from current_user.friends + limit to 10 statuses
===
this is my code:
@current_user_statuses = current_user.statuses.limit(10)
@friends_statuses = current_user.friends.collect(&:statuses)
if current_user.friends.collect(&:doweets)[0].any?
@friends_statuses = current_user.friends.collect(&:statuses)[0]
end
@statuses = (@current_user_statuses + @friends_statuses).sort_by{ |d| - d.created_at.to_i
i want to make it like this:
@current_user_statuses = current_user.statuses.limit(10)
@friends_statuses = current_user.friends.statuses.limit(10)
@statuses = (@current_user_statuses + @friends_statuses).sort_by{ |d| - d.created_at.to_i
but when i do it i get an error...
how can i do it?
my models:
Friendships model:
belongs_to :user
belongs_to :friend, :class_name => "User", :foreign_key => "friend_id"
def self.are_friends(user, friend)
return false if user == friend
return true unless find_by_user_id_and_friend_id(user, friend).nil?
return true unless find_by_user_id_and_friend_id(friend, user).nil?
return false
end
def self.request(user, friend)
return false if are_friends(user, friend)
return false if user == friend
f1 = new(:user => user, :friend => friend, :status => "pending")
f2 = new(:user => friend, :friend => user, :status => "requested")
transaction do
f1.save
f2.save
end
end
def self.accept(user, friend)
f1 = find_by_user_id_and_friend_id(user, friend)
f2 = find_by_user_id_and_friend_id(friend, user)
if f1.nil? or f2.nil?
return false
else
transaction do
f1.update_attributes(:status => "accepted")
f2.update_attributes(:status => "accepted")
end
end
return true
end
def self.reject(user, friend)
f1 = find_by_user_id_and_friend_id(user, friend)
f2 = find_by_user_id_and_friend_id(friend, user)
if f1.nil? or f2.nil?
return false
else
transaction do
f1.destroy
f2.destroy
return true
end
end
end
user model:
has_many :doweets
has_many :friendships
has_many :friends,
:through => :friendships,
:conditions => "status = 'accepted'"
has_many :requested_friends,
:through => :friendships,
:source => :friend,
:conditions => "status = 'requested'",
:order => :created_at
has_many :pending_friends,
:through => :friendships,
:source => :friend,
:conditions => "status = 'pending'",
:order => :created_at
thanks!!
| 0 |
6,018,837 | 05/16/2011 14:24:34 | 638,978 | 03/01/2011 07:48:02 | 24 | 0 | Prolog file Extension problem ? | I have a.txt file.
How can I make a.pl?
I use swi prolog.
Thank a lot
| file | prolog | null | null | null | 05/16/2011 19:33:24 | too localized | Prolog file Extension problem ?
===
I have a.txt file.
How can I make a.pl?
I use swi prolog.
Thank a lot
| 3 |
4,667,591 | 01/12/2011 10:17:33 | 459,041 | 09/27/2010 01:00:48 | 63 | 4 | Forwarding Emails With Postfix | I am absolutely at a loss for this, because I feel like it should be really simple.
I have postfix installed, and all I want it to do is listen for emails directed to my domain name, and send them to another email address according to some mapping.
My /etc/postfix/main.cf file is:
myorigin = MYDOMAIN.COM
mydestination = localhost
mynetworks_style = host
relay_domains = gmail.com
alias_maps = hash:/etc/postfix/aliases
virtual_alias_domains = MYDOMAIN.COM
virtual_alias_maps = hash:/etc/postfix/virtual
My /etc/postfix/aliases file is:
postmaster: USER
root: USER
And My /etc/postfix/virtual is:
ME@MYDOMAIN.COM you@gmail.com
I restart postfix like:
sudo postalias /etc/postfix/aliases
sudo postmap /etc/postfix/virtual
sudo service postfix restart
This configuration seems to work a little. Internally-generated emails get to my gmail account. And surprisingly, emails I send through gmail get there as well (which to me is the baffling part), but if it's an email from somewhere else, say, yahoo, it never gets there. | email | postfix | forwarding | null | null | 09/04/2011 15:48:40 | off topic | Forwarding Emails With Postfix
===
I am absolutely at a loss for this, because I feel like it should be really simple.
I have postfix installed, and all I want it to do is listen for emails directed to my domain name, and send them to another email address according to some mapping.
My /etc/postfix/main.cf file is:
myorigin = MYDOMAIN.COM
mydestination = localhost
mynetworks_style = host
relay_domains = gmail.com
alias_maps = hash:/etc/postfix/aliases
virtual_alias_domains = MYDOMAIN.COM
virtual_alias_maps = hash:/etc/postfix/virtual
My /etc/postfix/aliases file is:
postmaster: USER
root: USER
And My /etc/postfix/virtual is:
ME@MYDOMAIN.COM you@gmail.com
I restart postfix like:
sudo postalias /etc/postfix/aliases
sudo postmap /etc/postfix/virtual
sudo service postfix restart
This configuration seems to work a little. Internally-generated emails get to my gmail account. And surprisingly, emails I send through gmail get there as well (which to me is the baffling part), but if it's an email from somewhere else, say, yahoo, it never gets there. | 2 |
11,121,540 | 06/20/2012 14:13:27 | 1,007,777 | 10/21/2011 19:56:37 | 15 | 0 | redis.conf include: "Bad directive or wrong number of arguments" | I've created this config for redis [/etc/redis/map.conf]:
include /etc/redis/ideal.conf
port 11235
pidfile /var/run/redis-map.pid
logfile /var/log/redis/map.log
dbfilename map.rdb
As you can see, it includes /etc/redis/ideal.conf; this file actually exists and we're have read permissions.
Also there is another file, slightly different; consider [/etc/redis/storage.conf]:
include /etc/redis/ideal.conf
pidfile /var/run/redis-storage.pid
port 8000
bind 192.168.0.3
logfile /var/log/redis/storage.log
dbfilename dump_storage.rdb
My problem is: I can launch redis-server with **storage.conf** (and everything works fine), but **map.conf** leads to the following error:
Reading the configuration file, at line 1
>>> 'include /etc/redis/ideal.conf'
Bad directive or wrong number of arguments
failed
Version of redis is 2.2.
Where did I go wrong? | configuration | redis | null | null | null | null | open | redis.conf include: "Bad directive or wrong number of arguments"
===
I've created this config for redis [/etc/redis/map.conf]:
include /etc/redis/ideal.conf
port 11235
pidfile /var/run/redis-map.pid
logfile /var/log/redis/map.log
dbfilename map.rdb
As you can see, it includes /etc/redis/ideal.conf; this file actually exists and we're have read permissions.
Also there is another file, slightly different; consider [/etc/redis/storage.conf]:
include /etc/redis/ideal.conf
pidfile /var/run/redis-storage.pid
port 8000
bind 192.168.0.3
logfile /var/log/redis/storage.log
dbfilename dump_storage.rdb
My problem is: I can launch redis-server with **storage.conf** (and everything works fine), but **map.conf** leads to the following error:
Reading the configuration file, at line 1
>>> 'include /etc/redis/ideal.conf'
Bad directive or wrong number of arguments
failed
Version of redis is 2.2.
Where did I go wrong? | 0 |
3,404,747 | 08/04/2010 10:46:56 | 402,392 | 07/26/2010 14:43:25 | 25 | 0 | Feedback on website please. | I was wondering what everybody thought of this project I've been working on and whether there is anything that I should change before launching it. Bare in mind this is my first go at designing a full site.
Feel free to feedback on any aspect you feel is not up to scratch, ie design, code, whatever you like.
I'll be very grateful for your thoughts,
Jonny
[My site](http://www.polyrowing.co.uk/indexhome.html) | html | css | design | user-interface | null | 08/04/2010 12:02:13 | off topic | Feedback on website please.
===
I was wondering what everybody thought of this project I've been working on and whether there is anything that I should change before launching it. Bare in mind this is my first go at designing a full site.
Feel free to feedback on any aspect you feel is not up to scratch, ie design, code, whatever you like.
I'll be very grateful for your thoughts,
Jonny
[My site](http://www.polyrowing.co.uk/indexhome.html) | 2 |
9,294,729 | 02/15/2012 13:57:14 | 646,891 | 03/06/2011 12:08:48 | 707 | 50 | Why doesn't the following works on mobile safari? | I have the following test, I've been slamming my head against the wall trying to make it to work on mobile safari, it works on Android aswell as all the major web browsers - but doesn't run on mobile safari on iPhone 4, iOS 5.0.1, Any help would be appreciated.
All the JS is there.
Edit: what's not working is the close 'X' button.
[test case][1]
[1]: http://liveglobalcams.com/test/test.php | javascript | mobile-safari | null | null | null | null | open | Why doesn't the following works on mobile safari?
===
I have the following test, I've been slamming my head against the wall trying to make it to work on mobile safari, it works on Android aswell as all the major web browsers - but doesn't run on mobile safari on iPhone 4, iOS 5.0.1, Any help would be appreciated.
All the JS is there.
Edit: what's not working is the close 'X' button.
[test case][1]
[1]: http://liveglobalcams.com/test/test.php | 0 |
10,568,828 | 05/13/2012 02:14:27 | 1,020,241 | 10/29/2011 23:26:57 | 5 | 1 | INTCK function in SELECT statement SAS | I am having hard time getting the INTCK function to return the result i am using the following query
proc sql;
CREATE TABLE SASAVE.WEEK_NUM AS
SELECT DISTINCT MUC.CODE
,MUC.LOB
,MMD.MAX_DATE
,MMD.MIN_DATE
,INTCK('WEEK', MMD.MAX_DATE, MMD.MIN_DATE) AS WEEK_COUNT
FROM SASAVE.MUC,
MMD
WHERE MMD.LOB = MUC.LOB
AND MMD.CODE = MUC.CODE
quit;
here is the data in MUC and MMD tables
**MMD**
START END CODE LOB
13FEB2012 11MAY2012 527A TMZ
13FEB2012 1MAY2012 TB50 ZAE
13FEB2012 10MAY2012 3O05 ZAA
**MUC**
CODE LOB
527A TMZ
TB50 ZAE
3O05 ZAA
Can you please let me know if i can get the number of weeks using INTCK function
thanks
| sas | null | null | null | null | 05/14/2012 13:10:33 | not a real question | INTCK function in SELECT statement SAS
===
I am having hard time getting the INTCK function to return the result i am using the following query
proc sql;
CREATE TABLE SASAVE.WEEK_NUM AS
SELECT DISTINCT MUC.CODE
,MUC.LOB
,MMD.MAX_DATE
,MMD.MIN_DATE
,INTCK('WEEK', MMD.MAX_DATE, MMD.MIN_DATE) AS WEEK_COUNT
FROM SASAVE.MUC,
MMD
WHERE MMD.LOB = MUC.LOB
AND MMD.CODE = MUC.CODE
quit;
here is the data in MUC and MMD tables
**MMD**
START END CODE LOB
13FEB2012 11MAY2012 527A TMZ
13FEB2012 1MAY2012 TB50 ZAE
13FEB2012 10MAY2012 3O05 ZAA
**MUC**
CODE LOB
527A TMZ
TB50 ZAE
3O05 ZAA
Can you please let me know if i can get the number of weeks using INTCK function
thanks
| 1 |
8,499,852 | 12/14/2011 05:27:48 | 279,608 | 02/23/2010 15:33:00 | 2,710 | 125 | C# XmlDocument mis-reads UTF-8 'e-acute' character | I'm reading an XML document that contains the `é` (e acute) character. The document has been saved as UTF-8 and I have confirmed that the character is UTF-8 with a binary file reader (it is `c3`+`a9`). However, after processing, the character becomes a three-byte jumble (`c3`+`83`+`c2`).
My guess is that .NET has tried to convert the character(s) to UTF-16 (this is my best guess) or has split the character into one one-byte character and one double-byte UTF-8 character.
I'm loading the document like this:
XmlDocuments document = new XmlDocuments();
document.Load("z:\\source.xml");
How should I be loading this? Should I be reading this through a UTF-8-encoded stream?
| c# | xml | encoding | utf-16 | null | null | open | C# XmlDocument mis-reads UTF-8 'e-acute' character
===
I'm reading an XML document that contains the `é` (e acute) character. The document has been saved as UTF-8 and I have confirmed that the character is UTF-8 with a binary file reader (it is `c3`+`a9`). However, after processing, the character becomes a three-byte jumble (`c3`+`83`+`c2`).
My guess is that .NET has tried to convert the character(s) to UTF-16 (this is my best guess) or has split the character into one one-byte character and one double-byte UTF-8 character.
I'm loading the document like this:
XmlDocuments document = new XmlDocuments();
document.Load("z:\\source.xml");
How should I be loading this? Should I be reading this through a UTF-8-encoded stream?
| 0 |
10,818,636 | 05/30/2012 14:44:19 | 1,426,223 | 05/30/2012 14:04:34 | 1 | 0 | HTML5 page loging with mysql database in Node.js with socket.io | I tried the database login with HTML5+MySQL+Node.js+socket.io but failed. Please help.
I want to login from HTML5 page to MySQL database with Node.js and socket.io
I have a HTML5 page with 2 text box user name and password and a LogIn button.
user want to login from HTML5 page with user/password send to server and the server receive the user/password and validate with mysql database and return the result.
**My Code:
server_test.js**
var io = require('C:/Program Files (x86)/nodejs/node_modules/socket.io/lib/socket.io');
var socket = io.listen(8124);
socket.sockets.on('connection',function(socket){
socket.on('login', function(data, usr, pass){
var mysql = require('mysql');
var TEST_DATABASE = 'employee';
var TEST_TABLE = 'tblusers';
var client = mysql.createClient({
user: 'root',
password: 'secret10',
});
client.query('USE '+TEST_DATABASE);
client.query(
'SELECT name FROM '+TEST_TABLE+' WHERE user = '+usr+' AND password = '+pass,
function selectCb(err, results) {
if (err) {
throw err;
}
//Emit a message to client
socket.emit('retuLogIn',{username: results[0]['name']});
client.end();
}
);
});
socket.on('disconnect', function(){
console.log('Server has disconnected');
});
});
**client_test.html**
<!doctype html>
<html>
<title>WebSocket Client Demo [socket.io]</title>
<script src="/json.js"></script> <!-- for ie -->
<script src="http://localhost:8124/socket.io/socket.io.js"></script>
<script>
function connect() {
try
{
var socket = io.connect('http://localhost:8124/');
socket.on("connect",function(){
document.getElementById('status').innerHTML ="Browser has connected to the app server";
});
socket.on('login', function (data, document.getElementById('txtUser').value, document.getElementById('txtPass').value) {
//alert(data.hello);
document.getElementById('status').innerHTML = 'Welcome '+data.username;
});
}
catch(err)
{
document.getElementById('status').innerHTML = err.message;
}
}
</script>
<body>
<h1>WebSocket Client Demo</h1>
<div><p id="status">Enter user and password to Log-In</p></div>
<label>User :</label>
<input id="txtUser" type="text" maxlength="10" />
<label>Password :</label>
<input id="txtPass" type="text" maxlength="10" />
<button id="connect" onClick='connect()'/>Log-In</button>
</body>
</html>
Note :
I am tried with above mention code but no success. I was tried to send the userid/password to server from client with socket.send('abcd', 'ab12'). able to send but can't receive in server.
Please help me how to solve this issue. I am using MySQL database.
Thanks in advance.
Chandan Dey | mysql | html5 | node.js | socket.io | null | null | open | HTML5 page loging with mysql database in Node.js with socket.io
===
I tried the database login with HTML5+MySQL+Node.js+socket.io but failed. Please help.
I want to login from HTML5 page to MySQL database with Node.js and socket.io
I have a HTML5 page with 2 text box user name and password and a LogIn button.
user want to login from HTML5 page with user/password send to server and the server receive the user/password and validate with mysql database and return the result.
**My Code:
server_test.js**
var io = require('C:/Program Files (x86)/nodejs/node_modules/socket.io/lib/socket.io');
var socket = io.listen(8124);
socket.sockets.on('connection',function(socket){
socket.on('login', function(data, usr, pass){
var mysql = require('mysql');
var TEST_DATABASE = 'employee';
var TEST_TABLE = 'tblusers';
var client = mysql.createClient({
user: 'root',
password: 'secret10',
});
client.query('USE '+TEST_DATABASE);
client.query(
'SELECT name FROM '+TEST_TABLE+' WHERE user = '+usr+' AND password = '+pass,
function selectCb(err, results) {
if (err) {
throw err;
}
//Emit a message to client
socket.emit('retuLogIn',{username: results[0]['name']});
client.end();
}
);
});
socket.on('disconnect', function(){
console.log('Server has disconnected');
});
});
**client_test.html**
<!doctype html>
<html>
<title>WebSocket Client Demo [socket.io]</title>
<script src="/json.js"></script> <!-- for ie -->
<script src="http://localhost:8124/socket.io/socket.io.js"></script>
<script>
function connect() {
try
{
var socket = io.connect('http://localhost:8124/');
socket.on("connect",function(){
document.getElementById('status').innerHTML ="Browser has connected to the app server";
});
socket.on('login', function (data, document.getElementById('txtUser').value, document.getElementById('txtPass').value) {
//alert(data.hello);
document.getElementById('status').innerHTML = 'Welcome '+data.username;
});
}
catch(err)
{
document.getElementById('status').innerHTML = err.message;
}
}
</script>
<body>
<h1>WebSocket Client Demo</h1>
<div><p id="status">Enter user and password to Log-In</p></div>
<label>User :</label>
<input id="txtUser" type="text" maxlength="10" />
<label>Password :</label>
<input id="txtPass" type="text" maxlength="10" />
<button id="connect" onClick='connect()'/>Log-In</button>
</body>
</html>
Note :
I am tried with above mention code but no success. I was tried to send the userid/password to server from client with socket.send('abcd', 'ab12'). able to send but can't receive in server.
Please help me how to solve this issue. I am using MySQL database.
Thanks in advance.
Chandan Dey | 0 |
10,365,334 | 04/28/2012 16:20:16 | 391,531 | 07/14/2010 12:14:56 | 15,036 | 648 | Why can't I link with an associative array in a class method? | I can't seem to make a small example of this, but maybe someone's run into it before.
I have a class, `Path`, with a method `void find()` and when I try to instantiate an associative array of type `int[string]` inside the method, I get a linker error that looks like this:
/tmp/ccTF0A0c.o: In function `_D6object28__T16AssociativeArrayTAyaTiZ16AssociativeArray6rehashMFNdZHAyai':
game.d:(.text._D6object28__T16AssociativeArrayTAyaTiZ16AssociativeArray6rehashMFNdZHAyai[_D6object28__T16AssociativeArrayTAyaTiZ16AssociativeArray6rehashMFNdZHAyai]+0x44): undefined reference to `_D14TypeInfo_HAyai6__initZ'
collect2: ld returned 1 exit status
If I stick the associative array in the class's members, everything looks fine.
The code looks something like this:
class Path
{
int[string] bar; // Here it works.
void find()
{
int[string] foo; // Here it fails.
}
} | d | null | null | null | null | null | open | Why can't I link with an associative array in a class method?
===
I can't seem to make a small example of this, but maybe someone's run into it before.
I have a class, `Path`, with a method `void find()` and when I try to instantiate an associative array of type `int[string]` inside the method, I get a linker error that looks like this:
/tmp/ccTF0A0c.o: In function `_D6object28__T16AssociativeArrayTAyaTiZ16AssociativeArray6rehashMFNdZHAyai':
game.d:(.text._D6object28__T16AssociativeArrayTAyaTiZ16AssociativeArray6rehashMFNdZHAyai[_D6object28__T16AssociativeArrayTAyaTiZ16AssociativeArray6rehashMFNdZHAyai]+0x44): undefined reference to `_D14TypeInfo_HAyai6__initZ'
collect2: ld returned 1 exit status
If I stick the associative array in the class's members, everything looks fine.
The code looks something like this:
class Path
{
int[string] bar; // Here it works.
void find()
{
int[string] foo; // Here it fails.
}
} | 0 |
3,005,478 | 06/09/2010 11:47:15 | 222,588 | 12/02/2009 03:23:47 | 79 | 4 | black screen while retrieving result from webservices in android | i am using following webservices for retrieving data from server
server side:.net
client side:ksoap2
whenever activity start, onCreate i am using spinner for displying data returned by the webservices
when this activity start it showing black screen after lunching the activity .i found black screen is coming when activity connecting to webservices
How to resolve this
| android | null | null | null | null | null | open | black screen while retrieving result from webservices in android
===
i am using following webservices for retrieving data from server
server side:.net
client side:ksoap2
whenever activity start, onCreate i am using spinner for displying data returned by the webservices
when this activity start it showing black screen after lunching the activity .i found black screen is coming when activity connecting to webservices
How to resolve this
| 0 |
11,482,280 | 07/14/2012 08:38:55 | 1,525,308 | 07/14/2012 08:35:45 | 1 | 0 | Jquery Slider required | http://www.avenuesocial.com/
plz check this site and please help me to find out this slider exactly this one. any
help would be appreciated.
Thanks | php | javascript | jquery | wordpress | null | 07/14/2012 13:29:05 | not a real question | Jquery Slider required
===
http://www.avenuesocial.com/
plz check this site and please help me to find out this slider exactly this one. any
help would be appreciated.
Thanks | 1 |
6,871,648 | 07/29/2011 10:18:07 | 859,140 | 07/23/2011 09:05:30 | 14 | 0 | Which is the Best Tool for Creating XSL File..??? | > Which is the Best Tool for Creating XSLT File.. | xml | xslt | null | null | null | 09/07/2011 22:44:55 | not constructive | Which is the Best Tool for Creating XSL File..???
===
> Which is the Best Tool for Creating XSLT File.. | 4 |
6,753,456 | 07/19/2011 20:09:17 | 852,766 | 07/19/2011 20:09:17 | 1 | 0 | How i can delete img scr in the Javascript code above? | function quoteMessage(tekst, poster)
{
var selected = getSel($('tekst'));
if(selected.length > 0)
{
$('br').remove();
$('tekst').value = $('tekst').value.replace(selected, '[quote=Bericht geplaatst door' + poster + ' "] ' + tekst + ' [/quote] ');
}
else
{
$('tekst').value += '[quote=Bericht geplaatst door: ' + poster + ' "] ' + tekst + ' [/quote]';
}
$('tekst').focus();
}
How i can delete img scr in the Javascript code above? | jquery | null | null | null | null | 07/20/2011 00:15:48 | not a real question | How i can delete img scr in the Javascript code above?
===
function quoteMessage(tekst, poster)
{
var selected = getSel($('tekst'));
if(selected.length > 0)
{
$('br').remove();
$('tekst').value = $('tekst').value.replace(selected, '[quote=Bericht geplaatst door' + poster + ' "] ' + tekst + ' [/quote] ');
}
else
{
$('tekst').value += '[quote=Bericht geplaatst door: ' + poster + ' "] ' + tekst + ' [/quote]';
}
$('tekst').focus();
}
How i can delete img scr in the Javascript code above? | 1 |
11,705,000 | 07/28/2012 22:02:16 | 1,560,189 | 07/28/2012 21:37:52 | 1 | 0 | Android url.openstream gives too many redirects IOException | I can't seem to figure this out. I'm loading a URL that has a single redirect, and Android is throwing "Too many redirects" when there is only a single redirect, and it works in a browser. Here's a simplified code snippet:
URL url = null;
InputStream in;
String pic_url = "http://www.cdn.sherdog.com/image_crop/200/300/_images/fighter/20100221121302_bader.JPG";
try { url = new URL(pic_url); }
catch (MalformedURLException e1) { Log.d("iTrackMMA","URL had exception malformedURLEx on: " + pic_url); }
try { in = url.openStream(); }
catch (IOException ioe) { Log.d("iTrackMMA","URL had IOException on: " + pic_url + " with error: " + ioe.getMessage()); }
Error:
07-28 21:57:38.017: URL had IOException on: http://www.cdn.sherdog.com/image_crop/200/300/_images/fighter/20100221121302_bader.JPG with error: Too many redirects
If I use the URL that this redirects to, to cut out any redirects, I still get the same error, even though there doesn't seem to be any redirect?
URL url = null;
InputStream in;
String pic_url = "http://m.sherdog.com/image_crop.php?image=http://www.cdn.sherdog.com/_images/fighter/20100221121302_bader.JPG&&width=200&&height=300";
try { url = new URL(pic_url); }
catch (MalformedURLException e1) { Log.d("iTrackMMA","URL had exception malformedURLEx on: " + pic_url); }
try { in = url.openStream(); }
catch (IOException ioe) { Log.d("iTrackMMA","URL had IOException on: " + pic_url + " with error: " + ioe.getMessage()); }
Error:
07-28 21:48:31.337: URL had IOException on: http://m.sherdog.com/image_crop.php?image=http://www.cdn.sherdog.com/_images/fighter/20100221121302_bader.JPG&&width=200&&height=300 with error: Too many redirects
What am I missing? Does it do this for others as well? I'm wondering if there's something non-HTML compliant about this URL, and if so, I hope to find a workaround so that Android will play nice with it.
Thanks for any insight.
| android | url | ioexception | null | null | null | open | Android url.openstream gives too many redirects IOException
===
I can't seem to figure this out. I'm loading a URL that has a single redirect, and Android is throwing "Too many redirects" when there is only a single redirect, and it works in a browser. Here's a simplified code snippet:
URL url = null;
InputStream in;
String pic_url = "http://www.cdn.sherdog.com/image_crop/200/300/_images/fighter/20100221121302_bader.JPG";
try { url = new URL(pic_url); }
catch (MalformedURLException e1) { Log.d("iTrackMMA","URL had exception malformedURLEx on: " + pic_url); }
try { in = url.openStream(); }
catch (IOException ioe) { Log.d("iTrackMMA","URL had IOException on: " + pic_url + " with error: " + ioe.getMessage()); }
Error:
07-28 21:57:38.017: URL had IOException on: http://www.cdn.sherdog.com/image_crop/200/300/_images/fighter/20100221121302_bader.JPG with error: Too many redirects
If I use the URL that this redirects to, to cut out any redirects, I still get the same error, even though there doesn't seem to be any redirect?
URL url = null;
InputStream in;
String pic_url = "http://m.sherdog.com/image_crop.php?image=http://www.cdn.sherdog.com/_images/fighter/20100221121302_bader.JPG&&width=200&&height=300";
try { url = new URL(pic_url); }
catch (MalformedURLException e1) { Log.d("iTrackMMA","URL had exception malformedURLEx on: " + pic_url); }
try { in = url.openStream(); }
catch (IOException ioe) { Log.d("iTrackMMA","URL had IOException on: " + pic_url + " with error: " + ioe.getMessage()); }
Error:
07-28 21:48:31.337: URL had IOException on: http://m.sherdog.com/image_crop.php?image=http://www.cdn.sherdog.com/_images/fighter/20100221121302_bader.JPG&&width=200&&height=300 with error: Too many redirects
What am I missing? Does it do this for others as well? I'm wondering if there's something non-HTML compliant about this URL, and if so, I hope to find a workaround so that Android will play nice with it.
Thanks for any insight.
| 0 |
8,907,487 | 01/18/2012 08:59:59 | 323,926 | 04/23/2010 05:55:05 | 332 | 0 | GWT confusion for a startup web app. (beginner level) | I've been trying to learn GWT for quite a while, I want to build a website that is somewhat advance for my level.
I looked at a lot of documentations/books/blogs/videos, and I just keep getting more confused. Mainly due to facing new frameworks/methods/tools ... etc. in building apps using GWT.
For instance I'm having difficulty answering these questions:
1- Should I use Spring Roo/ SpringSource Tool Suite?
2- What sort of database specification/implementation should I use (JDO, JPA.. I'm a noob when it comes to Java DB issues)?
3- Should I use Google App Engine platform, how easy/useful it is for a start-up project?
4- Should I start coding now, or continue reading and confusing myself (I've started on my POJO data model)?
5- Communicating with the server, RPC or RequestFactory or something else?
Sorry for the many questions, as you can see I don't have much experience in GWT but I'm welling to challenge myself, I just need some guidance.
Thank you. | gwt | null | null | null | null | 01/23/2012 18:24:29 | not a real question | GWT confusion for a startup web app. (beginner level)
===
I've been trying to learn GWT for quite a while, I want to build a website that is somewhat advance for my level.
I looked at a lot of documentations/books/blogs/videos, and I just keep getting more confused. Mainly due to facing new frameworks/methods/tools ... etc. in building apps using GWT.
For instance I'm having difficulty answering these questions:
1- Should I use Spring Roo/ SpringSource Tool Suite?
2- What sort of database specification/implementation should I use (JDO, JPA.. I'm a noob when it comes to Java DB issues)?
3- Should I use Google App Engine platform, how easy/useful it is for a start-up project?
4- Should I start coding now, or continue reading and confusing myself (I've started on my POJO data model)?
5- Communicating with the server, RPC or RequestFactory or something else?
Sorry for the many questions, as you can see I don't have much experience in GWT but I'm welling to challenge myself, I just need some guidance.
Thank you. | 1 |
9,663,452 | 03/12/2012 07:58:14 | 329,700 | 04/30/2010 11:12:27 | 1,430 | 29 | Which is faster: $("li").last() or $("li:last-child")? | In jQuery, which is faster to execute: `$("li").last()` or `$("li:last-child")` ?
| jquery | null | null | null | null | null | open | Which is faster: $("li").last() or $("li:last-child")?
===
In jQuery, which is faster to execute: `$("li").last()` or `$("li:last-child")` ?
| 0 |
8,845,233 | 01/13/2012 02:39:04 | 1,146,779 | 01/13/2012 01:49:35 | 1 | 0 | How to use OpenVPN in iPad without Jailbroken ? is it possible? | I have setted one openvpn server and it works fine with my PCs.
But as many guide/manual said, if I want to use OpenVPN on iPad I have to jailbroken first.
Is it possible to direct use OpenVPN without jailbroken? Or, is there any apps can do that?
Thank you very much. | ipad | openvpn | null | null | null | 01/13/2012 21:50:25 | off topic | How to use OpenVPN in iPad without Jailbroken ? is it possible?
===
I have setted one openvpn server and it works fine with my PCs.
But as many guide/manual said, if I want to use OpenVPN on iPad I have to jailbroken first.
Is it possible to direct use OpenVPN without jailbroken? Or, is there any apps can do that?
Thank you very much. | 2 |
5,604,306 | 04/09/2011 09:59:05 | 699,823 | 04/09/2011 09:59:05 | 1 | 0 | Can an SQL subscription notification be properly registered for an SQL query on which it is not possible to create an indexed view? | SQL Server Service Broker - Query Notifications | sql | query | view | notifications | indexed | 04/09/2011 10:07:48 | not a real question | Can an SQL subscription notification be properly registered for an SQL query on which it is not possible to create an indexed view?
===
SQL Server Service Broker - Query Notifications | 1 |
5,345,669 | 03/17/2011 21:46:33 | 597,657 | 01/31/2011 23:28:20 | 170 | 6 | Is it possible to find the big-O notation in java? | is it possible to write a program that computes the big-O notation in Java? | java | math | null | null | null | 03/17/2011 21:48:45 | not a real question | Is it possible to find the big-O notation in java?
===
is it possible to write a program that computes the big-O notation in Java? | 1 |
7,022,591 | 08/11/2011 07:56:12 | 889,456 | 08/11/2011 07:51:44 | 1 | 1 | How to read a certificate installed on an iPhone | I want to read a certificate that has been installed on an iPhone (using Objective C). Can anybody help me in this.
Thanks,
Lakshman | objective-c | null | null | null | null | 10/10/2011 20:08:16 | not a real question | How to read a certificate installed on an iPhone
===
I want to read a certificate that has been installed on an iPhone (using Objective C). Can anybody help me in this.
Thanks,
Lakshman | 1 |
5,048,900 | 02/19/2011 04:43:17 | 419,017 | 08/12/2010 23:31:10 | 362 | 7 | What is the 'hackiest' solution you've come up with to cater for Internet Explorer's many shortcomings? | I just had to force a Javascript refresh on a page for IE to obtain a session. This is after 5 hours of constant debugging to no avail.
I have a strange feeling this isn't the 'hackiest' compromise. | internet-explorer | browser | cross-browser | browser-compatibility | null | 02/19/2011 04:58:12 | not a real question | What is the 'hackiest' solution you've come up with to cater for Internet Explorer's many shortcomings?
===
I just had to force a Javascript refresh on a page for IE to obtain a session. This is after 5 hours of constant debugging to no avail.
I have a strange feeling this isn't the 'hackiest' compromise. | 1 |
5,582,559 | 04/07/2011 14:16:34 | 554,340 | 12/26/2010 15:07:07 | 433 | 6 | including "offline" code in compiled querys | What happens behind the curtains when I include a function into my compiled query, like I do with DataConvert.ToThema() here to convert a table object into my custom business object:
public static class Queries
{
public static Func<MyDataContext, string, Thema> GetThemaByTitle
{
get
{
var func = CompiledQuery.Compile(
(MyDataContext db, string title) =>
(from th in elan.tbl_Thema
where th.Titel == title
select DataConvert.ToThema(th)).Single()
);
return func;
}
}
}
public static class DataConvert
{
public static Thema ToThema(tbl_Thema tblThema)
{
Thema thema = new Thema();
thema.ID = tblThema.ThemaID;
thema.Titel = tblThema.Titel;
// and some other stuff
return thema;
}
}
and call it like this
Thema th = Queries.GetThemaByTitle.Invoke(db, "someTitle");
Apparently the function is not translated in to SQL or something (how could it), but it also does not hold when I set a breakpoint there in VS2010.
It works without problems, but I don't understand how or why. What exactly happens there?
| c# | .net | linq-to-sql | compiled-query | null | null | open | including "offline" code in compiled querys
===
What happens behind the curtains when I include a function into my compiled query, like I do with DataConvert.ToThema() here to convert a table object into my custom business object:
public static class Queries
{
public static Func<MyDataContext, string, Thema> GetThemaByTitle
{
get
{
var func = CompiledQuery.Compile(
(MyDataContext db, string title) =>
(from th in elan.tbl_Thema
where th.Titel == title
select DataConvert.ToThema(th)).Single()
);
return func;
}
}
}
public static class DataConvert
{
public static Thema ToThema(tbl_Thema tblThema)
{
Thema thema = new Thema();
thema.ID = tblThema.ThemaID;
thema.Titel = tblThema.Titel;
// and some other stuff
return thema;
}
}
and call it like this
Thema th = Queries.GetThemaByTitle.Invoke(db, "someTitle");
Apparently the function is not translated in to SQL or something (how could it), but it also does not hold when I set a breakpoint there in VS2010.
It works without problems, but I don't understand how or why. What exactly happens there?
| 0 |
6,525,625 | 06/29/2011 18:44:26 | 536,912 | 12/09/2010 18:59:37 | 32 | 0 | What is the best framework for developing facebook applications? | I saw some frameworks and wanted to know which one is the best.
Raw PHP, .net, Java...? Another? | facebook | null | null | null | null | 06/30/2011 01:09:39 | not constructive | What is the best framework for developing facebook applications?
===
I saw some frameworks and wanted to know which one is the best.
Raw PHP, .net, Java...? Another? | 4 |
4,821,431 | 01/27/2011 20:23:44 | 592,836 | 01/27/2011 20:20:41 | 1 | 0 | Check if same User visited web site!?! How? | How can I check if User which came to my web site, is same User which came half hour before? | php | javascript | html | null | null | null | open | Check if same User visited web site!?! How?
===
How can I check if User which came to my web site, is same User which came half hour before? | 0 |
7,909,324 | 10/26/2011 21:45:59 | 123,348 | 06/15/2009 20:46:01 | 624 | 12 | SSRS How to move a row group? | I am using SSRS 2008 and I created a tablix with several groupings. However, I see now that my latest grouping is below the details. This was a mistake because I should have all groupings in my tablix preceding my details group. All of my groups are adjacent to each other. How to reposition this group so that it precedes details group instead?
Separate note: is there a way to merge cells for a range of rows? I only know how to merge cell one row at a time! And is there a way to copy n rows? Or do I have to copy one row at a time? | matrix | ssrs-2008 | row | null | null | null | open | SSRS How to move a row group?
===
I am using SSRS 2008 and I created a tablix with several groupings. However, I see now that my latest grouping is below the details. This was a mistake because I should have all groupings in my tablix preceding my details group. All of my groups are adjacent to each other. How to reposition this group so that it precedes details group instead?
Separate note: is there a way to merge cells for a range of rows? I only know how to merge cell one row at a time! And is there a way to copy n rows? Or do I have to copy one row at a time? | 0 |
749,827 | 04/15/2009 00:16:36 | 26,227 | 10/08/2008 17:50:42 | 4,207 | 363 | How do I time a program executing in Windows? | I want to be able to do the Windows equivalent of this Unix/Linux command:
time foo`enter code here`
foo
x cpu time
y real time
z wallclock time
| timing | windows | cli | null | null | null | open | How do I time a program executing in Windows?
===
I want to be able to do the Windows equivalent of this Unix/Linux command:
time foo`enter code here`
foo
x cpu time
y real time
z wallclock time
| 0 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.