repo_name stringlengths 7 104 | file_path stringlengths 13 198 | context stringlengths 67 7.15k | import_statement stringlengths 16 4.43k | code stringlengths 40 6.98k | prompt stringlengths 227 8.27k | next_line stringlengths 8 795 |
|---|---|---|---|---|---|---|
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/SpanTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class SpanTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/SpanTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class SpanTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode spanNode = JsonTestUtils.getSearchResponseJsonNode().path("region").path("span"); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/SpanTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class SpanTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode spanNode = JsonTestUtils.getSearchResponseJsonNode().path("region").path("span");
Span span = JsonTestUtils.deserializeJson(spanNode.toString(), Span.class);
Assert.assertEquals(new Double(spanNode.path("latitude_delta").asDouble()), span.latitudeDelta());
Assert.assertEquals(new Double(spanNode.path("longitude_delta").asDouble()), span.longitudeDelta());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode spanNode = JsonTestUtils.getSearchResponseJsonNode().path("region").path("span");
Span span = JsonTestUtils.deserializeJson(spanNode.toString(), Span.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/SpanTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class SpanTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode spanNode = JsonTestUtils.getSearchResponseJsonNode().path("region").path("span");
Span span = JsonTestUtils.deserializeJson(spanNode.toString(), Span.class);
Assert.assertEquals(new Double(spanNode.path("latitude_delta").asDouble()), span.latitudeDelta());
Assert.assertEquals(new Double(spanNode.path("longitude_delta").asDouble()), span.longitudeDelta());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode spanNode = JsonTestUtils.getSearchResponseJsonNode().path("region").path("span");
Span span = JsonTestUtils.deserializeJson(spanNode.toString(), Span.class);
| byte[] bytes = SerializationTestUtils.serialize(span); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/BusinessTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonMappingException;
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class BusinessTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/BusinessTest.java
import com.fasterxml.jackson.databind.JsonMappingException;
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class BusinessTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode businessNode = JsonTestUtils.getBusinessResponseJsonNode(); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/BusinessTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonMappingException;
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | @Test
public void testDeserializationWithUTF8Characters() throws IOException {
String businessJsonString = "{\"name\":\"Gööd Füsiön Fööd\", \"id\":\"gööd-füsiön-fööd-san-francisco\"}";
Business business = JsonTestUtils.deserializeJson(businessJsonString, Business.class);
Assert.assertEquals("Gööd Füsiön Fööd", business.name());
Assert.assertEquals("gööd-füsiön-fööd-san-francisco", business.id());
}
@Test
public void testDeserializationWithNoReviewBusinessHasNullForReview() throws IOException {
JsonNode businessNode = JsonTestUtils.getJsonNodeFromFile("noReviewBusinessResponse.json");
Business business = JsonTestUtils.deserializeJson(businessNode.toString(), Business.class);
Assert.assertNull(business.reviews());
Assert.assertEquals(new Integer(0), business.reviewCount());
Assert.assertEquals(businessNode.path("id").textValue(), business.id());
Assert.assertEquals(businessNode.path("rating_img_url").textValue(), business.ratingImgUrl());
Assert.assertEquals(businessNode.path("rating_img_url_small").textValue(), business.ratingImgUrlSmall());
}
@Test(expected = JsonMappingException.class)
public void testDeserializationFailedWithMissingAttributes() throws IOException {
String businessJsonString = "{\"name\":\"Yelp\"}";
JsonTestUtils.deserializeJson(businessJsonString, Business.class);
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode businessNode = JsonTestUtils.getBusinessResponseJsonNode();
Business business = JsonTestUtils.deserializeJson(businessNode.toString(), Business.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/BusinessTest.java
import com.fasterxml.jackson.databind.JsonMappingException;
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
@Test
public void testDeserializationWithUTF8Characters() throws IOException {
String businessJsonString = "{\"name\":\"Gööd Füsiön Fööd\", \"id\":\"gööd-füsiön-fööd-san-francisco\"}";
Business business = JsonTestUtils.deserializeJson(businessJsonString, Business.class);
Assert.assertEquals("Gööd Füsiön Fööd", business.name());
Assert.assertEquals("gööd-füsiön-fööd-san-francisco", business.id());
}
@Test
public void testDeserializationWithNoReviewBusinessHasNullForReview() throws IOException {
JsonNode businessNode = JsonTestUtils.getJsonNodeFromFile("noReviewBusinessResponse.json");
Business business = JsonTestUtils.deserializeJson(businessNode.toString(), Business.class);
Assert.assertNull(business.reviews());
Assert.assertEquals(new Integer(0), business.reviewCount());
Assert.assertEquals(businessNode.path("id").textValue(), business.id());
Assert.assertEquals(businessNode.path("rating_img_url").textValue(), business.ratingImgUrl());
Assert.assertEquals(businessNode.path("rating_img_url_small").textValue(), business.ratingImgUrlSmall());
}
@Test(expected = JsonMappingException.class)
public void testDeserializationFailedWithMissingAttributes() throws IOException {
String businessJsonString = "{\"name\":\"Yelp\"}";
JsonTestUtils.deserializeJson(businessJsonString, Business.class);
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode businessNode = JsonTestUtils.getBusinessResponseJsonNode();
Business business = JsonTestUtils.deserializeJson(businessNode.toString(), Business.class);
| byte[] bytes = SerializationTestUtils.serialize(business); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/GiftCertificateOptionTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class GiftCertificateOptionTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/GiftCertificateOptionTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class GiftCertificateOptionTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode giftCertificateOptionNode = JsonTestUtils.getBusinessResponseJsonNode() |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/GiftCertificateOptionTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class GiftCertificateOptionTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode giftCertificateOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("gift_certificates").get(0).path("options").get(0);
GiftCertificateOption giftCertificateOption = JsonTestUtils.deserializeJson(
giftCertificateOptionNode.toString(),
GiftCertificateOption.class
);
Assert.assertEquals(
giftCertificateOptionNode.path("formatted_price").textValue(),
giftCertificateOption.formattedPrice()
);
Assert.assertEquals(
new Integer(giftCertificateOptionNode.path("price").asInt()),
giftCertificateOption.price()
);
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode giftCertificateOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("gift_certificates").get(0).path("options").get(0);
GiftCertificateOption giftCertificateOption = JsonTestUtils.deserializeJson(
giftCertificateOptionNode.toString(),
GiftCertificateOption.class
);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/GiftCertificateOptionTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class GiftCertificateOptionTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode giftCertificateOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("gift_certificates").get(0).path("options").get(0);
GiftCertificateOption giftCertificateOption = JsonTestUtils.deserializeJson(
giftCertificateOptionNode.toString(),
GiftCertificateOption.class
);
Assert.assertEquals(
giftCertificateOptionNode.path("formatted_price").textValue(),
giftCertificateOption.formattedPrice()
);
Assert.assertEquals(
new Integer(giftCertificateOptionNode.path("price").asInt()),
giftCertificateOption.price()
);
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode giftCertificateOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("gift_certificates").get(0).path("options").get(0);
GiftCertificateOption giftCertificateOption = JsonTestUtils.deserializeJson(
giftCertificateOptionNode.toString(),
GiftCertificateOption.class
);
| byte[] bytes = SerializationTestUtils.serialize(giftCertificateOption); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
| import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException; | package com.yelp.clientlib.exception;
@RunWith(PowerMockRunner.class)
@PrepareForTest({Request.class, Response.class, Protocol.class})
public class ErrorHandlingInterceptorTest {
Interceptor errorHandlingInterceptor;
@Before
public void setUp() {
this.errorHandlingInterceptor = new ErrorHandlingInterceptor();
}
/**
* Ensure the interceptor does nothing besides proceeding the request if the request is done successfully.
*/
@Test
public void testSuccessfulRequestNotDoingAnythingExceptProceedingRequests() throws IOException {
Request mockRequest = PowerMock.createMock(Request.class);
Response mockResponse = PowerMock.createMock(Response.class);
Interceptor.Chain mockChain = PowerMock.createMock(Interceptor.Chain.class);
EasyMock.expect(mockChain.request()).andReturn(mockRequest);
EasyMock.expect(mockChain.proceed(mockRequest)).andReturn(mockResponse);
EasyMock.expect(mockResponse.isSuccessful()).andReturn(true);
PowerMock.replay(mockRequest, mockResponse, mockChain);
Response returnedResponse = errorHandlingInterceptor.intercept(mockChain);
PowerMock.verify(mockChain);
Assert.assertEquals(mockResponse, returnedResponse);
}
@Test
public void testParseNullResponseBody() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, null);
try {
errorHandlingInterceptor.intercept(mockChain); | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
// Path: src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java
import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException;
package com.yelp.clientlib.exception;
@RunWith(PowerMockRunner.class)
@PrepareForTest({Request.class, Response.class, Protocol.class})
public class ErrorHandlingInterceptorTest {
Interceptor errorHandlingInterceptor;
@Before
public void setUp() {
this.errorHandlingInterceptor = new ErrorHandlingInterceptor();
}
/**
* Ensure the interceptor does nothing besides proceeding the request if the request is done successfully.
*/
@Test
public void testSuccessfulRequestNotDoingAnythingExceptProceedingRequests() throws IOException {
Request mockRequest = PowerMock.createMock(Request.class);
Response mockResponse = PowerMock.createMock(Response.class);
Interceptor.Chain mockChain = PowerMock.createMock(Interceptor.Chain.class);
EasyMock.expect(mockChain.request()).andReturn(mockRequest);
EasyMock.expect(mockChain.proceed(mockRequest)).andReturn(mockResponse);
EasyMock.expect(mockResponse.isSuccessful()).andReturn(true);
PowerMock.replay(mockRequest, mockResponse, mockChain);
Response returnedResponse = errorHandlingInterceptor.intercept(mockChain);
PowerMock.verify(mockChain);
Assert.assertEquals(mockResponse, returnedResponse);
}
@Test
public void testParseNullResponseBody() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, null);
try {
errorHandlingInterceptor.intercept(mockChain); | } catch (UnexpectedAPIError error) { |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
| import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException; | package com.yelp.clientlib.exception;
@RunWith(PowerMockRunner.class)
@PrepareForTest({Request.class, Response.class, Protocol.class})
public class ErrorHandlingInterceptorTest {
Interceptor errorHandlingInterceptor;
@Before
public void setUp() {
this.errorHandlingInterceptor = new ErrorHandlingInterceptor();
}
/**
* Ensure the interceptor does nothing besides proceeding the request if the request is done successfully.
*/
@Test
public void testSuccessfulRequestNotDoingAnythingExceptProceedingRequests() throws IOException {
Request mockRequest = PowerMock.createMock(Request.class);
Response mockResponse = PowerMock.createMock(Response.class);
Interceptor.Chain mockChain = PowerMock.createMock(Interceptor.Chain.class);
EasyMock.expect(mockChain.request()).andReturn(mockRequest);
EasyMock.expect(mockChain.proceed(mockRequest)).andReturn(mockResponse);
EasyMock.expect(mockResponse.isSuccessful()).andReturn(true);
PowerMock.replay(mockRequest, mockResponse, mockChain);
Response returnedResponse = errorHandlingInterceptor.intercept(mockChain);
PowerMock.verify(mockChain);
Assert.assertEquals(mockResponse, returnedResponse);
}
@Test
public void testParseNullResponseBody() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, null);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (UnexpectedAPIError error) { | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
// Path: src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java
import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException;
package com.yelp.clientlib.exception;
@RunWith(PowerMockRunner.class)
@PrepareForTest({Request.class, Response.class, Protocol.class})
public class ErrorHandlingInterceptorTest {
Interceptor errorHandlingInterceptor;
@Before
public void setUp() {
this.errorHandlingInterceptor = new ErrorHandlingInterceptor();
}
/**
* Ensure the interceptor does nothing besides proceeding the request if the request is done successfully.
*/
@Test
public void testSuccessfulRequestNotDoingAnythingExceptProceedingRequests() throws IOException {
Request mockRequest = PowerMock.createMock(Request.class);
Response mockResponse = PowerMock.createMock(Response.class);
Interceptor.Chain mockChain = PowerMock.createMock(Interceptor.Chain.class);
EasyMock.expect(mockChain.request()).andReturn(mockRequest);
EasyMock.expect(mockChain.proceed(mockRequest)).andReturn(mockResponse);
EasyMock.expect(mockResponse.isSuccessful()).andReturn(true);
PowerMock.replay(mockRequest, mockResponse, mockChain);
Response returnedResponse = errorHandlingInterceptor.intercept(mockChain);
PowerMock.verify(mockChain);
Assert.assertEquals(mockResponse, returnedResponse);
}
@Test
public void testParseNullResponseBody() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, null);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (UnexpectedAPIError error) { | ErrorTestUtils.verifyErrorContent(error, errorCode, errorMessage, null, null); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
| import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException; | Assert.assertEquals(mockResponse, returnedResponse);
}
@Test
public void testParseNullResponseBody() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, null);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (UnexpectedAPIError error) {
ErrorTestUtils.verifyErrorContent(error, errorCode, errorMessage, null, null);
return;
}
Assert.fail("Expected failure not returned.");
}
@Test
public void testParseBusinessUnavailable() throws IOException {
int errorCode = 400;
String errorMessage = "Bad Request";
String errorId = "BUSINESS_UNAVAILABLE";
String errorText = "Business information is unavailable";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain); | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
// Path: src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java
import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException;
Assert.assertEquals(mockResponse, returnedResponse);
}
@Test
public void testParseNullResponseBody() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, null);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (UnexpectedAPIError error) {
ErrorTestUtils.verifyErrorContent(error, errorCode, errorMessage, null, null);
return;
}
Assert.fail("Expected failure not returned.");
}
@Test
public void testParseBusinessUnavailable() throws IOException {
int errorCode = 400;
String errorMessage = "Bad Request";
String errorId = "BUSINESS_UNAVAILABLE";
String errorText = "Business information is unavailable";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain); | } catch (BusinessUnavailable error) { |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
| import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException; | @Test
public void testParseBusinessUnavailable() throws IOException {
int errorCode = 400;
String errorMessage = "Bad Request";
String errorId = "BUSINESS_UNAVAILABLE";
String errorText = "Business information is unavailable";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (BusinessUnavailable error) {
ErrorTestUtils.verifyErrorContent(error, errorCode, errorMessage, errorId, errorText);
return;
}
Assert.fail("Expected failure not returned.");
}
@Test
public void testParseInternalError() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
String errorId = "INTERNAL_ERROR";
String errorText = "Some internal error happened";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain); | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
// Path: src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java
import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException;
@Test
public void testParseBusinessUnavailable() throws IOException {
int errorCode = 400;
String errorMessage = "Bad Request";
String errorId = "BUSINESS_UNAVAILABLE";
String errorText = "Business information is unavailable";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (BusinessUnavailable error) {
ErrorTestUtils.verifyErrorContent(error, errorCode, errorMessage, errorId, errorText);
return;
}
Assert.fail("Expected failure not returned.");
}
@Test
public void testParseInternalError() throws IOException {
int errorCode = 500;
String errorMessage = "Internal Server Error";
String errorId = "INTERNAL_ERROR";
String errorText = "Some internal error happened";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain); | } catch (InternalError error) { |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
| import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException; | int errorCode = 500;
String errorMessage = "Internal Server Error";
String errorId = "INTERNAL_ERROR";
String errorText = "Some internal error happened";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (InternalError error) {
ErrorTestUtils.verifyErrorContent(error, errorCode, errorMessage, errorId, errorText);
return;
}
Assert.fail("Expected failure not returned.");
}
@Test
public void testParseErrorWithField() throws IOException {
int errorCode = 400;
String errorMessage = "Bad Request";
String errorId = "INVALID_PARAMETER";
String errorText = "One or more parameters are invalid in request";
String errorField = "phone";
String expectedErrorText = String.format("%s: %s", errorText, errorField);
String errorJsonBody = generateErrorJsonString(errorId, errorText, errorField);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain); | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/BusinessUnavailable.java
// public class BusinessUnavailable extends YelpAPIError {
// public BusinessUnavailable(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InternalError.java
// public class InternalError extends YelpAPIError {
// public InternalError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/InvalidParameter.java
// public class InvalidParameter extends YelpAPIError {
// public InvalidParameter(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/main/java/com/yelp/clientlib/exception/exceptions/UnexpectedAPIError.java
// public class UnexpectedAPIError extends YelpAPIError {
// public UnexpectedAPIError(int code, String message) {
// this(code, message, null, null);
// }
//
// public UnexpectedAPIError(int code, String message, String id, String text) {
// super(code, message, id, text);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
// public class ErrorTestUtils {
//
// /**
// * Verify a {@link YelpAPIError} contains correct information.
// *
// * @param error The YelpAPIError to be verified.
// * @param expectCode Expected error code.
// * @param expectMessage Expected error message.
// * @param expectId Expected error Id.
// * @param expectText Expected error text.
// */
// public static void verifyErrorContent(
// YelpAPIError error,
// int expectCode,
// String expectMessage,
// String expectId,
// String expectText
// ) {
// Assert.assertEquals(expectCode, error.getCode());
// Assert.assertEquals(expectMessage, error.getMessage());
// Assert.assertEquals(expectId, error.getErrorId());
// Assert.assertEquals(expectText, error.getText());
// }
// }
// Path: src/test/java/com/yelp/clientlib/exception/ErrorHandlingInterceptorTest.java
import okhttp3.Interceptor;
import okhttp3.MediaType;
import okhttp3.Protocol;
import okhttp3.Request;
import okhttp3.Response;
import okhttp3.ResponseBody;
import com.yelp.clientlib.exception.exceptions.BusinessUnavailable;
import com.yelp.clientlib.exception.exceptions.InternalError;
import com.yelp.clientlib.exception.exceptions.InvalidParameter;
import com.yelp.clientlib.exception.exceptions.UnexpectedAPIError;
import com.yelp.clientlib.utils.ErrorTestUtils;
import org.easymock.EasyMock;
import org.junit.Assert;
import org.junit.Before;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.powermock.api.easymock.PowerMock;
import org.powermock.core.classloader.annotations.PrepareForTest;
import org.powermock.modules.junit4.PowerMockRunner;
import java.io.IOException;
int errorCode = 500;
String errorMessage = "Internal Server Error";
String errorId = "INTERNAL_ERROR";
String errorText = "Some internal error happened";
String errorJsonBody = generateErrorJsonString(errorId, errorText);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain);
} catch (InternalError error) {
ErrorTestUtils.verifyErrorContent(error, errorCode, errorMessage, errorId, errorText);
return;
}
Assert.fail("Expected failure not returned.");
}
@Test
public void testParseErrorWithField() throws IOException {
int errorCode = 400;
String errorMessage = "Bad Request";
String errorId = "INVALID_PARAMETER";
String errorText = "One or more parameters are invalid in request";
String errorField = "phone";
String expectedErrorText = String.format("%s: %s", errorText, errorField);
String errorJsonBody = generateErrorJsonString(errorId, errorText, errorField);
Interceptor.Chain mockChain = mockChainWithErrorResponse(errorCode, errorMessage, errorJsonBody);
try {
errorHandlingInterceptor.intercept(mockChain); | } catch (InvalidParameter error) { |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/LocationTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class LocationTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/LocationTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class LocationTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode locationNode = JsonTestUtils.getBusinessResponseJsonNode().path("location"); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/LocationTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class LocationTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode locationNode = JsonTestUtils.getBusinessResponseJsonNode().path("location");
Location location = JsonTestUtils.deserializeJson(locationNode.toString(), Location.class);
Assert.assertEquals(1, location.address().size());
Assert.assertEquals(locationNode.path("city").textValue(), location.city());
Assert.assertNotNull(location.coordinate());
Assert.assertEquals(locationNode.path("country_code").textValue(), location.countryCode());
Assert.assertEquals(locationNode.path("cross_streets").textValue(), location.crossStreets());
Assert.assertEquals(3, location.displayAddress().size());
Assert.assertEquals(new Double(locationNode.path("geo_accuracy").asDouble()), location.geoAccuracy());
Assert.assertEquals(2, location.neighborhoods().size());
Assert.assertEquals(locationNode.path("postal_code").textValue(), location.postalCode());
Assert.assertEquals(locationNode.path("state_code").textValue(), location.stateCode());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode locationNode = JsonTestUtils.getBusinessResponseJsonNode().path("location");
Location location = JsonTestUtils.deserializeJson(locationNode.toString(), Location.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/LocationTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class LocationTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode locationNode = JsonTestUtils.getBusinessResponseJsonNode().path("location");
Location location = JsonTestUtils.deserializeJson(locationNode.toString(), Location.class);
Assert.assertEquals(1, location.address().size());
Assert.assertEquals(locationNode.path("city").textValue(), location.city());
Assert.assertNotNull(location.coordinate());
Assert.assertEquals(locationNode.path("country_code").textValue(), location.countryCode());
Assert.assertEquals(locationNode.path("cross_streets").textValue(), location.crossStreets());
Assert.assertEquals(3, location.displayAddress().size());
Assert.assertEquals(new Double(locationNode.path("geo_accuracy").asDouble()), location.geoAccuracy());
Assert.assertEquals(2, location.neighborhoods().size());
Assert.assertEquals(locationNode.path("postal_code").textValue(), location.postalCode());
Assert.assertEquals(locationNode.path("state_code").textValue(), location.stateCode());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode locationNode = JsonTestUtils.getBusinessResponseJsonNode().path("location");
Location location = JsonTestUtils.deserializeJson(locationNode.toString(), Location.class);
| byte[] bytes = SerializationTestUtils.serialize(location); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/GiftCertificateTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class GiftCertificateTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/GiftCertificateTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class GiftCertificateTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode giftCertificatesNode = JsonTestUtils.getBusinessResponseJsonNode().path("gift_certificates").get(0); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/GiftCertificateTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class GiftCertificateTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode giftCertificatesNode = JsonTestUtils.getBusinessResponseJsonNode().path("gift_certificates").get(0);
GiftCertificate giftCertificate = JsonTestUtils.deserializeJson(
giftCertificatesNode.toString(),
GiftCertificate.class
);
Assert.assertEquals(giftCertificatesNode.path("id").textValue(), giftCertificate.id());
Assert.assertEquals(giftCertificatesNode.path("url").textValue(), giftCertificate.url());
Assert.assertEquals(giftCertificatesNode.path("image_url").textValue(), giftCertificate.imageUrl());
Assert.assertEquals(giftCertificatesNode.path("currency_code").textValue(), giftCertificate.currencyCode());
Assert.assertEquals(giftCertificatesNode.path("unused_balances").textValue(), giftCertificate.unusedBalances());
// GiftCertificateOption is tested in it's own test.
Assert.assertNotNull(giftCertificate.options().get(0));
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode giftCertificatesNode = JsonTestUtils.getBusinessResponseJsonNode().path("gift_certificates").get(0);
GiftCertificate giftCertificate = JsonTestUtils.deserializeJson(
giftCertificatesNode.toString(),
GiftCertificate.class
);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/GiftCertificateTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class GiftCertificateTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode giftCertificatesNode = JsonTestUtils.getBusinessResponseJsonNode().path("gift_certificates").get(0);
GiftCertificate giftCertificate = JsonTestUtils.deserializeJson(
giftCertificatesNode.toString(),
GiftCertificate.class
);
Assert.assertEquals(giftCertificatesNode.path("id").textValue(), giftCertificate.id());
Assert.assertEquals(giftCertificatesNode.path("url").textValue(), giftCertificate.url());
Assert.assertEquals(giftCertificatesNode.path("image_url").textValue(), giftCertificate.imageUrl());
Assert.assertEquals(giftCertificatesNode.path("currency_code").textValue(), giftCertificate.currencyCode());
Assert.assertEquals(giftCertificatesNode.path("unused_balances").textValue(), giftCertificate.unusedBalances());
// GiftCertificateOption is tested in it's own test.
Assert.assertNotNull(giftCertificate.options().get(0));
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode giftCertificatesNode = JsonTestUtils.getBusinessResponseJsonNode().path("gift_certificates").get(0);
GiftCertificate giftCertificate = JsonTestUtils.deserializeJson(
giftCertificatesNode.toString(),
GiftCertificate.class
);
| byte[] bytes = SerializationTestUtils.serialize(giftCertificate); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/CoordinateTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class CoordinateTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/CoordinateTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class CoordinateTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode coordinateNode = JsonTestUtils.getBusinessResponseJsonNode().path("location").path("coordinate"); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/CoordinateTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class CoordinateTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode coordinateNode = JsonTestUtils.getBusinessResponseJsonNode().path("location").path("coordinate");
Coordinate coordinate = JsonTestUtils.deserializeJson(coordinateNode.toString(), Coordinate.class);
Assert.assertEquals(new Double(coordinateNode.path("latitude").asDouble()), coordinate.latitude());
Assert.assertEquals(new Double(coordinateNode.path("longitude").asDouble()), coordinate.longitude());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode coordinateNode = JsonTestUtils.getBusinessResponseJsonNode().path("location").path("coordinate");
Coordinate coordinate = JsonTestUtils.deserializeJson(coordinateNode.toString(), Coordinate.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/CoordinateTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class CoordinateTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode coordinateNode = JsonTestUtils.getBusinessResponseJsonNode().path("location").path("coordinate");
Coordinate coordinate = JsonTestUtils.deserializeJson(coordinateNode.toString(), Coordinate.class);
Assert.assertEquals(new Double(coordinateNode.path("latitude").asDouble()), coordinate.latitude());
Assert.assertEquals(new Double(coordinateNode.path("longitude").asDouble()), coordinate.longitude());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode coordinateNode = JsonTestUtils.getBusinessResponseJsonNode().path("location").path("coordinate");
Coordinate coordinate = JsonTestUtils.deserializeJson(coordinateNode.toString(), Coordinate.class);
| byte[] bytes = SerializationTestUtils.serialize(coordinate); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/UserTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class UserTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/UserTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class UserTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode userNode = JsonTestUtils.getBusinessResponseJsonNode().path("reviews").get(0).path("user"); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/UserTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class UserTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode userNode = JsonTestUtils.getBusinessResponseJsonNode().path("reviews").get(0).path("user");
User user = JsonTestUtils.deserializeJson(userNode.toString(), User.class);
Assert.assertEquals(userNode.path("id").textValue(), user.id());
Assert.assertEquals(userNode.path("image_url").textValue(), user.imageUrl());
Assert.assertEquals(userNode.path("name").textValue(), user.name());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode userNode = JsonTestUtils.getBusinessResponseJsonNode().path("reviews").get(0).path("user");
User user = JsonTestUtils.deserializeJson(userNode.toString(), User.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/UserTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class UserTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode userNode = JsonTestUtils.getBusinessResponseJsonNode().path("reviews").get(0).path("user");
User user = JsonTestUtils.deserializeJson(userNode.toString(), User.class);
Assert.assertEquals(userNode.path("id").textValue(), user.id());
Assert.assertEquals(userNode.path("image_url").textValue(), user.imageUrl());
Assert.assertEquals(userNode.path("name").textValue(), user.name());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode userNode = JsonTestUtils.getBusinessResponseJsonNode().path("reviews").get(0).path("user");
User user = JsonTestUtils.deserializeJson(userNode.toString(), User.class);
| byte[] bytes = SerializationTestUtils.serialize(user); |
Yelp/yelp-android | src/main/java/com/yelp/clientlib/connection/YelpAPIFactory.java | // Path: src/main/java/com/yelp/clientlib/exception/ErrorHandlingInterceptor.java
// public class ErrorHandlingInterceptor implements Interceptor {
//
// private static final ObjectMapper objectMapper = new ObjectMapper();
//
// /**
// * Intercept HTTP responses and raise a {@link YelpAPIError} if the response code is not 2xx.
// *
// * @param chain {@link okhttp3.Interceptor.Chain} object for sending the HTTP request.
// * @return response
// * @throws IOException {@link YelpAPIError} generated depends on the response error id.
// */
// @Override
// public Response intercept(Chain chain) throws IOException {
// Response response = chain.proceed(chain.request());
//
// if (!response.isSuccessful()) {
// throw parseError(
// response.code(),
// response.message(),
// response.body() != null ? response.body().string() : null
// );
// }
// return response;
// }
//
// private YelpAPIError parseError(int code, String message, String responseBody) throws IOException {
// if (responseBody == null) {
// return new UnexpectedAPIError(code, message);
// }
//
// JsonNode errorJsonNode = objectMapper.readTree(responseBody).path("error");
// String errorId = errorJsonNode.path("id").asText();
// String errorText = errorJsonNode.path("text").asText();
//
// if (errorJsonNode.has("field")) {
// errorText += ": " + errorJsonNode.path("field").asText();
// }
//
// switch (errorId) {
// case "AREA_TOO_LARGE":
// return new AreaTooLarge(code, message, errorId, errorText);
// case "BAD_CATEGORY":
// return new BadCategory(code, message, errorId, errorText);
// case "BUSINESS_UNAVAILABLE":
// return new BusinessUnavailable(code, message, errorId, errorText);
// case "EXCEEDED_REQS":
// return new ExceededReqs(code, message, errorId, errorText);
// case "INTERNAL_ERROR":
// return new InternalError(code, message, errorId, errorText);
// case "INVALID_OAUTH_CREDENTIALS":
// return new InvalidOAuthCredentials(code, message, errorId, errorText);
// case "INVALID_OAUTH_USER":
// return new InvalidOAuthUser(code, message, errorId, errorText);
// case "INVALID_PARAMETER":
// return new InvalidParameter(code, message, errorId, errorText);
// case "INVALID_SIGNATURE":
// return new InvalidSignature(code, message, errorId, errorText);
// case "MISSING_PARAMETER":
// return new MissingParameter(code, message, errorId, errorText);
// case "MULTIPLE_LOCATIONS":
// return new MultipleLocations(code, message, errorId, errorText);
// case "SSL_REQUIRED":
// return new SSLRequired(code, message, errorId, errorText);
// case "UNAVAILABLE_FOR_LOCATION":
// return new UnavailableForLocation(code, message, errorId, errorText);
// case "UNSPECIFIED_LOCATION":
// return new UnspecifiedLocation(code, message, errorId, errorText);
// default:
// return new UnexpectedAPIError(code, message, errorId, errorText);
// }
// }
// }
| import okhttp3.OkHttpClient;
import com.yelp.clientlib.exception.ErrorHandlingInterceptor;
import retrofit2.converter.jackson.JacksonConverterFactory;
import retrofit2.Retrofit;
import se.akerfeldt.okhttp.signpost.OkHttpOAuthConsumer;
import se.akerfeldt.okhttp.signpost.SigningInterceptor; | package com.yelp.clientlib.connection;
/**
* Util class to create YelpAPI as the stub to use Yelp API. This is the entry point to use this clientlib.
* <p>
* Example:<br>
* YelpAPIFactory apiFactory = new YelpAPIFactory(consumerKey, consumerSecret, token, tokenSecret);<br>
* YelpAPI yelpAPI = apiFactory.createAPI();<br>
* Business business = yelpAPI.getBusiness(businessId).execute();
* </p>
*/
public class YelpAPIFactory {
private static final String YELP_API_BASE_URL = "https://api.yelp.com";
private OkHttpClient httpClient;
/**
* Construct a new {@code YelpAPIFactory}.
*
* @param consumerKey the consumer key.
* @param consumerSecret the consumer secret.
* @param token the access token.
* @param tokenSecret the token secret.
* @see <a href="https://www.yelp.com/developers/manage_api_keys">https://www.yelp.com/developers/manage_api_keys</a>
*/
public YelpAPIFactory(String consumerKey, String consumerSecret, String token, String tokenSecret) {
OkHttpOAuthConsumer consumer = new OkHttpOAuthConsumer(consumerKey, consumerSecret);
consumer.setTokenWithSecret(token, tokenSecret);
this.httpClient = new OkHttpClient.Builder()
.addInterceptor(new SigningInterceptor(consumer)) | // Path: src/main/java/com/yelp/clientlib/exception/ErrorHandlingInterceptor.java
// public class ErrorHandlingInterceptor implements Interceptor {
//
// private static final ObjectMapper objectMapper = new ObjectMapper();
//
// /**
// * Intercept HTTP responses and raise a {@link YelpAPIError} if the response code is not 2xx.
// *
// * @param chain {@link okhttp3.Interceptor.Chain} object for sending the HTTP request.
// * @return response
// * @throws IOException {@link YelpAPIError} generated depends on the response error id.
// */
// @Override
// public Response intercept(Chain chain) throws IOException {
// Response response = chain.proceed(chain.request());
//
// if (!response.isSuccessful()) {
// throw parseError(
// response.code(),
// response.message(),
// response.body() != null ? response.body().string() : null
// );
// }
// return response;
// }
//
// private YelpAPIError parseError(int code, String message, String responseBody) throws IOException {
// if (responseBody == null) {
// return new UnexpectedAPIError(code, message);
// }
//
// JsonNode errorJsonNode = objectMapper.readTree(responseBody).path("error");
// String errorId = errorJsonNode.path("id").asText();
// String errorText = errorJsonNode.path("text").asText();
//
// if (errorJsonNode.has("field")) {
// errorText += ": " + errorJsonNode.path("field").asText();
// }
//
// switch (errorId) {
// case "AREA_TOO_LARGE":
// return new AreaTooLarge(code, message, errorId, errorText);
// case "BAD_CATEGORY":
// return new BadCategory(code, message, errorId, errorText);
// case "BUSINESS_UNAVAILABLE":
// return new BusinessUnavailable(code, message, errorId, errorText);
// case "EXCEEDED_REQS":
// return new ExceededReqs(code, message, errorId, errorText);
// case "INTERNAL_ERROR":
// return new InternalError(code, message, errorId, errorText);
// case "INVALID_OAUTH_CREDENTIALS":
// return new InvalidOAuthCredentials(code, message, errorId, errorText);
// case "INVALID_OAUTH_USER":
// return new InvalidOAuthUser(code, message, errorId, errorText);
// case "INVALID_PARAMETER":
// return new InvalidParameter(code, message, errorId, errorText);
// case "INVALID_SIGNATURE":
// return new InvalidSignature(code, message, errorId, errorText);
// case "MISSING_PARAMETER":
// return new MissingParameter(code, message, errorId, errorText);
// case "MULTIPLE_LOCATIONS":
// return new MultipleLocations(code, message, errorId, errorText);
// case "SSL_REQUIRED":
// return new SSLRequired(code, message, errorId, errorText);
// case "UNAVAILABLE_FOR_LOCATION":
// return new UnavailableForLocation(code, message, errorId, errorText);
// case "UNSPECIFIED_LOCATION":
// return new UnspecifiedLocation(code, message, errorId, errorText);
// default:
// return new UnexpectedAPIError(code, message, errorId, errorText);
// }
// }
// }
// Path: src/main/java/com/yelp/clientlib/connection/YelpAPIFactory.java
import okhttp3.OkHttpClient;
import com.yelp.clientlib.exception.ErrorHandlingInterceptor;
import retrofit2.converter.jackson.JacksonConverterFactory;
import retrofit2.Retrofit;
import se.akerfeldt.okhttp.signpost.OkHttpOAuthConsumer;
import se.akerfeldt.okhttp.signpost.SigningInterceptor;
package com.yelp.clientlib.connection;
/**
* Util class to create YelpAPI as the stub to use Yelp API. This is the entry point to use this clientlib.
* <p>
* Example:<br>
* YelpAPIFactory apiFactory = new YelpAPIFactory(consumerKey, consumerSecret, token, tokenSecret);<br>
* YelpAPI yelpAPI = apiFactory.createAPI();<br>
* Business business = yelpAPI.getBusiness(businessId).execute();
* </p>
*/
public class YelpAPIFactory {
private static final String YELP_API_BASE_URL = "https://api.yelp.com";
private OkHttpClient httpClient;
/**
* Construct a new {@code YelpAPIFactory}.
*
* @param consumerKey the consumer key.
* @param consumerSecret the consumer secret.
* @param token the access token.
* @param tokenSecret the token secret.
* @see <a href="https://www.yelp.com/developers/manage_api_keys">https://www.yelp.com/developers/manage_api_keys</a>
*/
public YelpAPIFactory(String consumerKey, String consumerSecret, String token, String tokenSecret) {
OkHttpOAuthConsumer consumer = new OkHttpOAuthConsumer(consumerKey, consumerSecret);
consumer.setTokenWithSecret(token, tokenSecret);
this.httpClient = new OkHttpClient.Builder()
.addInterceptor(new SigningInterceptor(consumer)) | .addInterceptor(new ErrorHandlingInterceptor()) |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/DealOptionTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class DealOptionTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/DealOptionTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class DealOptionTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode dealOptionNode = JsonTestUtils.getBusinessResponseJsonNode() |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/DealOptionTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class DealOptionTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode dealOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("deals").get(0).path("options").get(0);
DealOption dealOption = JsonTestUtils.deserializeJson(dealOptionNode.toString(), DealOption.class);
Assert.assertEquals(
dealOptionNode.path("formatted_original_price").textValue(),
dealOption.formattedOriginalPrice()
);
Assert.assertEquals(dealOptionNode.path("formatted_price").textValue(), dealOption.formattedPrice());
Assert.assertEquals(dealOptionNode.path("is_quantity_limited").asBoolean(), dealOption.isQuantityLimited());
Assert.assertEquals(new Integer(dealOptionNode.path("original_price").asInt()), dealOption.originalPrice());
Assert.assertEquals(new Integer(dealOptionNode.path("price").asInt()), dealOption.price());
Assert.assertEquals(dealOptionNode.path("purchase_url").textValue(), dealOption.purchaseUrl());
Assert.assertEquals(new Integer(dealOptionNode.path("remaining_count").asInt()), dealOption.remainingCount());
Assert.assertEquals(dealOptionNode.path("title").textValue(), dealOption.title());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode dealOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("deals").get(0).path("options").get(0);
DealOption dealOption = JsonTestUtils.deserializeJson(dealOptionNode.toString(), DealOption.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/DealOptionTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class DealOptionTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode dealOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("deals").get(0).path("options").get(0);
DealOption dealOption = JsonTestUtils.deserializeJson(dealOptionNode.toString(), DealOption.class);
Assert.assertEquals(
dealOptionNode.path("formatted_original_price").textValue(),
dealOption.formattedOriginalPrice()
);
Assert.assertEquals(dealOptionNode.path("formatted_price").textValue(), dealOption.formattedPrice());
Assert.assertEquals(dealOptionNode.path("is_quantity_limited").asBoolean(), dealOption.isQuantityLimited());
Assert.assertEquals(new Integer(dealOptionNode.path("original_price").asInt()), dealOption.originalPrice());
Assert.assertEquals(new Integer(dealOptionNode.path("price").asInt()), dealOption.price());
Assert.assertEquals(dealOptionNode.path("purchase_url").textValue(), dealOption.purchaseUrl());
Assert.assertEquals(new Integer(dealOptionNode.path("remaining_count").asInt()), dealOption.remainingCount());
Assert.assertEquals(dealOptionNode.path("title").textValue(), dealOption.title());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode dealOptionNode = JsonTestUtils.getBusinessResponseJsonNode()
.path("deals").get(0).path("options").get(0);
DealOption dealOption = JsonTestUtils.deserializeJson(dealOptionNode.toString(), DealOption.class);
| byte[] bytes = SerializationTestUtils.serialize(dealOption); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/YelpAPIError.java
// public abstract class YelpAPIError extends IOException {
// private int code;
// private String message;
// private String text;
// private String errorId;
//
// public int getCode() {
// return code;
// }
//
// @Override
// public String getMessage() {
// return message;
// }
//
// public String getText() {
// return text;
// }
//
// public String getErrorId() {
// return errorId;
// }
//
// public YelpAPIError(int code, String message, String errorId, String text) {
// this.code = code;
// this.message = message;
// this.errorId = errorId;
// this.text = text;
// }
// }
| import com.yelp.clientlib.exception.exceptions.YelpAPIError;
import org.junit.Assert; | package com.yelp.clientlib.utils;
public class ErrorTestUtils {
/**
* Verify a {@link YelpAPIError} contains correct information.
*
* @param error The YelpAPIError to be verified.
* @param expectCode Expected error code.
* @param expectMessage Expected error message.
* @param expectId Expected error Id.
* @param expectText Expected error text.
*/
public static void verifyErrorContent( | // Path: src/main/java/com/yelp/clientlib/exception/exceptions/YelpAPIError.java
// public abstract class YelpAPIError extends IOException {
// private int code;
// private String message;
// private String text;
// private String errorId;
//
// public int getCode() {
// return code;
// }
//
// @Override
// public String getMessage() {
// return message;
// }
//
// public String getText() {
// return text;
// }
//
// public String getErrorId() {
// return errorId;
// }
//
// public YelpAPIError(int code, String message, String errorId, String text) {
// this.code = code;
// this.message = message;
// this.errorId = errorId;
// this.text = text;
// }
// }
// Path: src/test/java/com/yelp/clientlib/utils/ErrorTestUtils.java
import com.yelp.clientlib.exception.exceptions.YelpAPIError;
import org.junit.Assert;
package com.yelp.clientlib.utils;
public class ErrorTestUtils {
/**
* Verify a {@link YelpAPIError} contains correct information.
*
* @param error The YelpAPIError to be verified.
* @param expectCode Expected error code.
* @param expectMessage Expected error message.
* @param expectId Expected error Id.
* @param expectText Expected error text.
*/
public static void verifyErrorContent( | YelpAPIError error, |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/RegionTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class RegionTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/RegionTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class RegionTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode regionNode = JsonTestUtils.getSearchResponseJsonNode().path("region"); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/RegionTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class RegionTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode regionNode = JsonTestUtils.getSearchResponseJsonNode().path("region");
Region region = JsonTestUtils.deserializeJson(regionNode.toString(), Region.class);
// Coordinate and Span are tested in their own tests.
Assert.assertNotNull(region.center());
Assert.assertNotNull(region.span());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode regionNode = JsonTestUtils.getSearchResponseJsonNode().path("region");
Region region = JsonTestUtils.deserializeJson(regionNode.toString(), Region.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/RegionTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class RegionTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode regionNode = JsonTestUtils.getSearchResponseJsonNode().path("region");
Region region = JsonTestUtils.deserializeJson(regionNode.toString(), Region.class);
// Coordinate and Span are tested in their own tests.
Assert.assertNotNull(region.center());
Assert.assertNotNull(region.span());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode regionNode = JsonTestUtils.getSearchResponseJsonNode().path("region");
Region region = JsonTestUtils.deserializeJson(regionNode.toString(), Region.class);
| byte[] bytes = SerializationTestUtils.serialize(region); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/DealTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class DealTest {
@Test
public void testDeserializeFromJson() throws IOException { | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/DealTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class DealTest {
@Test
public void testDeserializeFromJson() throws IOException { | JsonNode dealNode = JsonTestUtils.getBusinessResponseJsonNode().path("deals").get(0); |
Yelp/yelp-android | src/test/java/com/yelp/clientlib/entities/DealTest.java | // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
| import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException; | package com.yelp.clientlib.entities;
public class DealTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode dealNode = JsonTestUtils.getBusinessResponseJsonNode().path("deals").get(0);
Deal deal = JsonTestUtils.deserializeJson(dealNode.toString(), Deal.class);
Assert.assertNull(deal.additionalRestrictions());
Assert.assertEquals(dealNode.path("currency_code").textValue(), deal.currencyCode());
Assert.assertNull(deal.id());
Assert.assertEquals(dealNode.path("image_url").textValue(), deal.imageUrl());
Assert.assertNull(deal.importantRestrictions());
Assert.assertEquals(dealNode.path("is_popular").asBoolean(), deal.isPopular());
Assert.assertNotNull(deal.options().get(0));
Assert.assertNull(deal.timeEnd());
Assert.assertEquals(new Long(dealNode.path("time_start").asLong()), deal.timeStart());
Assert.assertEquals(dealNode.path("title").textValue(), deal.title());
Assert.assertEquals(dealNode.path("url").textValue(), deal.url());
Assert.assertNull(deal.whatYouGet());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode dealNode = JsonTestUtils.getBusinessResponseJsonNode().path("deals").get(0);
Deal deal = JsonTestUtils.deserializeJson(dealNode.toString(), Deal.class);
| // Path: src/test/java/com/yelp/clientlib/utils/JsonTestUtils.java
// public class JsonTestUtils {
// public static final String BUSINESS_RESPONSE_JSON_FILENAME = "businessResponse.json";
//
// public static final String SEARCH_RESPONSE_JSON_FILENAME = "searchResponse.json";
//
// public static JsonNode getBusinessResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(BUSINESS_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getSearchResponseJsonNode() throws IOException {
// return getJsonNodeFromFile(SEARCH_RESPONSE_JSON_FILENAME);
// }
//
// public static JsonNode getJsonNodeFromFile(String filename) throws IOException {
// File jsonFile = new File(JsonTestUtils.class.getClassLoader().getResource(filename).getFile());
// return new ObjectMapper().readTree(jsonFile);
// }
//
// public static <T> T deserializeJson(String content, Class<T> valueType) throws IOException {
// return new ObjectMapper().readValue(content, valueType);
// }
// }
//
// Path: src/test/java/com/yelp/clientlib/utils/SerializationTestUtils.java
// public class SerializationTestUtils {
//
// /**
// * Serialize an object into a byte array. The object has to implement {@link Serializable} interface.
// *
// * @param object Object to be serialized.
// * @return Byte array serialized from the object.
// */
// public static <T extends Serializable> byte[] serialize(T object) throws IOException {
// ByteArrayOutputStream byteArrayOutputStream = new ByteArrayOutputStream();
// ObjectOutputStream objectOutputStream = new ObjectOutputStream(byteArrayOutputStream);
// objectOutputStream.writeObject(object);
// objectOutputStream.close();
//
// return byteArrayOutputStream.toByteArray();
// }
//
// /**
// * Deserialize a byte array into an object. The object has to implement {@link Serializable} interface.
// *
// * @param bytes Byte array to be deserialized.
// * @param clazz Class type the object should be deserialized into.
// * @return Object deserialized from the byte array.
// */
// public static <T extends Serializable> T deserialize(byte[] bytes, Class<T> clazz)
// throws IOException, ClassNotFoundException {
// ByteArrayInputStream byteArrayInputStream = new ByteArrayInputStream(bytes);
// ObjectInputStream objectInputStream = new ObjectInputStream(byteArrayInputStream);
// Object object = objectInputStream.readObject();
//
// return clazz.cast(object);
// }
// }
// Path: src/test/java/com/yelp/clientlib/entities/DealTest.java
import com.fasterxml.jackson.databind.JsonNode;
import com.yelp.clientlib.utils.JsonTestUtils;
import com.yelp.clientlib.utils.SerializationTestUtils;
import org.junit.Assert;
import org.junit.Test;
import java.io.IOException;
package com.yelp.clientlib.entities;
public class DealTest {
@Test
public void testDeserializeFromJson() throws IOException {
JsonNode dealNode = JsonTestUtils.getBusinessResponseJsonNode().path("deals").get(0);
Deal deal = JsonTestUtils.deserializeJson(dealNode.toString(), Deal.class);
Assert.assertNull(deal.additionalRestrictions());
Assert.assertEquals(dealNode.path("currency_code").textValue(), deal.currencyCode());
Assert.assertNull(deal.id());
Assert.assertEquals(dealNode.path("image_url").textValue(), deal.imageUrl());
Assert.assertNull(deal.importantRestrictions());
Assert.assertEquals(dealNode.path("is_popular").asBoolean(), deal.isPopular());
Assert.assertNotNull(deal.options().get(0));
Assert.assertNull(deal.timeEnd());
Assert.assertEquals(new Long(dealNode.path("time_start").asLong()), deal.timeStart());
Assert.assertEquals(dealNode.path("title").textValue(), deal.title());
Assert.assertEquals(dealNode.path("url").textValue(), deal.url());
Assert.assertNull(deal.whatYouGet());
}
@Test
public void testSerializable() throws IOException, ClassNotFoundException {
JsonNode dealNode = JsonTestUtils.getBusinessResponseJsonNode().path("deals").get(0);
Deal deal = JsonTestUtils.deserializeJson(dealNode.toString(), Deal.class);
| byte[] bytes = SerializationTestUtils.serialize(deal); |
kapelner/bartMachine | src/bartMachine/bartMachineRegressionMultThread.java | // Path: src/OpenSourceExtensions/UnorderedPair.java
// public final class UnorderedPair<E extends Comparable<E>> implements Comparable<UnorderedPair<E>> {
// private final E first;
// private final E second;
//
// /**
// * Creates an unordered pair of the specified elements. The order of the arguments is irrelevant,
// * so the first argument is not guaranteed to be returned by {@link #getFirst()}, for example.
// * @param a one element of the pair. Must not be <tt>null</tt>.
// * @param b one element of the pair. Must not be <tt>null</tt>. May be the same as <tt>a</tt>.
// */
// public UnorderedPair(E a, E b) {
// if (a.compareTo(b) < 0) {
// this.first = a;
// this.second = b;
// } else {
// this.first = b;
// this.second = a;
// }
// }
//
// /**
// * Gets the smallest element of the pair (according to its {@link Comparable} implementation).
// * @return an element of the pair. <tt>null</tt> is never returned.
// */
// public E getFirst() {
// return first;
// }
//
// /**
// * Gets the largest element of the pair (according to its {@link Comparable} implementation).
// * @return an element of the pair. <tt>null</tt> is never returned.
// */
// public E getSecond() {
// return second;
// }
//
// @Override
// public int hashCode() {
// return 31 * first.hashCode() + 173 * second.hashCode();
// }
//
// @Override
// public boolean equals(Object obj) {
// if (this == obj)
// return true;
// if (obj == null)
// return false;
// if (getClass() != obj.getClass())
// return false;
// UnorderedPair<?> other = (UnorderedPair<?>) obj;
// if (!first.equals(other.first))
// return false;
// if (!second.equals(other.second))
// return false;
// return true;
// }
//
// public int compareTo(UnorderedPair<E> o) {
// int firstCmp = first.compareTo(o.first);
// if (firstCmp != 0)
// return firstCmp;
// return second.compareTo(o.second);
// }
//
// @Override
// public String toString() {
// return "(" + first + "," + second + ")";
// }
// }
| import gnu.trove.list.array.TDoubleArrayList;
import java.io.Serializable;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.HashSet;
import java.util.concurrent.ExecutorService;
import java.util.concurrent.Executors;
import java.util.concurrent.TimeUnit;
import OpenSourceExtensions.UnorderedPair; | * Return the proportion of times each of the attributes were used (count over total number of splits)
* during the construction of the sum-of-trees by Gibbs sample.
*
* @param type Either "splits" or "trees" ("splits" means total number and "trees" means sum of binary values of whether or not it has appeared in the tree)
* @return The proportion of splits for all Gibbs samples further indexed by the attribute 1, ..., p
*/
public double[] getAttributeProps(final String type) {
int[][] variable_counts_all_gibbs = getCountsForAllAttribute(type);
double[] attribute_counts = new double[p];
for (int g = 0; g < num_gibbs_total_iterations - num_gibbs_burn_in; g++){
attribute_counts = Tools.add_arrays(attribute_counts, variable_counts_all_gibbs[g]);
}
Tools.normalize_array(attribute_counts); //will turn it into proportions
return attribute_counts;
}
/**
* For all Gibbs samples after burn in, calculate the set of interaction counts (consider a split on x_j
* and a daughter node splits on x_k and that would be considered an "interaction")
*
* @return A matrix of size p x p where the row is top split and the column is a bottom split. It is recommended to triangularize the matrix after ignoring the order.
*/
public int[][] getInteractionCounts(){
int[][] interaction_count_matrix = new int[p][p];
for (int g = 0; g < gibbs_samples_of_bart_trees_after_burn_in.length; g++){
bartMachineTreeNode[] trees = gibbs_samples_of_bart_trees_after_burn_in[g];
for (bartMachineTreeNode tree : trees){
//get the set of pairs of interactions | // Path: src/OpenSourceExtensions/UnorderedPair.java
// public final class UnorderedPair<E extends Comparable<E>> implements Comparable<UnorderedPair<E>> {
// private final E first;
// private final E second;
//
// /**
// * Creates an unordered pair of the specified elements. The order of the arguments is irrelevant,
// * so the first argument is not guaranteed to be returned by {@link #getFirst()}, for example.
// * @param a one element of the pair. Must not be <tt>null</tt>.
// * @param b one element of the pair. Must not be <tt>null</tt>. May be the same as <tt>a</tt>.
// */
// public UnorderedPair(E a, E b) {
// if (a.compareTo(b) < 0) {
// this.first = a;
// this.second = b;
// } else {
// this.first = b;
// this.second = a;
// }
// }
//
// /**
// * Gets the smallest element of the pair (according to its {@link Comparable} implementation).
// * @return an element of the pair. <tt>null</tt> is never returned.
// */
// public E getFirst() {
// return first;
// }
//
// /**
// * Gets the largest element of the pair (according to its {@link Comparable} implementation).
// * @return an element of the pair. <tt>null</tt> is never returned.
// */
// public E getSecond() {
// return second;
// }
//
// @Override
// public int hashCode() {
// return 31 * first.hashCode() + 173 * second.hashCode();
// }
//
// @Override
// public boolean equals(Object obj) {
// if (this == obj)
// return true;
// if (obj == null)
// return false;
// if (getClass() != obj.getClass())
// return false;
// UnorderedPair<?> other = (UnorderedPair<?>) obj;
// if (!first.equals(other.first))
// return false;
// if (!second.equals(other.second))
// return false;
// return true;
// }
//
// public int compareTo(UnorderedPair<E> o) {
// int firstCmp = first.compareTo(o.first);
// if (firstCmp != 0)
// return firstCmp;
// return second.compareTo(o.second);
// }
//
// @Override
// public String toString() {
// return "(" + first + "," + second + ")";
// }
// }
// Path: src/bartMachine/bartMachineRegressionMultThread.java
import gnu.trove.list.array.TDoubleArrayList;
import java.io.Serializable;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.HashSet;
import java.util.concurrent.ExecutorService;
import java.util.concurrent.Executors;
import java.util.concurrent.TimeUnit;
import OpenSourceExtensions.UnorderedPair;
* Return the proportion of times each of the attributes were used (count over total number of splits)
* during the construction of the sum-of-trees by Gibbs sample.
*
* @param type Either "splits" or "trees" ("splits" means total number and "trees" means sum of binary values of whether or not it has appeared in the tree)
* @return The proportion of splits for all Gibbs samples further indexed by the attribute 1, ..., p
*/
public double[] getAttributeProps(final String type) {
int[][] variable_counts_all_gibbs = getCountsForAllAttribute(type);
double[] attribute_counts = new double[p];
for (int g = 0; g < num_gibbs_total_iterations - num_gibbs_burn_in; g++){
attribute_counts = Tools.add_arrays(attribute_counts, variable_counts_all_gibbs[g]);
}
Tools.normalize_array(attribute_counts); //will turn it into proportions
return attribute_counts;
}
/**
* For all Gibbs samples after burn in, calculate the set of interaction counts (consider a split on x_j
* and a daughter node splits on x_k and that would be considered an "interaction")
*
* @return A matrix of size p x p where the row is top split and the column is a bottom split. It is recommended to triangularize the matrix after ignoring the order.
*/
public int[][] getInteractionCounts(){
int[][] interaction_count_matrix = new int[p][p];
for (int g = 0; g < gibbs_samples_of_bart_trees_after_burn_in.length; g++){
bartMachineTreeNode[] trees = gibbs_samples_of_bart_trees_after_burn_in[g];
for (bartMachineTreeNode tree : trees){
//get the set of pairs of interactions | HashSet<UnorderedPair<Integer>> set_of_interaction_pairs = new HashSet<UnorderedPair<Integer>>(p * p); |
nooone/gdx-vr | gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderer.java | // Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SizeInformation {
// /** Determines, how the size should be interpreted. */
// public SizeType sizeType;
//
// /**
// * The size to be used. Is ignored in case {@link SizeType} REST is
// * used.
// */
// public float size;
//
// public SizeInformation(SizeType sizeType, float size) {
// this.sizeType = sizeType;
// this.size = size;
// }
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public enum SizeType {
// /**
// * The size will be fixed and will have exactly the given size all the
// * time.
// */
// ABSOLUTE,
//
// /**
// * The given size needs to be in [0, 1]. It is relative to the "root"
// * viewport.
// */
// RELATIVE,
//
// /**
// * If this type is chosen, the given size will be ignored. Instead all
// * cells with this type will share the rest amount of the "root"
// * viewport that is still left after all other parts have been
// * subtracted.
// */
// REST
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SubView {
// /** The size information for this sub view. */
// public SizeInformation sizeInformation;
//
// /** The {@link Viewport} for this sub view. */
// public Viewport viewport;
//
// public SubView(SizeInformation sizeInformation, Viewport viewport) {
// this.sizeInformation = sizeInformation;
// this.viewport = viewport;
// }
//
// }
| import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.Pixmap.Format;
import com.badlogic.gdx.graphics.glutils.FrameBuffer;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.utils.Array;
import com.badlogic.gdx.utils.viewport.ScreenViewport;
import com.badlogic.gdx.utils.viewport.Viewport;
import com.badlogic.gdx.vr.SplitViewport.SizeInformation;
import com.badlogic.gdx.vr.SplitViewport.SizeType;
import com.badlogic.gdx.vr.SplitViewport.SubView; | /*******************************************************************************
* Copyright 2011 See AUTHORS file.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
******************************************************************************/
package com.badlogic.gdx.vr;
/**
* @author Daniel Holderbaum
*/
public class VirtualRealityRenderer {
public Array<VirtualRealityRenderListener> listeners = new Array<VirtualRealityRenderListener>();
private boolean distortionCorrected;
private FrameBuffer leftFBO, rightFBO;
private SplitViewport splitViewport = new SplitViewport(new ScreenViewport());
public VirtualRealityRenderer() { | // Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SizeInformation {
// /** Determines, how the size should be interpreted. */
// public SizeType sizeType;
//
// /**
// * The size to be used. Is ignored in case {@link SizeType} REST is
// * used.
// */
// public float size;
//
// public SizeInformation(SizeType sizeType, float size) {
// this.sizeType = sizeType;
// this.size = size;
// }
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public enum SizeType {
// /**
// * The size will be fixed and will have exactly the given size all the
// * time.
// */
// ABSOLUTE,
//
// /**
// * The given size needs to be in [0, 1]. It is relative to the "root"
// * viewport.
// */
// RELATIVE,
//
// /**
// * If this type is chosen, the given size will be ignored. Instead all
// * cells with this type will share the rest amount of the "root"
// * viewport that is still left after all other parts have been
// * subtracted.
// */
// REST
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SubView {
// /** The size information for this sub view. */
// public SizeInformation sizeInformation;
//
// /** The {@link Viewport} for this sub view. */
// public Viewport viewport;
//
// public SubView(SizeInformation sizeInformation, Viewport viewport) {
// this.sizeInformation = sizeInformation;
// this.viewport = viewport;
// }
//
// }
// Path: gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderer.java
import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.Pixmap.Format;
import com.badlogic.gdx.graphics.glutils.FrameBuffer;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.utils.Array;
import com.badlogic.gdx.utils.viewport.ScreenViewport;
import com.badlogic.gdx.utils.viewport.Viewport;
import com.badlogic.gdx.vr.SplitViewport.SizeInformation;
import com.badlogic.gdx.vr.SplitViewport.SizeType;
import com.badlogic.gdx.vr.SplitViewport.SubView;
/*******************************************************************************
* Copyright 2011 See AUTHORS file.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
******************************************************************************/
package com.badlogic.gdx.vr;
/**
* @author Daniel Holderbaum
*/
public class VirtualRealityRenderer {
public Array<VirtualRealityRenderListener> listeners = new Array<VirtualRealityRenderListener>();
private boolean distortionCorrected;
private FrameBuffer leftFBO, rightFBO;
private SplitViewport splitViewport = new SplitViewport(new ScreenViewport());
public VirtualRealityRenderer() { | splitViewport.row(new SizeInformation(SizeType.RELATIVE, 1f)); |
nooone/gdx-vr | gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderer.java | // Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SizeInformation {
// /** Determines, how the size should be interpreted. */
// public SizeType sizeType;
//
// /**
// * The size to be used. Is ignored in case {@link SizeType} REST is
// * used.
// */
// public float size;
//
// public SizeInformation(SizeType sizeType, float size) {
// this.sizeType = sizeType;
// this.size = size;
// }
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public enum SizeType {
// /**
// * The size will be fixed and will have exactly the given size all the
// * time.
// */
// ABSOLUTE,
//
// /**
// * The given size needs to be in [0, 1]. It is relative to the "root"
// * viewport.
// */
// RELATIVE,
//
// /**
// * If this type is chosen, the given size will be ignored. Instead all
// * cells with this type will share the rest amount of the "root"
// * viewport that is still left after all other parts have been
// * subtracted.
// */
// REST
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SubView {
// /** The size information for this sub view. */
// public SizeInformation sizeInformation;
//
// /** The {@link Viewport} for this sub view. */
// public Viewport viewport;
//
// public SubView(SizeInformation sizeInformation, Viewport viewport) {
// this.sizeInformation = sizeInformation;
// this.viewport = viewport;
// }
//
// }
| import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.Pixmap.Format;
import com.badlogic.gdx.graphics.glutils.FrameBuffer;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.utils.Array;
import com.badlogic.gdx.utils.viewport.ScreenViewport;
import com.badlogic.gdx.utils.viewport.Viewport;
import com.badlogic.gdx.vr.SplitViewport.SizeInformation;
import com.badlogic.gdx.vr.SplitViewport.SizeType;
import com.badlogic.gdx.vr.SplitViewport.SubView; | /*******************************************************************************
* Copyright 2011 See AUTHORS file.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
******************************************************************************/
package com.badlogic.gdx.vr;
/**
* @author Daniel Holderbaum
*/
public class VirtualRealityRenderer {
public Array<VirtualRealityRenderListener> listeners = new Array<VirtualRealityRenderListener>();
private boolean distortionCorrected;
private FrameBuffer leftFBO, rightFBO;
private SplitViewport splitViewport = new SplitViewport(new ScreenViewport());
public VirtualRealityRenderer() { | // Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SizeInformation {
// /** Determines, how the size should be interpreted. */
// public SizeType sizeType;
//
// /**
// * The size to be used. Is ignored in case {@link SizeType} REST is
// * used.
// */
// public float size;
//
// public SizeInformation(SizeType sizeType, float size) {
// this.sizeType = sizeType;
// this.size = size;
// }
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public enum SizeType {
// /**
// * The size will be fixed and will have exactly the given size all the
// * time.
// */
// ABSOLUTE,
//
// /**
// * The given size needs to be in [0, 1]. It is relative to the "root"
// * viewport.
// */
// RELATIVE,
//
// /**
// * If this type is chosen, the given size will be ignored. Instead all
// * cells with this type will share the rest amount of the "root"
// * viewport that is still left after all other parts have been
// * subtracted.
// */
// REST
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SubView {
// /** The size information for this sub view. */
// public SizeInformation sizeInformation;
//
// /** The {@link Viewport} for this sub view. */
// public Viewport viewport;
//
// public SubView(SizeInformation sizeInformation, Viewport viewport) {
// this.sizeInformation = sizeInformation;
// this.viewport = viewport;
// }
//
// }
// Path: gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderer.java
import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.Pixmap.Format;
import com.badlogic.gdx.graphics.glutils.FrameBuffer;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.utils.Array;
import com.badlogic.gdx.utils.viewport.ScreenViewport;
import com.badlogic.gdx.utils.viewport.Viewport;
import com.badlogic.gdx.vr.SplitViewport.SizeInformation;
import com.badlogic.gdx.vr.SplitViewport.SizeType;
import com.badlogic.gdx.vr.SplitViewport.SubView;
/*******************************************************************************
* Copyright 2011 See AUTHORS file.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
******************************************************************************/
package com.badlogic.gdx.vr;
/**
* @author Daniel Holderbaum
*/
public class VirtualRealityRenderer {
public Array<VirtualRealityRenderListener> listeners = new Array<VirtualRealityRenderListener>();
private boolean distortionCorrected;
private FrameBuffer leftFBO, rightFBO;
private SplitViewport splitViewport = new SplitViewport(new ScreenViewport());
public VirtualRealityRenderer() { | splitViewport.row(new SizeInformation(SizeType.RELATIVE, 1f)); |
nooone/gdx-vr | gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderer.java | // Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SizeInformation {
// /** Determines, how the size should be interpreted. */
// public SizeType sizeType;
//
// /**
// * The size to be used. Is ignored in case {@link SizeType} REST is
// * used.
// */
// public float size;
//
// public SizeInformation(SizeType sizeType, float size) {
// this.sizeType = sizeType;
// this.size = size;
// }
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public enum SizeType {
// /**
// * The size will be fixed and will have exactly the given size all the
// * time.
// */
// ABSOLUTE,
//
// /**
// * The given size needs to be in [0, 1]. It is relative to the "root"
// * viewport.
// */
// RELATIVE,
//
// /**
// * If this type is chosen, the given size will be ignored. Instead all
// * cells with this type will share the rest amount of the "root"
// * viewport that is still left after all other parts have been
// * subtracted.
// */
// REST
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SubView {
// /** The size information for this sub view. */
// public SizeInformation sizeInformation;
//
// /** The {@link Viewport} for this sub view. */
// public Viewport viewport;
//
// public SubView(SizeInformation sizeInformation, Viewport viewport) {
// this.sizeInformation = sizeInformation;
// this.viewport = viewport;
// }
//
// }
| import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.Pixmap.Format;
import com.badlogic.gdx.graphics.glutils.FrameBuffer;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.utils.Array;
import com.badlogic.gdx.utils.viewport.ScreenViewport;
import com.badlogic.gdx.utils.viewport.Viewport;
import com.badlogic.gdx.vr.SplitViewport.SizeInformation;
import com.badlogic.gdx.vr.SplitViewport.SizeType;
import com.badlogic.gdx.vr.SplitViewport.SubView; | /*******************************************************************************
* Copyright 2011 See AUTHORS file.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
******************************************************************************/
package com.badlogic.gdx.vr;
/**
* @author Daniel Holderbaum
*/
public class VirtualRealityRenderer {
public Array<VirtualRealityRenderListener> listeners = new Array<VirtualRealityRenderListener>();
private boolean distortionCorrected;
private FrameBuffer leftFBO, rightFBO;
private SplitViewport splitViewport = new SplitViewport(new ScreenViewport());
public VirtualRealityRenderer() {
splitViewport.row(new SizeInformation(SizeType.RELATIVE, 1f)); | // Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SizeInformation {
// /** Determines, how the size should be interpreted. */
// public SizeType sizeType;
//
// /**
// * The size to be used. Is ignored in case {@link SizeType} REST is
// * used.
// */
// public float size;
//
// public SizeInformation(SizeType sizeType, float size) {
// this.sizeType = sizeType;
// this.size = size;
// }
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public enum SizeType {
// /**
// * The size will be fixed and will have exactly the given size all the
// * time.
// */
// ABSOLUTE,
//
// /**
// * The given size needs to be in [0, 1]. It is relative to the "root"
// * viewport.
// */
// RELATIVE,
//
// /**
// * If this type is chosen, the given size will be ignored. Instead all
// * cells with this type will share the rest amount of the "root"
// * viewport that is still left after all other parts have been
// * subtracted.
// */
// REST
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/SplitViewport.java
// public static class SubView {
// /** The size information for this sub view. */
// public SizeInformation sizeInformation;
//
// /** The {@link Viewport} for this sub view. */
// public Viewport viewport;
//
// public SubView(SizeInformation sizeInformation, Viewport viewport) {
// this.sizeInformation = sizeInformation;
// this.viewport = viewport;
// }
//
// }
// Path: gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderer.java
import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.Pixmap.Format;
import com.badlogic.gdx.graphics.glutils.FrameBuffer;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.utils.Array;
import com.badlogic.gdx.utils.viewport.ScreenViewport;
import com.badlogic.gdx.utils.viewport.Viewport;
import com.badlogic.gdx.vr.SplitViewport.SizeInformation;
import com.badlogic.gdx.vr.SplitViewport.SizeType;
import com.badlogic.gdx.vr.SplitViewport.SubView;
/*******************************************************************************
* Copyright 2011 See AUTHORS file.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
******************************************************************************/
package com.badlogic.gdx.vr;
/**
* @author Daniel Holderbaum
*/
public class VirtualRealityRenderer {
public Array<VirtualRealityRenderListener> listeners = new Array<VirtualRealityRenderListener>();
private boolean distortionCorrected;
private FrameBuffer leftFBO, rightFBO;
private SplitViewport splitViewport = new SplitViewport(new ScreenViewport());
public VirtualRealityRenderer() {
splitViewport.row(new SizeInformation(SizeType.RELATIVE, 1f)); | splitViewport.add(new SubView(new SizeInformation(SizeType.RELATIVE, 0.5f), VirtualReality.head.getLeftEye())); |
nooone/gdx-vr | gdx-vr-simpleroom-core/src/com/badlogic/gdx/vr/simpleroom/SimpleRoom.java | // Path: gdx-vr/src/com/badlogic/gdx/vr/Stage3D.java
// public class Stage3D extends Stage {
//
// private final Plane plane;
//
// // private final Vector2 offsetOnPlane;
//
// public Stage3D() {
// super();
// this.plane = new Plane(new Vector3(0, 0, 1), Vector3.Zero);
// }
//
// public Stage3D(Viewport viewport) {
// super(viewport);
// this.plane = new Plane(new Vector3(0, 0, 1), Vector3.Zero);
// }
//
// public Stage3D(Viewport viewport, SpriteBatch batch) {
// super(viewport, batch);
// this.plane = new Plane(new Vector3(0, 0, 1), Vector3.Zero);
// }
//
// public Stage3D(Plane plane, Viewport viewport, SpriteBatch batch) {
// super(viewport, batch);
// this.plane = plane;
// }
//
// private static final Vector3 tmp = new Vector3();
//
// @Override
// public Vector2 screenToStageCoordinates(Vector2 screenCoords) {
// Ray pickRay = getViewport().getPickRay(screenCoords.x, screenCoords.y);
// Vector3 intersection = tmp;
// if (Intersector.intersectRayPlane(pickRay, plane, intersection)) {
// screenCoords.x = intersection.x;
// screenCoords.y = intersection.y;
// } else {
// screenCoords.x = Float.MAX_VALUE;
// screenCoords.y = Float.MAX_VALUE;
// }
// return screenCoords;
// }
//
// @Override
// public void calculateScissors(Rectangle localRect, Rectangle scissorRect) {
// super.calculateScissors(localRect, scissorRect);
// scissorRect.set(Float.MIN_VALUE, Float.MIN_VALUE, Float.MAX_VALUE, Float.MAX_VALUE);
// }
//
// private static final Matrix4 transform = new Matrix4();
//
// @Override
// public void draw() {
// transform.idt();
// transform.setToLookAt(plane.normal, Vector3.Z);
// // TODO: no cpy()
// transform.translate(plane.normal.cpy().nor().scl(plane.d));
//
// getBatch().setTransformMatrix(transform);
//
// super.draw();
// }
//
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/VirtualReality.java
// public class VirtualReality {
//
// public static HeadMountedDisplay headMountedDisplay;
//
// public static Head head;
//
// public static Body body;
//
// public static VirtualRealityRenderer renderer;
//
// static VirtualRealityImplementation implementation;
//
// static DistortionRenderer distortionRenderer;
//
// // TODO: remove from here and javadoc
// public static void update(float deltaTime) {
// implementation.update(deltaTime);
// }
//
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderListener.java
// public interface VirtualRealityRenderListener {
//
// /**
// * This is called before any rendering is triggered. It can be implemented
// * to clear the screen before each frame for example.
// */
// void frameStarted();
//
// /**
// * This is called after the rendering of all eyes is finished.
// */
// void frameEnded();
//
// /**
// * TODO: make this viewport, not camera.
// *
// * Called once or twice, depending on the settings of the renderer.
// */
// void render(Camera camera);
//
// }
| import com.badlogic.gdx.ApplicationAdapter;
import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.Input;
import com.badlogic.gdx.assets.AssetManager;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.GL20;
import com.badlogic.gdx.graphics.VertexAttributes.Usage;
import com.badlogic.gdx.graphics.g3d.Environment;
import com.badlogic.gdx.graphics.g3d.Material;
import com.badlogic.gdx.graphics.g3d.Model;
import com.badlogic.gdx.graphics.g3d.ModelBatch;
import com.badlogic.gdx.graphics.g3d.ModelInstance;
import com.badlogic.gdx.graphics.g3d.attributes.ColorAttribute;
import com.badlogic.gdx.graphics.g3d.environment.DirectionalLight;
import com.badlogic.gdx.graphics.g3d.shaders.DefaultShader;
import com.badlogic.gdx.graphics.g3d.shaders.DefaultShader.Config;
import com.badlogic.gdx.graphics.g3d.utils.DefaultShaderProvider;
import com.badlogic.gdx.graphics.g3d.utils.ModelBuilder;
import com.badlogic.gdx.graphics.g3d.utils.ShaderProvider;
import com.badlogic.gdx.math.Matrix4;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.vr.Stage3D;
import com.badlogic.gdx.vr.VirtualReality;
import com.badlogic.gdx.vr.VirtualRealityRenderListener; | package com.badlogic.gdx.vr.simpleroom;
public class SimpleRoom extends ApplicationAdapter implements VirtualRealityRenderListener {
private ModelBatch modelBatch;
private ModelInstance modelInstance;
private ModelInstance ground;
private AssetManager assets;
private Environment environment; | // Path: gdx-vr/src/com/badlogic/gdx/vr/Stage3D.java
// public class Stage3D extends Stage {
//
// private final Plane plane;
//
// // private final Vector2 offsetOnPlane;
//
// public Stage3D() {
// super();
// this.plane = new Plane(new Vector3(0, 0, 1), Vector3.Zero);
// }
//
// public Stage3D(Viewport viewport) {
// super(viewport);
// this.plane = new Plane(new Vector3(0, 0, 1), Vector3.Zero);
// }
//
// public Stage3D(Viewport viewport, SpriteBatch batch) {
// super(viewport, batch);
// this.plane = new Plane(new Vector3(0, 0, 1), Vector3.Zero);
// }
//
// public Stage3D(Plane plane, Viewport viewport, SpriteBatch batch) {
// super(viewport, batch);
// this.plane = plane;
// }
//
// private static final Vector3 tmp = new Vector3();
//
// @Override
// public Vector2 screenToStageCoordinates(Vector2 screenCoords) {
// Ray pickRay = getViewport().getPickRay(screenCoords.x, screenCoords.y);
// Vector3 intersection = tmp;
// if (Intersector.intersectRayPlane(pickRay, plane, intersection)) {
// screenCoords.x = intersection.x;
// screenCoords.y = intersection.y;
// } else {
// screenCoords.x = Float.MAX_VALUE;
// screenCoords.y = Float.MAX_VALUE;
// }
// return screenCoords;
// }
//
// @Override
// public void calculateScissors(Rectangle localRect, Rectangle scissorRect) {
// super.calculateScissors(localRect, scissorRect);
// scissorRect.set(Float.MIN_VALUE, Float.MIN_VALUE, Float.MAX_VALUE, Float.MAX_VALUE);
// }
//
// private static final Matrix4 transform = new Matrix4();
//
// @Override
// public void draw() {
// transform.idt();
// transform.setToLookAt(plane.normal, Vector3.Z);
// // TODO: no cpy()
// transform.translate(plane.normal.cpy().nor().scl(plane.d));
//
// getBatch().setTransformMatrix(transform);
//
// super.draw();
// }
//
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/VirtualReality.java
// public class VirtualReality {
//
// public static HeadMountedDisplay headMountedDisplay;
//
// public static Head head;
//
// public static Body body;
//
// public static VirtualRealityRenderer renderer;
//
// static VirtualRealityImplementation implementation;
//
// static DistortionRenderer distortionRenderer;
//
// // TODO: remove from here and javadoc
// public static void update(float deltaTime) {
// implementation.update(deltaTime);
// }
//
// }
//
// Path: gdx-vr/src/com/badlogic/gdx/vr/VirtualRealityRenderListener.java
// public interface VirtualRealityRenderListener {
//
// /**
// * This is called before any rendering is triggered. It can be implemented
// * to clear the screen before each frame for example.
// */
// void frameStarted();
//
// /**
// * This is called after the rendering of all eyes is finished.
// */
// void frameEnded();
//
// /**
// * TODO: make this viewport, not camera.
// *
// * Called once or twice, depending on the settings of the renderer.
// */
// void render(Camera camera);
//
// }
// Path: gdx-vr-simpleroom-core/src/com/badlogic/gdx/vr/simpleroom/SimpleRoom.java
import com.badlogic.gdx.ApplicationAdapter;
import com.badlogic.gdx.Gdx;
import com.badlogic.gdx.Input;
import com.badlogic.gdx.assets.AssetManager;
import com.badlogic.gdx.graphics.Camera;
import com.badlogic.gdx.graphics.GL20;
import com.badlogic.gdx.graphics.VertexAttributes.Usage;
import com.badlogic.gdx.graphics.g3d.Environment;
import com.badlogic.gdx.graphics.g3d.Material;
import com.badlogic.gdx.graphics.g3d.Model;
import com.badlogic.gdx.graphics.g3d.ModelBatch;
import com.badlogic.gdx.graphics.g3d.ModelInstance;
import com.badlogic.gdx.graphics.g3d.attributes.ColorAttribute;
import com.badlogic.gdx.graphics.g3d.environment.DirectionalLight;
import com.badlogic.gdx.graphics.g3d.shaders.DefaultShader;
import com.badlogic.gdx.graphics.g3d.shaders.DefaultShader.Config;
import com.badlogic.gdx.graphics.g3d.utils.DefaultShaderProvider;
import com.badlogic.gdx.graphics.g3d.utils.ModelBuilder;
import com.badlogic.gdx.graphics.g3d.utils.ShaderProvider;
import com.badlogic.gdx.math.Matrix4;
import com.badlogic.gdx.math.Quaternion;
import com.badlogic.gdx.math.Vector3;
import com.badlogic.gdx.vr.Stage3D;
import com.badlogic.gdx.vr.VirtualReality;
import com.badlogic.gdx.vr.VirtualRealityRenderListener;
package com.badlogic.gdx.vr.simpleroom;
public class SimpleRoom extends ApplicationAdapter implements VirtualRealityRenderListener {
private ModelBatch modelBatch;
private ModelInstance modelInstance;
private ModelInstance ground;
private AssetManager assets;
private Environment environment; | private Stage3D stage; |
nooone/gdx-vr | gdx-vr-simpleroom-ios/src/com/badlogic/gdx/vr/simpleroom/IOSLauncher.java | // Path: gdx-vr-simpleroom-core/src/com/badlogic/gdx/vr/simpleroom/SimpleRoom.java
// public class SimpleRoom extends ApplicationAdapter implements VirtualRealityRenderListener {
//
// private ModelBatch modelBatch;
// private ModelInstance modelInstance;
// private ModelInstance ground;
// private AssetManager assets;
// private Environment environment;
// private Stage3D stage;
//
// @Override
// public void create() {
// assets = new AssetManager();
// String model = "Bambo_House.g3db";
// assets.load(model, Model.class);
// assets.finishLoading();
// modelInstance = new ModelInstance(assets.get(model, Model.class), new Matrix4().setToScaling(0.6f, 0.6f, 0.6f));
//
// DefaultShader.Config config = new Config();
// config.defaultCullFace = GL20.GL_NONE;
// ShaderProvider shaderProvider = new DefaultShaderProvider(config);
// modelBatch = new ModelBatch(shaderProvider);
//
// ModelBuilder builder = new ModelBuilder();
// float groundSize = 1000f;
// ground = new ModelInstance(builder.createRect(-groundSize, 0, groundSize, groundSize, 0, groundSize, groundSize, 0, -groundSize, -groundSize, 0, -groundSize, 0,
// 1, 0, new Material(), Usage.Position | Usage.Normal), new Matrix4().setToTranslation(0, -0.01f, 0));
// environment = new Environment();
// environment.set(new ColorAttribute(ColorAttribute.AmbientLight, 0.4f, 0.4f, 0.4f, 1f));
// environment.add(new DirectionalLight().set(0.8f, 0.8f, 0.8f, -1f, -0.8f, -0.2f));
//
// VirtualReality.renderer.listeners.add(this);
// // VirtualReality.head.setCyclops(true);
// }
//
// @Override
// public void render() {
// float deltaTime = Gdx.graphics.getDeltaTime();
//
// if (Gdx.input.isKeyPressed(Input.Keys.W)) {
// VirtualReality.body.position.add(new Vector3(0, 0, -2).mul(VirtualReality.body.orientation).scl(deltaTime));
// }
// if (Gdx.input.isKeyPressed(Input.Keys.S)) {
// VirtualReality.body.position.add(new Vector3(0, 0, 2).mul(VirtualReality.body.orientation).scl(deltaTime));
// }
// if (Gdx.input.isKeyPressed(Input.Keys.A)) {
// VirtualReality.body.orientation.mulLeft(new Quaternion(Vector3.Y, 90f * deltaTime));
// }
// if (Gdx.input.isKeyPressed(Input.Keys.D)) {
// VirtualReality.body.orientation.mulLeft(new Quaternion(Vector3.Y, -90f * deltaTime));
// }
//
// VirtualReality.update(Gdx.graphics.getDeltaTime());
// VirtualReality.renderer.render();
// }
//
// @Override
// public void resize(int width, int height) {
// // TODO: resize VirtualReality
// }
//
// @Override
// public void frameStarted() {
// Gdx.gl.glClearColor(0, 0, 0, 1);
// Gdx.gl.glClear(GL20.GL_COLOR_BUFFER_BIT | GL20.GL_DEPTH_BUFFER_BIT);
// }
//
// @Override
// public void frameEnded() {
// }
//
// @Override
// public void render(Camera camera) {
// modelBatch.begin(camera);
// modelBatch.render(ground, environment);
// modelBatch.render(modelInstance, environment);
// modelBatch.end();
// }
// }
| import org.robovm.apple.foundation.NSAutoreleasePool;
import org.robovm.apple.uikit.UIApplication;
import com.badlogic.gdx.backends.iosrobovm.IOSApplication;
import com.badlogic.gdx.backends.iosrobovm.IOSApplicationConfiguration;
import com.badlogic.gdx.vr.simpleroom.SimpleRoom; | package com.badlogic.gdx.vr.simpleroom;
public class IOSLauncher extends IOSApplication.Delegate {
@Override
protected IOSApplication createApplication() {
IOSApplicationConfiguration config = new IOSApplicationConfiguration(); | // Path: gdx-vr-simpleroom-core/src/com/badlogic/gdx/vr/simpleroom/SimpleRoom.java
// public class SimpleRoom extends ApplicationAdapter implements VirtualRealityRenderListener {
//
// private ModelBatch modelBatch;
// private ModelInstance modelInstance;
// private ModelInstance ground;
// private AssetManager assets;
// private Environment environment;
// private Stage3D stage;
//
// @Override
// public void create() {
// assets = new AssetManager();
// String model = "Bambo_House.g3db";
// assets.load(model, Model.class);
// assets.finishLoading();
// modelInstance = new ModelInstance(assets.get(model, Model.class), new Matrix4().setToScaling(0.6f, 0.6f, 0.6f));
//
// DefaultShader.Config config = new Config();
// config.defaultCullFace = GL20.GL_NONE;
// ShaderProvider shaderProvider = new DefaultShaderProvider(config);
// modelBatch = new ModelBatch(shaderProvider);
//
// ModelBuilder builder = new ModelBuilder();
// float groundSize = 1000f;
// ground = new ModelInstance(builder.createRect(-groundSize, 0, groundSize, groundSize, 0, groundSize, groundSize, 0, -groundSize, -groundSize, 0, -groundSize, 0,
// 1, 0, new Material(), Usage.Position | Usage.Normal), new Matrix4().setToTranslation(0, -0.01f, 0));
// environment = new Environment();
// environment.set(new ColorAttribute(ColorAttribute.AmbientLight, 0.4f, 0.4f, 0.4f, 1f));
// environment.add(new DirectionalLight().set(0.8f, 0.8f, 0.8f, -1f, -0.8f, -0.2f));
//
// VirtualReality.renderer.listeners.add(this);
// // VirtualReality.head.setCyclops(true);
// }
//
// @Override
// public void render() {
// float deltaTime = Gdx.graphics.getDeltaTime();
//
// if (Gdx.input.isKeyPressed(Input.Keys.W)) {
// VirtualReality.body.position.add(new Vector3(0, 0, -2).mul(VirtualReality.body.orientation).scl(deltaTime));
// }
// if (Gdx.input.isKeyPressed(Input.Keys.S)) {
// VirtualReality.body.position.add(new Vector3(0, 0, 2).mul(VirtualReality.body.orientation).scl(deltaTime));
// }
// if (Gdx.input.isKeyPressed(Input.Keys.A)) {
// VirtualReality.body.orientation.mulLeft(new Quaternion(Vector3.Y, 90f * deltaTime));
// }
// if (Gdx.input.isKeyPressed(Input.Keys.D)) {
// VirtualReality.body.orientation.mulLeft(new Quaternion(Vector3.Y, -90f * deltaTime));
// }
//
// VirtualReality.update(Gdx.graphics.getDeltaTime());
// VirtualReality.renderer.render();
// }
//
// @Override
// public void resize(int width, int height) {
// // TODO: resize VirtualReality
// }
//
// @Override
// public void frameStarted() {
// Gdx.gl.glClearColor(0, 0, 0, 1);
// Gdx.gl.glClear(GL20.GL_COLOR_BUFFER_BIT | GL20.GL_DEPTH_BUFFER_BIT);
// }
//
// @Override
// public void frameEnded() {
// }
//
// @Override
// public void render(Camera camera) {
// modelBatch.begin(camera);
// modelBatch.render(ground, environment);
// modelBatch.render(modelInstance, environment);
// modelBatch.end();
// }
// }
// Path: gdx-vr-simpleroom-ios/src/com/badlogic/gdx/vr/simpleroom/IOSLauncher.java
import org.robovm.apple.foundation.NSAutoreleasePool;
import org.robovm.apple.uikit.UIApplication;
import com.badlogic.gdx.backends.iosrobovm.IOSApplication;
import com.badlogic.gdx.backends.iosrobovm.IOSApplicationConfiguration;
import com.badlogic.gdx.vr.simpleroom.SimpleRoom;
package com.badlogic.gdx.vr.simpleroom;
public class IOSLauncher extends IOSApplication.Delegate {
@Override
protected IOSApplication createApplication() {
IOSApplicationConfiguration config = new IOSApplicationConfiguration(); | return new IOSApplication(new SimpleRoom(), config); |
SecUSo/privacy-friendly-pedometer | app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/TrainingPersistenceHelper.java | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/Training.java
// public class Training {
// private long id;
// private String name;
// private String description;
// private double steps;
// private double distance;
// private double calories;
// private float feeling;
// private long start;
// private long end;
// /**
// * The view type for TrainingOverviewAdapter
// */
// private int viewType = TrainingOverviewAdapter.VIEW_TYPE_TRAINING_SESSION;
//
// public static Training from(Cursor c) {
// Training trainingSession = new Training();
// trainingSession.setId(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry._ID)));
// trainingSession.setName(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_NAME)));
// trainingSession.setDescription(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION)));
// trainingSession.setSteps(c.getInt(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS)));
// trainingSession.setDistance(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE)));
// trainingSession.setCalories(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES)));
// trainingSession.setFeeling(c.getFloat(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING)));
// trainingSession.setStart(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_START)));
// trainingSession.setEnd(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_END)));
// return trainingSession;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public String getDescription() {
// return description;
// }
//
// public void setDescription(String description) {
// this.description = description;
// }
//
// public double getSteps() {
// return steps;
// }
//
// public void setSteps(double steps) {
// this.steps = steps;
// }
//
// public double getDistance() {
// return distance;
// }
//
// public void setDistance(double distance) {
// this.distance = distance;
// }
//
// public double getCalories() {
// return calories;
// }
//
// public void setCalories(double calories) {
// this.calories = calories;
// }
//
// public float getFeeling() {
// return feeling;
// }
//
// public void setFeeling(float feeling) {
// this.feeling = feeling;
// }
//
// public long getStart() {
// return start;
// }
//
// public void setStart(long start) {
// this.start = start;
// }
//
// public long getEnd() {
// return end;
// }
//
// public void setEnd(long end) {
// this.end = end;
// }
//
// public int getViewType() {
// return viewType;
// }
//
// public void setViewType(int viewType) {
// this.viewType = viewType;
// }
//
// /**
// * Returns the duration in seconds
// * @return seconds
// */
// public int getDuration(){
// long end = this.getEnd();
// if(end == 0){
// end = Calendar.getInstance().getTimeInMillis();
// }
// return (Double.valueOf((end - this.getStart())/1000)).intValue();
// }
//
// /**
// * Returns the velocity in meters per second
// * @return m/s
// */
// public double getVelocity(){
// if(this.getDuration() == 0){
// return 0;
// }
// return this.getDistance()/this.getDuration();
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_NAME, this.getName());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION, this.getDescription());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS, this.getSteps());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE, String.valueOf(this.getDistance()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES, String.valueOf(this.getCalories()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING, String.valueOf(this.getFeeling()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_START, String.valueOf(this.getStart()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_END, String.valueOf(this.getEnd()));
// return values;
// }
// }
| import android.content.Context;
import org.secuso.privacyfriendlyactivitytracker.models.Training;
import java.util.List; | /*
Privacy Friendly Pedometer is licensed under the GPLv3.
Copyright (C) 2017 Tobias Neidig
This program is free software: you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation, either version 3 of the License, or
(at your option) any later version.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with this program. If not, see <http://www.gnu.org/licenses/>.
*/
package org.secuso.privacyfriendlyactivitytracker.persistence;
/**
* Helper to save and restore training sessions from database.
*
* @author Tobias Neidig
* @version 20170810
*/
public class TrainingPersistenceHelper {
public static final String LOG_CLASS = TrainingPersistenceHelper.class.getName();
/**
* @deprecated Use {@link TrainingDbHelper#getAllTrainings()} instead.
*
* Gets all training sessions from database
*
* @param context The application context
* @return a list of training sessions
*/ | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/Training.java
// public class Training {
// private long id;
// private String name;
// private String description;
// private double steps;
// private double distance;
// private double calories;
// private float feeling;
// private long start;
// private long end;
// /**
// * The view type for TrainingOverviewAdapter
// */
// private int viewType = TrainingOverviewAdapter.VIEW_TYPE_TRAINING_SESSION;
//
// public static Training from(Cursor c) {
// Training trainingSession = new Training();
// trainingSession.setId(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry._ID)));
// trainingSession.setName(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_NAME)));
// trainingSession.setDescription(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION)));
// trainingSession.setSteps(c.getInt(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS)));
// trainingSession.setDistance(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE)));
// trainingSession.setCalories(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES)));
// trainingSession.setFeeling(c.getFloat(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING)));
// trainingSession.setStart(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_START)));
// trainingSession.setEnd(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_END)));
// return trainingSession;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public String getDescription() {
// return description;
// }
//
// public void setDescription(String description) {
// this.description = description;
// }
//
// public double getSteps() {
// return steps;
// }
//
// public void setSteps(double steps) {
// this.steps = steps;
// }
//
// public double getDistance() {
// return distance;
// }
//
// public void setDistance(double distance) {
// this.distance = distance;
// }
//
// public double getCalories() {
// return calories;
// }
//
// public void setCalories(double calories) {
// this.calories = calories;
// }
//
// public float getFeeling() {
// return feeling;
// }
//
// public void setFeeling(float feeling) {
// this.feeling = feeling;
// }
//
// public long getStart() {
// return start;
// }
//
// public void setStart(long start) {
// this.start = start;
// }
//
// public long getEnd() {
// return end;
// }
//
// public void setEnd(long end) {
// this.end = end;
// }
//
// public int getViewType() {
// return viewType;
// }
//
// public void setViewType(int viewType) {
// this.viewType = viewType;
// }
//
// /**
// * Returns the duration in seconds
// * @return seconds
// */
// public int getDuration(){
// long end = this.getEnd();
// if(end == 0){
// end = Calendar.getInstance().getTimeInMillis();
// }
// return (Double.valueOf((end - this.getStart())/1000)).intValue();
// }
//
// /**
// * Returns the velocity in meters per second
// * @return m/s
// */
// public double getVelocity(){
// if(this.getDuration() == 0){
// return 0;
// }
// return this.getDistance()/this.getDuration();
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_NAME, this.getName());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION, this.getDescription());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS, this.getSteps());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE, String.valueOf(this.getDistance()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES, String.valueOf(this.getCalories()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING, String.valueOf(this.getFeeling()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_START, String.valueOf(this.getStart()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_END, String.valueOf(this.getEnd()));
// return values;
// }
// }
// Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/TrainingPersistenceHelper.java
import android.content.Context;
import org.secuso.privacyfriendlyactivitytracker.models.Training;
import java.util.List;
/*
Privacy Friendly Pedometer is licensed under the GPLv3.
Copyright (C) 2017 Tobias Neidig
This program is free software: you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation, either version 3 of the License, or
(at your option) any later version.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with this program. If not, see <http://www.gnu.org/licenses/>.
*/
package org.secuso.privacyfriendlyactivitytracker.persistence;
/**
* Helper to save and restore training sessions from database.
*
* @author Tobias Neidig
* @version 20170810
*/
public class TrainingPersistenceHelper {
public static final String LOG_CLASS = TrainingPersistenceHelper.class.getName();
/**
* @deprecated Use {@link TrainingDbHelper#getAllTrainings()} instead.
*
* Gets all training sessions from database
*
* @param context The application context
* @return a list of training sessions
*/ | public static List<Training> getAllItems(Context context) { |
SecUSo/privacy-friendly-pedometer | app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/StepCountDbHelper.java | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/StepCount.java
// public class StepCount {
//
// // from https://github.com/bagilevi/android-pedometer/blob/master/src/name/bagi/levente/pedometer/CaloriesNotifier.java
// private static double METRIC_RUNNING_FACTOR = 1.02784823;
// private static double METRIC_WALKING_FACTOR = 0.708;
// private static double METRIC_AVG_FACTOR = (METRIC_RUNNING_FACTOR + METRIC_WALKING_FACTOR) / 2;
//
//
// private int stepCount;
// private long startTime;
// private long endTime;
// private WalkingMode walkingMode;
//
// public int getStepCount() {
// return stepCount;
// }
//
// public void setStepCount(int stepCount) {
// this.stepCount = stepCount;
// }
//
// public long getStartTime() {
// return startTime;
// }
//
// public void setStartTime(long startTime) {
// this.startTime = startTime;
// }
//
// public long getEndTime() {
// return endTime;
// }
//
// public void setEndTime(long endTime) {
// this.endTime = endTime;
// }
//
// public WalkingMode getWalkingMode() {
// return walkingMode;
// }
//
// public void setWalkingMode(WalkingMode walkingMode) {
// this.walkingMode = walkingMode;
// }
//
// /**
// * Gets the distance walked in this interval.
// *
// * @return The distance in meters
// */
// public double getDistance(){
// if(getWalkingMode() != null) {
// return getStepCount() * getWalkingMode().getStepLength();
// }else{
// return 0;
// }
// }
//
// /**
// * Gets the calories
// * @return the calories in cal
// */
// public double getCalories(Context context){
// // inspired by https://github.com/bagilevi/android-pedometer/blob/master/src/name/bagi/levente/pedometer/CaloriesNotifier.java
// SharedPreferences sharedPref = PreferenceManager.getDefaultSharedPreferences(context);
// float bodyWeight = Float.parseFloat(sharedPref.getString(context.getString(R.string.pref_weight),context.getString(R.string.pref_default_weight)));
// return bodyWeight * METRIC_AVG_FACTOR * UnitHelper.metersToKilometers(getDistance());
// }
// @Override
// public String toString() {
// SimpleDateFormat format = new SimpleDateFormat("dd.MM.yyy HH:mm:ss");
// return "StepCount{" + format.format(new Date(startTime)) +
// " - " + format.format(new Date(endTime)) +
// ": " + stepCount + " @ " + ((walkingMode == null) ? -1 : walkingMode.getId())+
// '}';
// }
// }
| import android.content.ContentValues;
import android.content.Context;
import android.database.Cursor;
import android.database.sqlite.SQLiteDatabase;
import android.database.sqlite.SQLiteOpenHelper;
import android.provider.BaseColumns;
import org.secuso.privacyfriendlyactivitytracker.models.StepCount;
import java.util.ArrayList;
import java.util.List; | */
private static SQLiteDatabase getDatabase(StepCountDbHelper instance){
if(db == null){
db = instance.getWritableDatabase();
}
return db;
}
public static void invalidateReference(){
db = null;
}
public StepCountDbHelper(Context context) {
super(context, DATABASE_NAME, null, DATABASE_VERSION);
this.context = context;
}
public void onCreate(SQLiteDatabase db) {
db.execSQL(SQL_CREATE_ENTRIES);
}
public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) {
// Fill when upgrading DB
}
public void onDowngrade(SQLiteDatabase db, int oldVersion, int newVersion) {
onUpgrade(db, oldVersion, newVersion);
}
/**
* Stores the given StepCount in database. EndTime will be used for KEY_TIMESTAMP.
* @param stepCount the StepCount to save.
*/ | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/StepCount.java
// public class StepCount {
//
// // from https://github.com/bagilevi/android-pedometer/blob/master/src/name/bagi/levente/pedometer/CaloriesNotifier.java
// private static double METRIC_RUNNING_FACTOR = 1.02784823;
// private static double METRIC_WALKING_FACTOR = 0.708;
// private static double METRIC_AVG_FACTOR = (METRIC_RUNNING_FACTOR + METRIC_WALKING_FACTOR) / 2;
//
//
// private int stepCount;
// private long startTime;
// private long endTime;
// private WalkingMode walkingMode;
//
// public int getStepCount() {
// return stepCount;
// }
//
// public void setStepCount(int stepCount) {
// this.stepCount = stepCount;
// }
//
// public long getStartTime() {
// return startTime;
// }
//
// public void setStartTime(long startTime) {
// this.startTime = startTime;
// }
//
// public long getEndTime() {
// return endTime;
// }
//
// public void setEndTime(long endTime) {
// this.endTime = endTime;
// }
//
// public WalkingMode getWalkingMode() {
// return walkingMode;
// }
//
// public void setWalkingMode(WalkingMode walkingMode) {
// this.walkingMode = walkingMode;
// }
//
// /**
// * Gets the distance walked in this interval.
// *
// * @return The distance in meters
// */
// public double getDistance(){
// if(getWalkingMode() != null) {
// return getStepCount() * getWalkingMode().getStepLength();
// }else{
// return 0;
// }
// }
//
// /**
// * Gets the calories
// * @return the calories in cal
// */
// public double getCalories(Context context){
// // inspired by https://github.com/bagilevi/android-pedometer/blob/master/src/name/bagi/levente/pedometer/CaloriesNotifier.java
// SharedPreferences sharedPref = PreferenceManager.getDefaultSharedPreferences(context);
// float bodyWeight = Float.parseFloat(sharedPref.getString(context.getString(R.string.pref_weight),context.getString(R.string.pref_default_weight)));
// return bodyWeight * METRIC_AVG_FACTOR * UnitHelper.metersToKilometers(getDistance());
// }
// @Override
// public String toString() {
// SimpleDateFormat format = new SimpleDateFormat("dd.MM.yyy HH:mm:ss");
// return "StepCount{" + format.format(new Date(startTime)) +
// " - " + format.format(new Date(endTime)) +
// ": " + stepCount + " @ " + ((walkingMode == null) ? -1 : walkingMode.getId())+
// '}';
// }
// }
// Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/StepCountDbHelper.java
import android.content.ContentValues;
import android.content.Context;
import android.database.Cursor;
import android.database.sqlite.SQLiteDatabase;
import android.database.sqlite.SQLiteOpenHelper;
import android.provider.BaseColumns;
import org.secuso.privacyfriendlyactivitytracker.models.StepCount;
import java.util.ArrayList;
import java.util.List;
*/
private static SQLiteDatabase getDatabase(StepCountDbHelper instance){
if(db == null){
db = instance.getWritableDatabase();
}
return db;
}
public static void invalidateReference(){
db = null;
}
public StepCountDbHelper(Context context) {
super(context, DATABASE_NAME, null, DATABASE_VERSION);
this.context = context;
}
public void onCreate(SQLiteDatabase db) {
db.execSQL(SQL_CREATE_ENTRIES);
}
public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) {
// Fill when upgrading DB
}
public void onDowngrade(SQLiteDatabase db, int oldVersion, int newVersion) {
onUpgrade(db, oldVersion, newVersion);
}
/**
* Stores the given StepCount in database. EndTime will be used for KEY_TIMESTAMP.
* @param stepCount the StepCount to save.
*/ | public void addStepCount(StepCount stepCount){ |
SecUSo/privacy-friendly-pedometer | app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/WalkingModePersistenceHelper.java | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/WalkingMode.java
// public class WalkingMode {
// private long id;
// private String name;
// private double stepLength;
// private double stepFrequency;
// private boolean is_active;
// private boolean is_deleted;
//
// public static WalkingMode from(Cursor c) {
// WalkingMode alarmItem = new WalkingMode();
// alarmItem.setId(c.getLong(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry._ID)));
// alarmItem.setName(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME)));
// alarmItem.setStepLength(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE)));
// alarmItem.setStepFrequency(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY)));
// alarmItem.setIsActive(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE))));
// alarmItem.setIsDeleted(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED))));
// return alarmItem;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public double getStepLength() {
// return stepLength;
// }
//
// public void setStepLength(double stepLength) {
// this.stepLength = stepLength;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public double getStepFrequency() {
// return stepFrequency;
// }
//
// public void setStepFrequency(double stepFrequency) {
// this.stepFrequency = stepFrequency;
// }
//
// public boolean isActive() {
// return is_active;
// }
//
// public void setIsActive(boolean is_active) {
// this.is_active = is_active;
// }
//
// public boolean isDeleted() {
// return is_deleted;
// }
//
// public void setIsDeleted(boolean is_deleted) {
// this.is_deleted = is_deleted;
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME, this.getName());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE, this.getStepLength());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY, this.getStepFrequency());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE, String.valueOf(this.isActive()));
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED, String.valueOf(this.isDeleted()));
// return values;
// }
//
// @Override
// public String toString() {
// return "WalkingMode{" +
// "id=" + id +
// ", stepLength=" + stepLength +
// ", name='" + name + '\'' +
// '}';
// }
//
//
// /**
// * @return the walking-mode-specific color
// */
// public int getColor() {
// return ColorHelper.getMaterialColor(this.getId() + this.getName());
// }
//
// }
| import android.content.Context;
import android.content.Intent;
import android.util.Log;
import org.secuso.privacyfriendlyactivitytracker.models.WalkingMode;
import java.util.List; | /*
Privacy Friendly Pedometer is licensed under the GPLv3.
Copyright (C) 2017 Tobias Neidig
This program is free software: you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation, either version 3 of the License, or
(at your option) any later version.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with this program. If not, see <http://www.gnu.org/licenses/>.
*/
package org.secuso.privacyfriendlyactivitytracker.persistence;
/**
* Helper to save and restore walking modes from database.
*
* @author Tobias Neidig
* @version 20170810
*/
public class WalkingModePersistenceHelper {
/**
* Broadcast action identifier for messages broadcast when walking mode changed
*/
public static final String BROADCAST_ACTION_WALKING_MODE_CHANGED = "org.secuso.privacyfriendlystepcounter.WALKING_MODE_CHANGED";
public static final String BROADCAST_EXTRA_OLD_WALKING_MODE = "org.secuso.privacyfriendlystepcounter.EXTRA_OLD_WALKING_MODE";
public static final String BROADCAST_EXTRA_NEW_WALKING_MODE = "org.secuso.privacyfriendlystepcounter.EXTRA_NEW_WALKING_MODE";
public static final String LOG_CLASS = WalkingModePersistenceHelper.class.getName();
/**
* @deprecated Use {@link WalkingModeDbHelper#getAllWalkingModes()} instead.
*
* Gets all not deleted walking modes from database
*
* @param context The application context
* @return a list of walking modes
*/ | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/WalkingMode.java
// public class WalkingMode {
// private long id;
// private String name;
// private double stepLength;
// private double stepFrequency;
// private boolean is_active;
// private boolean is_deleted;
//
// public static WalkingMode from(Cursor c) {
// WalkingMode alarmItem = new WalkingMode();
// alarmItem.setId(c.getLong(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry._ID)));
// alarmItem.setName(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME)));
// alarmItem.setStepLength(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE)));
// alarmItem.setStepFrequency(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY)));
// alarmItem.setIsActive(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE))));
// alarmItem.setIsDeleted(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED))));
// return alarmItem;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public double getStepLength() {
// return stepLength;
// }
//
// public void setStepLength(double stepLength) {
// this.stepLength = stepLength;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public double getStepFrequency() {
// return stepFrequency;
// }
//
// public void setStepFrequency(double stepFrequency) {
// this.stepFrequency = stepFrequency;
// }
//
// public boolean isActive() {
// return is_active;
// }
//
// public void setIsActive(boolean is_active) {
// this.is_active = is_active;
// }
//
// public boolean isDeleted() {
// return is_deleted;
// }
//
// public void setIsDeleted(boolean is_deleted) {
// this.is_deleted = is_deleted;
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME, this.getName());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE, this.getStepLength());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY, this.getStepFrequency());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE, String.valueOf(this.isActive()));
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED, String.valueOf(this.isDeleted()));
// return values;
// }
//
// @Override
// public String toString() {
// return "WalkingMode{" +
// "id=" + id +
// ", stepLength=" + stepLength +
// ", name='" + name + '\'' +
// '}';
// }
//
//
// /**
// * @return the walking-mode-specific color
// */
// public int getColor() {
// return ColorHelper.getMaterialColor(this.getId() + this.getName());
// }
//
// }
// Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/WalkingModePersistenceHelper.java
import android.content.Context;
import android.content.Intent;
import android.util.Log;
import org.secuso.privacyfriendlyactivitytracker.models.WalkingMode;
import java.util.List;
/*
Privacy Friendly Pedometer is licensed under the GPLv3.
Copyright (C) 2017 Tobias Neidig
This program is free software: you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation, either version 3 of the License, or
(at your option) any later version.
This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with this program. If not, see <http://www.gnu.org/licenses/>.
*/
package org.secuso.privacyfriendlyactivitytracker.persistence;
/**
* Helper to save and restore walking modes from database.
*
* @author Tobias Neidig
* @version 20170810
*/
public class WalkingModePersistenceHelper {
/**
* Broadcast action identifier for messages broadcast when walking mode changed
*/
public static final String BROADCAST_ACTION_WALKING_MODE_CHANGED = "org.secuso.privacyfriendlystepcounter.WALKING_MODE_CHANGED";
public static final String BROADCAST_EXTRA_OLD_WALKING_MODE = "org.secuso.privacyfriendlystepcounter.EXTRA_OLD_WALKING_MODE";
public static final String BROADCAST_EXTRA_NEW_WALKING_MODE = "org.secuso.privacyfriendlystepcounter.EXTRA_NEW_WALKING_MODE";
public static final String LOG_CLASS = WalkingModePersistenceHelper.class.getName();
/**
* @deprecated Use {@link WalkingModeDbHelper#getAllWalkingModes()} instead.
*
* Gets all not deleted walking modes from database
*
* @param context The application context
* @return a list of walking modes
*/ | public static List<WalkingMode> getAllItems(Context context) { |
SecUSo/privacy-friendly-pedometer | app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/TrainingDbHelper.java | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/Training.java
// public class Training {
// private long id;
// private String name;
// private String description;
// private double steps;
// private double distance;
// private double calories;
// private float feeling;
// private long start;
// private long end;
// /**
// * The view type for TrainingOverviewAdapter
// */
// private int viewType = TrainingOverviewAdapter.VIEW_TYPE_TRAINING_SESSION;
//
// public static Training from(Cursor c) {
// Training trainingSession = new Training();
// trainingSession.setId(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry._ID)));
// trainingSession.setName(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_NAME)));
// trainingSession.setDescription(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION)));
// trainingSession.setSteps(c.getInt(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS)));
// trainingSession.setDistance(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE)));
// trainingSession.setCalories(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES)));
// trainingSession.setFeeling(c.getFloat(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING)));
// trainingSession.setStart(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_START)));
// trainingSession.setEnd(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_END)));
// return trainingSession;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public String getDescription() {
// return description;
// }
//
// public void setDescription(String description) {
// this.description = description;
// }
//
// public double getSteps() {
// return steps;
// }
//
// public void setSteps(double steps) {
// this.steps = steps;
// }
//
// public double getDistance() {
// return distance;
// }
//
// public void setDistance(double distance) {
// this.distance = distance;
// }
//
// public double getCalories() {
// return calories;
// }
//
// public void setCalories(double calories) {
// this.calories = calories;
// }
//
// public float getFeeling() {
// return feeling;
// }
//
// public void setFeeling(float feeling) {
// this.feeling = feeling;
// }
//
// public long getStart() {
// return start;
// }
//
// public void setStart(long start) {
// this.start = start;
// }
//
// public long getEnd() {
// return end;
// }
//
// public void setEnd(long end) {
// this.end = end;
// }
//
// public int getViewType() {
// return viewType;
// }
//
// public void setViewType(int viewType) {
// this.viewType = viewType;
// }
//
// /**
// * Returns the duration in seconds
// * @return seconds
// */
// public int getDuration(){
// long end = this.getEnd();
// if(end == 0){
// end = Calendar.getInstance().getTimeInMillis();
// }
// return (Double.valueOf((end - this.getStart())/1000)).intValue();
// }
//
// /**
// * Returns the velocity in meters per second
// * @return m/s
// */
// public double getVelocity(){
// if(this.getDuration() == 0){
// return 0;
// }
// return this.getDistance()/this.getDuration();
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_NAME, this.getName());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION, this.getDescription());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS, this.getSteps());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE, String.valueOf(this.getDistance()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES, String.valueOf(this.getCalories()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING, String.valueOf(this.getFeeling()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_START, String.valueOf(this.getStart()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_END, String.valueOf(this.getEnd()));
// return values;
// }
// }
| import android.content.ContentValues;
import android.content.Context;
import android.database.Cursor;
import android.database.sqlite.SQLiteDatabase;
import android.database.sqlite.SQLiteOpenHelper;
import android.provider.BaseColumns;
import org.secuso.privacyfriendlyactivitytracker.models.Training;
import java.util.ArrayList;
import java.util.List; | private static SQLiteDatabase getDatabase(TrainingDbHelper instance){
if(db == null){
db = instance.getWritableDatabase();
}
return db;
}
public static void invalidateReference(){
db = null;
}
public TrainingDbHelper(Context context) {
super(context, DATABASE_NAME, null, DATABASE_VERSION);
}
public void onCreate(SQLiteDatabase db) {
db.execSQL(SQL_CREATE_ENTRIES);
}
public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) {
// Fill when upgrading DB
}
public void onDowngrade(SQLiteDatabase db, int oldVersion, int newVersion) {
onUpgrade(db, oldVersion, newVersion);
}
/**
* Inserts the given training session as new entry.
*
* @param item The training session which should be stored
* @return the inserted id
*/ | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/Training.java
// public class Training {
// private long id;
// private String name;
// private String description;
// private double steps;
// private double distance;
// private double calories;
// private float feeling;
// private long start;
// private long end;
// /**
// * The view type for TrainingOverviewAdapter
// */
// private int viewType = TrainingOverviewAdapter.VIEW_TYPE_TRAINING_SESSION;
//
// public static Training from(Cursor c) {
// Training trainingSession = new Training();
// trainingSession.setId(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry._ID)));
// trainingSession.setName(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_NAME)));
// trainingSession.setDescription(c.getString(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION)));
// trainingSession.setSteps(c.getInt(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS)));
// trainingSession.setDistance(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE)));
// trainingSession.setCalories(c.getDouble(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES)));
// trainingSession.setFeeling(c.getFloat(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING)));
// trainingSession.setStart(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_START)));
// trainingSession.setEnd(c.getLong(c.getColumnIndex(TrainingDbHelper.TrainingSessionEntry.KEY_END)));
// return trainingSession;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public String getDescription() {
// return description;
// }
//
// public void setDescription(String description) {
// this.description = description;
// }
//
// public double getSteps() {
// return steps;
// }
//
// public void setSteps(double steps) {
// this.steps = steps;
// }
//
// public double getDistance() {
// return distance;
// }
//
// public void setDistance(double distance) {
// this.distance = distance;
// }
//
// public double getCalories() {
// return calories;
// }
//
// public void setCalories(double calories) {
// this.calories = calories;
// }
//
// public float getFeeling() {
// return feeling;
// }
//
// public void setFeeling(float feeling) {
// this.feeling = feeling;
// }
//
// public long getStart() {
// return start;
// }
//
// public void setStart(long start) {
// this.start = start;
// }
//
// public long getEnd() {
// return end;
// }
//
// public void setEnd(long end) {
// this.end = end;
// }
//
// public int getViewType() {
// return viewType;
// }
//
// public void setViewType(int viewType) {
// this.viewType = viewType;
// }
//
// /**
// * Returns the duration in seconds
// * @return seconds
// */
// public int getDuration(){
// long end = this.getEnd();
// if(end == 0){
// end = Calendar.getInstance().getTimeInMillis();
// }
// return (Double.valueOf((end - this.getStart())/1000)).intValue();
// }
//
// /**
// * Returns the velocity in meters per second
// * @return m/s
// */
// public double getVelocity(){
// if(this.getDuration() == 0){
// return 0;
// }
// return this.getDistance()/this.getDuration();
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_NAME, this.getName());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DESCRIPTION, this.getDescription());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_STEPS, this.getSteps());
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_DISTANCE, String.valueOf(this.getDistance()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_CALORIES, String.valueOf(this.getCalories()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_FEELING, String.valueOf(this.getFeeling()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_START, String.valueOf(this.getStart()));
// values.put(TrainingDbHelper.TrainingSessionEntry.KEY_END, String.valueOf(this.getEnd()));
// return values;
// }
// }
// Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/TrainingDbHelper.java
import android.content.ContentValues;
import android.content.Context;
import android.database.Cursor;
import android.database.sqlite.SQLiteDatabase;
import android.database.sqlite.SQLiteOpenHelper;
import android.provider.BaseColumns;
import org.secuso.privacyfriendlyactivitytracker.models.Training;
import java.util.ArrayList;
import java.util.List;
private static SQLiteDatabase getDatabase(TrainingDbHelper instance){
if(db == null){
db = instance.getWritableDatabase();
}
return db;
}
public static void invalidateReference(){
db = null;
}
public TrainingDbHelper(Context context) {
super(context, DATABASE_NAME, null, DATABASE_VERSION);
}
public void onCreate(SQLiteDatabase db) {
db.execSQL(SQL_CREATE_ENTRIES);
}
public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) {
// Fill when upgrading DB
}
public void onDowngrade(SQLiteDatabase db, int oldVersion, int newVersion) {
onUpgrade(db, oldVersion, newVersion);
}
/**
* Inserts the given training session as new entry.
*
* @param item The training session which should be stored
* @return the inserted id
*/ | protected long addTraining(Training item) { |
SecUSo/privacy-friendly-pedometer | app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/WalkingModeDbHelper.java | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/WalkingMode.java
// public class WalkingMode {
// private long id;
// private String name;
// private double stepLength;
// private double stepFrequency;
// private boolean is_active;
// private boolean is_deleted;
//
// public static WalkingMode from(Cursor c) {
// WalkingMode alarmItem = new WalkingMode();
// alarmItem.setId(c.getLong(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry._ID)));
// alarmItem.setName(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME)));
// alarmItem.setStepLength(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE)));
// alarmItem.setStepFrequency(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY)));
// alarmItem.setIsActive(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE))));
// alarmItem.setIsDeleted(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED))));
// return alarmItem;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public double getStepLength() {
// return stepLength;
// }
//
// public void setStepLength(double stepLength) {
// this.stepLength = stepLength;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public double getStepFrequency() {
// return stepFrequency;
// }
//
// public void setStepFrequency(double stepFrequency) {
// this.stepFrequency = stepFrequency;
// }
//
// public boolean isActive() {
// return is_active;
// }
//
// public void setIsActive(boolean is_active) {
// this.is_active = is_active;
// }
//
// public boolean isDeleted() {
// return is_deleted;
// }
//
// public void setIsDeleted(boolean is_deleted) {
// this.is_deleted = is_deleted;
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME, this.getName());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE, this.getStepLength());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY, this.getStepFrequency());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE, String.valueOf(this.isActive()));
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED, String.valueOf(this.isDeleted()));
// return values;
// }
//
// @Override
// public String toString() {
// return "WalkingMode{" +
// "id=" + id +
// ", stepLength=" + stepLength +
// ", name='" + name + '\'' +
// '}';
// }
//
//
// /**
// * @return the walking-mode-specific color
// */
// public int getColor() {
// return ColorHelper.getMaterialColor(this.getId() + this.getName());
// }
//
// }
| import android.content.ContentValues;
import android.content.Context;
import android.database.Cursor;
import android.database.sqlite.SQLiteDatabase;
import android.database.sqlite.SQLiteOpenHelper;
import android.provider.BaseColumns;
import android.util.Log;
import org.secuso.privacyfriendlyactivitytracker.R;
import org.secuso.privacyfriendlyactivitytracker.models.WalkingMode;
import java.util.ArrayList;
import java.util.List; | }
return db;
}
public static void invalidateReference(){
db = null;
}
public WalkingModeDbHelper(Context context) {
super(context, DATABASE_NAME, null, DATABASE_VERSION);
this.context = context;
}
public void onCreate(SQLiteDatabase db) {
db.execSQL(SQL_CREATE_ENTRIES);
// Insert default walking modes
String[] walkingModesNames = context.getResources().getStringArray(R.array.pref_default_walking_mode_names);
String[] walkingModesStepLengthStrings = context.getResources().getStringArray(R.array.pref_default_walking_mode_step_lenghts);
if (walkingModesStepLengthStrings.length != walkingModesNames.length) {
Log.e(LOG_CLASS, "Number of default walking mode step lengths and names have to be the same.");
return;
}
if (walkingModesNames.length == 0) {
Log.e(LOG_CLASS, "There are no default walking modes.");
}
for (int i = 0; i < walkingModesStepLengthStrings.length; i++) {
String stepLengthString = walkingModesStepLengthStrings[i];
double stepLength = Double.valueOf(stepLengthString);
String name = walkingModesNames[i]; | // Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/models/WalkingMode.java
// public class WalkingMode {
// private long id;
// private String name;
// private double stepLength;
// private double stepFrequency;
// private boolean is_active;
// private boolean is_deleted;
//
// public static WalkingMode from(Cursor c) {
// WalkingMode alarmItem = new WalkingMode();
// alarmItem.setId(c.getLong(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry._ID)));
// alarmItem.setName(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME)));
// alarmItem.setStepLength(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE)));
// alarmItem.setStepFrequency(c.getDouble(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY)));
// alarmItem.setIsActive(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE))));
// alarmItem.setIsDeleted(Boolean.valueOf(c.getString(c.getColumnIndex(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED))));
// return alarmItem;
// }
//
// public long getId() {
// return id;
// }
//
// public void setId(long id) {
// this.id = id;
// }
//
// public double getStepLength() {
// return stepLength;
// }
//
// public void setStepLength(double stepLength) {
// this.stepLength = stepLength;
// }
//
// public String getName() {
// return name;
// }
//
// public void setName(String name) {
// this.name = name;
// }
//
// public double getStepFrequency() {
// return stepFrequency;
// }
//
// public void setStepFrequency(double stepFrequency) {
// this.stepFrequency = stepFrequency;
// }
//
// public boolean isActive() {
// return is_active;
// }
//
// public void setIsActive(boolean is_active) {
// this.is_active = is_active;
// }
//
// public boolean isDeleted() {
// return is_deleted;
// }
//
// public void setIsDeleted(boolean is_deleted) {
// this.is_deleted = is_deleted;
// }
//
// public ContentValues toContentValues() {
// ContentValues values = new ContentValues();
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_NAME, this.getName());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_SIZE, this.getStepLength());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_STEP_FREQUENCY, this.getStepFrequency());
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_ACTIVE, String.valueOf(this.isActive()));
// values.put(WalkingModeDbHelper.WalkingModeEntry.KEY_IS_DELETED, String.valueOf(this.isDeleted()));
// return values;
// }
//
// @Override
// public String toString() {
// return "WalkingMode{" +
// "id=" + id +
// ", stepLength=" + stepLength +
// ", name='" + name + '\'' +
// '}';
// }
//
//
// /**
// * @return the walking-mode-specific color
// */
// public int getColor() {
// return ColorHelper.getMaterialColor(this.getId() + this.getName());
// }
//
// }
// Path: app/src/main/java/org/secuso/privacyfriendlyactivitytracker/persistence/WalkingModeDbHelper.java
import android.content.ContentValues;
import android.content.Context;
import android.database.Cursor;
import android.database.sqlite.SQLiteDatabase;
import android.database.sqlite.SQLiteOpenHelper;
import android.provider.BaseColumns;
import android.util.Log;
import org.secuso.privacyfriendlyactivitytracker.R;
import org.secuso.privacyfriendlyactivitytracker.models.WalkingMode;
import java.util.ArrayList;
import java.util.List;
}
return db;
}
public static void invalidateReference(){
db = null;
}
public WalkingModeDbHelper(Context context) {
super(context, DATABASE_NAME, null, DATABASE_VERSION);
this.context = context;
}
public void onCreate(SQLiteDatabase db) {
db.execSQL(SQL_CREATE_ENTRIES);
// Insert default walking modes
String[] walkingModesNames = context.getResources().getStringArray(R.array.pref_default_walking_mode_names);
String[] walkingModesStepLengthStrings = context.getResources().getStringArray(R.array.pref_default_walking_mode_step_lenghts);
if (walkingModesStepLengthStrings.length != walkingModesNames.length) {
Log.e(LOG_CLASS, "Number of default walking mode step lengths and names have to be the same.");
return;
}
if (walkingModesNames.length == 0) {
Log.e(LOG_CLASS, "There are no default walking modes.");
}
for (int i = 0; i < walkingModesStepLengthStrings.length; i++) {
String stepLengthString = walkingModesStepLengthStrings[i];
double stepLength = Double.valueOf(stepLengthString);
String name = walkingModesNames[i]; | WalkingMode walkingMode = new WalkingMode(); |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/ExponentialRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log1p(double value) {
// return JafamaMath.log1p(value);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.log1p; | package biz.k11i.rng;
/**
* Exponential random number generator.
*/
public interface ExponentialRNG {
ExponentialRNG FAST_RNG = ZigguratFast.Z_256;
ExponentialRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from exponential distribution.
*
* @param random random number generator
* @param theta mean of the distribution
* @return a random value
*/
double generate(Random random, double theta);
abstract class ZigguratBase implements ExponentialRNG {
final int N;
final double R;
final double V;
final int INDEX_BIT_MASK;
final int TAIL_INDEX;
ZigguratBase(int nBits, double r, double v) {
N = 1 << nBits;
R = r;
V = v;
INDEX_BIT_MASK = (1 << nBits) - 1;
TAIL_INDEX = (1 << nBits) - 1;
}
static double finv(double x, double v) { | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log1p(double value) {
// return JafamaMath.log1p(value);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/ExponentialRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.log1p;
package biz.k11i.rng;
/**
* Exponential random number generator.
*/
public interface ExponentialRNG {
ExponentialRNG FAST_RNG = ZigguratFast.Z_256;
ExponentialRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from exponential distribution.
*
* @param random random number generator
* @param theta mean of the distribution
* @return a random value
*/
double generate(Random random, double theta);
abstract class ZigguratBase implements ExponentialRNG {
final int N;
final double R;
final double V;
final int INDEX_BIT_MASK;
final int TAIL_INDEX;
ZigguratBase(int nBits, double r, double v) {
N = 1 << nBits;
R = r;
V = v;
INDEX_BIT_MASK = (1 << nBits) - 1;
TAIL_INDEX = (1 << nBits) - 1;
}
static double finv(double x, double v) { | return -log(exp(-x) + v / x); |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/ExponentialRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log1p(double value) {
// return JafamaMath.log1p(value);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.log1p; | package biz.k11i.rng;
/**
* Exponential random number generator.
*/
public interface ExponentialRNG {
ExponentialRNG FAST_RNG = ZigguratFast.Z_256;
ExponentialRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from exponential distribution.
*
* @param random random number generator
* @param theta mean of the distribution
* @return a random value
*/
double generate(Random random, double theta);
abstract class ZigguratBase implements ExponentialRNG {
final int N;
final double R;
final double V;
final int INDEX_BIT_MASK;
final int TAIL_INDEX;
ZigguratBase(int nBits, double r, double v) {
N = 1 << nBits;
R = r;
V = v;
INDEX_BIT_MASK = (1 << nBits) - 1;
TAIL_INDEX = (1 << nBits) - 1;
}
static double finv(double x, double v) { | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log1p(double value) {
// return JafamaMath.log1p(value);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/ExponentialRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.log1p;
package biz.k11i.rng;
/**
* Exponential random number generator.
*/
public interface ExponentialRNG {
ExponentialRNG FAST_RNG = ZigguratFast.Z_256;
ExponentialRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from exponential distribution.
*
* @param random random number generator
* @param theta mean of the distribution
* @return a random value
*/
double generate(Random random, double theta);
abstract class ZigguratBase implements ExponentialRNG {
final int N;
final double R;
final double V;
final int INDEX_BIT_MASK;
final int TAIL_INDEX;
ZigguratBase(int nBits, double r, double v) {
N = 1 << nBits;
R = r;
V = v;
INDEX_BIT_MASK = (1 << nBits) - 1;
TAIL_INDEX = (1 << nBits) - 1;
}
static double finv(double x, double v) { | return -log(exp(-x) + v / x); |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/ExponentialRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log1p(double value) {
// return JafamaMath.log1p(value);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.log1p; | k[N - 1] = (long) Math.floor(r / w[N - 1]);
f[N - 1] = exp(-r);
double x = r;
for (int i = N - 2; i >= 1; i--) {
x = finv(x, v);
w[i - 1] = x / b;
k[i] = (long) Math.floor(x / w[i]);
f[i] = exp(-x);
}
k[0] = 0;
f[0] = 1;
}
@Override
double generate(Random random, int recursiveCount) {
while (true) {
long u = random.nextLong();
int i = (int) (u & INDEX_BIT_MASK);
u >>>= INDEX_BITS;
if (u < k[i]) {
return u * w[i];
}
if (i == TAIL_INDEX) {
if (recursiveCount < 2) {
return R + generate(random, recursiveCount + 1);
} | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log1p(double value) {
// return JafamaMath.log1p(value);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/ExponentialRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.log1p;
k[N - 1] = (long) Math.floor(r / w[N - 1]);
f[N - 1] = exp(-r);
double x = r;
for (int i = N - 2; i >= 1; i--) {
x = finv(x, v);
w[i - 1] = x / b;
k[i] = (long) Math.floor(x / w[i]);
f[i] = exp(-x);
}
k[0] = 0;
f[0] = 1;
}
@Override
double generate(Random random, int recursiveCount) {
while (true) {
long u = random.nextLong();
int i = (int) (u & INDEX_BIT_MASK);
u >>>= INDEX_BITS;
if (u < k[i]) {
return u * w[i];
}
if (i == TAIL_INDEX) {
if (recursiveCount < 2) {
return R + generate(random, recursiveCount + 1);
} | return R - log1p(-random.nextDouble()); |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/GaussianRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log; | package biz.k11i.rng;
/**
* Gaussian random number generator.
*/
public interface GaussianRNG {
GaussianRNG FAST_RNG = ZigguratFast.Z_256;
GaussianRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from gaussian distribution (normal distribution).
*
* @param random random number generator
* @return a random value
*/
double generate(Random random);
abstract class ZigguratBase {
static double f(double x) {
// f(x) = e^{-x^2 / 2} | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/GaussianRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
package biz.k11i.rng;
/**
* Gaussian random number generator.
*/
public interface GaussianRNG {
GaussianRNG FAST_RNG = ZigguratFast.Z_256;
GaussianRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from gaussian distribution (normal distribution).
*
* @param random random number generator
* @return a random value
*/
double generate(Random random);
abstract class ZigguratBase {
static double f(double x) {
// f(x) = e^{-x^2 / 2} | return exp(-0.5 * x * x); |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/GaussianRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log; | package biz.k11i.rng;
/**
* Gaussian random number generator.
*/
public interface GaussianRNG {
GaussianRNG FAST_RNG = ZigguratFast.Z_256;
GaussianRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from gaussian distribution (normal distribution).
*
* @param random random number generator
* @return a random value
*/
double generate(Random random);
abstract class ZigguratBase {
static double f(double x) {
// f(x) = e^{-x^2 / 2}
return exp(-0.5 * x * x);
}
static double tail(Random random, double r) {
double _x, _y;
do { | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/GaussianRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
package biz.k11i.rng;
/**
* Gaussian random number generator.
*/
public interface GaussianRNG {
GaussianRNG FAST_RNG = ZigguratFast.Z_256;
GaussianRNG GENERAL_RNG = ZigguratGeneral.Z_256;
/**
* Generates a random value sampled from gaussian distribution (normal distribution).
*
* @param random random number generator
* @return a random value
*/
double generate(Random random);
abstract class ZigguratBase {
static double f(double x) {
// f(x) = e^{-x^2 / 2}
return exp(-0.5 * x * x);
}
static double tail(Random random, double r) {
double _x, _y;
do { | _x = -log(random.nextDouble()) / r; |
komiya-atsushi/fast-rng-java | benchmark/src/jmh/java/biz/k11i/rng/BetaBenchmark.java | // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
| import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.BetaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.apache.commons.math3.random.RandomGenerator;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random; | package biz.k11i.rng;
public class BetaBenchmark {
@State(Scope.Benchmark)
public static class FixedParameters {
@Param({"0.1:0.1",
"0.1:0.5",
"0.1:0.99999",
"0.5:0.5",
"0.5:0.99999",
"0.99999:0.99999",
"0.05:2.0",
"0.2:20.0",
"0.8:200.0",
"1.0:2.0",
"2.0:3.0",
"20.0:30.0",
"200.0:300.0"
})
public String parameters;
private double alpha;
private double beta;
| // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
// Path: benchmark/src/jmh/java/biz/k11i/rng/BetaBenchmark.java
import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.BetaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.apache.commons.math3.random.RandomGenerator;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random;
package biz.k11i.rng;
public class BetaBenchmark {
@State(Scope.Benchmark)
public static class FixedParameters {
@Param({"0.1:0.1",
"0.1:0.5",
"0.1:0.99999",
"0.5:0.5",
"0.5:0.99999",
"0.99999:0.99999",
"0.05:2.0",
"0.2:20.0",
"0.8:200.0",
"1.0:2.0",
"2.0:3.0",
"20.0:30.0",
"200.0:300.0"
})
public String parameters;
private double alpha;
private double beta;
| private Random random = new MtRandom(); |
komiya-atsushi/fast-rng-java | benchmark/src/jmh/java/biz/k11i/rng/BetaBenchmark.java | // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
| import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.BetaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.apache.commons.math3.random.RandomGenerator;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random; |
@Setup
public void setUp() {
String[] items = parameters.split(":");
alpha = Double.valueOf(items[0]);
beta = Double.valueOf(items[1]);
commonsMath = new BetaDistribution(alpha, beta);
}
@Benchmark
public double commonsMath() {
return commonsMath.sample();
}
@Benchmark
public double fastRng() {
return BetaRNG.FAST_RNG.generate(random, alpha, beta);
}
@Benchmark
public double generalRng() {
return BetaRNG.GENERAL_RNG.generate(random, alpha, beta);
}
}
@State(Scope.Benchmark)
public static class ArbitraryParameters {
private Random random = new MtRandom();
private RandomGenerator randomGenerator = new MersenneTwister();
| // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
// Path: benchmark/src/jmh/java/biz/k11i/rng/BetaBenchmark.java
import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.BetaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.apache.commons.math3.random.RandomGenerator;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random;
@Setup
public void setUp() {
String[] items = parameters.split(":");
alpha = Double.valueOf(items[0]);
beta = Double.valueOf(items[1]);
commonsMath = new BetaDistribution(alpha, beta);
}
@Benchmark
public double commonsMath() {
return commonsMath.sample();
}
@Benchmark
public double fastRng() {
return BetaRNG.FAST_RNG.generate(random, alpha, beta);
}
@Benchmark
public double generalRng() {
return BetaRNG.GENERAL_RNG.generate(random, alpha, beta);
}
}
@State(Scope.Benchmark)
public static class ArbitraryParameters {
private Random random = new MtRandom();
private RandomGenerator randomGenerator = new MersenneTwister();
| private ParameterPool alphaParameters = new ParameterPool(12345, 10000, 10.0); |
komiya-atsushi/fast-rng-java | fast-rng-test/src/test/java/biz/k11i/rng/test/SecondLevelTestTest.java | // Path: fast-rng-test/src/main/java/biz/k11i/rng/test/gof/GoodnessOfFitTest.java
// @SuppressWarnings("unused")
// public abstract class GoodnessOfFitTest {
// static class BuilderBase<SELF extends BuilderBase<SELF>> {
// @SuppressWarnings("unchecked")
// private final SELF self = (SELF) this;
//
// int numRandomValues;
// double significanceLevel = DEFAULT_SIGNIFICANCE_LEVEL;
//
// public SELF numRandomValues(int numRandomValues) {
// this.numRandomValues = numRandomValues;
// return self;
// }
//
// public SELF significanceLevel(double significanceLevel) {
// this.significanceLevel = significanceLevel;
// return self;
// }
// }
//
// /** Default significance level (0.1%) */
// private static final double DEFAULT_SIGNIFICANCE_LEVEL = 0.001;
//
// /** Name of the random number generator to be tested */
// public final String rngName;
//
// /** Significance level to reject the null hypothesis */
// public final double significanceLevel;
//
// GoodnessOfFitTest(String rngName, double significanceLevel) {
// this.rngName = rngName;
// this.significanceLevel = significanceLevel;
// }
//
// /**
// * Returns {@link ContinuousGofTest} builder object.
// *
// * @return builder object.
// */
// public static ContinuousGofTest.Builder continuous() {
// return new ContinuousGofTest.Builder();
// }
//
// /**
// * Returns {@link DiscreteGofTest} builder object.
// *
// * @return builder obbject.
// */
// public static DiscreteGofTest.Builder discrete() {
// return new DiscreteGofTest.Builder();
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test.
// *
// * @return test result.
// */
// public abstract Map<String, Double> test();
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel.
// *
// * @return test result.
// */
// public Map<String, Double> testInParallel() {
// ForkJoinPool pool = new ForkJoinPool();
// try {
// return testInParallel(pool);
//
// } finally {
// pool.shutdown();
// try {
// pool.awaitTermination(1, TimeUnit.SECONDS);
// } catch (InterruptedException ignore) {
// }
// }
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel using given {@link ForkJoinPool} instance.
// *
// * @param pool Fork/Join pool to execute tasks in paralle.
// * @return test result.
// */
// public abstract Map<String, Double> testInParallel(ForkJoinPool pool);
//
// /**
// * Runs Goodness-of-Fit tests and verifis whether the test failed to reject the null hypothesis
// * (which means the random sequence that was generated by random number generator can be described as random) or not.
// */
// public void testAndVerify() {
// Map<String, Double> result = test();
//
// result.forEach((t, p) ->
// assertThat(p)
// .describedAs("At a significance level of %e, the Goodness-of-Fit test of [%s] should fail to reject null hypothesis (The p-value %f should be greater than or equal to %e).\n" +
// "This means that the random sequence generated by the random number generator [%s] fit the theoretical probability distribution.",
// significanceLevel, t, p, significanceLevel,
// rngName)
// .isGreaterThanOrEqualTo(significanceLevel));
// }
// }
//
// Path: fast-rng-test/src/main/java/biz/k11i/rng/test/util/distribution/ProbabilityDistributions.java
// public interface ProbabilityDistributions {
// static ContinuousDistribution gaussian(double mean, double sd) {
// return new Gaussian(mean, sd);
// }
//
// static ContinuousDistribution gamma(double shape, double scale) {
// return new Gamma(shape, scale);
// }
//
// static ContinuousDistribution beta(double alpha, double beta) {
// return new Beta(alpha, beta);
// }
//
// static ContinuousDistribution wrap(RealDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Continuous(distribution);
// }
//
// static DiscreteDistribution wrap(IntegerDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Discrete(distribution);
// }
// }
| import biz.k11i.rng.test.gof.GoodnessOfFitTest;
import biz.k11i.rng.test.util.distribution.ProbabilityDistributions;
import org.junit.jupiter.api.Test;
import java.util.Random;
import static org.assertj.core.api.Assertions.assertThatThrownBy; | package biz.k11i.rng.test;
class SecondLevelTestTest {
@Test
void test() { | // Path: fast-rng-test/src/main/java/biz/k11i/rng/test/gof/GoodnessOfFitTest.java
// @SuppressWarnings("unused")
// public abstract class GoodnessOfFitTest {
// static class BuilderBase<SELF extends BuilderBase<SELF>> {
// @SuppressWarnings("unchecked")
// private final SELF self = (SELF) this;
//
// int numRandomValues;
// double significanceLevel = DEFAULT_SIGNIFICANCE_LEVEL;
//
// public SELF numRandomValues(int numRandomValues) {
// this.numRandomValues = numRandomValues;
// return self;
// }
//
// public SELF significanceLevel(double significanceLevel) {
// this.significanceLevel = significanceLevel;
// return self;
// }
// }
//
// /** Default significance level (0.1%) */
// private static final double DEFAULT_SIGNIFICANCE_LEVEL = 0.001;
//
// /** Name of the random number generator to be tested */
// public final String rngName;
//
// /** Significance level to reject the null hypothesis */
// public final double significanceLevel;
//
// GoodnessOfFitTest(String rngName, double significanceLevel) {
// this.rngName = rngName;
// this.significanceLevel = significanceLevel;
// }
//
// /**
// * Returns {@link ContinuousGofTest} builder object.
// *
// * @return builder object.
// */
// public static ContinuousGofTest.Builder continuous() {
// return new ContinuousGofTest.Builder();
// }
//
// /**
// * Returns {@link DiscreteGofTest} builder object.
// *
// * @return builder obbject.
// */
// public static DiscreteGofTest.Builder discrete() {
// return new DiscreteGofTest.Builder();
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test.
// *
// * @return test result.
// */
// public abstract Map<String, Double> test();
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel.
// *
// * @return test result.
// */
// public Map<String, Double> testInParallel() {
// ForkJoinPool pool = new ForkJoinPool();
// try {
// return testInParallel(pool);
//
// } finally {
// pool.shutdown();
// try {
// pool.awaitTermination(1, TimeUnit.SECONDS);
// } catch (InterruptedException ignore) {
// }
// }
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel using given {@link ForkJoinPool} instance.
// *
// * @param pool Fork/Join pool to execute tasks in paralle.
// * @return test result.
// */
// public abstract Map<String, Double> testInParallel(ForkJoinPool pool);
//
// /**
// * Runs Goodness-of-Fit tests and verifis whether the test failed to reject the null hypothesis
// * (which means the random sequence that was generated by random number generator can be described as random) or not.
// */
// public void testAndVerify() {
// Map<String, Double> result = test();
//
// result.forEach((t, p) ->
// assertThat(p)
// .describedAs("At a significance level of %e, the Goodness-of-Fit test of [%s] should fail to reject null hypothesis (The p-value %f should be greater than or equal to %e).\n" +
// "This means that the random sequence generated by the random number generator [%s] fit the theoretical probability distribution.",
// significanceLevel, t, p, significanceLevel,
// rngName)
// .isGreaterThanOrEqualTo(significanceLevel));
// }
// }
//
// Path: fast-rng-test/src/main/java/biz/k11i/rng/test/util/distribution/ProbabilityDistributions.java
// public interface ProbabilityDistributions {
// static ContinuousDistribution gaussian(double mean, double sd) {
// return new Gaussian(mean, sd);
// }
//
// static ContinuousDistribution gamma(double shape, double scale) {
// return new Gamma(shape, scale);
// }
//
// static ContinuousDistribution beta(double alpha, double beta) {
// return new Beta(alpha, beta);
// }
//
// static ContinuousDistribution wrap(RealDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Continuous(distribution);
// }
//
// static DiscreteDistribution wrap(IntegerDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Discrete(distribution);
// }
// }
// Path: fast-rng-test/src/test/java/biz/k11i/rng/test/SecondLevelTestTest.java
import biz.k11i.rng.test.gof.GoodnessOfFitTest;
import biz.k11i.rng.test.util.distribution.ProbabilityDistributions;
import org.junit.jupiter.api.Test;
import java.util.Random;
import static org.assertj.core.api.Assertions.assertThatThrownBy;
package biz.k11i.rng.test;
class SecondLevelTestTest {
@Test
void test() { | GoodnessOfFitTest gofTest = GoodnessOfFitTest.continuous() |
komiya-atsushi/fast-rng-java | fast-rng-test/src/test/java/biz/k11i/rng/test/SecondLevelTestTest.java | // Path: fast-rng-test/src/main/java/biz/k11i/rng/test/gof/GoodnessOfFitTest.java
// @SuppressWarnings("unused")
// public abstract class GoodnessOfFitTest {
// static class BuilderBase<SELF extends BuilderBase<SELF>> {
// @SuppressWarnings("unchecked")
// private final SELF self = (SELF) this;
//
// int numRandomValues;
// double significanceLevel = DEFAULT_SIGNIFICANCE_LEVEL;
//
// public SELF numRandomValues(int numRandomValues) {
// this.numRandomValues = numRandomValues;
// return self;
// }
//
// public SELF significanceLevel(double significanceLevel) {
// this.significanceLevel = significanceLevel;
// return self;
// }
// }
//
// /** Default significance level (0.1%) */
// private static final double DEFAULT_SIGNIFICANCE_LEVEL = 0.001;
//
// /** Name of the random number generator to be tested */
// public final String rngName;
//
// /** Significance level to reject the null hypothesis */
// public final double significanceLevel;
//
// GoodnessOfFitTest(String rngName, double significanceLevel) {
// this.rngName = rngName;
// this.significanceLevel = significanceLevel;
// }
//
// /**
// * Returns {@link ContinuousGofTest} builder object.
// *
// * @return builder object.
// */
// public static ContinuousGofTest.Builder continuous() {
// return new ContinuousGofTest.Builder();
// }
//
// /**
// * Returns {@link DiscreteGofTest} builder object.
// *
// * @return builder obbject.
// */
// public static DiscreteGofTest.Builder discrete() {
// return new DiscreteGofTest.Builder();
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test.
// *
// * @return test result.
// */
// public abstract Map<String, Double> test();
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel.
// *
// * @return test result.
// */
// public Map<String, Double> testInParallel() {
// ForkJoinPool pool = new ForkJoinPool();
// try {
// return testInParallel(pool);
//
// } finally {
// pool.shutdown();
// try {
// pool.awaitTermination(1, TimeUnit.SECONDS);
// } catch (InterruptedException ignore) {
// }
// }
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel using given {@link ForkJoinPool} instance.
// *
// * @param pool Fork/Join pool to execute tasks in paralle.
// * @return test result.
// */
// public abstract Map<String, Double> testInParallel(ForkJoinPool pool);
//
// /**
// * Runs Goodness-of-Fit tests and verifis whether the test failed to reject the null hypothesis
// * (which means the random sequence that was generated by random number generator can be described as random) or not.
// */
// public void testAndVerify() {
// Map<String, Double> result = test();
//
// result.forEach((t, p) ->
// assertThat(p)
// .describedAs("At a significance level of %e, the Goodness-of-Fit test of [%s] should fail to reject null hypothesis (The p-value %f should be greater than or equal to %e).\n" +
// "This means that the random sequence generated by the random number generator [%s] fit the theoretical probability distribution.",
// significanceLevel, t, p, significanceLevel,
// rngName)
// .isGreaterThanOrEqualTo(significanceLevel));
// }
// }
//
// Path: fast-rng-test/src/main/java/biz/k11i/rng/test/util/distribution/ProbabilityDistributions.java
// public interface ProbabilityDistributions {
// static ContinuousDistribution gaussian(double mean, double sd) {
// return new Gaussian(mean, sd);
// }
//
// static ContinuousDistribution gamma(double shape, double scale) {
// return new Gamma(shape, scale);
// }
//
// static ContinuousDistribution beta(double alpha, double beta) {
// return new Beta(alpha, beta);
// }
//
// static ContinuousDistribution wrap(RealDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Continuous(distribution);
// }
//
// static DiscreteDistribution wrap(IntegerDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Discrete(distribution);
// }
// }
| import biz.k11i.rng.test.gof.GoodnessOfFitTest;
import biz.k11i.rng.test.util.distribution.ProbabilityDistributions;
import org.junit.jupiter.api.Test;
import java.util.Random;
import static org.assertj.core.api.Assertions.assertThatThrownBy; | package biz.k11i.rng.test;
class SecondLevelTestTest {
@Test
void test() {
GoodnessOfFitTest gofTest = GoodnessOfFitTest.continuous() | // Path: fast-rng-test/src/main/java/biz/k11i/rng/test/gof/GoodnessOfFitTest.java
// @SuppressWarnings("unused")
// public abstract class GoodnessOfFitTest {
// static class BuilderBase<SELF extends BuilderBase<SELF>> {
// @SuppressWarnings("unchecked")
// private final SELF self = (SELF) this;
//
// int numRandomValues;
// double significanceLevel = DEFAULT_SIGNIFICANCE_LEVEL;
//
// public SELF numRandomValues(int numRandomValues) {
// this.numRandomValues = numRandomValues;
// return self;
// }
//
// public SELF significanceLevel(double significanceLevel) {
// this.significanceLevel = significanceLevel;
// return self;
// }
// }
//
// /** Default significance level (0.1%) */
// private static final double DEFAULT_SIGNIFICANCE_LEVEL = 0.001;
//
// /** Name of the random number generator to be tested */
// public final String rngName;
//
// /** Significance level to reject the null hypothesis */
// public final double significanceLevel;
//
// GoodnessOfFitTest(String rngName, double significanceLevel) {
// this.rngName = rngName;
// this.significanceLevel = significanceLevel;
// }
//
// /**
// * Returns {@link ContinuousGofTest} builder object.
// *
// * @return builder object.
// */
// public static ContinuousGofTest.Builder continuous() {
// return new ContinuousGofTest.Builder();
// }
//
// /**
// * Returns {@link DiscreteGofTest} builder object.
// *
// * @return builder obbject.
// */
// public static DiscreteGofTest.Builder discrete() {
// return new DiscreteGofTest.Builder();
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test.
// *
// * @return test result.
// */
// public abstract Map<String, Double> test();
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel.
// *
// * @return test result.
// */
// public Map<String, Double> testInParallel() {
// ForkJoinPool pool = new ForkJoinPool();
// try {
// return testInParallel(pool);
//
// } finally {
// pool.shutdown();
// try {
// pool.awaitTermination(1, TimeUnit.SECONDS);
// } catch (InterruptedException ignore) {
// }
// }
// }
//
// /**
// * Calculate p-values of Goodness-of-Fit test in parallel using given {@link ForkJoinPool} instance.
// *
// * @param pool Fork/Join pool to execute tasks in paralle.
// * @return test result.
// */
// public abstract Map<String, Double> testInParallel(ForkJoinPool pool);
//
// /**
// * Runs Goodness-of-Fit tests and verifis whether the test failed to reject the null hypothesis
// * (which means the random sequence that was generated by random number generator can be described as random) or not.
// */
// public void testAndVerify() {
// Map<String, Double> result = test();
//
// result.forEach((t, p) ->
// assertThat(p)
// .describedAs("At a significance level of %e, the Goodness-of-Fit test of [%s] should fail to reject null hypothesis (The p-value %f should be greater than or equal to %e).\n" +
// "This means that the random sequence generated by the random number generator [%s] fit the theoretical probability distribution.",
// significanceLevel, t, p, significanceLevel,
// rngName)
// .isGreaterThanOrEqualTo(significanceLevel));
// }
// }
//
// Path: fast-rng-test/src/main/java/biz/k11i/rng/test/util/distribution/ProbabilityDistributions.java
// public interface ProbabilityDistributions {
// static ContinuousDistribution gaussian(double mean, double sd) {
// return new Gaussian(mean, sd);
// }
//
// static ContinuousDistribution gamma(double shape, double scale) {
// return new Gamma(shape, scale);
// }
//
// static ContinuousDistribution beta(double alpha, double beta) {
// return new Beta(alpha, beta);
// }
//
// static ContinuousDistribution wrap(RealDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Continuous(distribution);
// }
//
// static DiscreteDistribution wrap(IntegerDistribution distribution) {
// return new CommonsMath3DistributionWrapper.Discrete(distribution);
// }
// }
// Path: fast-rng-test/src/test/java/biz/k11i/rng/test/SecondLevelTestTest.java
import biz.k11i.rng.test.gof.GoodnessOfFitTest;
import biz.k11i.rng.test.util.distribution.ProbabilityDistributions;
import org.junit.jupiter.api.Test;
import java.util.Random;
import static org.assertj.core.api.Assertions.assertThatThrownBy;
package biz.k11i.rng.test;
class SecondLevelTestTest {
@Test
void test() {
GoodnessOfFitTest gofTest = GoodnessOfFitTest.continuous() | .probabilityDistribution(ProbabilityDistributions.gaussian(0.0, 1.002 /* not 1.0 */)) |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/BetaRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double pow(double value, double power) {
// return JafamaMath.pow(value, power);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.pow; |
// min <= 1, max = 1
if (min == 1.0) {
// max = 1, min = 1
return BetaRNGAlgorithms.Unif.INSTANCE;
}
return BetaRNGAlgorithms.CdfInversion.INSTANCE;
}
}
}
class BetaRNGAlgorithms {
/**
* Implementation of Beta random number generator using Jöhnk's algorithm.
* <p>
* Jöhnk, M. D.
* <i>"Erzeugung von betaverteilten und gammaverteilten Zufallszahlen."</i>
* Metrika 8.1 (1964): 5-15.
* </p>
*/
static class Johnk implements BetaRNG {
static final BetaRNG INSTANCE = new Johnk();
@Override
public double generate(Random random, double alpha, double beta) {
while (true) { | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double pow(double value, double power) {
// return JafamaMath.pow(value, power);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/BetaRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.pow;
// min <= 1, max = 1
if (min == 1.0) {
// max = 1, min = 1
return BetaRNGAlgorithms.Unif.INSTANCE;
}
return BetaRNGAlgorithms.CdfInversion.INSTANCE;
}
}
}
class BetaRNGAlgorithms {
/**
* Implementation of Beta random number generator using Jöhnk's algorithm.
* <p>
* Jöhnk, M. D.
* <i>"Erzeugung von betaverteilten und gammaverteilten Zufallszahlen."</i>
* Metrika 8.1 (1964): 5-15.
* </p>
*/
static class Johnk implements BetaRNG {
static final BetaRNG INSTANCE = new Johnk();
@Override
public double generate(Random random, double alpha, double beta) {
while (true) { | double u = log(random.nextDouble()) / alpha; |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/BetaRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double pow(double value, double power) {
// return JafamaMath.pow(value, power);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.pow; | if (min == 1.0) {
// max = 1, min = 1
return BetaRNGAlgorithms.Unif.INSTANCE;
}
return BetaRNGAlgorithms.CdfInversion.INSTANCE;
}
}
}
class BetaRNGAlgorithms {
/**
* Implementation of Beta random number generator using Jöhnk's algorithm.
* <p>
* Jöhnk, M. D.
* <i>"Erzeugung von betaverteilten und gammaverteilten Zufallszahlen."</i>
* Metrika 8.1 (1964): 5-15.
* </p>
*/
static class Johnk implements BetaRNG {
static final BetaRNG INSTANCE = new Johnk();
@Override
public double generate(Random random, double alpha, double beta) {
while (true) {
double u = log(random.nextDouble()) / alpha;
double v = log(random.nextDouble()) / beta;
| // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double pow(double value, double power) {
// return JafamaMath.pow(value, power);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/BetaRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.pow;
if (min == 1.0) {
// max = 1, min = 1
return BetaRNGAlgorithms.Unif.INSTANCE;
}
return BetaRNGAlgorithms.CdfInversion.INSTANCE;
}
}
}
class BetaRNGAlgorithms {
/**
* Implementation of Beta random number generator using Jöhnk's algorithm.
* <p>
* Jöhnk, M. D.
* <i>"Erzeugung von betaverteilten und gammaverteilten Zufallszahlen."</i>
* Metrika 8.1 (1964): 5-15.
* </p>
*/
static class Johnk implements BetaRNG {
static final BetaRNG INSTANCE = new Johnk();
@Override
public double generate(Random random, double alpha, double beta) {
while (true) {
double u = log(random.nextDouble()) / alpha;
double v = log(random.nextDouble()) / beta;
| double uu = exp(u); |
komiya-atsushi/fast-rng-java | fast-rng/src/main/java/biz/k11i/rng/BetaRNG.java | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double pow(double value, double power) {
// return JafamaMath.pow(value, power);
// }
| import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.pow; |
double logM = u > v ? u : v;
u -= logM;
v -= logM;
return exp(u - log(exp(u) + exp(v)));
}
}
}
}
/**
* Implementation of Beta random number generator using Sakasegawa's B00 algorithm.
* <p>
* Sakasegawa, H.
* <i>"Stratified rejection and squeeze method for generating beta random numbers."</i>
* Annals of the Institute of Statistical Mathematics 35.1 (1983): 291-302.
* </p>
*/
static class B00 implements BetaRNG {
static final BetaRNG INSTANCE = new B00();
@Override
public double generate(Random random, double alpha, double beta) {
double t = (1 - alpha) / (2 - alpha - beta);
double s = (beta - alpha) * (1 - alpha - beta);
double r = alpha * (1 - alpha);
t -= ((s * t + 2 * r) * t - r) / 2 * (s * t + r);
double p = t / alpha;
double q = (1 - t) / beta; | // Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double exp(double value) {
// return JafamaMath.exp(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double log(double value) {
// return JafamaMath.log(value);
// }
//
// Path: fast-rng/src/main/java/biz/k11i/util/MathFunctions.java
// public static final double pow(double value, double power) {
// return JafamaMath.pow(value, power);
// }
// Path: fast-rng/src/main/java/biz/k11i/rng/BetaRNG.java
import java.util.Random;
import static biz.k11i.util.MathFunctions.exp;
import static biz.k11i.util.MathFunctions.log;
import static biz.k11i.util.MathFunctions.pow;
double logM = u > v ? u : v;
u -= logM;
v -= logM;
return exp(u - log(exp(u) + exp(v)));
}
}
}
}
/**
* Implementation of Beta random number generator using Sakasegawa's B00 algorithm.
* <p>
* Sakasegawa, H.
* <i>"Stratified rejection and squeeze method for generating beta random numbers."</i>
* Annals of the Institute of Statistical Mathematics 35.1 (1983): 291-302.
* </p>
*/
static class B00 implements BetaRNG {
static final BetaRNG INSTANCE = new B00();
@Override
public double generate(Random random, double alpha, double beta) {
double t = (1 - alpha) / (2 - alpha - beta);
double s = (beta - alpha) * (1 - alpha - beta);
double r = alpha * (1 - alpha);
t -= ((s * t + 2 * r) * t - r) / 2 * (s * t + r);
double p = t / alpha;
double q = (1 - t) / beta; | s = pow((1 - t), beta - 1); |
komiya-atsushi/fast-rng-java | benchmark/src/jmh/java/biz/k11i/rng/GammaBenchmark.java | // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
| import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.GammaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random; | package biz.k11i.rng;
public class GammaBenchmark {
@State(Scope.Benchmark)
public static class FixedParameters {
@Param({"0.05", "0.1", "0.2", "0.5", "0.9", "1.0", "1.1", "40.0", "10000.0"})
public double shape;
public double scale = 1.0;
| // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
// Path: benchmark/src/jmh/java/biz/k11i/rng/GammaBenchmark.java
import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.GammaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random;
package biz.k11i.rng;
public class GammaBenchmark {
@State(Scope.Benchmark)
public static class FixedParameters {
@Param({"0.05", "0.1", "0.2", "0.5", "0.9", "1.0", "1.1", "40.0", "10000.0"})
public double shape;
public double scale = 1.0;
| private Random random = new MtRandom(); |
komiya-atsushi/fast-rng-java | benchmark/src/jmh/java/biz/k11i/rng/GammaBenchmark.java | // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
| import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.GammaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random; | @Setup
public void setUp() {
gammaDistribution = new GammaDistribution(
new MersenneTwister(),
shape,
scale,
GammaDistribution.DEFAULT_INVERSE_ABSOLUTE_ACCURACY);
}
@Benchmark
public double commonsMath3() {
return gammaDistribution.sample();
}
@Benchmark
public double fastRng() {
return GammaRNG.FAST_RNG.generate(random, shape, scale);
}
@Benchmark
public double generalRng() {
return GammaRNG.GENERAL_RNG.generate(random, shape, scale);
}
}
@State(Scope.Benchmark)
public static class ArbitraryParameters {
private double scale = 1.0;
private Random random = new MtRandom();
private MersenneTwister mersenneTwister = new MersenneTwister(); | // Path: benchmark/src/jmh/java/biz/k11i/rng/util/MtRandom.java
// public class MtRandom extends Random {
// private final MersenneTwister mersenneTwister;
//
// public MtRandom() {
// mersenneTwister = new MersenneTwister();
// }
//
// public MtRandom(int seed) {
// mersenneTwister = new MersenneTwister(seed);
// }
//
// @Override
// public boolean nextBoolean() {
// return mersenneTwister.nextBoolean();
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// mersenneTwister.nextBytes(bytes);
// }
//
// @Override
// public double nextDouble() {
// return mersenneTwister.nextDouble();
// }
//
// @Override
// public float nextFloat() {
// return mersenneTwister.nextFloat();
// }
//
// @Override
// public double nextGaussian() {
// return mersenneTwister.nextGaussian();
// }
//
// @Override
// public int nextInt() {
// return mersenneTwister.nextInt();
// }
//
// @Override
// public int nextInt(int n) throws IllegalArgumentException {
// return mersenneTwister.nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return mersenneTwister.nextLong();
// }
// }
//
// Path: benchmark/src/jmh/java/biz/k11i/rng/util/ParameterPool.java
// public class ParameterPool {
// private double[] parameters;
// private int index;
//
// public ParameterPool(int seed, int count, double theta) {
// parameters = new double[count];
// MtRandom r = new MtRandom(seed);
//
// for (int i = 0; i < count; i++) {
// parameters[i] = Math.nextUp(ExponentialRNG.FAST_RNG.generate(r, theta));
// }
// }
//
// public double next() {
// if (index >= parameters.length) {
// index = 0;
// }
//
// return parameters[index++];
// }
// }
// Path: benchmark/src/jmh/java/biz/k11i/rng/GammaBenchmark.java
import biz.k11i.rng.util.MtRandom;
import biz.k11i.rng.util.ParameterPool;
import org.apache.commons.math3.distribution.GammaDistribution;
import org.apache.commons.math3.random.MersenneTwister;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Param;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.Random;
@Setup
public void setUp() {
gammaDistribution = new GammaDistribution(
new MersenneTwister(),
shape,
scale,
GammaDistribution.DEFAULT_INVERSE_ABSOLUTE_ACCURACY);
}
@Benchmark
public double commonsMath3() {
return gammaDistribution.sample();
}
@Benchmark
public double fastRng() {
return GammaRNG.FAST_RNG.generate(random, shape, scale);
}
@Benchmark
public double generalRng() {
return GammaRNG.GENERAL_RNG.generate(random, shape, scale);
}
}
@State(Scope.Benchmark)
public static class ArbitraryParameters {
private double scale = 1.0;
private Random random = new MtRandom();
private MersenneTwister mersenneTwister = new MersenneTwister(); | private ParameterPool parameters = new ParameterPool(12345, 10000, 10.0); |
komiya-atsushi/fast-rng-java | benchmark/src/jmh/java/biz/k11i/rng/ExponentialBenchmark.java | // Path: benchmark/src/jmh/java/biz/k11i/rng/util/ThreadLocalRandomGenerator.java
// public class ThreadLocalRandomGenerator implements RandomGenerator {
// @Override
// public void setSeed(int seed) {
// ThreadLocalRandom.current().setSeed(seed);
// }
//
// @Override
// public void setSeed(int[] seed) {
// throw new UnsupportedOperationException();
// }
//
// @Override
// public void setSeed(long seed) {
// ThreadLocalRandom.current().setSeed(seed);
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// ThreadLocalRandom.current().nextBytes(bytes);
// }
//
// @Override
// public int nextInt() {
// return ThreadLocalRandom.current().nextInt();
// }
//
// @Override
// public int nextInt(int n) {
// return ThreadLocalRandom.current().nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return ThreadLocalRandom.current().nextLong();
// }
//
// @Override
// public boolean nextBoolean() {
// return ThreadLocalRandom.current().nextBoolean();
// }
//
// @Override
// public float nextFloat() {
// return ThreadLocalRandom.current().nextFloat();
// }
//
// @Override
// public double nextDouble() {
// return ThreadLocalRandom.current().nextDouble();
// }
//
// @Override
// public double nextGaussian() {
// return ThreadLocalRandom.current().nextGaussian();
// }
// }
| import biz.k11i.rng.util.ThreadLocalRandomGenerator;
import org.apache.commons.math3.distribution.ExponentialDistribution;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.concurrent.ThreadLocalRandom; | package biz.k11i.rng;
@State(Scope.Benchmark)
public class ExponentialBenchmark {
private ExponentialDistribution exponentialDistribution;
@Setup
public void setUp() {
exponentialDistribution = new ExponentialDistribution( | // Path: benchmark/src/jmh/java/biz/k11i/rng/util/ThreadLocalRandomGenerator.java
// public class ThreadLocalRandomGenerator implements RandomGenerator {
// @Override
// public void setSeed(int seed) {
// ThreadLocalRandom.current().setSeed(seed);
// }
//
// @Override
// public void setSeed(int[] seed) {
// throw new UnsupportedOperationException();
// }
//
// @Override
// public void setSeed(long seed) {
// ThreadLocalRandom.current().setSeed(seed);
// }
//
// @Override
// public void nextBytes(byte[] bytes) {
// ThreadLocalRandom.current().nextBytes(bytes);
// }
//
// @Override
// public int nextInt() {
// return ThreadLocalRandom.current().nextInt();
// }
//
// @Override
// public int nextInt(int n) {
// return ThreadLocalRandom.current().nextInt(n);
// }
//
// @Override
// public long nextLong() {
// return ThreadLocalRandom.current().nextLong();
// }
//
// @Override
// public boolean nextBoolean() {
// return ThreadLocalRandom.current().nextBoolean();
// }
//
// @Override
// public float nextFloat() {
// return ThreadLocalRandom.current().nextFloat();
// }
//
// @Override
// public double nextDouble() {
// return ThreadLocalRandom.current().nextDouble();
// }
//
// @Override
// public double nextGaussian() {
// return ThreadLocalRandom.current().nextGaussian();
// }
// }
// Path: benchmark/src/jmh/java/biz/k11i/rng/ExponentialBenchmark.java
import biz.k11i.rng.util.ThreadLocalRandomGenerator;
import org.apache.commons.math3.distribution.ExponentialDistribution;
import org.openjdk.jmh.annotations.Benchmark;
import org.openjdk.jmh.annotations.Scope;
import org.openjdk.jmh.annotations.Setup;
import org.openjdk.jmh.annotations.State;
import java.util.concurrent.ThreadLocalRandom;
package biz.k11i.rng;
@State(Scope.Benchmark)
public class ExponentialBenchmark {
private ExponentialDistribution exponentialDistribution;
@Setup
public void setUp() {
exponentialDistribution = new ExponentialDistribution( | new ThreadLocalRandomGenerator(), |
futurice/meeting-room-tablet | app/src/main/java/com/futurice/android/reservator/view/wizard/WizardAccountSelectionFragment.java | // Path: app/src/main/java/com/futurice/android/reservator/common/PreferenceManager.java
// public class PreferenceManager {
// private static PreferenceManager sharedInstance = null;
//
// public static PreferenceManager getInstance(Context context) {
// if (sharedInstance == null) {
// sharedInstance = new PreferenceManager(context);
// }
// return sharedInstance;
// }
//
// final static String PREFERENCES_IDENTIFIER = "ReservatorPreferences";
//
// final static String PREFERENCES_DEFAULT_ACCOUNT = "googleAccount";
// final static String PREFERENCES_DEFAULT_USER_NAME = "reservationAccount";
// final static String PREFERENCES_ADDRESSBOOK_ENABLED = "addressBookOption";
// final static String PREFERENCES_UNSELECTED_ROOMS = "unselectedRooms";
// final static String PREFERENCES_SELECTED_ROOM = "roomName";
// final static String PREFERENCES_CONFIGURED = "preferencedConfigured";
// final static String PREFERENCES_CALENDAR_MODE = "resourcesOnly";
//
//
// final SharedPreferences preferences;
//
// private PreferenceManager(Context c) {
// preferences = c.getSharedPreferences(PREFERENCES_IDENTIFIER,
// Context.MODE_PRIVATE);
// }
//
// public String getDefaultCalendarAccount() {
// return preferences.getString(PREFERENCES_DEFAULT_ACCOUNT, null);
// }
//
// public void setDefaultCalendarAccount(String account) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_DEFAULT_ACCOUNT, account);
// editor.apply();
// }
//
// public String getDefaultUserName() {
// return preferences.getString(PREFERENCES_DEFAULT_USER_NAME, null);
// }
//
// public void setDefaultUserName(String user) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_DEFAULT_USER_NAME, user);
// editor.apply();
// }
//
// public boolean getAddressBookEnabled() {
// return preferences.getBoolean(PREFERENCES_ADDRESSBOOK_ENABLED, false);
// }
//
// public void setAddressBookEnabled(boolean enabled) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putBoolean(PREFERENCES_ADDRESSBOOK_ENABLED, enabled);
// editor.apply();
// }
//
// public HashSet<String> getUnselectedRooms() {
// return (HashSet<String>) preferences
// .getStringSet(PREFERENCES_UNSELECTED_ROOMS,
// new HashSet<String>());
// }
//
//
// public void setUnselectedRooms(HashSet<String> rooms) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putStringSet(PREFERENCES_UNSELECTED_ROOMS,
// new HashSet<String>(rooms));
// editor.apply();
// }
//
//
// public String getSelectedRoom() {
// return preferences.getString(PREFERENCES_SELECTED_ROOM, null);
// }
//
// public void setSelectedRoom(String newRoom) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_SELECTED_ROOM, newRoom);
// editor.apply();
// }
//
//
// public boolean getApplicationConfigured() {
// return preferences.getBoolean(PREFERENCES_CONFIGURED, false);
// }
//
// public void setApplicationConfigured(boolean configured) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putBoolean(PREFERENCES_CONFIGURED, configured);
// editor.apply();
// }
//
//
// public void removeAllSettings() {
// SharedPreferences.Editor editor = preferences.edit();
// Map<String, ?> keys = preferences.getAll();
// for (Map.Entry<String, ?> entry : keys.entrySet()) {
// editor.remove(entry.getKey());
// }
// editor.apply();
// }
//
// public PlatformCalendarDataProxy.Mode getCalendarMode() {
// String name = preferences.getString(PREFERENCES_CALENDAR_MODE, null);
// if (name == null) {
// return null;
// }
// return Enum.valueOf(PlatformCalendarDataProxy.Mode.class, name);
// }
//
// public void setCalendarMode(PlatformCalendarDataProxy.Mode mode) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_CALENDAR_MODE, mode.name());
// editor.apply();
// }
//
// }
| import android.accounts.Account;
import android.accounts.AccountManager;
import android.app.AlertDialog;
import android.content.DialogInterface;
import android.content.Intent;
import android.os.Bundle;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import android.widget.RadioButton;
import android.widget.RadioGroup;
import android.widget.TextView;
import com.futurice.android.reservator.R;
import com.futurice.android.reservator.common.PreferenceManager;
import com.github.paolorotolo.appintro.ISlidePolicy;
import java.util.ArrayList;
import java.util.List;
import butterknife.BindView;
import butterknife.ButterKnife;
import butterknife.Unbinder; | package com.futurice.android.reservator.view.wizard;
/**
* Created by shoj on 10/11/2016.
*/
public final class WizardAccountSelectionFragment
extends android.support.v4.app.Fragment implements ISlidePolicy {
@BindView(R.id.wizard_accounts_radiogroup)
RadioGroup accountsRadioGroup = null;
@BindView(R.id.wizard_accounts_title)
TextView title;
Unbinder unbinder;
AlertDialog alertDialog;
@Override
public View onCreateView(
LayoutInflater inflater, ViewGroup container,
Bundle savedInstanceState) {
View view = inflater.inflate(R.layout.wizard_account_selection, container, false);
unbinder = ButterKnife.bind(this, view);
title.setText(R.string.selectGoogleAccount);
accountsRadioGroup.setOnCheckedChangeListener(
new RadioGroup.OnCheckedChangeListener() {
@Override
public void onCheckedChanged(
RadioGroup group, int checkedId) {
String account =
((RadioButton) group.findViewById(checkedId))
.getText().toString(); | // Path: app/src/main/java/com/futurice/android/reservator/common/PreferenceManager.java
// public class PreferenceManager {
// private static PreferenceManager sharedInstance = null;
//
// public static PreferenceManager getInstance(Context context) {
// if (sharedInstance == null) {
// sharedInstance = new PreferenceManager(context);
// }
// return sharedInstance;
// }
//
// final static String PREFERENCES_IDENTIFIER = "ReservatorPreferences";
//
// final static String PREFERENCES_DEFAULT_ACCOUNT = "googleAccount";
// final static String PREFERENCES_DEFAULT_USER_NAME = "reservationAccount";
// final static String PREFERENCES_ADDRESSBOOK_ENABLED = "addressBookOption";
// final static String PREFERENCES_UNSELECTED_ROOMS = "unselectedRooms";
// final static String PREFERENCES_SELECTED_ROOM = "roomName";
// final static String PREFERENCES_CONFIGURED = "preferencedConfigured";
// final static String PREFERENCES_CALENDAR_MODE = "resourcesOnly";
//
//
// final SharedPreferences preferences;
//
// private PreferenceManager(Context c) {
// preferences = c.getSharedPreferences(PREFERENCES_IDENTIFIER,
// Context.MODE_PRIVATE);
// }
//
// public String getDefaultCalendarAccount() {
// return preferences.getString(PREFERENCES_DEFAULT_ACCOUNT, null);
// }
//
// public void setDefaultCalendarAccount(String account) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_DEFAULT_ACCOUNT, account);
// editor.apply();
// }
//
// public String getDefaultUserName() {
// return preferences.getString(PREFERENCES_DEFAULT_USER_NAME, null);
// }
//
// public void setDefaultUserName(String user) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_DEFAULT_USER_NAME, user);
// editor.apply();
// }
//
// public boolean getAddressBookEnabled() {
// return preferences.getBoolean(PREFERENCES_ADDRESSBOOK_ENABLED, false);
// }
//
// public void setAddressBookEnabled(boolean enabled) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putBoolean(PREFERENCES_ADDRESSBOOK_ENABLED, enabled);
// editor.apply();
// }
//
// public HashSet<String> getUnselectedRooms() {
// return (HashSet<String>) preferences
// .getStringSet(PREFERENCES_UNSELECTED_ROOMS,
// new HashSet<String>());
// }
//
//
// public void setUnselectedRooms(HashSet<String> rooms) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putStringSet(PREFERENCES_UNSELECTED_ROOMS,
// new HashSet<String>(rooms));
// editor.apply();
// }
//
//
// public String getSelectedRoom() {
// return preferences.getString(PREFERENCES_SELECTED_ROOM, null);
// }
//
// public void setSelectedRoom(String newRoom) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_SELECTED_ROOM, newRoom);
// editor.apply();
// }
//
//
// public boolean getApplicationConfigured() {
// return preferences.getBoolean(PREFERENCES_CONFIGURED, false);
// }
//
// public void setApplicationConfigured(boolean configured) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putBoolean(PREFERENCES_CONFIGURED, configured);
// editor.apply();
// }
//
//
// public void removeAllSettings() {
// SharedPreferences.Editor editor = preferences.edit();
// Map<String, ?> keys = preferences.getAll();
// for (Map.Entry<String, ?> entry : keys.entrySet()) {
// editor.remove(entry.getKey());
// }
// editor.apply();
// }
//
// public PlatformCalendarDataProxy.Mode getCalendarMode() {
// String name = preferences.getString(PREFERENCES_CALENDAR_MODE, null);
// if (name == null) {
// return null;
// }
// return Enum.valueOf(PlatformCalendarDataProxy.Mode.class, name);
// }
//
// public void setCalendarMode(PlatformCalendarDataProxy.Mode mode) {
// SharedPreferences.Editor editor = preferences.edit();
// editor.putString(PREFERENCES_CALENDAR_MODE, mode.name());
// editor.apply();
// }
//
// }
// Path: app/src/main/java/com/futurice/android/reservator/view/wizard/WizardAccountSelectionFragment.java
import android.accounts.Account;
import android.accounts.AccountManager;
import android.app.AlertDialog;
import android.content.DialogInterface;
import android.content.Intent;
import android.os.Bundle;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import android.widget.RadioButton;
import android.widget.RadioGroup;
import android.widget.TextView;
import com.futurice.android.reservator.R;
import com.futurice.android.reservator.common.PreferenceManager;
import com.github.paolorotolo.appintro.ISlidePolicy;
import java.util.ArrayList;
import java.util.List;
import butterknife.BindView;
import butterknife.ButterKnife;
import butterknife.Unbinder;
package com.futurice.android.reservator.view.wizard;
/**
* Created by shoj on 10/11/2016.
*/
public final class WizardAccountSelectionFragment
extends android.support.v4.app.Fragment implements ISlidePolicy {
@BindView(R.id.wizard_accounts_radiogroup)
RadioGroup accountsRadioGroup = null;
@BindView(R.id.wizard_accounts_title)
TextView title;
Unbinder unbinder;
AlertDialog alertDialog;
@Override
public View onCreateView(
LayoutInflater inflater, ViewGroup container,
Bundle savedInstanceState) {
View view = inflater.inflate(R.layout.wizard_account_selection, container, false);
unbinder = ButterKnife.bind(this, view);
title.setText(R.string.selectGoogleAccount);
accountsRadioGroup.setOnCheckedChangeListener(
new RadioGroup.OnCheckedChangeListener() {
@Override
public void onCheckedChanged(
RadioGroup group, int checkedId) {
String account =
((RadioButton) group.findViewById(checkedId))
.getText().toString(); | PreferenceManager.getInstance(getActivity()) |
futurice/meeting-room-tablet | app/src/main/java/com/futurice/android/reservator/model/platformcontacts/PlatformContactsAddressBook.java | // Path: app/src/main/java/com/futurice/android/reservator/model/AddressBook.java
// public abstract class AddressBook {
// private Vector<AddressBookEntry> entries;
// private Set<AddressBookUpdatedListener> listeners = new HashSet<AddressBookUpdatedListener>();
//
// public AddressBook() {
// }
//
// protected abstract Vector<AddressBookEntry> fetchEntries() throws ReservatorException;
//
// public abstract void setCredentials(String username, String password);
//
// public Vector<AddressBookEntry> getEntries() throws ReservatorException {
// return entries;
// }
//
// public void prefetchEntries() {
// if (entries == null) {
// new PrefetchEntriesTask().execute();
// }
// }
//
// public AddressBookEntry getEntryByName(String name) {
// if (entries == null) {
// return null; // no entries, no win
// }
//
// for (AddressBookEntry entry : entries) {
// if (entry.getName().equals(name)) {
// return entry;
// }
// }
// return null;
// }
//
// public String toString() {
// if (entries != null)
// return entries.toString();
// return "";
// }
//
// /**
// * Add a listener for this proxy. The listener will be notified after calls to refreshRooms and refreshRoomReservations finish or fail.
// *
// * @param listener
// */
// public void addDataUpdatedListener(AddressBookUpdatedListener listener) {
// listeners.add(listener);
// }
//
// /**
// * Remove a listener from this proxy.
// *
// * @param listener
// */
// public void removeDataUpdatedListener(AddressBookUpdatedListener listener) {
// listeners.remove(listener);
// }
//
// private void notifyEntriesUpdated() {
// synchronized (listeners) {
// for (AddressBookUpdatedListener l : listeners) {
// l.addressBookUpdated();
// }
// }
// }
//
// private void notifyAddressBookUpdateFailed(ReservatorException e) {
// synchronized (listeners) {
// for (AddressBookUpdatedListener l : listeners) {
// l.addressBookUpdateFailed(e);
// }
// }
// }
//
// public void refetchEntries() {
// entries = null;
// prefetchEntries();
// }
//
// private class PrefetchEntriesTask extends AsyncTask<Void, Void, Vector<AddressBookEntry>> {
// ReservatorException e = null;
//
// @Override
// protected Vector<AddressBookEntry> doInBackground(Void... params) {
// try {
// return fetchEntries();
// } catch (ReservatorException e) {
// this.e = e;
// return null;
// }
// }
//
// @Override
// protected void onPostExecute(Vector<AddressBookEntry> entries) {
// if (entries != null) {
// AddressBook.this.entries = entries;
// notifyEntriesUpdated();
// } else {
// notifyAddressBookUpdateFailed(e);
// }
// }
// }
// }
//
// Path: app/src/main/java/com/futurice/android/reservator/model/AddressBookEntry.java
// public class AddressBookEntry {
// private String name, email;
//
// public AddressBookEntry(String name, String email) {
// this.name = name;
// this.email = email;
// }
//
// public String getName() {
// return name;
// }
//
// public String getEmail() {
// return email;
// }
//
// public String toString() {
// return getName() + " <" + getEmail() + ">";
// }
// }
| import android.content.ContentResolver;
import android.database.Cursor;
import android.provider.ContactsContract;
import com.futurice.android.reservator.model.AddressBook;
import com.futurice.android.reservator.model.AddressBookEntry;
import com.futurice.android.reservator.model.ReservatorException;
import java.util.Vector; | package com.futurice.android.reservator.model.platformcontacts;
public class PlatformContactsAddressBook extends AddressBook {
private final String GOOGLE_ACCOUNT_TYPE = "com.google";
private String account = null;
private ContentResolver resolver;
public PlatformContactsAddressBook(ContentResolver resolver) {
super();
this.resolver = resolver;
}
/**
* This is a heavy query, and should be called rarely.
*/
@Override | // Path: app/src/main/java/com/futurice/android/reservator/model/AddressBook.java
// public abstract class AddressBook {
// private Vector<AddressBookEntry> entries;
// private Set<AddressBookUpdatedListener> listeners = new HashSet<AddressBookUpdatedListener>();
//
// public AddressBook() {
// }
//
// protected abstract Vector<AddressBookEntry> fetchEntries() throws ReservatorException;
//
// public abstract void setCredentials(String username, String password);
//
// public Vector<AddressBookEntry> getEntries() throws ReservatorException {
// return entries;
// }
//
// public void prefetchEntries() {
// if (entries == null) {
// new PrefetchEntriesTask().execute();
// }
// }
//
// public AddressBookEntry getEntryByName(String name) {
// if (entries == null) {
// return null; // no entries, no win
// }
//
// for (AddressBookEntry entry : entries) {
// if (entry.getName().equals(name)) {
// return entry;
// }
// }
// return null;
// }
//
// public String toString() {
// if (entries != null)
// return entries.toString();
// return "";
// }
//
// /**
// * Add a listener for this proxy. The listener will be notified after calls to refreshRooms and refreshRoomReservations finish or fail.
// *
// * @param listener
// */
// public void addDataUpdatedListener(AddressBookUpdatedListener listener) {
// listeners.add(listener);
// }
//
// /**
// * Remove a listener from this proxy.
// *
// * @param listener
// */
// public void removeDataUpdatedListener(AddressBookUpdatedListener listener) {
// listeners.remove(listener);
// }
//
// private void notifyEntriesUpdated() {
// synchronized (listeners) {
// for (AddressBookUpdatedListener l : listeners) {
// l.addressBookUpdated();
// }
// }
// }
//
// private void notifyAddressBookUpdateFailed(ReservatorException e) {
// synchronized (listeners) {
// for (AddressBookUpdatedListener l : listeners) {
// l.addressBookUpdateFailed(e);
// }
// }
// }
//
// public void refetchEntries() {
// entries = null;
// prefetchEntries();
// }
//
// private class PrefetchEntriesTask extends AsyncTask<Void, Void, Vector<AddressBookEntry>> {
// ReservatorException e = null;
//
// @Override
// protected Vector<AddressBookEntry> doInBackground(Void... params) {
// try {
// return fetchEntries();
// } catch (ReservatorException e) {
// this.e = e;
// return null;
// }
// }
//
// @Override
// protected void onPostExecute(Vector<AddressBookEntry> entries) {
// if (entries != null) {
// AddressBook.this.entries = entries;
// notifyEntriesUpdated();
// } else {
// notifyAddressBookUpdateFailed(e);
// }
// }
// }
// }
//
// Path: app/src/main/java/com/futurice/android/reservator/model/AddressBookEntry.java
// public class AddressBookEntry {
// private String name, email;
//
// public AddressBookEntry(String name, String email) {
// this.name = name;
// this.email = email;
// }
//
// public String getName() {
// return name;
// }
//
// public String getEmail() {
// return email;
// }
//
// public String toString() {
// return getName() + " <" + getEmail() + ">";
// }
// }
// Path: app/src/main/java/com/futurice/android/reservator/model/platformcontacts/PlatformContactsAddressBook.java
import android.content.ContentResolver;
import android.database.Cursor;
import android.provider.ContactsContract;
import com.futurice.android.reservator.model.AddressBook;
import com.futurice.android.reservator.model.AddressBookEntry;
import com.futurice.android.reservator.model.ReservatorException;
import java.util.Vector;
package com.futurice.android.reservator.model.platformcontacts;
public class PlatformContactsAddressBook extends AddressBook {
private final String GOOGLE_ACCOUNT_TYPE = "com.google";
private String account = null;
private ContentResolver resolver;
public PlatformContactsAddressBook(ContentResolver resolver) {
super();
this.resolver = resolver;
}
/**
* This is a heavy query, and should be called rarely.
*/
@Override | protected Vector<AddressBookEntry> fetchEntries() throws ReservatorException { |
futurice/meeting-room-tablet | app/src/main/java/com/futurice/android/reservator/model/Room.java | // Path: app/src/main/java/com/futurice/android/reservator/common/Helpers.java
// public class Helpers {
// /**
// * Read all from InputStream
// *
// * @param is Stream to read from
// * @param size Guess the size of InputStream contents, give negative for the automatic
// * @return
// */
// public static String readFromInputStream(InputStream is, int size) {
// try {
// ByteArrayOutputStream os;
// if (size <= 0) {
// os = new ByteArrayOutputStream();
// } else {
// os = new ByteArrayOutputStream(size);
// }
// byte buffer[] = new byte[4096];
// int len;
// while ((len = is.read(buffer)) != -1) {
// os.write(buffer, 0, len);
// }
// return os.toString("UTF-8");
// } catch (IOException e) {
// Log.e("SOAP", "readFromInputStream", e);
// return "";
// }
// }
//
// // TODO: an hour and a half - and other common expressions
// public static String humanizeTimeSpan(int minutes) {
// if (minutes < 30) {
// return Integer.toString(minutes) + " minutes";
// } else if (minutes < 45) {
// return "half an hour";
// } else if (minutes < 60) {
// return "45 minutes";
// } else if (minutes < 85) {
// return "an hour";
// } else if (minutes < 110) {
// return "an hour and a half";
// } else if (minutes < 24 * 60) {
// return Integer.toString((minutes + 10) / 60) + " hours";
// } else {
// return Integer.toString(minutes / (60 * 24)) + " days";
// }
// }
//
// // For use in traffic lights
// public static String humanizeTimeSpan2(int minutes) {
// int hours = minutes / 60;
//
// if (minutes < 15) {
// return getUnits(minutes, "minute", "minutes");
// } else if (minutes < 30) {
// return getUnits(roundTo(minutes, 5), "minute", "minutes");
// } else if (minutes < 60) {
// return getUnits(roundTo(minutes, 15), "minute", "minutes");
// } else if (minutes < 60 * 4) {
// int hourMins = roundTo(minutes - hours * 60, 15);
// if (hourMins == 60) {
// hours++;
// hourMins = 0;
// }
//
// if (hourMins == 0) {
// return getUnits(hours, "hour", "hours");
// } else {
// return String.format(Locale.getDefault(), "%dh:%02dmin", hours, hourMins);
// }
// } else if (minutes < 24 * 60) {
// return getUnits(hours, "hour", "hours");
// } else {
// return getUnits(hours / 24, "day", "days");
// }
// }
//
// private static String getUnits(int amount, String unitName, String unitNamePlural) {
// if (amount == 1) return String.format("1 %s", unitName);
// return String.format(Locale.getDefault(), "%d %s", amount, unitNamePlural);
// }
//
// private static int roundTo(int in, int precision) {
// return precision * ((int) Math.floor(in / (1.0 * precision)));
// }
// }
| import java.io.Serializable;
import java.util.ArrayList;
import java.util.Calendar;
import java.util.Collections;
import java.util.List;
import java.util.Vector;
import com.futurice.android.reservator.common.Helpers; | }
/**
* Prerequisite: isFree
*
* @return true if room is continuously free now and for the rest of the day
*/
public boolean isFreeRestOfDay() {
DateTime now = new DateTime();
DateTime max = now.add(Calendar.DAY_OF_YEAR, 1).stripTime();
TimeSpan restOfDay = new TimeSpan(now, max);
for (Reservation r : reservations) {
if (r.getTimeSpan().intersects(restOfDay)) return false;
if (r.getStartTime().after(max)) return true;
}
return true;
}
public String getStatusText() {
if (this.isFree()) {
int freeMinutes = this.minutesFreeFromNow();
if (freeMinutes > FREE_THRESHOLD_MINUTES) {
return "Free";
} else if (freeMinutes < RESERVED_THRESHOLD_MINUTES) {
return "Reserved";
} else { | // Path: app/src/main/java/com/futurice/android/reservator/common/Helpers.java
// public class Helpers {
// /**
// * Read all from InputStream
// *
// * @param is Stream to read from
// * @param size Guess the size of InputStream contents, give negative for the automatic
// * @return
// */
// public static String readFromInputStream(InputStream is, int size) {
// try {
// ByteArrayOutputStream os;
// if (size <= 0) {
// os = new ByteArrayOutputStream();
// } else {
// os = new ByteArrayOutputStream(size);
// }
// byte buffer[] = new byte[4096];
// int len;
// while ((len = is.read(buffer)) != -1) {
// os.write(buffer, 0, len);
// }
// return os.toString("UTF-8");
// } catch (IOException e) {
// Log.e("SOAP", "readFromInputStream", e);
// return "";
// }
// }
//
// // TODO: an hour and a half - and other common expressions
// public static String humanizeTimeSpan(int minutes) {
// if (minutes < 30) {
// return Integer.toString(minutes) + " minutes";
// } else if (minutes < 45) {
// return "half an hour";
// } else if (minutes < 60) {
// return "45 minutes";
// } else if (minutes < 85) {
// return "an hour";
// } else if (minutes < 110) {
// return "an hour and a half";
// } else if (minutes < 24 * 60) {
// return Integer.toString((minutes + 10) / 60) + " hours";
// } else {
// return Integer.toString(minutes / (60 * 24)) + " days";
// }
// }
//
// // For use in traffic lights
// public static String humanizeTimeSpan2(int minutes) {
// int hours = minutes / 60;
//
// if (minutes < 15) {
// return getUnits(minutes, "minute", "minutes");
// } else if (minutes < 30) {
// return getUnits(roundTo(minutes, 5), "minute", "minutes");
// } else if (minutes < 60) {
// return getUnits(roundTo(minutes, 15), "minute", "minutes");
// } else if (minutes < 60 * 4) {
// int hourMins = roundTo(minutes - hours * 60, 15);
// if (hourMins == 60) {
// hours++;
// hourMins = 0;
// }
//
// if (hourMins == 0) {
// return getUnits(hours, "hour", "hours");
// } else {
// return String.format(Locale.getDefault(), "%dh:%02dmin", hours, hourMins);
// }
// } else if (minutes < 24 * 60) {
// return getUnits(hours, "hour", "hours");
// } else {
// return getUnits(hours / 24, "day", "days");
// }
// }
//
// private static String getUnits(int amount, String unitName, String unitNamePlural) {
// if (amount == 1) return String.format("1 %s", unitName);
// return String.format(Locale.getDefault(), "%d %s", amount, unitNamePlural);
// }
//
// private static int roundTo(int in, int precision) {
// return precision * ((int) Math.floor(in / (1.0 * precision)));
// }
// }
// Path: app/src/main/java/com/futurice/android/reservator/model/Room.java
import java.io.Serializable;
import java.util.ArrayList;
import java.util.Calendar;
import java.util.Collections;
import java.util.List;
import java.util.Vector;
import com.futurice.android.reservator.common.Helpers;
}
/**
* Prerequisite: isFree
*
* @return true if room is continuously free now and for the rest of the day
*/
public boolean isFreeRestOfDay() {
DateTime now = new DateTime();
DateTime max = now.add(Calendar.DAY_OF_YEAR, 1).stripTime();
TimeSpan restOfDay = new TimeSpan(now, max);
for (Reservation r : reservations) {
if (r.getTimeSpan().intersects(restOfDay)) return false;
if (r.getStartTime().after(max)) return true;
}
return true;
}
public String getStatusText() {
if (this.isFree()) {
int freeMinutes = this.minutesFreeFromNow();
if (freeMinutes > FREE_THRESHOLD_MINUTES) {
return "Free";
} else if (freeMinutes < RESERVED_THRESHOLD_MINUTES) {
return "Reserved";
} else { | return "Free for " + Helpers.humanizeTimeSpan(freeMinutes); |
futurice/meeting-room-tablet | app/src/main/java/com/futurice/android/reservator/model/CachedDataProxy.java | // Path: app/src/main/java/com/futurice/android/reservator/common/CacheMap.java
// public class CacheMap<K, V> {
// private final HashMap<K, Bucket> map;
//
// public CacheMap() {
// this.map = new HashMap<K, Bucket>();
// }
//
// public V get(K key) {
// Bucket b = map.get(key);
//
// if (b == null || b.getExpireMillis() < System.currentTimeMillis()) {
// return null;
// } else {
// return b.getValue();
// }
// }
//
// public void put(K key, V value, long duration) {
// map.put(key, new Bucket(value, System.currentTimeMillis() + duration));
// }
//
// public void remove(K key) {
// map.remove(key);
// }
//
// public void clear() {
// this.map.clear();
// }
//
// private class Bucket {
// private long expireAt;
// private V value;
//
// public Bucket(V value, long expireAt) {
// this.value = value;
// this.expireAt = expireAt;
// }
//
// public V getValue() {
// return value;
// }
//
// public long getExpireMillis() {
// return expireAt;
// }
// }
// }
| import java.util.Vector;
import android.util.Log;
import com.futurice.android.reservator.common.CacheMap; | package com.futurice.android.reservator.model;
public class CachedDataProxy extends DataProxy {
// private static final long CACHE_ROOMS_FOR = 3600*1000; // 1 hour
private static final long CACHE_RESERVATION_FOR = 60 * 1000; // 1 minute
private final DataProxy dataProxy; | // Path: app/src/main/java/com/futurice/android/reservator/common/CacheMap.java
// public class CacheMap<K, V> {
// private final HashMap<K, Bucket> map;
//
// public CacheMap() {
// this.map = new HashMap<K, Bucket>();
// }
//
// public V get(K key) {
// Bucket b = map.get(key);
//
// if (b == null || b.getExpireMillis() < System.currentTimeMillis()) {
// return null;
// } else {
// return b.getValue();
// }
// }
//
// public void put(K key, V value, long duration) {
// map.put(key, new Bucket(value, System.currentTimeMillis() + duration));
// }
//
// public void remove(K key) {
// map.remove(key);
// }
//
// public void clear() {
// this.map.clear();
// }
//
// private class Bucket {
// private long expireAt;
// private V value;
//
// public Bucket(V value, long expireAt) {
// this.value = value;
// this.expireAt = expireAt;
// }
//
// public V getValue() {
// return value;
// }
//
// public long getExpireMillis() {
// return expireAt;
// }
// }
// }
// Path: app/src/main/java/com/futurice/android/reservator/model/CachedDataProxy.java
import java.util.Vector;
import android.util.Log;
import com.futurice.android.reservator.common.CacheMap;
package com.futurice.android.reservator.model;
public class CachedDataProxy extends DataProxy {
// private static final long CACHE_ROOMS_FOR = 3600*1000; // 1 hour
private static final long CACHE_RESERVATION_FOR = 60 * 1000; // 1 minute
private final DataProxy dataProxy; | private final CacheMap<String, Vector<Reservation>> reservationCache; |
Daskiworks/ghwatch | app/src/main/java/com/daskiworks/ghwatch/ListOfNotificationsByRepositoriesFilterDialog.java | // Path: app/src/main/java/com/daskiworks/ghwatch/model/NotifCount.java
// public class NotifCount {
//
// public String title;
// public int count = 0;
//
// }
| import com.daskiworks.ghwatch.model.NotificationStreamViewData;
import android.app.Dialog;
import androidx.annotation.NonNull;
import com.google.android.material.bottomsheet.BottomSheetBehavior;
import com.google.android.material.bottomsheet.BottomSheetDialog;
import com.google.android.material.bottomsheet.BottomSheetDialogFragment;
import android.view.MotionEvent;
import android.view.View;
import android.view.ViewTreeObserver;
import android.widget.AdapterView;
import android.widget.FrameLayout;
import android.widget.ImageButton;
import android.widget.ListView;
import android.widget.Toast;
import com.daskiworks.ghwatch.model.NotifCount; | } else {
resetButton.setOnClickListener(new View.OnClickListener() {
@Override
public void onClick(View v) {
getMainActivity().setFilterByRepository(null);
dismiss();
}
});
//long press tooltip!
resetButton.setOnLongClickListener(new View.OnLongClickListener() {
@Override
public boolean onLongClick(View view) {
Toast.makeText(getContext(), view.getContentDescription(), Toast.LENGTH_SHORT).show();
return true;
}
});
}
ActivityTracker.sendView(getActivity(), TAG);
}
protected MainActivity getMainActivity() {
return (MainActivity) getActivity();
}
private class RepositoriesListItemClickListener implements ListView.OnItemClickListener {
@Override
public void onItemClick(AdapterView<?> parent, View view, int position, long id) {
if (repositoriesListView != null) { | // Path: app/src/main/java/com/daskiworks/ghwatch/model/NotifCount.java
// public class NotifCount {
//
// public String title;
// public int count = 0;
//
// }
// Path: app/src/main/java/com/daskiworks/ghwatch/ListOfNotificationsByRepositoriesFilterDialog.java
import com.daskiworks.ghwatch.model.NotificationStreamViewData;
import android.app.Dialog;
import androidx.annotation.NonNull;
import com.google.android.material.bottomsheet.BottomSheetBehavior;
import com.google.android.material.bottomsheet.BottomSheetDialog;
import com.google.android.material.bottomsheet.BottomSheetDialogFragment;
import android.view.MotionEvent;
import android.view.View;
import android.view.ViewTreeObserver;
import android.widget.AdapterView;
import android.widget.FrameLayout;
import android.widget.ImageButton;
import android.widget.ListView;
import android.widget.Toast;
import com.daskiworks.ghwatch.model.NotifCount;
} else {
resetButton.setOnClickListener(new View.OnClickListener() {
@Override
public void onClick(View v) {
getMainActivity().setFilterByRepository(null);
dismiss();
}
});
//long press tooltip!
resetButton.setOnLongClickListener(new View.OnLongClickListener() {
@Override
public boolean onLongClick(View view) {
Toast.makeText(getContext(), view.getContentDescription(), Toast.LENGTH_SHORT).show();
return true;
}
});
}
ActivityTracker.sendView(getActivity(), TAG);
}
protected MainActivity getMainActivity() {
return (MainActivity) getActivity();
}
private class RepositoriesListItemClickListener implements ListView.OnItemClickListener {
@Override
public void onItemClick(AdapterView<?> parent, View view, int position, long id) {
if (repositoriesListView != null) { | NotifCount nc = (NotifCount) repositoriesListAdapter.getItem(position); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptTextComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptTextModule.java
// @Module
// public class EncryptTextModule {
// @Provides
// @ActivityScope
// public EncryptTextViewModel provideEncryptTextViewModel(Zerokit zerokit, EventBus eventBus) {
// return new EncryptTextViewModel(zerokit, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
| import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.module.EncryptTextModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptTextModule.java
// @Module
// public class EncryptTextModule {
// @Provides
// @ActivityScope
// public EncryptTextViewModel provideEncryptTextViewModel(Zerokit zerokit, EventBus eventBus) {
// return new EncryptTextViewModel(zerokit, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptTextComponent.java
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.module.EncryptTextModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | EncryptTextModule.class |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptTextComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptTextModule.java
// @Module
// public class EncryptTextModule {
// @Provides
// @ActivityScope
// public EncryptTextViewModel provideEncryptTextViewModel(Zerokit zerokit, EventBus eventBus) {
// return new EncryptTextViewModel(zerokit, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
| import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.module.EncryptTextModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
EncryptTextModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface EncryptTextComponent { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptTextModule.java
// @Module
// public class EncryptTextModule {
// @Provides
// @ActivityScope
// public EncryptTextViewModel provideEncryptTextViewModel(Zerokit zerokit, EventBus eventBus) {
// return new EncryptTextViewModel(zerokit, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptTextComponent.java
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.module.EncryptTextModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
EncryptTextModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface EncryptTextComponent { | void inject(EncryptTextFragment fragment); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptTextComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptTextModule.java
// @Module
// public class EncryptTextModule {
// @Provides
// @ActivityScope
// public EncryptTextViewModel provideEncryptTextViewModel(Zerokit zerokit, EventBus eventBus) {
// return new EncryptTextViewModel(zerokit, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
| import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.module.EncryptTextModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
EncryptTextModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface EncryptTextComponent {
void inject(EncryptTextFragment fragment); | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptTextModule.java
// @Module
// public class EncryptTextModule {
// @Provides
// @ActivityScope
// public EncryptTextViewModel provideEncryptTextViewModel(Zerokit zerokit, EventBus eventBus) {
// return new EncryptTextViewModel(zerokit, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptTextComponent.java
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.module.EncryptTextModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
EncryptTextModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface EncryptTextComponent {
void inject(EncryptTextFragment fragment); | EncryptTextViewModel viewmodel(); |
tresorit/ZeroKit-Android-SDK | zerokit/src/main/java/com/tresorit/zerokit/ZerokitInitializer.java | // Path: zerokit/src/main/java/com/tresorit/zerokit/Zerokit.java
// public static final String API_ROOT = "com.tresorit.zerokitsdk.API_ROOT";
| import android.content.ContentProvider;
import android.content.ContentValues;
import android.content.Context;
import android.content.pm.PackageManager;
import android.database.Cursor;
import android.net.Uri;
import android.support.annotation.NonNull;
import android.support.annotation.Nullable;
import static com.tresorit.zerokit.Zerokit.API_ROOT; | package com.tresorit.zerokit;
public class ZerokitInitializer extends ContentProvider {
@Override
public boolean onCreate() {
try {
Context context = getContext(); | // Path: zerokit/src/main/java/com/tresorit/zerokit/Zerokit.java
// public static final String API_ROOT = "com.tresorit.zerokitsdk.API_ROOT";
// Path: zerokit/src/main/java/com/tresorit/zerokit/ZerokitInitializer.java
import android.content.ContentProvider;
import android.content.ContentValues;
import android.content.Context;
import android.content.pm.PackageManager;
import android.database.Cursor;
import android.net.Uri;
import android.support.annotation.NonNull;
import android.support.annotation.Nullable;
import static com.tresorit.zerokit.Zerokit.API_ROOT;
package com.tresorit.zerokit;
public class ZerokitInitializer extends ContentProvider {
@Override
public boolean onCreate() {
try {
Context context = getContext(); | String url = context.getPackageManager().getApplicationInfo(context.getPackageName(), PackageManager.GET_META_DATA).metaData.getString(API_ROOT); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/RegistrationComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignUpFragment.java
// public class SignUpFragment extends ComponentControllerFragment<RegistrationComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// RegistrationViewModel registrationViewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentRegistrationBinding binding = FragmentRegistrationBinding.inflate(inflater, container, false);
// binding.setViewmodel(registrationViewModel);
// return binding.getRoot();
// }
//
//
// @Override
// protected RegistrationComponent onCreateNonConfigurationComponent() {
// return DaggerRegistrationComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/RegistrationModule.java
// @Module
// public class RegistrationModule {
//
// @Provides
// @ActivityScope
// public RegistrationViewModel provideRegistrationViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventbus, SharedPreferences sharedPreferences, Context context) {
// return new RegistrationViewModel(zerokit, adminApi, eventbus, sharedPreferences, context.getResources());
// }
// }
| import com.tresorit.zerokitsdk.fragment.SignUpFragment;
import com.tresorit.zerokitsdk.module.RegistrationModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignUpFragment.java
// public class SignUpFragment extends ComponentControllerFragment<RegistrationComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// RegistrationViewModel registrationViewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentRegistrationBinding binding = FragmentRegistrationBinding.inflate(inflater, container, false);
// binding.setViewmodel(registrationViewModel);
// return binding.getRoot();
// }
//
//
// @Override
// protected RegistrationComponent onCreateNonConfigurationComponent() {
// return DaggerRegistrationComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/RegistrationModule.java
// @Module
// public class RegistrationModule {
//
// @Provides
// @ActivityScope
// public RegistrationViewModel provideRegistrationViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventbus, SharedPreferences sharedPreferences, Context context) {
// return new RegistrationViewModel(zerokit, adminApi, eventbus, sharedPreferences, context.getResources());
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/RegistrationComponent.java
import com.tresorit.zerokitsdk.fragment.SignUpFragment;
import com.tresorit.zerokitsdk.module.RegistrationModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | RegistrationModule.class |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/RegistrationComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignUpFragment.java
// public class SignUpFragment extends ComponentControllerFragment<RegistrationComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// RegistrationViewModel registrationViewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentRegistrationBinding binding = FragmentRegistrationBinding.inflate(inflater, container, false);
// binding.setViewmodel(registrationViewModel);
// return binding.getRoot();
// }
//
//
// @Override
// protected RegistrationComponent onCreateNonConfigurationComponent() {
// return DaggerRegistrationComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/RegistrationModule.java
// @Module
// public class RegistrationModule {
//
// @Provides
// @ActivityScope
// public RegistrationViewModel provideRegistrationViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventbus, SharedPreferences sharedPreferences, Context context) {
// return new RegistrationViewModel(zerokit, adminApi, eventbus, sharedPreferences, context.getResources());
// }
// }
| import com.tresorit.zerokitsdk.fragment.SignUpFragment;
import com.tresorit.zerokitsdk.module.RegistrationModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
RegistrationModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface RegistrationComponent { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignUpFragment.java
// public class SignUpFragment extends ComponentControllerFragment<RegistrationComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// RegistrationViewModel registrationViewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentRegistrationBinding binding = FragmentRegistrationBinding.inflate(inflater, container, false);
// binding.setViewmodel(registrationViewModel);
// return binding.getRoot();
// }
//
//
// @Override
// protected RegistrationComponent onCreateNonConfigurationComponent() {
// return DaggerRegistrationComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/RegistrationModule.java
// @Module
// public class RegistrationModule {
//
// @Provides
// @ActivityScope
// public RegistrationViewModel provideRegistrationViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventbus, SharedPreferences sharedPreferences, Context context) {
// return new RegistrationViewModel(zerokit, adminApi, eventbus, sharedPreferences, context.getResources());
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/RegistrationComponent.java
import com.tresorit.zerokitsdk.fragment.SignUpFragment;
import com.tresorit.zerokitsdk.module.RegistrationModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
RegistrationModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface RegistrationComponent { | void inject(SignUpFragment fragment); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/module/ApplicationModule.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
| import android.content.Context;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.scopes.ApplicationScope;
import dagger.Module;
import dagger.Provides; | package com.tresorit.zerokitsdk.module;
@Module
public class ApplicationModule {
| // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/ApplicationModule.java
import android.content.Context;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.scopes.ApplicationScope;
import dagger.Module;
import dagger.Provides;
package com.tresorit.zerokitsdk.module;
@Module
public class ApplicationModule {
| private final ZerokitApplication application; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
| import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java
import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | PagerModule.class, |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
| import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java
import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent { | void inject(EncryptPagerAdapter fragment); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
| import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent {
void inject(EncryptPagerAdapter fragment);
| // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java
import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent {
void inject(EncryptPagerAdapter fragment);
| CreateTresorFragment createTresorFragment(); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
| import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent {
void inject(EncryptPagerAdapter fragment);
CreateTresorFragment createTresorFragment(); | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java
import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent {
void inject(EncryptPagerAdapter fragment);
CreateTresorFragment createTresorFragment(); | EncryptTextFragment encryptTextFragment(); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
| import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent {
void inject(EncryptPagerAdapter fragment);
CreateTresorFragment createTresorFragment();
EncryptTextFragment encryptTextFragment(); | // Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
// public class EncryptPagerAdapter extends FragmentPagerAdapter {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorFragment createTresorFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// EncryptTextFragment encryptTextFragment;
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// ShareTresorFragment shareTresorFragment;
//
//
// public EncryptPagerAdapter(Context context, FragmentManager fm) {
// super(fm);
// DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this);
// }
//
// @Override
// public Fragment getItem(int position) {
// switch (position){
// case 0:
// return createTresorFragment;
// case 1:
// return encryptTextFragment;
// case 2:
// return shareTresorFragment;
// default:
// return new Fragment();
// }
// }
//
// @Override
// public int getCount() {
// return 3;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/PagerModule.java
// @Module
// public class PagerModule {
//
// @Provides
// @ActivityScope
// public CreateTresorFragment provideCreateTresorFragment() {
// return new CreateTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public ShareTresorFragment provideShareTresorFragment() {
// return new ShareTresorFragment();
// }
//
// @Provides
// @ActivityScope
// public EncryptTextFragment provideEncryptTextFragment() {
// return new EncryptTextFragment();
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/PagerComponent.java
import com.tresorit.zerokitsdk.adapter.EncryptPagerAdapter;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import com.tresorit.zerokitsdk.module.PagerModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
PagerModule.class,
},
dependencies = {
ApplicationComponent.class
}
)
public interface PagerComponent extends ApplicationComponent {
void inject(EncryptPagerAdapter fragment);
CreateTresorFragment createTresorFragment();
EncryptTextFragment encryptTextFragment(); | ShareTresorFragment shareTresorFragment(); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/module/SignInModule.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
| import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import dagger.Module;
import dagger.Provides; | package com.tresorit.zerokitsdk.module;
@Module
public class SignInModule {
@Provides
@ActivityScope | // Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/SignInModule.java
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import dagger.Module;
import dagger.Provides;
package com.tresorit.zerokitsdk.module;
@Module
public class SignInModule {
@Provides
@ActivityScope | public SignInViewModel provideSignInViewModel(EventBus eventBus) { |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerEncryptTextComponent;
import com.tresorit.zerokitsdk.databinding.FragmentEncryptTextBinding;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class EncryptTextFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerEncryptTextComponent;
import com.tresorit.zerokitsdk.databinding.FragmentEncryptTextBinding;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class EncryptTextFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject | EncryptTextViewModel viewModel; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerEncryptTextComponent;
import com.tresorit.zerokitsdk.databinding.FragmentEncryptTextBinding;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class EncryptTextFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EncryptTextViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptTextViewModel.java
// public class EncryptTextViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerCopy;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressEncrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> encryptClicked;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textOriginal;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public EncryptTextViewModel(Zerokit zerokit, final EventBus eventBus) {
// this.zerokit = zerokit;
//
// this.inProgressEncrypt = new ObservableField<>(false);
// this.inProgressDecrypt = new ObservableField<>(false);
// this.encryptClicked = new ObservableField<>(false);
// this.textOriginal = new ObservableField<>();
// this.textEncrypted = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerEncrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// encryptClicked.set(true);
// encrypt(tresorId, textOriginal.get());
// }
// };
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// this.clickListenerCopy = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// eventBus.post(new CopyEncryptedTextMessage(textEncrypted.get()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void encrypt(String tresorId, String text) {
// inProgressEncrypt.set(true);
// zerokit.encrypt(tresorId, text).enqueue(new Action<String>() {
// @Override
// public void call(String encryptedText) {
// inProgressEncrypt.set(false);
// textEncrypted.set(encryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// inProgressEncrypt.set(false);
// }
// });
// }
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText) {
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerEncryptTextComponent;
import com.tresorit.zerokitsdk.databinding.FragmentEncryptTextBinding;
import com.tresorit.zerokitsdk.viewmodel.EncryptTextViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class EncryptTextFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EncryptTextViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { | DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/DecryptFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/DecryptViewModel.java
// public class DecryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
//
// private final Zerokit zerokit;
//
// @Inject
// public DecryptViewModel(Zerokit zerokit) {
// this.zerokit = zerokit;
//
// this.inProgressDecrypt = new ObservableField<>(false);
// this.textEncrypted = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// }
//
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText){
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerDecryptComponent;
import com.tresorit.zerokitsdk.databinding.FragmentDecryptBinding;
import com.tresorit.zerokitsdk.viewmodel.DecryptViewModel;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class DecryptFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/DecryptViewModel.java
// public class DecryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
//
// private final Zerokit zerokit;
//
// @Inject
// public DecryptViewModel(Zerokit zerokit) {
// this.zerokit = zerokit;
//
// this.inProgressDecrypt = new ObservableField<>(false);
// this.textEncrypted = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// }
//
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText){
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/DecryptFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerDecryptComponent;
import com.tresorit.zerokitsdk.databinding.FragmentDecryptBinding;
import com.tresorit.zerokitsdk.viewmodel.DecryptViewModel;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class DecryptFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject | DecryptViewModel viewModel; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/DecryptFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/DecryptViewModel.java
// public class DecryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
//
// private final Zerokit zerokit;
//
// @Inject
// public DecryptViewModel(Zerokit zerokit) {
// this.zerokit = zerokit;
//
// this.inProgressDecrypt = new ObservableField<>(false);
// this.textEncrypted = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// }
//
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText){
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerDecryptComponent;
import com.tresorit.zerokitsdk.databinding.FragmentDecryptBinding;
import com.tresorit.zerokitsdk.viewmodel.DecryptViewModel;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class DecryptFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject
DecryptViewModel viewModel;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/DecryptViewModel.java
// public class DecryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgressDecrypt;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textEncrypted;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textDecrypted;
//
// private final Zerokit zerokit;
//
// @Inject
// public DecryptViewModel(Zerokit zerokit) {
// this.zerokit = zerokit;
//
// this.inProgressDecrypt = new ObservableField<>(false);
// this.textEncrypted = new ObservableField<>();
// this.textDecrypted = new ObservableField<>();
// this.clickListenerDecrypt = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// decrypt(textEncrypted.get());
// }
// };
// }
//
//
// @SuppressWarnings("WeakerAccess")
// void decrypt(String cipherText){
// inProgressDecrypt.set(true);
// zerokit.decrypt(cipherText).enqueue(new Action<String>() {
// @Override
// public void call(String decryptedText) {
// inProgressDecrypt.set(false);
// textDecrypted.set(decryptedText);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseError) {
// inProgressDecrypt.set(false);
// textDecrypted.set("");
// }
// });
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/DecryptFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerDecryptComponent;
import com.tresorit.zerokitsdk.databinding.FragmentDecryptBinding;
import com.tresorit.zerokitsdk.viewmodel.DecryptViewModel;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class DecryptFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject
DecryptViewModel viewModel;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) { | DaggerDecryptComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/component/ApplicationComponent.java
// @ApplicationScope
// @Component(
// modules = {
// ApplicationModule.class,
// EventBusModule.class,
// AdminApiModule.class,
// ZerokitSdkModule.class,
// SharedPreferencesModule.class
// }
// )
// public interface ApplicationComponent {
// Context context();
// EventBus eventbus();
// AdminApi adminApi();
// Zerokit zerokit();
// SharedPreferences sharedpreferences();
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/AdminApiModule.java
// @Module
// public class AdminApiModule {
//
// public AdminApiModule(String host, String cliendId) {
// AdminApi.init(host, cliendId);
// }
//
// @Provides
// @ApplicationScope
// public AdminApi provideAdminApi(){
// return AdminApi.getInstance();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/ApplicationModule.java
// @Module
// public class ApplicationModule {
//
// private final ZerokitApplication application;
//
// public ApplicationModule(ZerokitApplication application) {
// this.application = application;
// }
//
// @Provides
// @ApplicationScope
// public Context provideContext() {
// return application;
// }
// }
| import android.app.Application;
import android.content.Context;
import com.tresorit.zerokitsdk.component.ApplicationComponent;
import com.tresorit.zerokitsdk.component.DaggerApplicationComponent;
import com.tresorit.zerokitsdk.module.AdminApiModule;
import com.tresorit.zerokitsdk.module.ApplicationModule; | package com.tresorit.zerokitsdk;
public class ZerokitApplication extends Application {
private ApplicationComponent component;
public static ZerokitApplication get(Context context) {
return (ZerokitApplication) context.getApplicationContext();
}
@Override
public void onCreate() {
super.onCreate();
component = DaggerApplicationComponent.builder() | // Path: sample/src/main/java/com/tresorit/zerokitsdk/component/ApplicationComponent.java
// @ApplicationScope
// @Component(
// modules = {
// ApplicationModule.class,
// EventBusModule.class,
// AdminApiModule.class,
// ZerokitSdkModule.class,
// SharedPreferencesModule.class
// }
// )
// public interface ApplicationComponent {
// Context context();
// EventBus eventbus();
// AdminApi adminApi();
// Zerokit zerokit();
// SharedPreferences sharedpreferences();
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/AdminApiModule.java
// @Module
// public class AdminApiModule {
//
// public AdminApiModule(String host, String cliendId) {
// AdminApi.init(host, cliendId);
// }
//
// @Provides
// @ApplicationScope
// public AdminApi provideAdminApi(){
// return AdminApi.getInstance();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/ApplicationModule.java
// @Module
// public class ApplicationModule {
//
// private final ZerokitApplication application;
//
// public ApplicationModule(ZerokitApplication application) {
// this.application = application;
// }
//
// @Provides
// @ApplicationScope
// public Context provideContext() {
// return application;
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
import android.app.Application;
import android.content.Context;
import com.tresorit.zerokitsdk.component.ApplicationComponent;
import com.tresorit.zerokitsdk.component.DaggerApplicationComponent;
import com.tresorit.zerokitsdk.module.AdminApiModule;
import com.tresorit.zerokitsdk.module.ApplicationModule;
package com.tresorit.zerokitsdk;
public class ZerokitApplication extends Application {
private ApplicationComponent component;
public static ZerokitApplication get(Context context) {
return (ZerokitApplication) context.getApplicationContext();
}
@Override
public void onCreate() {
super.onCreate();
component = DaggerApplicationComponent.builder() | .applicationModule(new ApplicationModule(this)) |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/component/ApplicationComponent.java
// @ApplicationScope
// @Component(
// modules = {
// ApplicationModule.class,
// EventBusModule.class,
// AdminApiModule.class,
// ZerokitSdkModule.class,
// SharedPreferencesModule.class
// }
// )
// public interface ApplicationComponent {
// Context context();
// EventBus eventbus();
// AdminApi adminApi();
// Zerokit zerokit();
// SharedPreferences sharedpreferences();
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/AdminApiModule.java
// @Module
// public class AdminApiModule {
//
// public AdminApiModule(String host, String cliendId) {
// AdminApi.init(host, cliendId);
// }
//
// @Provides
// @ApplicationScope
// public AdminApi provideAdminApi(){
// return AdminApi.getInstance();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/ApplicationModule.java
// @Module
// public class ApplicationModule {
//
// private final ZerokitApplication application;
//
// public ApplicationModule(ZerokitApplication application) {
// this.application = application;
// }
//
// @Provides
// @ApplicationScope
// public Context provideContext() {
// return application;
// }
// }
| import android.app.Application;
import android.content.Context;
import com.tresorit.zerokitsdk.component.ApplicationComponent;
import com.tresorit.zerokitsdk.component.DaggerApplicationComponent;
import com.tresorit.zerokitsdk.module.AdminApiModule;
import com.tresorit.zerokitsdk.module.ApplicationModule; | package com.tresorit.zerokitsdk;
public class ZerokitApplication extends Application {
private ApplicationComponent component;
public static ZerokitApplication get(Context context) {
return (ZerokitApplication) context.getApplicationContext();
}
@Override
public void onCreate() {
super.onCreate();
component = DaggerApplicationComponent.builder()
.applicationModule(new ApplicationModule(this)) | // Path: sample/src/main/java/com/tresorit/zerokitsdk/component/ApplicationComponent.java
// @ApplicationScope
// @Component(
// modules = {
// ApplicationModule.class,
// EventBusModule.class,
// AdminApiModule.class,
// ZerokitSdkModule.class,
// SharedPreferencesModule.class
// }
// )
// public interface ApplicationComponent {
// Context context();
// EventBus eventbus();
// AdminApi adminApi();
// Zerokit zerokit();
// SharedPreferences sharedpreferences();
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/AdminApiModule.java
// @Module
// public class AdminApiModule {
//
// public AdminApiModule(String host, String cliendId) {
// AdminApi.init(host, cliendId);
// }
//
// @Provides
// @ApplicationScope
// public AdminApi provideAdminApi(){
// return AdminApi.getInstance();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/ApplicationModule.java
// @Module
// public class ApplicationModule {
//
// private final ZerokitApplication application;
//
// public ApplicationModule(ZerokitApplication application) {
// this.application = application;
// }
//
// @Provides
// @ApplicationScope
// public Context provideContext() {
// return application;
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
import android.app.Application;
import android.content.Context;
import com.tresorit.zerokitsdk.component.ApplicationComponent;
import com.tresorit.zerokitsdk.component.DaggerApplicationComponent;
import com.tresorit.zerokitsdk.module.AdminApiModule;
import com.tresorit.zerokitsdk.module.ApplicationModule;
package com.tresorit.zerokitsdk;
public class ZerokitApplication extends Application {
private ApplicationComponent component;
public static ZerokitApplication get(Context context) {
return (ZerokitApplication) context.getApplicationContext();
}
@Override
public void onCreate() {
super.onCreate();
component = DaggerApplicationComponent.builder()
.applicationModule(new ApplicationModule(this)) | .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID)) |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/ShareTresorViewModel.java
// public class ShareTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userId;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> sharedWithUserId;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public ShareTresorViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
//
// this.inProgress = new ObservableField<>(false);
// this.userId = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.sharedWithUserId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// shareTresor(tresorId, userId.get());
// }
// };
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void shareTresor(final String tresorId, final String userName) {
// inProgress.set(true);
// sharedWithUserId.set("");
// this.adminApi.getUserId(userName).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.shareTresor(tresorId, userId).enqueue(new Action<String>() {
// @Override
// public void call(String shareId) {
// adminApi.sharedTresor(shareId).enqueue(new Action<Void>() {
// @Override
// public void call(Void result) {
// sharedWithUserId.set("Shared with: " + userName);
// inProgress.set(false);
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// sharedWithUserId.set("");
// }
//
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerShareTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentShareTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.ShareTresorViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class ShareTresorFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/ShareTresorViewModel.java
// public class ShareTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userId;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> sharedWithUserId;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public ShareTresorViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
//
// this.inProgress = new ObservableField<>(false);
// this.userId = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.sharedWithUserId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// shareTresor(tresorId, userId.get());
// }
// };
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void shareTresor(final String tresorId, final String userName) {
// inProgress.set(true);
// sharedWithUserId.set("");
// this.adminApi.getUserId(userName).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.shareTresor(tresorId, userId).enqueue(new Action<String>() {
// @Override
// public void call(String shareId) {
// adminApi.sharedTresor(shareId).enqueue(new Action<Void>() {
// @Override
// public void call(Void result) {
// sharedWithUserId.set("Shared with: " + userName);
// inProgress.set(false);
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// sharedWithUserId.set("");
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerShareTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentShareTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.ShareTresorViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class ShareTresorFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject | ShareTresorViewModel viewModel; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/ShareTresorViewModel.java
// public class ShareTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userId;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> sharedWithUserId;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public ShareTresorViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
//
// this.inProgress = new ObservableField<>(false);
// this.userId = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.sharedWithUserId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// shareTresor(tresorId, userId.get());
// }
// };
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void shareTresor(final String tresorId, final String userName) {
// inProgress.set(true);
// sharedWithUserId.set("");
// this.adminApi.getUserId(userName).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.shareTresor(tresorId, userId).enqueue(new Action<String>() {
// @Override
// public void call(String shareId) {
// adminApi.sharedTresor(shareId).enqueue(new Action<Void>() {
// @Override
// public void call(Void result) {
// sharedWithUserId.set("Shared with: " + userName);
// inProgress.set(false);
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// sharedWithUserId.set("");
// }
//
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerShareTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentShareTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.ShareTresorViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class ShareTresorFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
ShareTresorViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/ShareTresorViewModel.java
// public class ShareTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userId;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> textSummary;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> sharedWithUserId;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// String tresorId;
//
// @Inject
// public ShareTresorViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
//
// this.inProgress = new ObservableField<>(false);
// this.userId = new ObservableField<>();
// this.textSummary = new ObservableField<>();
// this.sharedWithUserId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// shareTresor(tresorId, userId.get());
// }
// };
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void shareTresor(final String tresorId, final String userName) {
// inProgress.set(true);
// sharedWithUserId.set("");
// this.adminApi.getUserId(userName).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.shareTresor(tresorId, userId).enqueue(new Action<String>() {
// @Override
// public void call(String shareId) {
// adminApi.sharedTresor(shareId).enqueue(new Action<Void>() {
// @Override
// public void call(Void result) {
// sharedWithUserId.set("Shared with: " + userName);
// inProgress.set(false);
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(CreateTresorFinishedMessage message) {
// tresorId = message.getTresorId();
// textSummary.set("Tresor ID: " + message.getTresorId());
// sharedWithUserId.set("");
// }
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerShareTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentShareTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.ShareTresorViewModel;
import org.greenrobot.eventbus.EventBus;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class ShareTresorFragment extends Fragment {
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
ShareTresorViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { | DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/LoginComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignInFragment.java
// public class SignInFragment extends ComponentControllerFragment<LoginComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// LoginViewModel loginViewModel;
//
// @Override
// protected LoginComponent onCreateNonConfigurationComponent() {
// return DaggerLoginComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentLoginBinding binding = FragmentLoginBinding.inflate(inflater, container, false);
// binding.setViewmodel(loginViewModel);
// return binding.getRoot();
// }
//
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/LoginModule.java
// @Module
// public class LoginModule {
// @Provides
// @ActivityScope
// public LoginViewModel provideLoginViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventBus) {
// return new LoginViewModel(zerokit, adminApi, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/LoginViewModel.java
// public class LoginViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userName;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> passwordError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> usernameError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerLogin;
// @SuppressWarnings("WeakerAccess")
// public final View.OnFocusChangeListener focusChangeListener;
//
// @SuppressWarnings("WeakerAccess")
// public final PasswordEditText.PasswordExporter passwordExporter;
//
// @SuppressWarnings("WeakerAccess")
// final Zerokit zerokit;
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// @Inject
// public LoginViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
// this.passwordExporter = new PasswordEditText.PasswordExporter();
//
// this.clickListenerLogin = new View.OnClickListener() {
// @Override
// public void onClick(View view) {
// attemptLogin();
// }
// };
//
// userName = new ObservableField<>("");
// passwordError = new ObservableField<>("");
// usernameError = new ObservableField<>("");
// inProgress = new ObservableField<>(false);
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// focusChangeListener = new View.OnFocusChangeListener() {
// @Override
// public void onFocusChange(View v, boolean hasFocus) {
// passwordError.set("");
// usernameError.set("");
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void attemptLogin() {
// if (TextUtils.isEmpty(userName.get())) usernameError.set("Required");
// else if (passwordExporter.isEmpty()) passwordError.set("Required");
// else login(userName.get(), passwordExporter);
// }
//
// private void login(String username, final PasswordEditText.PasswordExporter passwordExporter) {
// inProgress.set(true);
// adminApi.getUserId(username).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.login(userId, passwordExporter).enqueue(new Action<ResponseZerokitLogin>() {
// @Override
// public void call(ResponseZerokitLogin responseLogin) {
// zerokit.getIdentityTokens(adminApi.getClientId()).enqueue(new Action<IdentityTokens>() {
// @Override
// public void call(IdentityTokens identityTokens) {
// adminApi.login(identityTokens.getAuthorizationCode()).enqueue(new Action<ResponseAdminApiLoginByCode>() {
// @Override
// public void call(ResponseAdminApiLoginByCode responseAdminApiLoginByCode) {
// adminApi.setToken(responseAdminApiLoginByCode.getId());
// inProgress.set(false);
// eventBus.post(new LoginFinisedMessage());
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
// }
| import com.tresorit.zerokitsdk.fragment.SignInFragment;
import com.tresorit.zerokitsdk.module.LoginModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.LoginViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignInFragment.java
// public class SignInFragment extends ComponentControllerFragment<LoginComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// LoginViewModel loginViewModel;
//
// @Override
// protected LoginComponent onCreateNonConfigurationComponent() {
// return DaggerLoginComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentLoginBinding binding = FragmentLoginBinding.inflate(inflater, container, false);
// binding.setViewmodel(loginViewModel);
// return binding.getRoot();
// }
//
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/LoginModule.java
// @Module
// public class LoginModule {
// @Provides
// @ActivityScope
// public LoginViewModel provideLoginViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventBus) {
// return new LoginViewModel(zerokit, adminApi, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/LoginViewModel.java
// public class LoginViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userName;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> passwordError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> usernameError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerLogin;
// @SuppressWarnings("WeakerAccess")
// public final View.OnFocusChangeListener focusChangeListener;
//
// @SuppressWarnings("WeakerAccess")
// public final PasswordEditText.PasswordExporter passwordExporter;
//
// @SuppressWarnings("WeakerAccess")
// final Zerokit zerokit;
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// @Inject
// public LoginViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
// this.passwordExporter = new PasswordEditText.PasswordExporter();
//
// this.clickListenerLogin = new View.OnClickListener() {
// @Override
// public void onClick(View view) {
// attemptLogin();
// }
// };
//
// userName = new ObservableField<>("");
// passwordError = new ObservableField<>("");
// usernameError = new ObservableField<>("");
// inProgress = new ObservableField<>(false);
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// focusChangeListener = new View.OnFocusChangeListener() {
// @Override
// public void onFocusChange(View v, boolean hasFocus) {
// passwordError.set("");
// usernameError.set("");
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void attemptLogin() {
// if (TextUtils.isEmpty(userName.get())) usernameError.set("Required");
// else if (passwordExporter.isEmpty()) passwordError.set("Required");
// else login(userName.get(), passwordExporter);
// }
//
// private void login(String username, final PasswordEditText.PasswordExporter passwordExporter) {
// inProgress.set(true);
// adminApi.getUserId(username).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.login(userId, passwordExporter).enqueue(new Action<ResponseZerokitLogin>() {
// @Override
// public void call(ResponseZerokitLogin responseLogin) {
// zerokit.getIdentityTokens(adminApi.getClientId()).enqueue(new Action<IdentityTokens>() {
// @Override
// public void call(IdentityTokens identityTokens) {
// adminApi.login(identityTokens.getAuthorizationCode()).enqueue(new Action<ResponseAdminApiLoginByCode>() {
// @Override
// public void call(ResponseAdminApiLoginByCode responseAdminApiLoginByCode) {
// adminApi.setToken(responseAdminApiLoginByCode.getId());
// inProgress.set(false);
// eventBus.post(new LoginFinisedMessage());
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/LoginComponent.java
import com.tresorit.zerokitsdk.fragment.SignInFragment;
import com.tresorit.zerokitsdk.module.LoginModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.LoginViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | LoginModule.class |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/LoginComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignInFragment.java
// public class SignInFragment extends ComponentControllerFragment<LoginComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// LoginViewModel loginViewModel;
//
// @Override
// protected LoginComponent onCreateNonConfigurationComponent() {
// return DaggerLoginComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentLoginBinding binding = FragmentLoginBinding.inflate(inflater, container, false);
// binding.setViewmodel(loginViewModel);
// return binding.getRoot();
// }
//
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/LoginModule.java
// @Module
// public class LoginModule {
// @Provides
// @ActivityScope
// public LoginViewModel provideLoginViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventBus) {
// return new LoginViewModel(zerokit, adminApi, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/LoginViewModel.java
// public class LoginViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userName;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> passwordError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> usernameError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerLogin;
// @SuppressWarnings("WeakerAccess")
// public final View.OnFocusChangeListener focusChangeListener;
//
// @SuppressWarnings("WeakerAccess")
// public final PasswordEditText.PasswordExporter passwordExporter;
//
// @SuppressWarnings("WeakerAccess")
// final Zerokit zerokit;
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// @Inject
// public LoginViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
// this.passwordExporter = new PasswordEditText.PasswordExporter();
//
// this.clickListenerLogin = new View.OnClickListener() {
// @Override
// public void onClick(View view) {
// attemptLogin();
// }
// };
//
// userName = new ObservableField<>("");
// passwordError = new ObservableField<>("");
// usernameError = new ObservableField<>("");
// inProgress = new ObservableField<>(false);
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// focusChangeListener = new View.OnFocusChangeListener() {
// @Override
// public void onFocusChange(View v, boolean hasFocus) {
// passwordError.set("");
// usernameError.set("");
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void attemptLogin() {
// if (TextUtils.isEmpty(userName.get())) usernameError.set("Required");
// else if (passwordExporter.isEmpty()) passwordError.set("Required");
// else login(userName.get(), passwordExporter);
// }
//
// private void login(String username, final PasswordEditText.PasswordExporter passwordExporter) {
// inProgress.set(true);
// adminApi.getUserId(username).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.login(userId, passwordExporter).enqueue(new Action<ResponseZerokitLogin>() {
// @Override
// public void call(ResponseZerokitLogin responseLogin) {
// zerokit.getIdentityTokens(adminApi.getClientId()).enqueue(new Action<IdentityTokens>() {
// @Override
// public void call(IdentityTokens identityTokens) {
// adminApi.login(identityTokens.getAuthorizationCode()).enqueue(new Action<ResponseAdminApiLoginByCode>() {
// @Override
// public void call(ResponseAdminApiLoginByCode responseAdminApiLoginByCode) {
// adminApi.setToken(responseAdminApiLoginByCode.getId());
// inProgress.set(false);
// eventBus.post(new LoginFinisedMessage());
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
// }
| import com.tresorit.zerokitsdk.fragment.SignInFragment;
import com.tresorit.zerokitsdk.module.LoginModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.LoginViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
LoginModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface LoginComponent { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignInFragment.java
// public class SignInFragment extends ComponentControllerFragment<LoginComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// LoginViewModel loginViewModel;
//
// @Override
// protected LoginComponent onCreateNonConfigurationComponent() {
// return DaggerLoginComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentLoginBinding binding = FragmentLoginBinding.inflate(inflater, container, false);
// binding.setViewmodel(loginViewModel);
// return binding.getRoot();
// }
//
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/LoginModule.java
// @Module
// public class LoginModule {
// @Provides
// @ActivityScope
// public LoginViewModel provideLoginViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventBus) {
// return new LoginViewModel(zerokit, adminApi, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/LoginViewModel.java
// public class LoginViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userName;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> passwordError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> usernameError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerLogin;
// @SuppressWarnings("WeakerAccess")
// public final View.OnFocusChangeListener focusChangeListener;
//
// @SuppressWarnings("WeakerAccess")
// public final PasswordEditText.PasswordExporter passwordExporter;
//
// @SuppressWarnings("WeakerAccess")
// final Zerokit zerokit;
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// @Inject
// public LoginViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
// this.passwordExporter = new PasswordEditText.PasswordExporter();
//
// this.clickListenerLogin = new View.OnClickListener() {
// @Override
// public void onClick(View view) {
// attemptLogin();
// }
// };
//
// userName = new ObservableField<>("");
// passwordError = new ObservableField<>("");
// usernameError = new ObservableField<>("");
// inProgress = new ObservableField<>(false);
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// focusChangeListener = new View.OnFocusChangeListener() {
// @Override
// public void onFocusChange(View v, boolean hasFocus) {
// passwordError.set("");
// usernameError.set("");
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void attemptLogin() {
// if (TextUtils.isEmpty(userName.get())) usernameError.set("Required");
// else if (passwordExporter.isEmpty()) passwordError.set("Required");
// else login(userName.get(), passwordExporter);
// }
//
// private void login(String username, final PasswordEditText.PasswordExporter passwordExporter) {
// inProgress.set(true);
// adminApi.getUserId(username).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.login(userId, passwordExporter).enqueue(new Action<ResponseZerokitLogin>() {
// @Override
// public void call(ResponseZerokitLogin responseLogin) {
// zerokit.getIdentityTokens(adminApi.getClientId()).enqueue(new Action<IdentityTokens>() {
// @Override
// public void call(IdentityTokens identityTokens) {
// adminApi.login(identityTokens.getAuthorizationCode()).enqueue(new Action<ResponseAdminApiLoginByCode>() {
// @Override
// public void call(ResponseAdminApiLoginByCode responseAdminApiLoginByCode) {
// adminApi.setToken(responseAdminApiLoginByCode.getId());
// inProgress.set(false);
// eventBus.post(new LoginFinisedMessage());
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/LoginComponent.java
import com.tresorit.zerokitsdk.fragment.SignInFragment;
import com.tresorit.zerokitsdk.module.LoginModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.LoginViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
LoginModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface LoginComponent { | void inject(SignInFragment fragment); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/LoginComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignInFragment.java
// public class SignInFragment extends ComponentControllerFragment<LoginComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// LoginViewModel loginViewModel;
//
// @Override
// protected LoginComponent onCreateNonConfigurationComponent() {
// return DaggerLoginComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentLoginBinding binding = FragmentLoginBinding.inflate(inflater, container, false);
// binding.setViewmodel(loginViewModel);
// return binding.getRoot();
// }
//
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/LoginModule.java
// @Module
// public class LoginModule {
// @Provides
// @ActivityScope
// public LoginViewModel provideLoginViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventBus) {
// return new LoginViewModel(zerokit, adminApi, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/LoginViewModel.java
// public class LoginViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userName;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> passwordError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> usernameError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerLogin;
// @SuppressWarnings("WeakerAccess")
// public final View.OnFocusChangeListener focusChangeListener;
//
// @SuppressWarnings("WeakerAccess")
// public final PasswordEditText.PasswordExporter passwordExporter;
//
// @SuppressWarnings("WeakerAccess")
// final Zerokit zerokit;
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// @Inject
// public LoginViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
// this.passwordExporter = new PasswordEditText.PasswordExporter();
//
// this.clickListenerLogin = new View.OnClickListener() {
// @Override
// public void onClick(View view) {
// attemptLogin();
// }
// };
//
// userName = new ObservableField<>("");
// passwordError = new ObservableField<>("");
// usernameError = new ObservableField<>("");
// inProgress = new ObservableField<>(false);
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// focusChangeListener = new View.OnFocusChangeListener() {
// @Override
// public void onFocusChange(View v, boolean hasFocus) {
// passwordError.set("");
// usernameError.set("");
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void attemptLogin() {
// if (TextUtils.isEmpty(userName.get())) usernameError.set("Required");
// else if (passwordExporter.isEmpty()) passwordError.set("Required");
// else login(userName.get(), passwordExporter);
// }
//
// private void login(String username, final PasswordEditText.PasswordExporter passwordExporter) {
// inProgress.set(true);
// adminApi.getUserId(username).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.login(userId, passwordExporter).enqueue(new Action<ResponseZerokitLogin>() {
// @Override
// public void call(ResponseZerokitLogin responseLogin) {
// zerokit.getIdentityTokens(adminApi.getClientId()).enqueue(new Action<IdentityTokens>() {
// @Override
// public void call(IdentityTokens identityTokens) {
// adminApi.login(identityTokens.getAuthorizationCode()).enqueue(new Action<ResponseAdminApiLoginByCode>() {
// @Override
// public void call(ResponseAdminApiLoginByCode responseAdminApiLoginByCode) {
// adminApi.setToken(responseAdminApiLoginByCode.getId());
// inProgress.set(false);
// eventBus.post(new LoginFinisedMessage());
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
// }
| import com.tresorit.zerokitsdk.fragment.SignInFragment;
import com.tresorit.zerokitsdk.module.LoginModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.LoginViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
LoginModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface LoginComponent {
void inject(SignInFragment fragment); | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/SignInFragment.java
// public class SignInFragment extends ComponentControllerFragment<LoginComponent> {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// LoginViewModel loginViewModel;
//
// @Override
// protected LoginComponent onCreateNonConfigurationComponent() {
// return DaggerLoginComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build();
// }
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// getComponent().inject(this);
// FragmentLoginBinding binding = FragmentLoginBinding.inflate(inflater, container, false);
// binding.setViewmodel(loginViewModel);
// return binding.getRoot();
// }
//
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/LoginModule.java
// @Module
// public class LoginModule {
// @Provides
// @ActivityScope
// public LoginViewModel provideLoginViewModel(Zerokit zerokit, AdminApi adminApi, EventBus eventBus) {
// return new LoginViewModel(zerokit, adminApi, eventBus);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/LoginViewModel.java
// public class LoginViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> userName;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> passwordError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> usernameError;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListenerLogin;
// @SuppressWarnings("WeakerAccess")
// public final View.OnFocusChangeListener focusChangeListener;
//
// @SuppressWarnings("WeakerAccess")
// public final PasswordEditText.PasswordExporter passwordExporter;
//
// @SuppressWarnings("WeakerAccess")
// final Zerokit zerokit;
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
//
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
// @Inject
// public LoginViewModel(Zerokit zerokit, AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
// this.passwordExporter = new PasswordEditText.PasswordExporter();
//
// this.clickListenerLogin = new View.OnClickListener() {
// @Override
// public void onClick(View view) {
// attemptLogin();
// }
// };
//
// userName = new ObservableField<>("");
// passwordError = new ObservableField<>("");
// usernameError = new ObservableField<>("");
// inProgress = new ObservableField<>(false);
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// focusChangeListener = new View.OnFocusChangeListener() {
// @Override
// public void onFocusChange(View v, boolean hasFocus) {
// passwordError.set("");
// usernameError.set("");
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void attemptLogin() {
// if (TextUtils.isEmpty(userName.get())) usernameError.set("Required");
// else if (passwordExporter.isEmpty()) passwordError.set("Required");
// else login(userName.get(), passwordExporter);
// }
//
// private void login(String username, final PasswordEditText.PasswordExporter passwordExporter) {
// inProgress.set(true);
// adminApi.getUserId(username).enqueue(new Action<String>() {
// @Override
// public void call(String userId) {
// zerokit.login(userId, passwordExporter).enqueue(new Action<ResponseZerokitLogin>() {
// @Override
// public void call(ResponseZerokitLogin responseLogin) {
// zerokit.getIdentityTokens(adminApi.getClientId()).enqueue(new Action<IdentityTokens>() {
// @Override
// public void call(IdentityTokens identityTokens) {
// adminApi.login(identityTokens.getAuthorizationCode()).enqueue(new Action<ResponseAdminApiLoginByCode>() {
// @Override
// public void call(ResponseAdminApiLoginByCode responseAdminApiLoginByCode) {
// adminApi.setToken(responseAdminApiLoginByCode.getId());
// inProgress.set(false);
// eventBus.post(new LoginFinisedMessage());
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerSdk);
// }
// }, errorResponseHandlerAdminapi);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/LoginComponent.java
import com.tresorit.zerokitsdk.fragment.SignInFragment;
import com.tresorit.zerokitsdk.module.LoginModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.LoginViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
LoginModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface LoginComponent {
void inject(SignInFragment fragment); | LoginViewModel viewModel(); |
tresorit/ZeroKit-Android-SDK | zerokit/src/main/java/com/tresorit/zerokit/response/ResponseZerokitInternalException.java | // Path: zerokit/src/main/java/com/tresorit/zerokit/util/JSONObject.java
// public class JSONObject {
//
// private org.json.JSONObject jsonObject;
//
// public JSONObject() {
// jsonObject = new org.json.JSONObject();
// }
//
// public JSONObject(String json) {
// try {
// jsonObject = new org.json.JSONObject(json);
// } catch (JSONException e) {
// //e.printStackTrace();
// jsonObject = new org.json.JSONObject();
// }
// }
//
// public org.json.JSONObject getJSONObject(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getJSONObject(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new org.json.JSONObject();
// }
//
//
// public String getString(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getString(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return "";
// }
//
// public double getDouble(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getDouble(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public int getInt(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getInt(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public List<String> getStringArray(String name) {
// if (jsonObject != null)
// try {
// JSONArray jsonArray = jsonObject.getJSONArray(name);
// List<String> result = new ArrayList<>();
// for (int i = 0; i < jsonArray.length(); i++)
// result.add(jsonArray.getString(i));
// return result;
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new ArrayList<>();
// }
//
// public JSONObject put(String name, Object value) {
// if (jsonObject != null)
// try {
// jsonObject.put(name, value);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return this;
// }
//
// @Override
// public String toString() {
// return jsonObject != null ? jsonObject.toString() : "";
// }
// }
//
// Path: common/src/main/java/com/tresorit/zerokit/util/ZerokitJson.java
// public abstract class ZerokitJson {
//
// public abstract <T extends ZerokitJson> T parse(String json);
//
// }
| import com.tresorit.zerokit.util.JSONObject;
import com.tresorit.zerokit.util.ZerokitJson; | package com.tresorit.zerokit.response;
public class ResponseZerokitInternalException extends ZerokitJson {
private String type;
private String code;
@Override
public String toString() {
return String.format("type: %s, code: %s", type, code);
}
@SuppressWarnings("unchecked")
@Override
public ResponseZerokitInternalException parse(String json) { | // Path: zerokit/src/main/java/com/tresorit/zerokit/util/JSONObject.java
// public class JSONObject {
//
// private org.json.JSONObject jsonObject;
//
// public JSONObject() {
// jsonObject = new org.json.JSONObject();
// }
//
// public JSONObject(String json) {
// try {
// jsonObject = new org.json.JSONObject(json);
// } catch (JSONException e) {
// //e.printStackTrace();
// jsonObject = new org.json.JSONObject();
// }
// }
//
// public org.json.JSONObject getJSONObject(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getJSONObject(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new org.json.JSONObject();
// }
//
//
// public String getString(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getString(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return "";
// }
//
// public double getDouble(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getDouble(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public int getInt(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getInt(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public List<String> getStringArray(String name) {
// if (jsonObject != null)
// try {
// JSONArray jsonArray = jsonObject.getJSONArray(name);
// List<String> result = new ArrayList<>();
// for (int i = 0; i < jsonArray.length(); i++)
// result.add(jsonArray.getString(i));
// return result;
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new ArrayList<>();
// }
//
// public JSONObject put(String name, Object value) {
// if (jsonObject != null)
// try {
// jsonObject.put(name, value);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return this;
// }
//
// @Override
// public String toString() {
// return jsonObject != null ? jsonObject.toString() : "";
// }
// }
//
// Path: common/src/main/java/com/tresorit/zerokit/util/ZerokitJson.java
// public abstract class ZerokitJson {
//
// public abstract <T extends ZerokitJson> T parse(String json);
//
// }
// Path: zerokit/src/main/java/com/tresorit/zerokit/response/ResponseZerokitInternalException.java
import com.tresorit.zerokit.util.JSONObject;
import com.tresorit.zerokit.util.ZerokitJson;
package com.tresorit.zerokit.response;
public class ResponseZerokitInternalException extends ZerokitJson {
private String type;
private String code;
@Override
public String toString() {
return String.format("type: %s, code: %s", type, code);
}
@SuppressWarnings("unchecked")
@Override
public ResponseZerokitInternalException parse(String json) { | JSONObject jsonobject = new JSONObject(json); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/module/MainModule.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/MainViewModel.java
// public class MainViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
//
// @Inject
// public MainViewModel(final EventBus eventBus) {
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// eventBus.post(new TabSelectMessage(item.getItemId()));
// return true;
// }
// };
// }
// }
| import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.MainViewModel;
import org.greenrobot.eventbus.EventBus;
import dagger.Module;
import dagger.Provides; | package com.tresorit.zerokitsdk.module;
@Module
public class MainModule {
@Provides
@ActivityScope | // Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/MainViewModel.java
// public class MainViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
//
// @Inject
// public MainViewModel(final EventBus eventBus) {
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// eventBus.post(new TabSelectMessage(item.getItemId()));
// return true;
// }
// };
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/MainModule.java
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.MainViewModel;
import org.greenrobot.eventbus.EventBus;
import dagger.Module;
import dagger.Provides;
package com.tresorit.zerokitsdk.module;
@Module
public class MainModule {
@Provides
@ActivityScope | public MainViewModel provideMainViewModel(EventBus eventBus) { |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
| import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx; | package com.tresorit.zerokitsdk.activity;
public class SignInActivity extends ComponentControllerActivity<SignInComponent> {
private static final int REQ_DEFAULT = 0;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java
import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx;
package com.tresorit.zerokitsdk.activity;
public class SignInActivity extends ComponentControllerActivity<SignInComponent> {
private static final int REQ_DEFAULT = 0;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject | SignInViewModel viewModel; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
| import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx; | package com.tresorit.zerokitsdk.activity;
public class SignInActivity extends ComponentControllerActivity<SignInComponent> {
private static final int REQ_DEFAULT = 0;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
SignInViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@SuppressWarnings("WeakerAccess")
ActivitySigninBinding binding;
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
getComponent().inject(this);
binding = DataBindingUtil.setContentView(this, R.layout.activity_signin);
binding.setViewmodel(viewModel);
binding.container.getViewTreeObserver().addOnGlobalLayoutListener(new ViewTreeObserver.OnGlobalLayoutListener() {
@Override
public void onGlobalLayout() {
binding.bottomBar.post(new Runnable() {
@Override
public void run() { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java
import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx;
package com.tresorit.zerokitsdk.activity;
public class SignInActivity extends ComponentControllerActivity<SignInComponent> {
private static final int REQ_DEFAULT = 0;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
SignInViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@SuppressWarnings("WeakerAccess")
ActivitySigninBinding binding;
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
getComponent().inject(this);
binding = DataBindingUtil.setContentView(this, R.layout.activity_signin);
binding.setViewmodel(viewModel);
binding.container.getViewTreeObserver().addOnGlobalLayoutListener(new ViewTreeObserver.OnGlobalLayoutListener() {
@Override
public void onGlobalLayout() {
binding.bottomBar.post(new Runnable() {
@Override
public void run() { | binding.bottomBar.setVisibility(binding.container.getRootView().getHeight() - binding.container.getHeight() > dpToPx(SignInActivity.this, 200) ? View.GONE : View.VISIBLE); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
| import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx; | SignInViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@SuppressWarnings("WeakerAccess")
ActivitySigninBinding binding;
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
getComponent().inject(this);
binding = DataBindingUtil.setContentView(this, R.layout.activity_signin);
binding.setViewmodel(viewModel);
binding.container.getViewTreeObserver().addOnGlobalLayoutListener(new ViewTreeObserver.OnGlobalLayoutListener() {
@Override
public void onGlobalLayout() {
binding.bottomBar.post(new Runnable() {
@Override
public void run() {
binding.bottomBar.setVisibility(binding.container.getRootView().getHeight() - binding.container.getHeight() > dpToPx(SignInActivity.this, 200) ? View.GONE : View.VISIBLE);
}
});
}
});
}
@Override
protected SignInComponent onCreateNonConfigurationComponent() { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java
import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx;
SignInViewModel viewModel;
@SuppressWarnings({"WeakerAccess", "CanBeFinal"})
@Inject
EventBus eventBus;
@SuppressWarnings("WeakerAccess")
ActivitySigninBinding binding;
@Override
public void onCreate(Bundle savedInstanceState) {
super.onCreate(savedInstanceState);
getComponent().inject(this);
binding = DataBindingUtil.setContentView(this, R.layout.activity_signin);
binding.setViewmodel(viewModel);
binding.container.getViewTreeObserver().addOnGlobalLayoutListener(new ViewTreeObserver.OnGlobalLayoutListener() {
@Override
public void onGlobalLayout() {
binding.bottomBar.post(new Runnable() {
@Override
public void run() {
binding.bottomBar.setVisibility(binding.container.getRootView().getHeight() - binding.container.getHeight() > dpToPx(SignInActivity.this, 200) ? View.GONE : View.VISIBLE);
}
});
}
});
}
@Override
protected SignInComponent onCreateNonConfigurationComponent() { | return DaggerSignInComponent.builder().applicationComponent(ZerokitApplication.get(this).component()).build(); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
| import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx; | @Override
protected SignInComponent onCreateNonConfigurationComponent() {
return DaggerSignInComponent.builder().applicationComponent(ZerokitApplication.get(this).component()).build();
}
@Override
protected void onActivityResult(int requestCode, int resultCode, Intent data) {
super.onActivityResult(requestCode, resultCode, data);
switch (requestCode) {
case REQ_DEFAULT:
finish();
break;
}
}
@Override
protected void onStart() {
super.onStart();
eventBus.register(this);
}
@Override
protected void onStop() {
eventBus.unregister(this);
super.onStop();
}
@Subscribe
@SuppressWarnings("unused") | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java
import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx;
@Override
protected SignInComponent onCreateNonConfigurationComponent() {
return DaggerSignInComponent.builder().applicationComponent(ZerokitApplication.get(this).component()).build();
}
@Override
protected void onActivityResult(int requestCode, int resultCode, Intent data) {
super.onActivityResult(requestCode, resultCode, data);
switch (requestCode) {
case REQ_DEFAULT:
finish();
break;
}
}
@Override
protected void onStart() {
super.onStart();
eventBus.register(this);
}
@Override
protected void onStop() {
eventBus.unregister(this);
super.onStop();
}
@Subscribe
@SuppressWarnings("unused") | public void onEvent(ShowMessageMessage message) { |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
| import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx; | protected void onActivityResult(int requestCode, int resultCode, Intent data) {
super.onActivityResult(requestCode, resultCode, data);
switch (requestCode) {
case REQ_DEFAULT:
finish();
break;
}
}
@Override
protected void onStart() {
super.onStart();
eventBus.register(this);
}
@Override
protected void onStop() {
eventBus.unregister(this);
super.onStop();
}
@Subscribe
@SuppressWarnings("unused")
public void onEvent(ShowMessageMessage message) {
showMessage(message.getMessage());
}
@Subscribe
@SuppressWarnings("unused") | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/cache/ComponentControllerActivity.java
// public abstract class ComponentControllerActivity<C> extends ComponentCacheActivity {
//
// private final ComponentControllerDelegate<C> componentDelegate = new ComponentControllerDelegate<>();
//
// @Override
// @CallSuper
// public void onCreate(@Nullable Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// ComponentCache componentCache = this;
// componentDelegate.onCreate(componentCache, savedInstanceState, componentFactory);
// }
//
// @Override
// @CallSuper
// public void onResume() {
// super.onResume();
// componentDelegate.onResume();
// }
//
// @Override
// @CallSuper
// public void onSaveInstanceState(Bundle outState) {
// super.onSaveInstanceState(outState);
// componentDelegate.onSaveInstanceState(outState);
// }
//
// @Override
// @CallSuper
// public void onDestroy() {
// super.onDestroy();
// componentDelegate.onDestroy();
// }
//
//
// protected C getComponent() {
// return componentDelegate.getComponent();
// }
//
// protected abstract C onCreateNonConfigurationComponent();
//
// private final ComponentFactory<C> componentFactory = new ComponentFactory<C>() {
// @NonNull
// @Override
// public C createComponent() {
// return onCreateNonConfigurationComponent();
// }
// };
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/SignInComponent.java
// @ActivityScope
// @Component(
// modules = {
// SignInModule.class
// },
// dependencies = {
// ApplicationComponent.class
// }
// )
// public interface SignInComponent {
// void inject(SignInActivity activity);
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/LoginFinisedMessage.java
// public class LoginFinisedMessage {
//
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/message/ShowMessageMessage.java
// public class ShowMessageMessage {
//
// private final String message;
//
// public ShowMessageMessage(String message) {
// this.message = message;
// }
//
// public String getMessage() {
// return message;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/SignInViewModel.java
// public class SignInViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final BottomNavigationView.OnNavigationItemSelectedListener onNavigationItemSelectedListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableInt displayedChild;
//
// @Inject
// public SignInViewModel(@SuppressWarnings("UnusedParameters") EventBus eventBus) {
// displayedChild = new ObservableInt(0);
// onNavigationItemSelectedListener = new BottomNavigationView.OnNavigationItemSelectedListener() {
// @Override
// public boolean onNavigationItemSelected(@NonNull MenuItem item) {
// displayedChild.set(item.getItemId() == R.id.tab_signin ? 0 : 1);
// return true;
// }
// };
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/util/Util.java
// public static float dpToPx(Context context, float valueInDp) {
// DisplayMetrics metrics = context.getResources().getDisplayMetrics();
// return TypedValue.applyDimension(TypedValue.COMPLEX_UNIT_DIP, valueInDp, metrics);
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/activity/SignInActivity.java
import android.content.Intent;
import android.databinding.DataBindingUtil;
import android.os.Bundle;
import android.support.design.widget.Snackbar;
import android.view.View;
import android.view.ViewTreeObserver;
import com.tresorit.zerokitsdk.R;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.cache.ComponentControllerActivity;
import com.tresorit.zerokitsdk.component.DaggerSignInComponent;
import com.tresorit.zerokitsdk.component.SignInComponent;
import com.tresorit.zerokitsdk.databinding.ActivitySigninBinding;
import com.tresorit.zerokitsdk.message.LoginFinisedMessage;
import com.tresorit.zerokitsdk.message.ShowMessageMessage;
import com.tresorit.zerokitsdk.viewmodel.SignInViewModel;
import org.greenrobot.eventbus.EventBus;
import org.greenrobot.eventbus.Subscribe;
import javax.inject.Inject;
import static com.tresorit.zerokitsdk.util.Util.dpToPx;
protected void onActivityResult(int requestCode, int resultCode, Intent data) {
super.onActivityResult(requestCode, resultCode, data);
switch (requestCode) {
case REQ_DEFAULT:
finish();
break;
}
}
@Override
protected void onStart() {
super.onStart();
eventBus.register(this);
}
@Override
protected void onStop() {
eventBus.unregister(this);
super.onStop();
}
@Subscribe
@SuppressWarnings("unused")
public void onEvent(ShowMessageMessage message) {
showMessage(message.getMessage());
}
@Subscribe
@SuppressWarnings("unused") | public void onEvent(@SuppressWarnings("UnusedParameters") LoginFinisedMessage message) { |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
| import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject | CreateTresorFragment createTresorFragment; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
| import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorFragment createTresorFragment;
@SuppressWarnings("WeakerAccess")
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorFragment createTresorFragment;
@SuppressWarnings("WeakerAccess")
@Inject | EncryptTextFragment encryptTextFragment; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
| import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorFragment createTresorFragment;
@SuppressWarnings("WeakerAccess")
@Inject
EncryptTextFragment encryptTextFragment;
@SuppressWarnings("WeakerAccess")
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorFragment createTresorFragment;
@SuppressWarnings("WeakerAccess")
@Inject
EncryptTextFragment encryptTextFragment;
@SuppressWarnings("WeakerAccess")
@Inject | ShareTresorFragment shareTresorFragment; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
| import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorFragment createTresorFragment;
@SuppressWarnings("WeakerAccess")
@Inject
EncryptTextFragment encryptTextFragment;
@SuppressWarnings("WeakerAccess")
@Inject
ShareTresorFragment shareTresorFragment;
public EncryptPagerAdapter(Context context, FragmentManager fm) {
super(fm); | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
// public class CreateTresorFragment extends Fragment {
//
// @SuppressWarnings("WeakerAccess")
// @Inject
// CreateTresorViewModel viewModel;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentCreateTresorBinding binding = FragmentCreateTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptTextFragment.java
// public class EncryptTextFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptTextViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerEncryptTextComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentEncryptTextBinding binding = FragmentEncryptTextBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/ShareTresorFragment.java
// public class ShareTresorFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// ShareTresorViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) {
// DaggerShareTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this);
// FragmentShareTresorBinding binding = FragmentShareTresorBinding.inflate(inflater, container, false);
// binding.setViewmodel(viewModel);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(viewModel);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(viewModel);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/adapter/EncryptPagerAdapter.java
import android.content.Context;
import android.support.v4.app.Fragment;
import android.support.v4.app.FragmentManager;
import android.support.v4.app.FragmentPagerAdapter;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerPagerComponent;
import com.tresorit.zerokitsdk.fragment.CreateTresorFragment;
import com.tresorit.zerokitsdk.fragment.EncryptTextFragment;
import com.tresorit.zerokitsdk.fragment.ShareTresorFragment;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.adapter;
public class EncryptPagerAdapter extends FragmentPagerAdapter {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorFragment createTresorFragment;
@SuppressWarnings("WeakerAccess")
@Inject
EncryptTextFragment encryptTextFragment;
@SuppressWarnings("WeakerAccess")
@Inject
ShareTresorFragment shareTresorFragment;
public EncryptPagerAdapter(Context context, FragmentManager fm) {
super(fm); | DaggerPagerComponent.builder().applicationComponent(ZerokitApplication.get(context).component()).build().inject(this); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/RootComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/activity/RootActivity.java
// public class RootActivity extends AppCompatActivity {
//
// private static final int REQ_DEFAULT = 0;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// Zerokit zerokit;
//
// private boolean start = true;
//
// @Override
// protected void onCreate(Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// DaggerRootComponent.builder().applicationComponent(ZerokitApplication.get(this).component()).build().inject(this);
// }
//
// @Override
// protected void onNewIntent(Intent intent) {
// super.onNewIntent(intent);
// start = true;
// }
//
// @Override
// protected void onStart() {
// super.onStart();
// if (!start) finish();
// else {
// start = false;
// zerokit.whoAmI().enqueue(new Action<String>() {
// @Override
// public void call(String response) {
// if ("null".equals(response))
// startActivityForResult(new Intent(RootActivity.this, SignInActivity.class), REQ_DEFAULT);
// else
// startActivityForResult(new Intent(RootActivity.this, MainActivity.class), REQ_DEFAULT);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// Toast.makeText(RootActivity.this, responseZerokitError.getDescription(), Toast.LENGTH_SHORT).show();
// startActivityForResult(new Intent(RootActivity.this, SignInActivity.class), REQ_DEFAULT);
// }
// });
//
// }
// }
// }
| import com.tresorit.zerokitsdk.activity.RootActivity;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
dependencies = {
ApplicationComponent.class
}
)
public interface RootComponent { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/activity/RootActivity.java
// public class RootActivity extends AppCompatActivity {
//
// private static final int REQ_DEFAULT = 0;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// Zerokit zerokit;
//
// private boolean start = true;
//
// @Override
// protected void onCreate(Bundle savedInstanceState) {
// super.onCreate(savedInstanceState);
// DaggerRootComponent.builder().applicationComponent(ZerokitApplication.get(this).component()).build().inject(this);
// }
//
// @Override
// protected void onNewIntent(Intent intent) {
// super.onNewIntent(intent);
// start = true;
// }
//
// @Override
// protected void onStart() {
// super.onStart();
// if (!start) finish();
// else {
// start = false;
// zerokit.whoAmI().enqueue(new Action<String>() {
// @Override
// public void call(String response) {
// if ("null".equals(response))
// startActivityForResult(new Intent(RootActivity.this, SignInActivity.class), REQ_DEFAULT);
// else
// startActivityForResult(new Intent(RootActivity.this, MainActivity.class), REQ_DEFAULT);
// }
// }, new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError responseZerokitError) {
// Toast.makeText(RootActivity.this, responseZerokitError.getDescription(), Toast.LENGTH_SHORT).show();
// startActivityForResult(new Intent(RootActivity.this, SignInActivity.class), REQ_DEFAULT);
// }
// });
//
// }
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/RootComponent.java
import com.tresorit.zerokitsdk.activity.RootActivity;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
dependencies = {
ApplicationComponent.class
}
)
public interface RootComponent { | void inject(RootActivity activity); |
tresorit/ZeroKit-Android-SDK | zerokit/src/main/java/com/tresorit/zerokit/response/Feedback.java | // Path: zerokit/src/main/java/com/tresorit/zerokit/util/JSONObject.java
// public class JSONObject {
//
// private org.json.JSONObject jsonObject;
//
// public JSONObject() {
// jsonObject = new org.json.JSONObject();
// }
//
// public JSONObject(String json) {
// try {
// jsonObject = new org.json.JSONObject(json);
// } catch (JSONException e) {
// //e.printStackTrace();
// jsonObject = new org.json.JSONObject();
// }
// }
//
// public org.json.JSONObject getJSONObject(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getJSONObject(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new org.json.JSONObject();
// }
//
//
// public String getString(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getString(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return "";
// }
//
// public double getDouble(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getDouble(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public int getInt(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getInt(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public List<String> getStringArray(String name) {
// if (jsonObject != null)
// try {
// JSONArray jsonArray = jsonObject.getJSONArray(name);
// List<String> result = new ArrayList<>();
// for (int i = 0; i < jsonArray.length(); i++)
// result.add(jsonArray.getString(i));
// return result;
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new ArrayList<>();
// }
//
// public JSONObject put(String name, Object value) {
// if (jsonObject != null)
// try {
// jsonObject.put(name, value);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return this;
// }
//
// @Override
// public String toString() {
// return jsonObject != null ? jsonObject.toString() : "";
// }
// }
//
// Path: common/src/main/java/com/tresorit/zerokit/util/ZerokitJson.java
// public abstract class ZerokitJson {
//
// public abstract <T extends ZerokitJson> T parse(String json);
//
// }
| import android.text.TextUtils;
import com.tresorit.zerokit.util.JSONObject;
import com.tresorit.zerokit.util.ZerokitJson;
import java.util.List; | package com.tresorit.zerokit.response;
@SuppressWarnings("WeakerAccess")
public class Feedback extends ZerokitJson {
private List<String> suggestions;
private String warning;
public List<String> getSuggestions() {
return suggestions;
}
public String getWarning() {
return warning;
}
@Override
public String toString() {
return String.format("suggestions: %s, warning: %s", TextUtils.join(", ", suggestions), warning);
}
@SuppressWarnings("unchecked")
@Override
public <T extends ZerokitJson> T parse(String json) { | // Path: zerokit/src/main/java/com/tresorit/zerokit/util/JSONObject.java
// public class JSONObject {
//
// private org.json.JSONObject jsonObject;
//
// public JSONObject() {
// jsonObject = new org.json.JSONObject();
// }
//
// public JSONObject(String json) {
// try {
// jsonObject = new org.json.JSONObject(json);
// } catch (JSONException e) {
// //e.printStackTrace();
// jsonObject = new org.json.JSONObject();
// }
// }
//
// public org.json.JSONObject getJSONObject(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getJSONObject(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new org.json.JSONObject();
// }
//
//
// public String getString(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getString(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return "";
// }
//
// public double getDouble(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getDouble(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public int getInt(String name) {
// if (jsonObject != null)
// try {
// return jsonObject.getInt(name);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return 0;
// }
//
// public List<String> getStringArray(String name) {
// if (jsonObject != null)
// try {
// JSONArray jsonArray = jsonObject.getJSONArray(name);
// List<String> result = new ArrayList<>();
// for (int i = 0; i < jsonArray.length(); i++)
// result.add(jsonArray.getString(i));
// return result;
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return new ArrayList<>();
// }
//
// public JSONObject put(String name, Object value) {
// if (jsonObject != null)
// try {
// jsonObject.put(name, value);
// } catch (JSONException e) {
// //e.printStackTrace();
// }
// return this;
// }
//
// @Override
// public String toString() {
// return jsonObject != null ? jsonObject.toString() : "";
// }
// }
//
// Path: common/src/main/java/com/tresorit/zerokit/util/ZerokitJson.java
// public abstract class ZerokitJson {
//
// public abstract <T extends ZerokitJson> T parse(String json);
//
// }
// Path: zerokit/src/main/java/com/tresorit/zerokit/response/Feedback.java
import android.text.TextUtils;
import com.tresorit.zerokit.util.JSONObject;
import com.tresorit.zerokit.util.ZerokitJson;
import java.util.List;
package com.tresorit.zerokit.response;
@SuppressWarnings("WeakerAccess")
public class Feedback extends ZerokitJson {
private List<String> suggestions;
private String warning;
public List<String> getSuggestions() {
return suggestions;
}
public String getWarning() {
return warning;
}
@Override
public String toString() {
return String.format("suggestions: %s, warning: %s", TextUtils.join(", ", suggestions), warning);
}
@SuppressWarnings("unchecked")
@Override
public <T extends ZerokitJson> T parse(String json) { | JSONObject jsonObject = new JSONObject(json); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptModule.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptViewModel.java
// public class EncryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final EncryptPagerAdapter pagerAdapter;
// @SuppressWarnings("WeakerAccess")
// public final ViewPager.OnPageChangeListener pageChangeListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot1;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot2;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot3;
//
//
// public EncryptViewModel(final Context context, FragmentManager fragmentManager) {
// pagerAdapter = new EncryptPagerAdapter(context, fragmentManager);
// pageChangeListener = new ViewPager.SimpleOnPageChangeListener() {
//
// @Override
// public void onPageSelected(int position) {
// drawableDot1.set(context.getResources().getDrawable(position == 0 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot2.set(context.getResources().getDrawable(position == 1 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot3.set(context.getResources().getDrawable(position == 2 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// }
//
// };
//
// drawableDot1 = new ObservableField<>(context.getResources().getDrawable(R.drawable.selecteditem_dot));
// drawableDot2 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// drawableDot3 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// }
//
//
//
// }
| import android.content.Context;
import android.support.v4.app.FragmentManager;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptViewModel;
import dagger.Module;
import dagger.Provides; | package com.tresorit.zerokitsdk.module;
@Module
public class EncryptModule {
private final FragmentManager fragmentManager;
public EncryptModule(FragmentManager fragmentManager) {
this.fragmentManager = fragmentManager;
}
@Provides
@ActivityScope | // Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptViewModel.java
// public class EncryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final EncryptPagerAdapter pagerAdapter;
// @SuppressWarnings("WeakerAccess")
// public final ViewPager.OnPageChangeListener pageChangeListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot1;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot2;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot3;
//
//
// public EncryptViewModel(final Context context, FragmentManager fragmentManager) {
// pagerAdapter = new EncryptPagerAdapter(context, fragmentManager);
// pageChangeListener = new ViewPager.SimpleOnPageChangeListener() {
//
// @Override
// public void onPageSelected(int position) {
// drawableDot1.set(context.getResources().getDrawable(position == 0 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot2.set(context.getResources().getDrawable(position == 1 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot3.set(context.getResources().getDrawable(position == 2 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// }
//
// };
//
// drawableDot1 = new ObservableField<>(context.getResources().getDrawable(R.drawable.selecteditem_dot));
// drawableDot2 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// drawableDot3 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// }
//
//
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptModule.java
import android.content.Context;
import android.support.v4.app.FragmentManager;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptViewModel;
import dagger.Module;
import dagger.Provides;
package com.tresorit.zerokitsdk.module;
@Module
public class EncryptModule {
private final FragmentManager fragmentManager;
public EncryptModule(FragmentManager fragmentManager) {
this.fragmentManager = fragmentManager;
}
@Provides
@ActivityScope | public EncryptViewModel provideEncryptViewModel(Context context) { |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/CreateTresorViewModel.java
// public class CreateTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> tresorId;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
//
// @Inject
// public CreateTresorViewModel(final Zerokit zerokit, final AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
//
// this.inProgress = new ObservableField<>(false);
// this.tresorId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// createTresor();
// inProgress.set(true);
// }
// };
//
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void createTresor() {
// inProgress.set(true);
// this.zerokit.createTresor().enqueue(new Action<String>() {
// @Override
// public void call(final String tresorId) {
// adminApi.createdTresor(tresorId).enqueue(new Action<Void>() {
// @Override
// public void call(Void res) {
// CreateTresorViewModel.this.inProgress.set(false);
// CreateTresorViewModel.this.tresorId.set("Tresor Id: " + tresorId);
// CreateTresorViewModel.this.eventBus.post(new CreateTresorFinishedMessage(tresorId));
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerCreateTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentCreateTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.CreateTresorViewModel;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class CreateTresorFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/CreateTresorViewModel.java
// public class CreateTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> tresorId;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
//
// @Inject
// public CreateTresorViewModel(final Zerokit zerokit, final AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
//
// this.inProgress = new ObservableField<>(false);
// this.tresorId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// createTresor();
// inProgress.set(true);
// }
// };
//
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void createTresor() {
// inProgress.set(true);
// this.zerokit.createTresor().enqueue(new Action<String>() {
// @Override
// public void call(final String tresorId) {
// adminApi.createdTresor(tresorId).enqueue(new Action<Void>() {
// @Override
// public void call(Void res) {
// CreateTresorViewModel.this.inProgress.set(false);
// CreateTresorViewModel.this.tresorId.set("Tresor Id: " + tresorId);
// CreateTresorViewModel.this.eventBus.post(new CreateTresorFinishedMessage(tresorId));
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerCreateTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentCreateTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.CreateTresorViewModel;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class CreateTresorFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject | CreateTresorViewModel viewModel; |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/CreateTresorViewModel.java
// public class CreateTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> tresorId;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
//
// @Inject
// public CreateTresorViewModel(final Zerokit zerokit, final AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
//
// this.inProgress = new ObservableField<>(false);
// this.tresorId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// createTresor();
// inProgress.set(true);
// }
// };
//
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void createTresor() {
// inProgress.set(true);
// this.zerokit.createTresor().enqueue(new Action<String>() {
// @Override
// public void call(final String tresorId) {
// adminApi.createdTresor(tresorId).enqueue(new Action<Void>() {
// @Override
// public void call(Void res) {
// CreateTresorViewModel.this.inProgress.set(false);
// CreateTresorViewModel.this.tresorId.set("Tresor Id: " + tresorId);
// CreateTresorViewModel.this.eventBus.post(new CreateTresorFinishedMessage(tresorId));
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }
| import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerCreateTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentCreateTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.CreateTresorViewModel;
import javax.inject.Inject; | package com.tresorit.zerokitsdk.fragment;
public class CreateTresorFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorViewModel viewModel;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/ZerokitApplication.java
// public class ZerokitApplication extends Application {
//
// private ApplicationComponent component;
//
// public static ZerokitApplication get(Context context) {
// return (ZerokitApplication) context.getApplicationContext();
// }
//
// @Override
// public void onCreate() {
// super.onCreate();
// component = DaggerApplicationComponent.builder()
// .applicationModule(new ApplicationModule(this))
// .adminApiModule(new AdminApiModule(BuildConfig.APP_BACKEND, BuildConfig.CLIENT_ID))
// .build();
// }
//
// public ApplicationComponent component() {
// return component;
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/CreateTresorViewModel.java
// public class CreateTresorViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final View.OnClickListener clickListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Boolean> inProgress;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<String> tresorId;
//
// private final Zerokit zerokit;
//
// @SuppressWarnings("WeakerAccess")
// final AdminApi adminApi;
// @SuppressWarnings("WeakerAccess")
// final EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseZerokitError> errorResponseHandlerSdk;
// @SuppressWarnings("WeakerAccess")
// final Action<ResponseAdminApiError> errorResponseHandlerAdminapi;
//
//
// @Inject
// public CreateTresorViewModel(final Zerokit zerokit, final AdminApi adminApi, final EventBus eventBus) {
// this.zerokit = zerokit;
// this.adminApi = adminApi;
// this.eventBus = eventBus;
//
//
// this.inProgress = new ObservableField<>(false);
// this.tresorId = new ObservableField<>("");
// this.clickListener = new View.OnClickListener() {
// @Override
// public void onClick(View v) {
// createTresor();
// inProgress.set(true);
// }
// };
//
// errorResponseHandlerSdk = new Action<ResponseZerokitError>() {
// @Override
// public void call(ResponseZerokitError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// errorResponseHandlerAdminapi = new Action<ResponseAdminApiError>() {
// @Override
// public void call(ResponseAdminApiError errorResponse) {
// inProgress.set(false);
// eventBus.post(new ShowMessageMessage(errorResponse.toString()));
// }
// };
// }
//
// @SuppressWarnings("WeakerAccess")
// void createTresor() {
// inProgress.set(true);
// this.zerokit.createTresor().enqueue(new Action<String>() {
// @Override
// public void call(final String tresorId) {
// adminApi.createdTresor(tresorId).enqueue(new Action<Void>() {
// @Override
// public void call(Void res) {
// CreateTresorViewModel.this.inProgress.set(false);
// CreateTresorViewModel.this.tresorId.set("Tresor Id: " + tresorId);
// CreateTresorViewModel.this.eventBus.post(new CreateTresorFinishedMessage(tresorId));
// }
// }, errorResponseHandlerAdminapi);
// }
// }, errorResponseHandlerSdk);
// }
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/CreateTresorFragment.java
import android.os.Bundle;
import android.support.annotation.Nullable;
import android.support.v4.app.Fragment;
import android.view.LayoutInflater;
import android.view.View;
import android.view.ViewGroup;
import com.tresorit.zerokitsdk.ZerokitApplication;
import com.tresorit.zerokitsdk.component.DaggerCreateTresorComponent;
import com.tresorit.zerokitsdk.databinding.FragmentCreateTresorBinding;
import com.tresorit.zerokitsdk.viewmodel.CreateTresorViewModel;
import javax.inject.Inject;
package com.tresorit.zerokitsdk.fragment;
public class CreateTresorFragment extends Fragment {
@SuppressWarnings("WeakerAccess")
@Inject
CreateTresorViewModel viewModel;
@Nullable
@Override
public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { | DaggerCreateTresorComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).build().inject(this); |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptFragment.java
// public class EncryptFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// FragmentEncryptBinding binding;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// binding = FragmentEncryptBinding.inflate(inflater, container, false);
// DaggerEncryptComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).encryptModule(new EncryptModule(getChildFragmentManager())).build().inject(this);
// binding.setViewmodel(viewModel);
// binding.pager.setPagingEnabled(false);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(this);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(this);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(@SuppressWarnings("UnusedParameters") CreateTresorFinishedMessage message){
// binding.pager.setPagingEnabled(true);
// binding.pager.postDelayed(new Runnable() {
// @Override
// public void run() {
// binding.pager.setCurrentItem(1);
// }
// }, 500);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptModule.java
// @Module
// public class EncryptModule {
//
// private final FragmentManager fragmentManager;
//
// public EncryptModule(FragmentManager fragmentManager) {
// this.fragmentManager = fragmentManager;
// }
//
// @Provides
// @ActivityScope
// public EncryptViewModel provideEncryptViewModel(Context context) {
// return new EncryptViewModel(context, fragmentManager);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptViewModel.java
// public class EncryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final EncryptPagerAdapter pagerAdapter;
// @SuppressWarnings("WeakerAccess")
// public final ViewPager.OnPageChangeListener pageChangeListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot1;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot2;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot3;
//
//
// public EncryptViewModel(final Context context, FragmentManager fragmentManager) {
// pagerAdapter = new EncryptPagerAdapter(context, fragmentManager);
// pageChangeListener = new ViewPager.SimpleOnPageChangeListener() {
//
// @Override
// public void onPageSelected(int position) {
// drawableDot1.set(context.getResources().getDrawable(position == 0 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot2.set(context.getResources().getDrawable(position == 1 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot3.set(context.getResources().getDrawable(position == 2 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// }
//
// };
//
// drawableDot1 = new ObservableField<>(context.getResources().getDrawable(R.drawable.selecteditem_dot));
// drawableDot2 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// drawableDot3 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// }
//
//
//
// }
| import com.tresorit.zerokitsdk.fragment.EncryptFragment;
import com.tresorit.zerokitsdk.module.EncryptModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptFragment.java
// public class EncryptFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// FragmentEncryptBinding binding;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// binding = FragmentEncryptBinding.inflate(inflater, container, false);
// DaggerEncryptComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).encryptModule(new EncryptModule(getChildFragmentManager())).build().inject(this);
// binding.setViewmodel(viewModel);
// binding.pager.setPagingEnabled(false);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(this);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(this);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(@SuppressWarnings("UnusedParameters") CreateTresorFinishedMessage message){
// binding.pager.setPagingEnabled(true);
// binding.pager.postDelayed(new Runnable() {
// @Override
// public void run() {
// binding.pager.setCurrentItem(1);
// }
// }, 500);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptModule.java
// @Module
// public class EncryptModule {
//
// private final FragmentManager fragmentManager;
//
// public EncryptModule(FragmentManager fragmentManager) {
// this.fragmentManager = fragmentManager;
// }
//
// @Provides
// @ActivityScope
// public EncryptViewModel provideEncryptViewModel(Context context) {
// return new EncryptViewModel(context, fragmentManager);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptViewModel.java
// public class EncryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final EncryptPagerAdapter pagerAdapter;
// @SuppressWarnings("WeakerAccess")
// public final ViewPager.OnPageChangeListener pageChangeListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot1;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot2;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot3;
//
//
// public EncryptViewModel(final Context context, FragmentManager fragmentManager) {
// pagerAdapter = new EncryptPagerAdapter(context, fragmentManager);
// pageChangeListener = new ViewPager.SimpleOnPageChangeListener() {
//
// @Override
// public void onPageSelected(int position) {
// drawableDot1.set(context.getResources().getDrawable(position == 0 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot2.set(context.getResources().getDrawable(position == 1 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot3.set(context.getResources().getDrawable(position == 2 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// }
//
// };
//
// drawableDot1 = new ObservableField<>(context.getResources().getDrawable(R.drawable.selecteditem_dot));
// drawableDot2 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// drawableDot3 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// }
//
//
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptComponent.java
import com.tresorit.zerokitsdk.fragment.EncryptFragment;
import com.tresorit.zerokitsdk.module.EncryptModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = { | EncryptModule.class |
tresorit/ZeroKit-Android-SDK | sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptComponent.java | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptFragment.java
// public class EncryptFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// FragmentEncryptBinding binding;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// binding = FragmentEncryptBinding.inflate(inflater, container, false);
// DaggerEncryptComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).encryptModule(new EncryptModule(getChildFragmentManager())).build().inject(this);
// binding.setViewmodel(viewModel);
// binding.pager.setPagingEnabled(false);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(this);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(this);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(@SuppressWarnings("UnusedParameters") CreateTresorFinishedMessage message){
// binding.pager.setPagingEnabled(true);
// binding.pager.postDelayed(new Runnable() {
// @Override
// public void run() {
// binding.pager.setCurrentItem(1);
// }
// }, 500);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptModule.java
// @Module
// public class EncryptModule {
//
// private final FragmentManager fragmentManager;
//
// public EncryptModule(FragmentManager fragmentManager) {
// this.fragmentManager = fragmentManager;
// }
//
// @Provides
// @ActivityScope
// public EncryptViewModel provideEncryptViewModel(Context context) {
// return new EncryptViewModel(context, fragmentManager);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptViewModel.java
// public class EncryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final EncryptPagerAdapter pagerAdapter;
// @SuppressWarnings("WeakerAccess")
// public final ViewPager.OnPageChangeListener pageChangeListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot1;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot2;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot3;
//
//
// public EncryptViewModel(final Context context, FragmentManager fragmentManager) {
// pagerAdapter = new EncryptPagerAdapter(context, fragmentManager);
// pageChangeListener = new ViewPager.SimpleOnPageChangeListener() {
//
// @Override
// public void onPageSelected(int position) {
// drawableDot1.set(context.getResources().getDrawable(position == 0 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot2.set(context.getResources().getDrawable(position == 1 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot3.set(context.getResources().getDrawable(position == 2 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// }
//
// };
//
// drawableDot1 = new ObservableField<>(context.getResources().getDrawable(R.drawable.selecteditem_dot));
// drawableDot2 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// drawableDot3 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// }
//
//
//
// }
| import com.tresorit.zerokitsdk.fragment.EncryptFragment;
import com.tresorit.zerokitsdk.module.EncryptModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptViewModel;
import dagger.Component; | package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
EncryptModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface EncryptComponent { | // Path: sample/src/main/java/com/tresorit/zerokitsdk/fragment/EncryptFragment.java
// public class EncryptFragment extends Fragment {
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EncryptViewModel viewModel;
//
// @SuppressWarnings({"WeakerAccess", "CanBeFinal"})
// @Inject
// EventBus eventBus;
//
// @SuppressWarnings("WeakerAccess")
// FragmentEncryptBinding binding;
//
// @Nullable
// @Override
// public View onCreateView(LayoutInflater inflater, @Nullable ViewGroup container, @Nullable Bundle savedInstanceState) {
// binding = FragmentEncryptBinding.inflate(inflater, container, false);
// DaggerEncryptComponent.builder().applicationComponent(ZerokitApplication.get(getActivity()).component()).encryptModule(new EncryptModule(getChildFragmentManager())).build().inject(this);
// binding.setViewmodel(viewModel);
// binding.pager.setPagingEnabled(false);
// return binding.getRoot();
// }
//
// @Override
// public void onStart() {
// super.onStart();
// eventBus.register(this);
// }
//
// @Override
// public void onStop() {
// super.onStop();
// eventBus.unregister(this);
// }
//
// @Subscribe
// @SuppressWarnings("unused")
// public void onEvent(@SuppressWarnings("UnusedParameters") CreateTresorFinishedMessage message){
// binding.pager.setPagingEnabled(true);
// binding.pager.postDelayed(new Runnable() {
// @Override
// public void run() {
// binding.pager.setCurrentItem(1);
// }
// }, 500);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/module/EncryptModule.java
// @Module
// public class EncryptModule {
//
// private final FragmentManager fragmentManager;
//
// public EncryptModule(FragmentManager fragmentManager) {
// this.fragmentManager = fragmentManager;
// }
//
// @Provides
// @ActivityScope
// public EncryptViewModel provideEncryptViewModel(Context context) {
// return new EncryptViewModel(context, fragmentManager);
// }
// }
//
// Path: sample/src/main/java/com/tresorit/zerokitsdk/viewmodel/EncryptViewModel.java
// public class EncryptViewModel extends BaseObservable {
//
// @SuppressWarnings("WeakerAccess")
// public final EncryptPagerAdapter pagerAdapter;
// @SuppressWarnings("WeakerAccess")
// public final ViewPager.OnPageChangeListener pageChangeListener;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot1;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot2;
// @SuppressWarnings("WeakerAccess")
// public final ObservableField<Drawable> drawableDot3;
//
//
// public EncryptViewModel(final Context context, FragmentManager fragmentManager) {
// pagerAdapter = new EncryptPagerAdapter(context, fragmentManager);
// pageChangeListener = new ViewPager.SimpleOnPageChangeListener() {
//
// @Override
// public void onPageSelected(int position) {
// drawableDot1.set(context.getResources().getDrawable(position == 0 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot2.set(context.getResources().getDrawable(position == 1 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// drawableDot3.set(context.getResources().getDrawable(position == 2 ? R.drawable.selecteditem_dot : R.drawable.nonselecteditem_dot));
// }
//
// };
//
// drawableDot1 = new ObservableField<>(context.getResources().getDrawable(R.drawable.selecteditem_dot));
// drawableDot2 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// drawableDot3 = new ObservableField<>(context.getResources().getDrawable(R.drawable.nonselecteditem_dot));
// }
//
//
//
// }
// Path: sample/src/main/java/com/tresorit/zerokitsdk/component/EncryptComponent.java
import com.tresorit.zerokitsdk.fragment.EncryptFragment;
import com.tresorit.zerokitsdk.module.EncryptModule;
import com.tresorit.zerokitsdk.scopes.ActivityScope;
import com.tresorit.zerokitsdk.viewmodel.EncryptViewModel;
import dagger.Component;
package com.tresorit.zerokitsdk.component;
@ActivityScope
@Component(
modules = {
EncryptModule.class
},
dependencies = {
ApplicationComponent.class
}
)
public interface EncryptComponent { | void inject(EncryptFragment fragment); |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.