UniProt ID
stringlengths
6
10
Protein Sequence
stringlengths
2
35.2k
Functional Description
stringlengths
5
30.7k
A1U0Y3
MSGNTFGKLFTVTTFGESHGAALGCIIDGCPPGLELSEEDMQRDLDRRKPGTSRHTTQRREADEVRILSGVFEGKTTGTPIGLIIENTDQRSKDYSRIAAQFRPAHADYTYHHKYGARDYRGGGRSSARETAMRVAAGAVARKFLEQRLGIKVRGYLSQLGPIKTDKLDWEQVHQNPFFCPDADKVSEMEAYMDALRKEGDSIGARINVVAEGVPPGLGEPIFDRLDADLAHALMSINAVKGVEIGAGFDCIEQKGTEHRDEMTPEGFLSNNAGGVLGGISSGQPIVASIALKPTSSLRLPGKGIDVDGNPVEVITTGRHDPCVGIRATPIAEAMMAIVLMDHYLRHRGQNGDVEVTTPVLGQL
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
C6C0I6
MSGNTFGQIFKVTTYGESHGPGLGGVIDGCPAGIELSEEIIQLELDRRKPGQGIASTARKEADRVKILSGVFEGRTTGTSIGFHIENTDQRSHDYSKIMNVYRPGHADRTFDAKYGFRDYRGGGRSSGRETVSRVAGGAVAQEFLRQQSISCQAYTVRIGGIDGEVKAPEKAHELPFFSADPDVIPSWEERIKEVRSQGDTLGGVVEVCIKGVPAGLGEPVFDKLDARLAYALMSVGAVKGVEIGAGCKAADALGSENNDFMDGDGFCSNNAGGVLGGISSGQDVVVRAYVKPIPSISKPQQTVDRDGNATEIKIGGRHDICAIPRIVPVLKSMAMLTVADFILLQRRMG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
A6UUV1
MNTIGKSFRITAWGESHGKALGAVVDGCPSNLPLTGEDIQKELNRRRPGYSLFSTPRKEGDKVEILSGIFEGKTTGTPISAIVYNTNQKSKDYSHLKNTPRPGHADLSYKLKYGNYDYRGGGRSSGRTTIGHTIGGAIAKKLLDYTHNIKIIGYTTKIGNIEGDFNYYNSIENNEKMINEELINKIENNPLRCPSSNADEMKDFVLNAMENKNSVGGVIELIALNVPVGVGNPIFGKLNGELSNAIMNINAVKGVEIGRGFESAELLGSEMNDEYYYDENNNIKLKTNNCGGVLGGISCGAPLVIRVAVKPTPSISAVQSTINIENKTTENLEIGGRHDPIIVPRVIPVLESMVAIALSDLMIRGGFIHPCKL
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Belongs to the chorismate synthase family.
Q8TT87
MAGNIFGQMFRIATWGESHGRAVGVVVDGLPAGLPFSEADIQKELDRRRPGQSEVSTPRSEADRVEILSGIFEGMSTGTPISMLVWNSDARSSSYDVIKNTPRPGHADFSYMARYGIRDHRGGGRSSARETIGRVAGGALAKLLLSRYGVRIAGHVLELGGIRAKPLSFEEILENVEKTPVRCADLEAAEKMLEKVATLRQEGDSVGGIVELIVKGVPAGLGEPVFDRLDADLSKALMSIPAVKGFEIGAGFEAARMRGSEMNDPFRMEQGEITCSKNNAGGILGGISTGLDIICRAAVKPTPSIGKVQQTVDLTTRENTEISIRGRHDPTIPPRMVPVAEAMVALVLSDHMLRSGFINPRTLLE
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Belongs to the chorismate synthase family.
Q0W6Q8
MTGNTFGNAFRITTFGESHGPGLGVVIDGCPAGLPLTEADVQAELDKRKPGQSEVTTQRKEADMVEILSGVFEGLTTGTPIAMLVRNADARSAAYENIRNIARPGHADFGYMEKYGMRDYRGGGRSSGRETLSRVAGGAVAKKLLSLYGVEVHAHTVAIGNVRAKPATIEEIKANVWKNPVRCADLSAADAMLREVSAAREASDSVGGIVEIVATGVPAGVGTPAFDKLDACLAYALMGIGGVKAVEIGAGIASAGMRGSEMNDEFCTEDGKVRTKTNRCGGILGGISTGMPIVCRAAIKPTPSISRPQRTVNLETGAETIIEITGRHDPSIVPRAVPVAEAMVALVIVDQMISGGLINPVSAGAVDASRNR
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Belongs to the chorismate synthase family.
Q46CJ6
MAGNVFGQMFRITTWGESHGKAVGVVVDGLPAGLPFSEADIQKELDRRRPGQSEVSTPRHEADRVEILSGIFEGMSTGTPVSMLVWNSDARSSAYDVIKDTPRPGHADFTYMARYGMRDHRGGGRSSARETIGRVAGGALAKLLLSRFGILIAGHVLELGALRAKPLSFEEILENVEKTPVRCADLEAAEKMLEKVAALRQEGDSIGGIVELIIRGVPAGLGEPVFDRLDADLAKALMSIPAVKGFEIGAGFEAARLYGSEMNDPFRIKEGKITTSSNNAGGILGGISTGLDIVCRAAVKPTPSIGKVQQTVDLKTLENTEIAIKGRHDPTIPPRMVPVAEAMVALVIADHMLRSGFINPRTLLE
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Belongs to the chorismate synthase family.
Q12X75
MPGNTFGHSFRITTWGESHGRALGVVIDGVPAGLPLDTEIVQKELDRRRPGQSAVSTPRSETDKVEIISGIFEGKTTGTPISMMVWNKDADSSSYDNIKDLPRPGHADYPYMEKYGIRDHRGGGRSSARETIGRVAAGAVAKEILSIFGIDIIAHVTELGGIRAKEMPFDTIKEHLEKTPVRCADLEAAQLMLEKVGKAREEHESIGGVVEIIAIGLPPGIGEPVFDKLDADIAKAIMSIGAVKGVEIGIGNEAAQMKGSQMNDPFILEDGKIIAQTNNAGGILGGLSTGMPIICRASVKPTPSISKVQHTVNTKEMKNSDIIIKGRHDPTIPPRMVPVAEAMMALVLVDHMIRSGHIHPNSLLKQ
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Belongs to the chorismate synthase family.
B7KT24
MSHNTFGHLFRVTTFGESHGVALGCVVDGCPPGLALEAEDIQAELDRRKPGQSRFTTQRREPDQVKILSGVFSDDRTGGRQLTTGTPIALMIENTDQRSKDYSEIRDSYRPGHADFTYDAKYGIRDYRGGGRSSARETAARVAAGAVARKVIPGITIRAALVQMGPHAIDRANWDWEQVGQNPFFCPDAKAAALYETYLDAIRKDGSSVGAVIEVVAEGVPPGLGAPIYGKLDADLAAAMMSINAVKGVEIGDGFAAAALRGEDNADEMRAGNDGRPRFLANHAGGILGGISSGEPVVVRFAVKPTSSILTPRQSVNRDGAEIDLITKGRHDPCVGIRAVPVAEAMMACVLADHTLRHRGQNGERP
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
B5ZST4
MSHNTFGHLFRVTTWGESHGPALGCVVDGCPPGLRFKLEDLQVWLDKRKPGQSRFVTQRREDDLVKVLSGVMLDADGETMTTTGTPISMLIENTDQRSKDYGEIARQFRPGHADYTYDLKYGIRDYRGGGRSSARETAARVAAGGIARLVVPGVTVRGALVQIGKHKIDRRAWDWDQVGQNPFFSPDAAIVPVWEEYLDGIRKNGSSIGAVVEVIAEGVPAGLGAPIYSKLDQDIASLLMSINAVKGVEIGNGFAAAETSGEDNADEMRMGNDGVPIFLSNNAGGILGGISTGQPVVARFAVKPTSSILTERQSIDADGKNVDVRTKGRHDPCVGIRAVPIGEAMVACAIADHYLRDRGQTGRLK
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q92RH3
MSHNTFGHLFRVTTWGESHGPALGCVVDGCPPGIRFTLAEVQAWLDKRKPGQSRFVTQRREDDLVKVLSGVMLDDDGETMISTGTPISMMIENTDQRSKDYSEIAKRYRPGHADYTYDAKYGIRDYRGGGRSSARETAARVAAGAIARKVVPGLVVRGALVQIGKHRIDRSNWDWAEVNNNPFFAPDPAIVPVWEEYLDGIRKAGSSIGAVVEVVAEGVPAGIGAPIYAKLDQDIAANLMSINAVKGVEIGNGFAAAEISGEENADEMRIGAQGEPVFLSNNAGGILGGIATGQPVVARFAIKPTSSILTERRSIDSDGKEVDVRTKGRHDPCVGIRAVPIGEAMLACAIADHYLRDRGQTGRLK
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
A5VFP1
MSFNSFGRVFRFSTWGESHGPAIGAVVDGCPPGLELSEADIQPWLDKRRPGTSRFTTQRQEPDQVRILSGVFEGRTTGTPISLMIDNVDQRSKDYSEVALAYRPGHADYAYDAKYGFRDHRGGGRSSARETASRVAAGAVARLVIPEVRIRAYLIELGGDRIDPAAFDDAAIDENPFFCPDRAAAARWEAIVDDARKAGSSVGAVVECVAEGVPAGWGAPLYAKLDSELAAACMSINAVKGVEIGDGFAAARLTGETNADPMRPGNDGKPVFLANHAGGIAGGIATGQPVVVRIALKPTSSILTPVETIGRDGKAADIRTKGRHDPCVGIRAAPVLEAMVALVLADQKLLHRAQIG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q7UPN5
MEILGGPHFAVAGAGESHGPAVTTIIHGSPPGFRIRRCDVQPFLDRRRPGGNKHGTPRNEKDKVVFLAGLYRDDTDALLTGSKLTVDVDDQSFETEGYEDGFTTGEPIAAIVLSTSKKSGDYTQFSGPTGEVRPGHTDLVKFHQSKGFVDVRGGGRSSYRSTITDVIGGSVARIILRECFGTRFVSSICQVGSLKSKQSLADTLTIDNIDEIETSLGEAEIASIDHEFANEAGELIKETRKRGNSLGAAVEVVAVGVPPLLGQPLYQSLKVRLMGALGGLNAVQSCEIGSGVDVIPRTGSENNDPIRSSGYQSNTHGGLLGGITTGSPLVARVGFKPTSTINLPQDSVNKRLDEIEFELAKGRHDPCVGVRAGVTLESRMAIELLNSVLAYQATAHCGDSIKLF
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
B6IRC6
MAGNSFGTLFRFTTFGESHGPAIGCIVDGVPPRLPLDEAFIQGFLDRRRPGQSRFVTQRQEPDAVRILSGVFEGLTTGTPVMLEIVNQDQRSRDYGEIRDRFRPGHADWTYQAKYGIRDHRGGGRSSARETASRVAAGAVARRVLETAPAPVTVRGALVQVGPHRVDRARWDWAEVERNPFFCPDAGTAALWADYLDGVRKAGSSIGAVVEVVASGVPAGWGEPIYDKLDGDLARAMMTINAVKGVEIGAGFAAAELSGEENADEMRAGPDGQPLFLSNRAGGILGGISTGQDIVVRFAVKPTSSILTPRRTIDTAGHETEIVTKGRHDPCVGIRAVPVGEAMMACVLADHFLRHRALVGAPGPVGNGGPVEDGDPVGG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q0S0N2
MLRWITAGESHGPALVAMLEGMVAGVEVTSEDISTQLARRRLGYGRGARMKFEADKVTIVGGVRHGRTLGGPIAVEVGNTEWPKWETIMSADPVDAELLADQARNAPLTRPRPGHADYSGMLKYGFDDARPVLERASARETAARVAAATFARSFLRQVFGVEVLSHVISIGASDPYVGPEPTASDLAAIDASPVRAFDKAAEESMIAEIEAAKRDGDTLGGVVEVVIHGLPVGLGSFISGADRLDARLASALMGIQAIKGVEVGDGFETARRRGSQAHDEMRPGPDGILRSTNRAGGLEGGMTNGEALRVRAAMKPISTVPRALATVDMSTGEEAVAIHQRSDVCAVPAAGVVAEAMVALVVAQAALEKFGGDSVAETTANYERYASGVAARLAR
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
C1B4H9
MLRWITAGESHGPALVAMLEGMVAGVEVTSEDISTQLARRRLGYGRGARMKFEADKVTIVGGVRHGRTLGGPIAVEVGNTEWPKWETIMSADPVDADLLADQARNAPLTRPRPGHADYSGMLKYGFDDARPVLERASARETAARVAAATFARGFLRQVFGVEVLSHVISIGASDPYAGPEPTASDLAAIDASPVRAFDKAAEESMIAEIEAAKRDGDTLGGIVEVVIHGLPVGLGSFISGADRLDARLASALMGIQAIKGVEVGDGFETARRRGSQAHDEMRPGPDGILRSTNRAGGLEGGMTNGEALRVRAAMKPISTVPRALATVDMSTGEEAVAIHQRSDVCAVPAAGVVAEAMVALVVAQAALEKFGGDSVAETAANYERYASGVAARLAR
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q2J0T8
MSFNTFGHMFRVTTFGESHGVAIGCVVDGCPPLIPLTEADIQGDLDRRRPGQSRFTTQRQEADQVKILSGVMAHPETGVQVTTGTPIALLIENTDQRSKDYSEIQNKFRPGHADFTYEAKYGIRDYRGGGRSSARETATRVAAGAVARKVIAGMTVRGALVQIGPHQIDRDKWDWAEIGNNPFFCPDKDKAAFFADYLDGIRKSGSSIGAVIEVVAEGVPAGLGAPIYAKLDTDLAAALMSINAVKGVEIGDGFATAALTGEENADEMRMGNAGPQFLSNHAGGILGGISTGQPVVARFAVKPTSSILSPRKTIDRAGHDTDILTKGRHDPCVGIRAVPVGEAMVACVLADHLLRHRGQVG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q07HS5
MSFNTFGHMFRVTTFGESHGVAIGCVVDGCPPLIPLTEADIQGDLDRRRPGQSRFTTQRQEADQVKILSGVMAHPVSGEQVTTGTPIALQIENTDQRSKDYSEIKDKYRPGHADFTYEAKYGIRDYRGGGRSSARETASRVAAGAVARKVVPGMTIRAALVQMGPHAIDRAKWDWAEISNNPFFCPDKDKAAFFEEYLDGIRKTGSSIGAVIEVIAEGVPAGLGAPIYGKLDSDLAAALMSINAVKGVEIGDGFATAALSGEENADEIRSSNHGPVFLSNHAGGILGGISTGQPVVARFAVKPTSSILSPRKTIDREGHDTDILTKGRHDPCVGIRAVPVAEAMVACVLADHLIRHRGQVG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q6NAI4
MSFNTFGHLFRVTTFGESHGVAIGCVVDGCPPLIPLTEADIQGDLDRRRPGQSRFTTQRQEADQVKILSGVMVHPETGVQVTTGTPIALLIENTDQRSKDYSDIQNKFRPGHADFTYEAKYGIRDYRGGGRSSARETASRVAAGAIARKVIAGMTVRGALVQIGPHKIDRDKWDWDEIGNNPFFCPDKDKAAFYADYLDGIRKSGSSIGAVVEIVAEGVPAGLGAPIYAKLDGDLAAALMSINAVKGVEIGDGFASAELTGEQNADEMRTGNHGPAFLSNHAGGILGGISTGQPVVARFAVKPTSSILTPRKTVDRTGHDTEILTKGRHDPCVGIRAVPVGEAMVACVLADHLLRHRGQVGG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q21A81
MSFNTFGHMFRVTTFGESHGVAIGCVVDGCPPLIALTEADIQRDLDRRRPGQSRFTTQRQEADQVKILSGVMVHPQSGLQVTTGAPIALLIENTDQRSKDYSEIKDKFRPGHADFTYEAKYGIRDYRGGGRSSARETATRVAAGAIARKVVPGITVRAALVQMGPHQIDRDNWDWEEVGNNPFFCPDKDKAKFFEDYLDGIRKNGSSIGAVIEVVADGVPAGWGAPIYAKLDTDIAAALMSINAVKGVEIGDGFATAALTGEQNADEMRAGNDGPSFLSNHAGGILGGISTGQPVVARFAVKPTSSILAPRKTVDRDGHDTDILTKGRHDPCVGIRAVSVAEAMVACVLADHLIRHRGQIGG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q13BI7
MSFNTFGHMFRVTTFGESHGVAIGCVVDGCPPLIPLTEADIQGDLDRRRPGQSRFTTQRQEADQVKIVSGVMAHPESGAQVTTGTPIALMIENTDQRSKDYSDIKDKYRPGHADFTYEAKYGIRDYRGGGRSSARETASRVAAGAIARKVITGMSVRGALVQIGPHKIDREKWDWDEIGNNPFFCPDKDAASVWEAYLDGIRKSGSSIGAVIEVIAEGVPAGLGAPIYAKLDGDIAAALMSINAVKGVEIGDGFATAALTGEENADEMRMGNHGPAFLSNHAGGILGGISTGQPVVARFAVKPTSSILSPRRTVDREGHDTDILTKGRHDPCVGIRAVPVGEAMVACVLADHLLRHRGQVG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
B3QIL0
MSFNTFGHLFRVTTFGESHGVAIGCVVDGCPPLIPLTEADIQGDLDRRRPGQSRFTTQRQEADQVKILSGVMVHPETGVQVTTGTPIALLIENTDQRSKDYSDIQNKYRPGHADFTYEAKYGIRDYRGGGRSSARETATRVAAGAIARKVIAGMTVRGALVQIGPHKIDRDKWDWDEIGNNPFFCPDKDKAAFYADYLDGIRKSGSSIGAVVEIVAEGVPAGLGAPIYAKLDGDLAAALMSINAVKGVEIGDGFASAELTGEQNADEMRTGNHGPAFLSNHAGGILGGISTGQPVVARFAVKPTSSILTPRKTVDRTGHDTEILTKGRHDPCVGIRAVPVGEAMVACVLADHLLRHRGQVGG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q2RR25
MAGDSFGTLFRFTSFGESHGPAIGCVVEGVPPGIPLTAADLQHDLDRRKPGQSRFTTQRREDDAAEILSGVYEGVTTGTPIAVLIRNTDQRSKDYSDIAQRFRPGHADYTYWVKYGVRDPRGGGRSSARETAVRVAAGAIARKVLTSVLGRPLTIRAAVVEMGGLAIERANWDWLSVDANPFFSPDAAMVAPWEALLDGVRRDGSSVGAVVEVVAEGVPPGLGEPVYDRLDADLAKALMSINAVKGVEIGAGFEAARLRGESNADEMLPNGLGGVRFTSNNAGGVLGGISTGQTIIARLAVKPTSSIMIPRQSVDTQGRPVDVVTKGRHDPCVGIRAVPVAEAMVAVVLADHLLRFRGQCGLPVGL
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
B7JVZ9
MGNTFGHLFRITTFGESHGGGVGVVIDGCPPRLEISESDIQYDLDRRRPGQSKITTPRHESDTCEIISGVFEGKTLGTPIAILVRNKDQRSQDYDEMSVKLRPSHADATYEAKYGIRNWQGGGRSSARETIGRVAAGAIAKKILKQVANVEIIGYVKRIKDLEGMVDPSTVTLENVESNIVRCPDPEMAEKMIDLIDQTRRNKDSIGGVVECVARNIPKGLGQPVFDKLEADLAKGVMSLPASKGFEIGSGFAGTLLTGSEHNDEFYLDETGEIRTTTNRSGGIQGGISNGENIIIRVAFKPTATIGKEQKTVTNTGEETTLAAKGRHDPCVLPRAVPMVEAMVALVLCDHLLRQEGQCGLF
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
A7NQM2
MPGNTFGQVFRLTTWGESHGPAVGCVVDGCPAGLDISEDYIQHELNRRRVGQSRVTSARQESDQVQILSGVFEGRATGAPISMLVFNTDAKPGHYENIKDLYRPGHADYTWDVKYGFRDWRGGGRSSARETIGRVAGGAVAKRLLAQHGVSIIAWTAQLGDLKAEVIDESEIERNIMRCPDARVAALMVERVEQARRSLDSLGGIVEVRARGVPPGLGEPVFDKLQADIGKAMFSIPAIKGVEFGEGFGVAHMTGSVHNDPFERRADGTIGTSSNHHGGILGGISTGEEIVLRIAAKPPASIARLQRTVDREGNPTEIEIHGRHDPTVLPRLVPIAEAMLALVLADHLLRQRLARMER
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q16CN2
MSMNSFGHLFRVTTWGESHGTALGATVDGCPPGVAIDAGKIQHWLDKRKPGQNKYTTQRREADEVKILSGTFEGVTTGTPVQLMIENTDQRSKDYGDIKDKFRPGHADITYFQKYGVRDYRGGGRSSARETAARVAAGGLAREAIKSIAPGIDIKGYMTRMGAHEIDRSRFDWDQIDANPFWTPDAQAADEWASYLDGLRKSGSSVGAVIEVVARGVPAGLGAPIYAKLDTDLAAAMMSINAVKGVEIGEGMSAAMLTGELNADEISMGRDGPQYSSNHAGGILGGISTGQDIVVRFAVKPTSSILTTRKTITKSGEDTEIITKGRHDPCVGIRAVPVGEAMMACVLLDHLLLHRGQVGQNQGHIG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
A5UUN7
MPGNTFGQVFRLTTWGESHGPAVGCVVDGCPAGIEISEAFIQRELDRRRVGQSRVTSARQEPDQVQILSGVFEGRSTGAPISMLVFNTDAKPGHYDTIKHLYRPGHADYTWDAKYGFRDWRGGGRSSARETIGRVAGGAIAKLLLARYGISVIAWTSQLGDLKAEVIDESEIERNIMRCPDARVAALMVERVEQARRSLDSLGGVVEVRARGVPPGLGEPVFDKLQADIGKAMFSIPAIKGVEFGEGFGVAYMTGSTHNDPFVRRDDGTIGTASNHHGGILGGISTGEEIVLRIAAKPPASIARPQHTVDRAGNPAAIEIHGRHDPTVLPRLVPIAEAMLALVLADHLLRQRLARVDA
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q1AW05
MRFGFSTAGESHGPAEVVIVHGVPAGLRLLAEDVDRDLARRQLGYGRGGRQKIERDRVEFLGGVRHGRTLGSPVAMLVRNRDYANWERRMNPAPVEDPPEPITLPRPGHADLAGMQKYGFGDLRNVLERSSARETVARVAAGAVARRLLGEFGVRVFSAVYRIGEVAMDRALAAAGAGKADRSEVRCPDPEVSERMKAEIDAARHARDALGGEFVVVAEGCPPGLGSYADWRDRLDARLAAAVVSINAIKGVEIGDAFEAARRRSSEVQDEIVRRGGALGRASNRLGGLEGGMTNGEPVVVAAAMKPISTIARALRTVDLSTGEEARAFRERADSCAVPAAAVIGEAMVAVVLAEAFLEKFGADALEDIRASYEHYMRRIGLPARRADA
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q5LX60
MSMNSFGHLFRVTTWGESHGPALGATVDGCPPGVPIEEAMIQHWLDRRKPGQNKYTTQRREADEVKILSGVFEGQTTGTPVQLMIENTDQRSKDYGDIKDKFRPGHADITYFQKYGIRDYRGGGRSSARETAARVAAGGLAREAIRALAPNAQITGYMVQMGPHRIDRARFDWAQIEQNPFWVPDAQAASDWADYLDGLRKSGSSVGAVIEVVARGVPAGLGAPVYGKLDTDLAAAMMSINAVKGVEIGEGMAAAELTGEANADEIFMGQNGPQYSSNHAGGILGGISTGQDIVVRFAVKPTSSILTTRKTITKSGEETEIITKGRHDPCVGIRAVPVGEAMMACVILDHLLLHRGQIGANRGHIG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
A7IMW7
MSFNTFGHLFRVTTFGESHGAAIGCVVDGCPPNLRFTLEDVQAALDRRRPGQSRFTTQRREPDQVKVLSGTLEHPEGGLVTTGTPIALLIENVDQRSKDYADIAGAYRPGHADFTYDIKYGIRDHRGGGRSSARETATRVAAGAIAAKVLPGVTVRGAVVRIGEIEIDRSRWDWNEVPNNPFFCPDPKTVPLWEEYLDAVRKAGSSIGAVVELVAEGVPAGLGAPLYGKLDADLASALLGINAAKGVEIGEGFNAAQLTGEENADEMRLGNEGRPQFLSNHAGGILGGIATGAPIVARFALKPTSSILTPRQTVDRTGQETEIFTKGRHDPCVGIRAVPVGEAMMWCVLADHFLRHRGQVGESVAWPFKG
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
B2I9I6
MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGLTTGTPIALLIRNTDQRSKDYATIARQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAAVVAKKWLQQRYGVTVRGFLSQLGEIRPEGFAWDAIEDNPFFWPHAAQVPALEAYMDALRKSGDSVGARVDVVAEGVPPGWGEPIYGKLDGELAAALMGINAVKGVEIGAGFGSAVQKGTEHRDLMTPLGFLSNHAGGIIGGIATGQPIIVSIALKPTSSLRLPGETVDVDGCAVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCIPEGVGLRNADD
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q9PDL0
MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGRTTGTPIALLIRNTDQRSKDYATIARQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAGVVAKKWLKQRYGVIVRGFLSQLGEIRPEGFAWDAVEDNPFFWPQAAQVPELEAYMDALRKSGNSVGARVDVVAEGVPPGWGEPIYGKLDGELAAALMSINAVKGVEIGAGFGSTVQKGTEHRDLMTPLGFLSNHAGGIIGGITTGQPIIVSIALKPTSSLRLPGETVDVDGHPVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCILENVGFRNADD
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family. Extended N-terminus.
B0U6K0
MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGRTTGTPIALLIRNTDQRSKDYATIVRQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVTAGVVAKKWLKQRYGVIVRGFLSQLGEIRPEGFAWDAIEDNPFFWPHAAQVPALEAYMDALRKSGNSVGARVGVVAEGVPPGWGEPIYGKLDGELAAALMSINAVKGVEIGAGFGSAVQKGTEHRDLMTPLGFLSNHAGGIIGGIATGQPIIVSIALKPTSSLRLPGETVDVDGCAVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCIPEGVGLRNADD
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q87DS4
MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGLTTGTPIALLIRNTDQRSKDYATIARQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAAVVAKKWLQQRYGVTVRGFLSQLGEIRPEGFAWDAIEDNPFFWPHAAQVPALEAYMDALRKSGDSVGARVDVVAEGVPPGWGEPIYGKLDGELAAALMGINAVKGVEIGAGFGSAVQKGTEHRDLMTPLGFLSNHAGGIIGGIATGQPIIVSIALKPTSSLRLPGETVDVDGCAVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCIPEGVGLRNADD
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
D6VU01
MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEKDRVEIQSGTEFGKTLGTPIAMMIKNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSGGGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKMNRDSFDPEFQHLLNTITREKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPCFDKLEAMLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDPFYFEKETNRLRTKTNNSGGVQGGISNGENIYFSVPFKSVATISQEQKTATYDGEEGILAAKGRHDPAVTPRAIPIVEAMTALVLADALLIQKARDFSRSVVH
5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. By amino acid starvation. Present with 2310 molecules/cell in log phase SD medium. Belongs to the chorismate synthase family.
A1JK48
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRREPDQVRILSGIFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQIGDISCDVVDWDQVEQNPFFCPDASKLESLDALMRELKKAGDSIGAKITVVAEHVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSITVPGQTINRQGEAVEMITRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVVSDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
A7FGK6
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q1C664
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
B2K8I9
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEIVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q0WDE0
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family. Extended N-terminus. Extended N-terminus.
A9R7W3
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
C4GU75
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
A4TM78
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q668V5
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEIVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
B1JGG7
MAGNSIGQFFRVTTFGESHGIALGCIIDGVPPGIPITEADIQLDLDRRRPGTSRYTTQRRELDQVRILSGVFEGVTTGTSIGLMIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGVRDYRGGGRSSARETAMRVAAGAIAKKYLAQKFGVQVRGYLAQMGDVSCDLLDWDLVEQNPFFCPDASKLEPLDALMRELKKAGDSIGAKITVVAENVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVVTKRGSENRDEITPQGFQSNHAGGILGGISSGQPVVAHIALKPTSSIMVPGQTINRQGEAVEMVTRGRHDPCVGIRAVPIAEAMMAIVLMDHLLRQRAQCGDVASDVPRW
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
E0TIQ1
MFCNILGKIFTISCFGESHGKVIGCIIGGCPSNIKLSNIDVQIEVNKRKPGISKYITSRKENDKIKILSGIFNKKTTGAPIAIIIKNNDKKSRDYDNIKNIFRPGHADYTYWNKYKNIDFRGGGHSSGRLTANIVSASSITKKYLFKNYGIVFKGYVKQIGKNKILFESWDLINFKLNIANIKKKNIIKKYIKYINKIGDSCGANINLIIKNLPIGIGNPIFDKLNSRISYYLMNINAIKAINIGNGIKGIKYKGSKFNDIITKKGFKTNNSGGILGGISTGQDIKISIFIKPTSSIKIPQKSINKFNKKVKFIIKGRHDTCIGIRILSVAESMLSLVIMDFILNFNSYKI
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q5NLU3
MSFNSFGHLFRFTSWGESHGPALGAVVDGCPPGLELSEKDIQPFLDRRKPGSSRFTTQRREADAVKILSGVFEGRTTGTPISLMIENTDQRSRDYSNVAQQYRPAHGDFAYDAKYGLRDYRGGGRSSARETAARVAAGAVARLVISEVKIQGYLVELGGDKIDRQAFDEAEINNNPFFCPDKAAVARWEKIVDEARKDGNSVGAVVECVAFHVPAGWGAPLYAKLDSELAAACMGINAVKGVEIGDGFDAARSTGRDNADALRPADQGDRVKFLSNHAGGVTAGIATGQPVVVRCALKPTPSIVSPLPSINREGEAVEVVTKGRHDPCVGIRAVPVVEAMMALVLADQKLLHRAQTGR
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. 5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate Reduced FMN (FMNH(2)). Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 7/7. Homotetramer. Belongs to the chorismate synthase family.
Q94B20
MALRCFPIWVCPQTTHHRSPLMGLAEFDADKRRRFCLWECSSSASQRAVTAIEGEIPFSRELKKSSDELGLTQETQSLSFHRDLSMLPKPLTANSLYSSDGDDSKVRISFQGIPGAYSETAALKAFPNCETVPCEQFEAAFQAVELWLVDKAVLPIENSVGGSIHRNYDLLLRHRLHIVQEVHLPVNHCLLGVPGVKKEDIKCVLSHPQALDQCVNSLNNLGIQRISAKDTATAAQTVSSSGKIDVGAIASVRAANIYGLDILAENIQDDVNNVTRFLILAREPMIPRTDRPYKTSIVFSLEEGPGVLFKALAVFALRSINLSKIESRPQRRRPLRVVDGSNNGSAKYFDYLFYIDFEASMADTRAQHALGHLQEFASFIRILGCYPMDLVR
Converts the prephenate produced from the shikimate-chorismate pathway into phenylalanine (PubMed:17726025). Dehydratase that uses arogenate and prephenate as substrates (PubMed:17726025). Utilzes more efficiently arogenate than prephenate (PubMed:17726025). H(+) + L-arogenate = CO2 + H2O + L-phenylalanine H(+) + prephenate = 3-phenylpyruvate + CO2 + H2O Amino-acid biosynthesis; L-phenylalanine biosynthesis; L-phenylalanine from L-arogenate: step 1/1. Amino-acid biosynthesis; L-phenylalanine biosynthesis; phenylpyruvate from prephenate: step 1/1. Expressed in roots, leaves, stems, flowers and siliques.
D3U715
MQSLTPSSGVNLKSIIRKTSLPPGQTRFITGRVIKCGYQVDSANTVNTAGAPASYNSGHVGASRADWQSSCAILASKVVSQQPDTEKTGGAGNITAVNGHKTLDLVSIDNLPKALTITDLSPAPMHGSTLRVAYQGVPGAYSEAAAGKAYPNCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALAQCELTITKLGLNVAREAVDDTAGAAEYIAANNLRDTAAVASARAAELYGLQILAEGIQDDSSNVTRFVMLAREPIIPRMDRPFKTSIVFAHEGTGVLFKVLSAFAFRNISLTKIESRPHRNRPIRLVDDANVGTAKHFEYMFYVDFDASMADVRAQNALAEVQEFTSFLRVLGSYPMDMTPCCPSRDE
Converts L-arogenate produced from the shikimate-chorismate pathway into phenylalanine (Phe) (PubMed:20215586). Involved in floral volatile benzenoids and phenylpropanoids (FVBP) production (PubMed:20215586). H(+) + L-arogenate = CO2 + H2O + L-phenylalanine kcat is 0.267 sec(-1) with L-arogenate as substrate. Amino-acid biosynthesis; L-phenylalanine biosynthesis; L-phenylalanine from L-arogenate: step 1/1. Mostly expressed in flowers, especially in petals (corollas and tubes), and, at low levels, in roots, stems, leaves, pistils, stamens, ovaries and sepals. Expressed throughout flower development (PubMed:20215586). In corollas, accumulates progressively during flower development, from buds to anthesis (PubMed:20543029, PubMed:20215586). Circadian-regulation with peak levels occurring at the end of the light period in flowers (PubMed:26124104). Triggered by EOBI in flowers (PubMed:23275577). Reduced arogenate dehydratase activity leading to lower levels of phenylalanine (Phe) and downstream phenylpropanoid/benzenoid volatiles (PubMed:20215586). Petals accumulate unaltered arogenate levels but decreased shikimate and tryptophan (Trp) levels associated with the down-regulation of carbon flux toward shikimic acid (PubMed:20215586). Has no detectable prehenate dehydratase activity.
Q1JCG7
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q1JME5
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q1JHJ2
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q1J7B3
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
A2RF79
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
B1ICH8
MKLIVSVMPRSLEEAQALDATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQFYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
B8ZKM6
MKLIVSVMPRSLEEAQALSATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQFYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q48U89
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q97Q54
MKLIVSVMPRSLEEAQALDATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQLYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q9A0E5
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
B2IQJ5
MKLIVSVMPRSLEEAQALDATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQLYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
B5XKU3
MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
A4W247
MKIVVPIMPRNLEEVEAIDVERLAEADIVEWRADYLLKDDILRVAPAIFEKCSGKEVVFTIRTTREGGHLDLDDQEYVNVIKEVATLYQPDYIDFEYYSYKSVFEQMLEFPNLVLSYHNFEETPSNYMEIMSELTSLSPAVVKMAVMAKTEQDVLDVMNYTRGFKSLNTEQIFATIAMGELGKLTRIAGVITGSCWTFASLDETSAPGQMSLSNTRKFLEILEN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
C0MGL4
MKIVAPVMPRNVEEAQSIDVSKYQDVNLIEWRADFLPKEDIVSVAPAIFEKFAGREIIFTLRTSQEGGHITLSDQEYVDLIKEINAIYNPDYIDFEYFSHKAVFHEMLDFPNLVLSYHNFDETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATMSMGRLGRLSRLAGDVVGSSWTFVSLDQASAPGQVSLADMKRILHILESED
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
A3CNV9
MKLVVSVMPKSLEEAQEIDVSRYEEADIIEWRADFLAKDDILNVAPAIFEKFAGRELIFTLRTRQEGGEIELSDDEYVALIKEVAGFYQPDYIDFEYFSHKGKFEEMLEFPNLVLSYHNFEETPENMMEILSELTSLTPKVVKVSVMAHNEQDVLDLMNYTRGFKTLNPEQDFVTISMGKVGRISRIAADLTGSSWSFASQDMASAPGQISLSNMKKIQEILNEN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
A4VVU0
MKIVVPIMPRNLEEVEAIDVERLAEADIVEWRADYLLKDDILRVAPAIFEKCSGKEVVFTIRTTREGGHLDLDDQEYVNVIKEVATLYQPDYIDFEYYSYKSVFEQMLEFPNLVLSYHNFEETPSNYMEIMSELTSLSPAVVKMAVMAKTEQDVLDVMNYTRGFKSLNTEQIFATIAMGELGKLTRIAGVITGSCWTFASLDETSAPGQMSLSNTRKFLEILEN
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q5M0M2
MKIVVPIMPTSLEEAQALELSRFEGADIIEWRADFLDKHSILTVAPAIFEKFAGFEIVFTIRTTREGGKIELTDGEYVTLIKDVAAIYSPDYIDFEYFTRKEVFDQMLGFSNLVLSYHNFEETPENLMELLSEMTNLTPRVVKVAVMPKNEQDVLDLMNFTRGFKAFNPEQEFVTMSMGKLGRLSRLAGDLVGSSWTFASLDNTSAPGQVALADMCRIREVLDAD
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q5M558
MKIVVPIMPTSLEEAQALELSRFEGADIIEWRADFLDKHSILTVAPAIFEKFAGFEIVFTIRTTREGGKIELTDGEYVTLIKDVAAIYSPDYIDFEYFTRKEVFDQMLGFSNLVLSYHNFEETPENLMELLSEMTNLTPRVVKVAVMPKNEQDVLDLMNFTRGFKAFNPEQEFVTMSMGKLGRLSRLAGDLVGSSWTFASLDNTSAPGQVALADMCRIREVLDAD
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q03LH6
MKIVVPIMPTSLEEAQALELSRFEGADIIEWRADFLDKHSILTVAPAIFEKFAGFEIVFTIRTTREGGKIELTDGEYVTLIKDVAAIYSPDYIDFEYFTRKEVFDQMLEFSNLVLSYHNFEETPENLMELLSEMTNLTPRVVKVAVMPKNEQDVLDLMNFTRGFKAFNPEQEFVTMSMGKLGRLSRLAGDLVGSSWTFASLDNTSAPGQVALADMCRIREVLDAD
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. 3-dehydroquinate = 3-dehydroshikimate + H2O Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 3/7. Homodimer. Belongs to the type-I 3-dehydroquinase family.
Q18KS0
MDIYGLIGNPVEHSLSPPMHEAAYDARGIDARYVTFEPTKDTLETAINGANALDIAGINVTIPFKQDVLNHIIPDDIAREVGAVNTIKFHDGETPRGYNTDVAGVKRAFQHHNISIDGYDAVVVGAGGAGRAAAFALADAGAHVHIANRTVERAETIATDIGGQATAGGLDTRDEISDADILLNATSVGMDPDSNQTPVPQSYLHDGLVVLDAVYTPIETRLLREATAAGATTIDGAWMLLYQGVVAFEIWTEQDAPIQQMNAALRAELEDA
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q17Z34
MGLKSFGVLGNPIKHSKSPLIHNACFLTFQKELGFLGHYHPILLPLESHIKNEFLNLGLSGANVTLPFKERAFQVCDKIKGIALECGAVNTLVLENDELVGYNTDALGFYLSLKQKNYQSALILGSGGSAKALACELKKRGLKVSVLNRSTKGLDFFQNLGCACFTTTPKGAFDLIINATSASLNNELPLDKEVLKGYFKESRLAYDLAYGFLTPFLSLAKELKLPFQDGKGMLIYQASLSFEKFSSSQISYSKAFEIMRSVF
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q7VGS3
MLGFFAVYGNPITHSKSPFLHNYAFTKLGLSGYYSRILLDKGANLRQNFLSNGLSGANITLPFKEEAFNQCDEVRGVAQNIGACNTWVLEDKNHLVGYNTDAQGFYECIKEYKIKNALIIGAGGSAKAVAMILQSHNIPTTLINRSVQNLSFFVHKGFECYVNSEFKPTCSYDILINTTSAGLNDNLLPCDESQLKELCSCGKYAFDLIYGKCTPFLALAQSFHLSCSDGKEMLINQAALSFELFCKQKYNKGNLEIQRIASFMNEIL
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
B6JN89
MKLKSFGVFGNPIKHSKSPLIHNACFLTFQKKLGFLGHYHPILLPLESHIKNEFLHLGLSGANVTLPFKERAFQICDKIKGIALECGAVNTLVLENDELVGYNTDALGFYLSLKQKNYQNALILGSGGSAKALACELKKQGLEVSVLNRSARGLDFFQRLGCDCFMEPPKSAFDLIINATSASLNNELPLNKEVLKGYFKEGQLAYDLAYGFLTPFLSLAKELEIPFQDGKDMLIYQAALSFEKFSASQIPYSKAFEVMRSVF
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
B5Z8P5
MKLKSFGVFGNPIKHSKSPLIHNACFLTFQKELGFLGHYHPILLPLESRIKNEFLHLGLSGANVTLPFKERAFQICDKIKGIALECGAVNTLVLEDDELVGYNTDALGFWLSLGGEDYQSALILGSGGSAKALACELKKQGLKVSVLNRSSRGLDFFQRLGCDCFMDPPKSAFDLIINATSASLNHELPLNKEVLKGYFKEGQLAYDLAYGFLTPFLSLAKELETPFQDGKGMLIYQASLSFEKFSASQIPYPKVFEVMRSVF
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q1CS13
MKLKSFGVLGNPIKHSKSPLIHNACFLTFQKKLGFLGHYHPILLPLESHIKNEFLHLGLSGANVTLPFKERAFQICDKIKGIALECGAVNTLVLEDDELVGYNTDALGFWLSLGDEGYQSALILGSGGSAKALACELKKQGLKVSVLNRSARGLDFFQRLGCDCFMEPPKSAFDLIINATSASLNNELPLNKEVLKGYFKEGKLAYDLAYGFLTPFLSLAKELKTPFQDGKDMLIYQASLSFEKFSASQIPYSKAFEVMRSVF
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q9ZJX8
MKLKSFGVFGNPIKHSKSPLIHNACFLTFQKELGFLGHYHPILLPLESRIKNEFLHLGLSGANVTLPFKERAFQICDKIKGIALECASVNTLVLENDELVGYNTDALGFYLSLKHQNYQNDQNALILGAGGSAKALACGLQKQGLKVSVLNRSARGLDFFQRLGCDCFMEPPKSAFDLIINATSASLHNELPLNKEVLKGYFKESKLAYDLAYGFLTPFLSLAKELKIPFQDGKDMLIYQASLSFEKFSDSQIPYSKAFEVMRSVF
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q56S04
MKLKSFGVFGNPIKHSKSPLIHNACFLTFQKELGFLGHYHPILLPLESHIKSEFLHLGLSGANVTLPFKERAFQICDKIKGIALECGAVNTLVVENDELVGYNTDALGFWLSLGGEGYQSALILGSGGSAKALACELQKQGLKVSVLNRSARGLDFFQRLGCDCFMDPPKSTFDLIINATSASLNNELPLNKEVLKGYFKEGKLAYDLAYGFLTPFLSLAKELETPFQDGKDMLIYQAALSFEKFSASQIPYPKAFEVMRSVF
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). It can also use NAD to oxidize shikimate. NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Inhibited by curcumin, 3-(2-naphthyloxy)-4-oxo-2-(trifluoromethyl)-4H-chromen-7-yl 3-chlorobenzoate, butyl 2-{[3-(2-naphthyloxy)-4-oxo-2-(trifluoromethyl)-4H-chromen-7-yl]oxy}propanoate, 2-({2-[(2-{[2-(2,3-dimethylanilino)-2-oxoethyl]sulfanyl}-1,3-benzothiazol-6-yl)amino]-2-oxoethyl}sulfanyl)-N-(2-naphthyl)acetamide, and maesaquinone diacetate. kcat is 5.2 sec(-1) for dehydrogenase activity with NAD (at pH 8 and 25 degrees Celsius). kcat is 7.1 sec(-1) for dehydrogenase activity with NADP (at pH 8 and 25 degrees Celsius). kcat is 7.7 sec(-1) for dehydrogenase activity with shikimate (at pH 8 and 25 degrees Celsius). Optimum pH is between 8 and 9. Optimum temperature is 60 degrees Celsius. Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
P56119
MKLKSFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPILLPLESHIKSEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECGAVNTLVLENDELVGYNTDALGFYLSLKQKNYQNALILGAGGSAKALACELKKQGLQVSVLNRSSRGLDFFQRLGCDCFMEPPKSAFDLIINATSASLHNELPLNKEVLKGYFKEGKLAYDLAYGFLTPFLSLAKELKTPFQDGKDMLIYQAALSFEKFSASQIPYSKAFEVMRSVF
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
A4G8N3
MSTMTDRYAVIGNPIAHSKSPDIHARFAAQTQQDMRYEPLLAPLDGFLATVQDFVRNGGKGVNVTVPFKLEAYALATTLTERARAAGAVNTLKFDGADMLGDNTDGFGLVSDIVRNAKVEIANKSVLLLGAGGAARGVLLPLLHEQPARLVLANRTHSKALDLAHRFAAQPRLKVSTFADLDDSFDIVINATAASLASEVPPISPRVFTAHTLAYDMMYGAQPTAFMRFAAQHGATVRDGLGMLVEQAAESFYLWRGVRPETAAVFAELRAQL
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
B0UWV8
MDKYAVWGNPIAQSKSPQLHRYFAKQTRQNLDYVAILGDEEKFEQQLSDFFAQGAKGCNITAPFKERAFKLAQQHSKRCLSAESCNTLKKLADGTLFADNTDGAGLVSDLQRLNWLKPNQRILILGAGGATKGVLLPLLQAQQNILITNRTFSRAEDLAHKFNQFGTIEALDLKHIPIQTFDLIINATSTGLQGKTIDINPQILQLASAVYDMQYSKESDTPFIALCKKQGVTKISDGFGMLVGQAAHAFYLWRGVMPEIDPLFSGNEIKI
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q31JC4
MTDLYAVVGNPIAHSKSPLIHRLFAEQTDQDLVYEALLIDTEDTTFQFAISDLIARGYRGINITVPFKLDAFELADELSPRAEVAHAVNTFSFKDGKIFGDNTDGIGLVTDIEENANRPFKDQKVLILGAGGAVQGILQPLLEKQPGLVHIANRTAKRAEVLGKRFETFSPITSSDWEGIPDQAYDIIINGTSASLEGKLPPINSNVVGQDSLVYDMMYGAEPTIFMQWAQQHQPSCQVRDGLGMLVGQAAEAFYIWRGVRPQTQSVIDEVRRLIQA
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q0C6A6
MTHLLGVVGDPVAHSLSPFIHNGWLRAHQIDAVYSAFEVKAGELVSGLQSLSSQGVIGLNVTLPHKEEAMRLATSVSGTAHRLGAVNFLVRREDGWIGDNTDAPGFGLTLDFGDIEVSGRNVFLLGAGGSARAVASVLADRGARLTICNRTVGRAEDLARDLAPGARVRSLDEGLRKLSSAALVVNTLSLGHSGGRLELPPSAGGIFYDISYGKGAEAALKEAREKGWRALDGLGMLVAQAAISFEHWFGIKPDMAEAHARCRKLVEATS
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q5QXJ3
MKSVTSLGVFGNPIAHSLSPRIHALFAQTRQDSINYQRYLSTPGHFPRRVAEFFRHGGQGANVTLPFKQQAASLVTKLSDRARLAGAVNTLIPYGNGLLLGDNTDGEGLIIDLKNKGLNVSERSLAVFGAGGSARGIIPLLLEQKPRCLYLVNRTAKKAEMLKSQLETLGLVAANRIQVRSSASEIDEPIDLLINATSSSLNGQRLTLPPLLSENASGYDLMYADQPTVFMEQLTQAGCKNVSDGFGMLIEQAASSYQLWMGDERPDTAFVMAEMRTPS
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
A8A8Z7
MLFAVIGHPIEHSLSPLLHKISFELMKVEAEYVKVDVPPHRLGDFMSSVDMIFNGINVTIPHKVEVLKYVDVADDLVNEVGAANTLKIKDGKIYAFNTDVEGVRGSIKDAVDPKGLKVAVLGAGGAARAAVVALRDEAQVTVFNRTLEKAKRLAEELGVDYAGLNEVDKIKKHDIIINATPVGMDGVSMPIPPDVIESRHVLMDMVYRPLYTPFLKVGLAKGAKTVNGLKMLVIQGMESEKVWLGASPYWRDVYERLLASLA
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
A6T2A5
MSTRTDHYAVIGNPIAHSKSPDIHARFAAQTQQDLKYDRLLAPLDGFLASVQEFIRNDGKGLNVTVPFKLEAYAMASRLSERARAAGAVNTLKFENGEMLGDNTDGVGLVTDIVRNAGVAVAGKTVLLLGAGGAARGVILPLLHEKPARLVIANRTHSKALDLAERFAPQPTLEVSDFGALDDAFDIVINATAASLASEVPPISPRVFAKRTLAYDMMYGAAPTPFMQFAAEHGATVRDGLGMLVEQAAESFYVWRNVRPETAAVFKELRDKL
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q28VZ9
MTRDTIPLAGVIGDPISHSLSPRLHGHWLRRYGLQGHYVPLHVNHANLETVLRTLPLMGFVGVNVTLPHKEHVLSIADSVTDRAALIGAANTLTFTANEQIQADNTDGMGFLSNIRQALPGWSASAGPALVLGSGGAAKAIVSALVSDGAPVVHVANRTRARADGLKEQFGARVSPSDWTHIPDLIGDAALIVNTTSLGMAGQSPLSLDLSRLSPPTVVTDIVYAPLQTNLLRDASIRGCETVDGLGMLLHQAVPGFERWFNYTPTVDEDLREAVLAG
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q9CES7
MNINGYTRMAAVVANPIKHSLSPFIHNLAFDLTNENGVYLAWEVEAEKLPAIVDNVRTLDMYGLNISMPYKTEITPFMDELSPAAELIGAVNTVVNQSGKLIGHNTDGIGFFNSLEKYHFNIQNKQMLILGGGGAAIAIIAQAALSGAKKIVVAARKSASYIPLKEKLEKLSVKTGIEILLTDLSEADRLQKELKQTDLLVNATSVGMDGESLPLEKSLVLPEKLLVVDAIYKVRETPFLRWAKGQGAQTENGLGMLIGQAAESFYLWTGKKMPVAEITLEMEKEA
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
A2RMH6
MKIDGYTRMAAVVANPIKHSLSPFIHNLAFDLTDENGVYLAWEVESKKLAAIVENVRNLDMYGLNISMPYKGEIIKFMDELSPAAELIGAVNTVVNHSGKLIGHNTDGIGFFNSLKKYDFKIENKQILVLGGGGAAIALIAQAALSGAKKIVVAARKSASYDPLNEKLAKLSAKTGVEILLTDLSGADRLQKELNQTDLLVNATSVGMDGASFPLEKSLLLPDKLLVVDAIYKVRETPFLHWAKEQGAQTENGLGMLIGQAAESFYLWTGKEMPVDKITLEMEREV
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q02XB7
MKIDGYTRMAAVVANPIKHSLSPFIHNLAFDLTDENGVYLAWEVESKKLAAIVENVRNLDMYGLNISMPYKGEIIKFMDELSPAAELIGAVNTVVNHSGKIIGHNTDGIGFFNSLKKYDFKIENKQMLVLGGGGAAIALIAQAALSGAKKIVVAARKSASYDPLNEKLAKLSAKTGVEIFLTDLSGADRLQKELNQTDLLVNATSVGMDGASFPLEKSLLLPDRLLVVDAIYKVRETPFLRWAKEQGAQTENGLGMLIGQAAESFYLWTGKEMPVDKITLEMEREV
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q0AZJ6
MPLDIKTELMGLIGYPLQHSLSPLMHNLTLKKMGLNCIYLALEIEEGKLPEIPSAIRTLNFRGLNVTIPYKEKIIPFLDELSPEAAAFGAVNVIKNKNGHLHGYNTDGRGFVEALREEGIDPGERALFIGAGGAARSVAFALAGLGVSRLDFLDLDFSRARQLAEFITSRSSSLASAFLMNTLEFQRLSRTASIIINCSPVGMFPDTGKSPVSKEDLRGSRAVLCDLIYNPLQSRFLSLGQELGLETMNGLGMFVQQGALTLEILLGQKPPLDYMKEVVQNQLEKRVDPD
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
P74591
MPSITGKTKLLGVIGYPVGHSLSPVMHNAALQAMASDYAYVAFPIAPEDLTIAIAGLGASGVQGLSVTIPHKQVVMPLLTQITETARQVGAVNTLWRDGHGWQGTNTDVEGFLAPLLELKQDWSGRTAVILGYGGAARAVVVGLTQLGCPEIIVVGRSQEKLAQFANSWTDPKIKQALQVLPWEALSTVIPKASLLINSTPVGMAPHPKQSPLDQSLVEKLPPTAIAYDLIYTPRPTRFLQHAQERGLVTIDGAEMLVQQGAAALKIWLQQEVPVDVMRQALLHHLEKSA
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q9HLE4
MNGNSIIGLIGHPVSHSIGQILYNRIFQDMGIDAFYLAMDVHMNVLPAFLKNSFFLKAFNVTIPHKVSIIPFLDDLDEIASQTRSVNLVIREQSRMKGYNTDYYGLDYALSFNQVEIEEKRIVIAGSGGIARTVIRYMLDHGAHRVDVLTRNAQNARRNLDIPGIGLHENIDEDYDIYVNCTPLGTLGDGDPFSTVDFRSGRTGIDLVYNPPDTPFLKRMRNAGGRTVSGLDVFIGQGLRTLELVFGIRPDSIFREYAVEALNEIRKG
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q5JFT1
MADAETRLYGVIGFPARHSLSPVMHNAAFRALGINAVYLAFEVPPEELGEAIGGAKALGISGLNVTMPHKEAVIHFLDSLSEDSGEIGSVNTVVNRKGRLEGHTTDGLGARRALERAIELGGRRILIIGAGGAGKAIAYELSRDNEVVVLNRTPEKAKALERFGITGDALNRENLGEYLEWAEVLINATSVGMNSWETPVPAELLRRDLVVMDIVYKPLKTRLLTEAELRGCKTVDGLWMLVYQGIESFRLWTGFKPDEGLMRGAALEGISE
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q9WYI1
MKFCIIGYPVRHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILEEYDGFNATIPHKERVMRYVEPSEDAQRIKAVNCVFRGKGYNTDWVGVVKSLEGVEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVKIFSLDQLDEVVKKAKSLFNTTSVGMKGEELPVSDDSLKNLSLVYDVIYFDTPLVVKARKLGVKHIIKGNLMFYYQAMENLKIWGIYDEEVFKEVFGEVLK
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
B9KBV5
MKFCIIGYPVSHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILEEYDGFNATIPHKERVMRYVEPSEDAQRIKAVNCVFRGKGYNTDWVGVVKSLEGVEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVKIFSLDQLDEVVKKAKSLFNTTSVGMKGEKLTVSEASLKGLYLVYDVVYFETPLVSDAKRLGVEHVVKGNLMFYYQAMENLKIWGIYDERSFKEVFEEVLR
NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Belongs to the shikimate dehydrogenase family.
A5IK72
MKFCIIGYPVSHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILEEYDGFNATIPHKERVMRYVEPSEDAQRIKAVNCVFRGKGYNTDWVGVVKSLEGVEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVKIFSLDQLDEVVKKAKSLFNTTSVGMKGEKLTVSEASLKGLYLVYDVVYFETPLVSDAKRLGVEHVVKGNLMFYYQAMENLKIWGIYDERSFKEVFEEVLR
NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Belongs to the shikimate dehydrogenase family.
B1L9E4
MKFCIIGYPVSHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILEEYDGFNATIPHKERVMRYVEPSEDAQRIKAVNCVFRGKGYNTDWVGVVKSLEGVEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVKIFSLDQLDEVVKKAKSLFNTTSVGMKGEKLTVSEASLKGLYLVYDVVYFETPLVSDAKRLGVEHVVKGNLMFYYQAMENLKIWGIYDERSFKEVFEEVLR
NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Belongs to the shikimate dehydrogenase family.
Q72JT0
MLRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRRAFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTVLQVEGRLFGFNTDAPGFLEALKAGGIPLKGPALVLGAGGAGRAVAFALREAGLEVWVWNRTPQRALALAEEFGLRAVPLEKAREARLLVNATRVGLEDPSASPLPAELLPEEGAVVDLVYRPLWTRFLREAQERGLKVQTGLPMLAWQGALAFRLWTGLLPDPSGMEEAARRALGV
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q5SJF8
MLRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRRAFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTVLQVEGRLFGFNTDAPGFLEALKAGGIPLKGPALVLGAGGAGRAVAFALREAGLEVWVWNRTPQRALALAEEFGLRAVPLEKAREARLLVNATRVGLEDPSASPLPAELFPEEGAAVDLVYRPLWTRFLREAKAKGLKVQTGLPMLAWQGALAFRLWTGLLPDPSGMEEAARRALGV
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q8DLA6
MPKISGQTQLLGVIGDPIEHTLSPAMHNAALEYLGLNYVYVPFWVKPQQLGVAIAGLEALNVVGFNVTIPHKETILPYLADVSDLAQQVGAVNTVYRSEKGWVGTNTDVHGFLAPLRQQSCLWSEIAVLVLGYGGAARAVVTACYDLGCRQIYISGRQRERLGAFVASWPQITLHPLLWSERATCLAKISLVVNTTPIGMSPHTGATPLTAEDLAKLPATAIVYDLIYKPRPTLLLQLAMARGLQTFDGLAMLLHQGAAALEYWLGQPAPTAIMATALETALGTEK
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
Q978S5
MMPPDYVFGLIGHPVSHSIGQIVYNRYFQKKGLNAIYLSIDIFPETLKYFMSYASKMDGFNVTIPHKISIMDYLDQIDWEARSIGSVNLVKTEDGLLKGFNTDYYGIEYMFKKGGVDVSGKSIVVAGSGGIARTVIHYLIKNNAKSVTVKARDVKLAKNKLNAYDVDIKEYANNDYDIYINCTPLGTEAVGDPFPEVQFGKGKIAVDVVYNPPVTPFLKRAGISGSKTLSGLDLYIGQAIKTLDILTSGCDIDTLINSVRVAVNEVR
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.
B5YJ55
MITGKTKIIGIFGDPIEHTLSPLIHNEAFSYLGLDYCYVAFNVKKDKLKEAVEAIRALNIRGVNITVPHKETVIQYIDELSDEVKNIGAVNTILNNEGILKGFNTDVNGFILSLKDEGISMKNKNFLILGAGGAAKAIVYGILKEGGKVYIYNRTPSNALAIKEKFKKFGFIEIVEMDKSVTEKIDVIVNATSLGLKKDDPMPLNPELIKPEHVYCDIVYPETPLMREAERIGCKVVGGIGMLLWQAAFAFKIWTEVEAPIEIMKKTLNKLLTKD
Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). NADP(+) + shikimate = 3-dehydroshikimate + H(+) + NADPH Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 4/7. Homodimer. Belongs to the shikimate dehydrogenase family.