UniProt ID stringlengths 6 10 | Protein Sequence stringlengths 2 35.2k | Functional Description stringlengths 5 30.7k |
|---|---|---|
X2BHY3 | MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRERDAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQQVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q7AM16 | MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A4XAW6 | MFLAAEGSHNPILPIWQELVVGTIAFALLVFVLLKFVMPRMETMYQARVDAIEGGLKRAEAAQAEANQLLEQYRAQLAEVRTEAARIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERTTIVRELRTEVGTLAVDLAGKIVGESLADEARRAGTVDRFLNGLESAGAR | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q7CPE4 | MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
O94373 | MSSKLFCLRSFPSVQRTAWQRLVLPSTRKFSLTPTTFDKTPSGRIPPDQKAANIISSVPSTSLLTKSGVLTVTAAALATAISKGIYVVNDESIVVASFLGLVGVFGTLGRKAYNEWSDKTIAKIGGIMQAARNDHTSAIRERIDQVASLQEVESVTQALFHTSKETARMEAEIFELEQRVALAKEAKSVLDSWVHHEANVRAEQQERLVEDVLARVNSKVSTQKFQQDALNESLGEIEKVLASA | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. In yeast, the dimeric form of ATP synthase consists of 17 polypeptides: alpha, beta, gamma, delta, epsilon, 4 (B), 5 (OSCP), 6 (A), 8, 9 (C), d, E (Tim11), f, g, h, i/j and k (By similarity). Belongs to the eukaryotic ATPase B chain family. |
A8G7M4 | MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLASAERAKKDLDLAQANATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A1SBU4 | MNINATLIGQTVAFIIFVWFCMKYVWPPLMNAIEERQKRIADGLANADRAAKDLELAQAKATEQLKEAKATANEIIESANKRKAQIVEEAKAEADAERARIIAQGKAEIEAERNRVKEELRKQVATLALAGAEKILERSIDAAAHSDIVEKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A3DAR8 | MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEANAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A6WUJ4 | MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A9KX10 | MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q12HP7 | MNFNATLIGQSVAFLIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELARSKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAILGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q07VU0 | MNFNATLFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIKATEQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDLRKQVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
B0TQF8 | MSINATLLGQAISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVKATEQLKDAKATANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDLRKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A3QJR4 | MNINVTLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q8E8B6 | MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A8HAG7 | MSINATLLGQAISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVKATEQLKDAKATANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDLRKQVAILAIAGAEKILERSIDEAAHSDIVNKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A4YCI2 | MSINATLLGQAISFALFVWFCIKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQAKATEQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIENERSRVKDDLRKQVAALAVLGAERILERSIDQAAHSDIVDKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A0L2T2 | MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A8G1W9 | MNINATLLGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQSKATDQLKDAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGQAEIEAERNRVKEDLRKQVATLAIYGAEKILERSIDEAAHSDIVNKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q0HD75 | MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q0HPF7 | MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A7FPE4 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q1C091 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
B2K843 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q74P97 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A9R5U3 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
D1Q305 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
A4TSI9 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q663Q4 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
B1JRM8 | MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family. |
Q32RL0 | MGERIKSTMDLLIYLQNSHLATGFGFNTNLFETNLINLAVVIGVLVYFGKGVLTTLLNNRKETIVNTIRDAEERYQEATEKLNKAYTRLEQAKAKAEEIRVNGLAQMEIEKQELIKAADEDSKRLEDSKNATLRFEEQRAIEQVRQQVSRLALELALETLKTRLNRDLHAQMIDYHIGLLQSMESVID | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has four main subunits: a(1), b(1), b'(1) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta, b and b' chains. In plastids the F-type ATPase is also known as CF(1)CF(0). Belongs to the ATPase B chain family. |
Q01908 | MACSNLTTMWVSSKPSLSADSSSLSFRSVLKCPTNTSSPPSRASSVSPLQASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVTGDRGLCGGFNNFIIKKAEARIKELKGLGLEYTVISVGKKGNSYFLRRPYIPVDKYLEAGTLPTAKEAQAVADDVFSLFISEEVDKVELLYTKFVSLVKSEPVIHTLLPLSPKGEICDINGTCVDAAEDEFFRLTTKEGKLTVERETFRTPTADFSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAMSSASDNASDLKKSLSMVYNRKRQAKITGEILEIVAGANAQV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a, b, b' and c (By similarity). Interacts with PAB (PubMed:25775508). By light. Belongs to the ATPase gamma chain family. |
Q6LLG7 | MASAKEIRNKIGSVQNTQKITKAMEMVAASKMRKTQDAMESSRPYAETMRKVIGHIALGNLEYKHPYLEVREAKRVGYIIVSSDRGLCGGLNINLFKSAMTDIKGWADQGADVEMALVGAKATAFFNSYGGNVVAQVSGLGDSPTVNELIGTVGVMLKKYNEGLLDRLYLVYNQFVNTMIQEPVIDQLLPLPKSKDEEMQRNHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMVAMKSATDNAGDIINDLQLVYNKARQAAITQELSEIVSGASAV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q01909 | MTGSISTSWLLSSPSNSNSASSSESYSFIATLKPVRYYPFQSLTPNRISSRSPLPSIQIRAGIRELRERIDSVKNTQKITEAMRLVAAARVRRAQDAVIKGRPFTETLVEILYSINQSAQLEDIDFPLSIVRPVKRVALVVVTGDKGLCGGFNNAVTKKATLRVQELKQRGIDCVVISVGKKGNAYFSRRDEFDVDKCIEGGGVFPTTKEAQVIADDVFSLFVSEEVDKVELVYTKFVSLVKSDPVIHTLLPLSMKGESCDVKGECVDAIEDEMFRLTSKDGKLAVERTKLEVEKPEISPLMQFEQDPVQILDAMMPLYLNSQILRALQESLASELASRMNAMSNATDNAVELKKNLTMAYNRARQAKITGELLEIVAGAEALRES | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a, b, b' and c (By similarity). By light. Belongs to the ATPase gamma chain family. |
Q6LKZ7 | MANAKEIRTKIASVQNTQKITSAMEMVAASKMRKVQDNMAATRPYAENMRKVISHVASGSLEYKHPYLEEREAKRVAYIIISSDRGLCGGLNSNLFKRALTDMRQWQEKNVEVDLTLIGSKAISFFHRFGNVIAQTSGLGDKPKLEDLLGAVTAMLEHFDDGKIDRLYLVYNEFVNTMVQNPRITQLLPHPDKDESQDSKPNDATSRWDYIYEPDPKDILNALMLRYIESQVYQGTVESIACEQAARMVAMKSATDNAGDIINDLQLVYNKARQSAITQELSEIVAGAQAV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q7GB12 | MAMAVFRREGRRLLPSIAARPIAAIRSPLSSDQEEGLLGVRSISTQVVRNRMKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQPFTALLGDNPSIDVKKSVVVTLSSDKGLCGGINSTVVKVSRALYKLNAGPEKEVQFVIVGEKAKAIMFRDSKNDIVLSVTELNKNPLNYAQVSVLADDILKNVEFDALRIVYNKFHSVVAFLPTVSTVLSPEIIEKESEIGGKLGELDSYEIEGGETKGEILQNLAEFQFSCVMFNAVLENACSEMGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALEAAK | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
P26360 | MAMAALRREGRRLAAAPFTSPTPLNALRSSLVSPSEEIGLSGVRSISTQVVRNRMKSVKNIQKITKAMKMVAASKLRAIQTRAENSRGLWQPFTALLGDTPSVDVKKNVIITISSDKGLCGGINSTSVKTSRNIHKLNSGPEKENKYVILGEKAKAQLVRDSKKDIELIITELQKNPLNYTQVSVVADDILKNVEFDALRIVFNKFQSVVSFVPTMSTVLSPEVVERESESGGKLGDLDSYEIEGAESKSEVLQNLTEFQFSSVLFNAVLENACSEQGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALEG | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
P80084 | IGTQIVXNXMKSIKNIQKITKAMKMV | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B0BZL3 | MPNLKSIRDRISTVKNTKKITEAMRLVAAAKVRRAQEQVTATRPFADRLAQVLYGLQARLKFEEVELPLLQERALRKVCLLVVTGDRGLCGAYNSSVIKRAEERSNELKAKGIDYTFVLVGRKAIQYFQRRDQPIEATYGGLEQIPTAQEASEIADELLSLYLSEEVDHVELIYTRFISLVNSRPVVQTLLPLDPDALVVAEEDEVFRLTTRGGQFQVERERMERGTPQEMPSDMIFEQNPIQILDALLPLYLNNQLLRALQESAASELAARMTAMNNASDNASELIGTLTLSYNKARQAAITQELLEVVGGAEALN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A3DIM8 | MAHINEIKLRMKSIRETRQITNAMKLISAAKLKKAKKQLEKASPYFEKVRSTMADILLRSGKIENKYFHARDEKTDKKKAYIVITGEKGFAGGYNHNIIKFTEECLKQDKDPLLFVAGNVGRNHFLKNKYNVYMEFDYPVQNPSIYMAREIMEVILDLFDKEVFDELYIIYTHMFSNIKMEPSIIKLLPLELDTLKEKLQINESTEKIVDGCMEYEPDPEYVFNVLVRKYIKGVVYGAFVESFTSEQNSRMTAMDNATANANDMLKKLDLLYNRARQSKITQDITEIVGGAEALK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
H6LG95 | MAENVQDIKRRIKSVNSTMQITHAMELVASAKLRKSRELAEGRRPYFEAMIESIGRIVEKSGNARNIFMDQREVKKTAYIIITGDKGLAGGYNVNVAKLVEEHITDKENAVLFTVGSRGRDHFRNREYHIQGEYLGISERPNFFNAKEVTAIVMEGFKNGEYDEVYIAYTKFVSTITQHAQMMKLLPLSAEELITSGKVKTTEETKEEKSKMSDRELTIMTYEPEPEELLKYLIPNFVSSTVYGSMIESAASEQGARRTAMESATTNANEMIDGLTLQYNRVRQAAITQEISEIVGGAEALN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Inhibited by nitrate. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A1VXI9 | MSNLKEIKRKIKSVYNTQKTTNAMKLVSTAKLKKAEEAAKRSKIYAQKIDEILSEISVQINKIVHNEDDVRLFLFHKKEQIKTVDLIFITADKGLCGGFNIKTLKTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHAAVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGTELLEDLIKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITTELIEIISGVESMK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q5HX60 | MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLKKAEEAAKRSKIYAQKIDEILSEISFQINKIVHNEDDVRLSLFHKKEQIKTVDLIFITADKGLCGGFNIKTLKTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHAAVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGTELLEDLMKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITTELIEIISGVESMK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B9KES2 | MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLRKAEEAAKKSKVFAQKIDEVLSEIAFKINQYEGLDDKLPFFRKKDNIEKMDIIFVTADKGLCGGFNIKTIKAVNEMLEDCKTKKIKVRLRAIGKTGIEYFNFQNIEILEKYLDTSSSPDYDKACAIIQKAVDDFVNGVTDKIVIIHNGYKNMISQEIRINELLPVEAIVSKEEQKSESLMDLEPEDEEILNDLLKTYFEYNMYFSLVDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITTELIEIISGVESMK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q3A945 | MPSMRDLRRRIKSIKNTQQITKAMKMVAAAKLRRAQEMVVASRPYAKRIKDVLARAAAATTETAHPLLIKREVKATGYVLITADRGLCGGFNANLIRKATVELKEFSNPKLITVGRKGRDFFKKRGYEIVGEFTNLGESISFDAARVIAGFIMEKYLDGTFDEVYLVFSEFVNPLVQRPQTLKLLPLEAPAEESGGGEYIFEPSADAVLNTLLPKYVEVQVYRALLESKASEHGARMTAMDTATENATEMIAKLTLQLNRARQAAITKEIAEIVGGAAALEA | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B0T336 | MASLKEMRNRIASVKATQKITKAMQMVAAAKLRRSQDAAEAARPYARRLAAVIANLAAGVTGDGAPPMLAGTGRDDRHLIIVAAADRGLAGGFTSSIVRAARERIETLIAQGKDVKIVCIGKKSTAQLRRLYSDRIVEDFDLSAYRQFTLTVAQPIADVVTRLYEAGDVDVVTLFYSRFKSVVIQTPTALQLIPATVDGANAPAAAQGAQAVYEYEPSEEEILETLLPRNLTVQILSALLDNMAGFYASQMTAMDNATRNAGDMIKRYTLEYNRSRQAQITKELIEIISGAEAV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q9A2V8 | MASLKEMRNRISSVKATQKITKAMQMVAAAKLRRSQDAAESARPYARRLASVIANLAAGVSGDGAPKLLAGTGRDDRHLVVVAAADRGLAGGFTSSIVRAARAHIDGLIAQGKDVRVVCVGKKVTAQLAKPYAGRIVETFDLSSYRQLTLSVAQPIADVITREYEAGETDVVTLFYSRFKSVVQQIPTGLQLIPAVVETGEAASGPTAVYEYEPSEEAILETLLPRNLTVQILSALLDNMAGFYASQMTAMDNATRNAGDMIKRYTLEYNRSRQAQITKELIEIISGAEAV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B8H5I1 | MASLKEMRNRISSVKATQKITKAMQMVAAAKLRRSQDAAESARPYARRLASVIANLAAGVSGDGAPKLLAGTGRDDRHLVVVAAADRGLAGGFTSSIVRAARAHIDGLIAQGKDVRVVCVGKKVTAQLAKPYAGRIVETFDLSSYRQLTLSVAQPIADVITREYEAGETDVVTLFYSRFKSVVQQIPTGLQLIPAVVETGEAASGPTAVYEYEPSEEAILETLLPRNLTVQILSALLDNMAGFYASQMTAMDNATRNAGDMIKRYTLEYNRSRQAQITKELIEIISGAEAV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A3PIB8 | MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVHLLVVMTAERGLCGGFNSSIVRLARAHAAKLLTQGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDLLDRFDKGEFDVATIFFARFQSVISQVPTAQQVIPAVFEGEGEVSSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIEYNRSRQAAITKELIEIISGAEAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q3J432 | MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVHLLVVMTAERGLCGGFNSSIVRLARAHAAKLLTQGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDLLDRFDKGEFDVATIFFARFQSVINQVPTAQQVIPAVFEGEGEVSSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIEYNRSRQAAITKELIEIISGAEAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A4WUM8 | MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVQLLVVMTAERGLCGGFNSSIVRLARAHAAKLLAEGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDVLDRFDKGEFDVATIFFARFQSVISQIPTAQQVIPAVFEGEGEVNSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIQYNRSRQAAITKELIEIISGAEAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B9KPI7 | MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVHLLVVMTAERGLCGGFNSSIVRLARAHAAKLLTQGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDLLDRFDKGEFDVATIFFARFQSVISQVPTAQQVIPAVFEGEGEVSSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIEYNRSRQAAITKELIEIISGAEAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q11DD6 | MPSLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQEAAEAARPYAERMDAVLANVSASISGADAPPLMAGTGKDDVHLVVVCTADRGLAGSFNSQIARLAREHIRKLQANGRQVKIITVGKKGYDLLRRDFGKLVIDRIELREVKQIGFANADAIAKKVIGLFEAGEFDVCTLIYSRFKSVISQIPTEQQIIPAAVPQAEGESTGAIYEYEPDAGAILADLIPRNIAVQIFRALLENAAGEMGAKMTAMDNATRNAGEMINKLTITYNRQRQAQITKELIEIISGAEAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A9WGS5 | MPSSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTARVVGAARRGTLLEKRETVKSVALLVVTPDRGLCGSLVANVLRRAGRFITEQRAMGRTVDVYTFGRKGRDFFLRTGFAPAGEATRLGDAPKLEAILGVAISAINGFQSGKYDELYIIYSEFINTLVQRPAIKQLLPVESPDISTTTNVDYTYEPGEEEVLNSILPRYVETQIYQAVLESIASEHSARMVAMRNATNNAKDLVRDLTLSFNKARQAAITKEVSEIASGAAALTS | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B8G6G7 | MASSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTARVVGAARRGTLLEKRETVKSVALLVVTPDRGLCGSLVANVLRRAGRFITEQRAMGRTVDVYTFGRKGRDFFLRTGFAPAGEAIRLGDAPKLEAILGVAISAISGFQSGKYDELYIIYSEFINTLVQRPAIKQLLPVESPDISTTINVDYTYEPSEEDVLNSILPRYVETQIYQAVLESIASEHSARMVAMRNATNNAKDLVRDLTLSFNKARQAAITKEVSEIASGAAALIS | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q3AUA6 | MATLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQDRAIMARPYASKLKEMLASLSAKVDTSVNPLFAVRSEVNKVLVILVTSDRGLCGAFNGNIIKLAYKTIHEDYAAQYGKGGVSMICAGTRGYEFFKKRHYTLTKGYPAVFQNLDFAVAKEIADMASNMYLRGEVDRVVVVYNEFKSVLAPQLKSEVLLPITSGDASAKENSGGEYMYEPNPAAIIDVLLPKHLRTQVWRIMLESNAAEQAARMAAMDSATENAKELLRTLNISYNRARQAAITTELSEIVAGAEALNG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B3EHU5 | MPTLKDIRVRIKGIKSTQQVTKAMKMVAAAKLRRAQERAIMARPYAGKLKEMLGSLSAKVDTSLNPLLSSRQDVKKVLVILIAADRGLCGAFNTNIIKLAQKVVTEDYAAQYKNGGVSMICAGSRGFDFFRKRGFSIVKGYPSVFQNLDFSVAKEIAETASGMYLRGEADKVIVVYNEFKSVLAPVLKAEDLLPIAAENAGKDNSGDYIYEPSPAVIIDELVPKHLSTQVWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVAGADALKN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q3B1F5 | MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRKAQERAVMARPYAAKLKEMLGSLSGKVDTSASPLLADRADASRVLVVLITSDRGLCGAFNTNIIKLAHRTIHEEYAAAYAAGNVQLICAGTRGFDFFRKRGYSVLKGYPAVFQNLDFSTAREIAETASSMYVKGEVDRVVVVYNEFKSVLAPTLKAEVLLPIKSELPVAEGGDYIYEPSPAAIIEELVPKHLNTQVWGMMLESNAAEQAARMTAMDSATENAKELLRGLNISYNRARQAAITKELSEIVGGADALQN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B3QL62 | MPTLKDIRIRLKGIKSTQQVTKAMKMVAAAKLRRAQDRAIQARPYAGKLKEMLASLSTKVDTSLNPLLSPREEVNKVLVVLVTSDRGLCGGFNANIMKLAQRVIHEDYAAQHAKGAVTMICAGTKGSDFFRKRGYNVTKAYPGVFQNLDFSSAKEIAELASQMYLKGEADKVILVYNEFKSVLAPNLRTEQLLPIAPEEGTEEAAGSEYLYEPSPEAIIDELVPKHLNTQVWRVMLESNAAEQAARMAAMDSATENAKELIRVLNISYNRARQAAITKELSEIVAGADALKQ | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B3EL40 | MATLKDIRTRIQSIASTQQVTKAMKMVSAAKLRRAQDSAIQARPYAAKLKEMLGSLSTRVDTTLNPLLSDRDEVKNVLVVVITSDRGLCGAFNANIIKIAQKVVTEEHGDLYRDGKVEMLCAGSKGNDYFRKRGFSISKAYPGLFQNLHFSVAREIAEYASERYLKGEVDKVVVVYNEFKSVLAPVLKSEVLLPITPEKVEGEKTGSSIDYIYEPSPSAIIDVLVPKHLNTQIWRMMLESNAAEHASRMTAMDSATENAKELMRVLKISYNRARQAAITTELSEIVAGAEALQGE | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A1BJF4 | MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAIMARPYARKLKEMLGSLSDKVDTSLNPLLSNRSEVNKVVVILITADRGLCGAFNTNIVKLAYKLIHEDYAAQHSKNGVSLICAGSRGFDFFRKRGYNIIKGYPGVFQRLDFSFAKEIAETVSGMYLRGEADRVVVVYNEFKSVLAPVLKFETLLPITPEASGKDGGSDYIYEPSPESIIDVLVPKHLNTQVWRVMLESNAAEQAARMSAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGADALKG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A9KK93 | MASMRDIKRRKESIQSTGQITKAMKLVSTVKLQKAKSKAENAKPYFDHMYDTVLNMLRKSGNISHPYLSAGKSNKKAIIVITSNRGLAGGYNSNILKLVMSSDINKEDAVVYAVGRKGKEALARRGYHIAKDYSEVMNAPIYKDAIEIGKAVLDAFVADEVGEIYLAYTSFKNTVSHEPTLIKLLPVDMEAALQEGEKSEDLNERLTLMNYEPAAEEALNLIIPKYINSLIYGALVQALASENGARMQAMDSATNNAEDMISDLSLKYNRARQSSITQELTEIIAGANAIN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
F9UQR4 | MAESLMDVKRRIDSTKKTHQITSAMQMVSTSKLNQIQKHTSTYQVYASKVESIVSHLAKAHLMSASAGVANSNSNTISVSELLAQRPVKKTGLLVITSDRGLVGSYNSNVLKQTNDFMRTHKVDADNAVVLAVGGTGADFYKKNGLNVAYEYRGVSDVPTFKEVREIVKTVTSMYHNEVFDELYVFYNHFINRLSSGFRAVKMLPISEETFEQSESDNRKAKDSRVDVGPEYEMEPSEEAILSAVLPQYAESLVYGAILDAKTAEHASSSTAMKAASDNAGDLIDKLNLKYNRARQAAITTEITEITGGLVAQE | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
C1D5G3 | MAVGKEIRSKIKSVQSTQKITRAMQMVATSKMRKTQERMRSARPYAEKIREVMAHVAETNPDFKHPALERRDVVKRVGVILVTTDKGLCGGLNANALRTFYQYAERWAEQGIEVDVCCFGQKGYAALTRLDMKVVSSATQLGDTPQQEKLLGPASHIVRAYLDGEIDELHIVYSKFLNTMKQEPRVEQLLPLKTEELESEFPYSWDYLYEPDVRGVLDVLVRRYLESVVYQAVSENMASEQSARMVAMKAATDNAAQAIERLKLTYNKARQAAITTELSEICAGAAAV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q38WK4 | MAESLMDIKRRIASTKKTGQITSAMQMVSGAKLSQIEKNSVAYQVYTDKIREIVTHLAASQLIDIARQKSSLQAEPADSTIKKAIKHEVTLSNLLVERPIKKTGYLVITSDRGLVGAYNSSILKAMVQMISETHQSPDEYAILAVGGTGADFFKARGMNLTYEYRGVSDVPSFEEVKQIIKTAVAMYDNGVYDELYVCYNHHVNSLTSGFRAEKMLPITDLDVSEVADQNLEYITEPSVDDALDAILPQYAESLIYGAMLDSKTAEHAASMAAMKSATDNANNLISELSIKYNRARQAQITTEITEIVGGAAALE | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q1MP34 | MASLKDVKIKIAGVRKTKQITKAMNMVASAKLRGAQIKIEHFRPYAEKFQDVISNLATRSDETVHKLLEKRTNGTSCIFILITSDRGLCGIFNTMLIIKALELAKQKTTKGKKVSFICIGRKGRDAIKKTHYPILSDYSDKFTRDYQLASHISEKVIDGYLTVNMDEVVLIYGQFINAMRQIVGFSTLLPIHPKPLDKEQLEKYSEYIYEPGVAILLSELLPKFVTTQIYRGFLDTDASENAARMTAMDNATRNCDELIGNLTRLYNKTRQASITSELIDIVSGAEALK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q5X0P2 | MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGAIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A5III4 | MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGTIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q5ZRA0 | MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGTIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q5WSG7 | MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGTIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q6AG59 | MGAQLRVYRQKIKSAHRTKKITRAMELISASRIQKEQARVAASSPYARAITRAVSAVATYSNVGHVLTTEPEKIERAVIVIFSSDRGLAGAFNSNVLKESEKLAELLRSQGKEVVYFLIGRKAQGYFSFRRRAFERVWTGNTDAPEFEQAKEVADAILESFLRDSADGGVDEIHVIYNRFVSMLTQEPQVVRLLPMEVVEGVEEPDRTQVLPLYEFEPDVNTVLDSLLPVYIESRIFNAMLQSAASKHAATQKAMKAASDNADKLITDYTRLANNARQAEITQQISEIVGGADALSSAN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B0SDA4 | MATPREIKKRINSVKNTRKITRTMEMVSTAKAKKATNKVNAAKPYADLTRELVSSLSSLASIIHSPYLRKPDKIRKVAILAIAANRGLCGGFNSNLLRMVKNRIEELKSKGVEVEVHAAGKKAISFFKFAKVELVTSYTNIDDKAGSKEANDLASYFMERFANESVDSVEIISTHYYSAANQKPETTTVLPLQMEETGSKGSSGPEVLYEPDPKTILENLLPMVIKTTFVKIILESVASEHIARRVAMKAATDAAGEMIKLLTRGYNRVRQAKITQEISEIVGGAEAIS | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q04S17 | MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLSGVVHSPYLRRPEKIKTVALLVITANRGLCGGYNSNVNRLAKAKVAEWKKAGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYKEAEEFANLFLELFANEEVDAVEIASTVYYSSASQKPEVTRILPFEPAKEGNGNDLVVYEPSPERVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q04ZU4 | MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLSGVVHSPYLRRPEKIKTVALLVITANRGLCGGYNSNVNRLAKAKVAEWKKAGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYKEAEEFANLFLELFANEEVDAVEIASTVYYSSASQKPEVTRILPFEPAKEGNGNDLVVYEPSPERVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B0SLC7 | MATPREIKKRINSVKNTRKITRTMEMVSTAKAKKATNKVNAAKPYADLTRELVSSLSSLASIIHSPYLRKPDKIRKVAILAIAANRGLCGGFNSNLLRMVKNRIEELKSKGVEVEVHAAGKKAISFFKFAKVELVTSYTNIDDKAGSKEANDLASYFMERFANESVDSVEIISTHYYSAANQKPETTTVLPLQMEETGSKGSSGPEVLYEPDPKTILENLLPMVIKTTFVKIILESVASEHIARRVAMKAATDAAGEMIKLLTRGYNRVRQAKITQEISEIVGGAEAIS | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B1Y3S8 | MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYADKIRNITANLSRATPEYHHPFVVKNSGSGVVGMIIVTTDKGLCGGMNTNVLRLVTNKMRELDAAGTKVQAVAIGNKGLGFLNRIGAKVVSQATQLGDTPHLDKLIGPVKVLLDLYAEGKLDAVYICYTRFLNTMKQEPQVEQLLPLSDERLSQSAAEQQSHGWDYIYEPDAQAVIDNLMVRYAEALIYQSVAENMASEQSARMVAMKAATDNAGSLIGELKLVYNKTRQAAITKELSEIVSGAAAVG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q72SY0 | MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLGGVVHSPYLRRPEKIKTVALLIITANRGLCGGYNSNVNRMAKAKIQEWKKSGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYREAEEFANLFLELFAKEEVDVVEIASTVYYSSASQKPEVTRVLPLEPAGEGSVSDMMVYEPSPEKVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B1MW86 | MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQRYGRGYQAYAARLEAVVEHLVAAHLFDNADAKHIPLIAQRPIRKTGILVVTSDRGLVGSYNANVIKQTNALMARLNLDTTNTAILAVGGNGADFYKKRGFEVILEHRGVSDVPSFNEIRSVVKTVTSLYESEVFDALHVVYNHFVNRLTSEYRDVQLLPLTGDTLVAMGGTEAHKAELDIQSAYEVEPDTTAVLNVVLPQFAQSLVYEAVLDAKTAEHAASSTAMKAATDNAKDLIGRLELQFNRARQAAITTEITEITGGMAALE | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q03V28 | MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQKYSAGYGSYAARLEAVVEHLVSAHLFDNADADHIPLIAQRPIKKTGILVVTSDRGLVGSYNANVIKQTNVLMQNLNLDTSNTTILAVGGNGADFYKKRGFEVILEHRGVSDVPTFNEIRSVVKTVTSLYENEVFDALHVVYNHFVNRLTSEYRDVQLLPLTGDTLNAMGGTEEQKAELNVQATYEIEPDTTAVLNVVLPQFAQSLVYEAVLDAKTAEHAASSTAMKGATDNAKDLIGRLELQFNRARQAAITTEITEITGGMAALE | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q03QY7 | MAESIHDVQRRINSTKATRQITSAMHMVSTAKLNKIQKQAVGYQDYVSKVKAVVMHLSQSHLLDNSSSSLQSNRPVKKTAYLVITSDRGMVGSYNSSVLRDTNAFIKERTPNPDDYMVLAVGGTGADFYKHRGVNVAYEYRGVSDVPEFNEVREIVKTVTTMFNNEVFDELFVCYNHFVNRISSRFRAEKMLPVDKETMSTDAAKDTQAAPLTAEYDTEPSEEEVLQVVLPQYAESLVYGAILDAKTAEHASSTNAMQSATDNADDLIATLQLHYNRARQAAITTEITEITGGQEALNN | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q1WUC7 | MPASLQEVKRRIESTKKTSQITSAMQMVSTAKLSQIQKHATSYQVYATKIRSVITHLSKSHLLDSVNTTSKNSDGKVNTLGMLRQRPVKTTGIVVITSDRGLVGSYNSNVIKETLELIENNHHSTEDVAIIAIGGTGADFFKKRGYNVAYEYRGISDIPTYKDARPLVEAIVSMYDKEVYDELFVCYSHFVNTLTSEFRAEKMLPVSAENMGHDDLTSNDEGYSIEYETEPSEDAILEVVLPQYAESLVYGAILDAKTSEHASSSTAMKSASDNAKDIISSLELQYNRARQSAITTEITEITGAQAALE | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A6QB60 | MANLKEIKRKISSVKNTQKTTNAMKLVSSAKLKRTEELAKRSRVYAAKLTELIEEIAQKMQHASAEGLDNIFFQENNNPKKVDIIFITADKGLCGGFNSQTIKRTSQMIAEYQSKGAKVRLRAIGRKGIDYFKFNNVELDDAIVGLSAAPDYKQSSEFISEVVTSYVNGDTDRIVLVHNGYVNMITQEIREDQILPVDASQLELSTVSTSEMEVEPDDDDTLLDALVKRYVEYSIYYALIDSLAAEHSARMQAMDAATKNAKEMVKDLNVKYNKARQEAITTELIEIISGMESMK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B2V6N5 | MAKLSPRDIKRKINGIKNTQRITKAMKAVSAAKLRKAQALLYATRPYSNKLYELIEDLAVYIDRESHPLLEKREEKSVDLVIITADRGLAGAFNSNVIKTAWREIQRLKSEGKEVSLLLIGRKGVNFYKNKGFNIIEAYEDIYRDQVNLTYTAKVGGILASRFIDKKSDAVYLINNELITSSTYETKIRKLLPLESTASSKKLEEVSVYNIEPSKEEVLSSLLQRYINYQLFRALVESSTAEHSARMLAMDNATKNAGEAIRKWTIIFNKARQEAITTELIDIINAAEAIK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q67TB8 | MAENKKAVQRRIRAVKSTQQITKAMKMVDAAKLRRAQEKVQNARPYSRELAKTLGRLIQAGAGIDHPLLHRRTEGTPTVAYVLLTADRGLAGAFNINVIRKAHQALQKESRPTKLITIGRKGRDYFVKRKIQPVLEFVNLGDNITFALARSVLSKIVDLYLSGEVDEVRVIYTEFVNAVTQRPKEMQLLPIQPAQADGAHTHVEYIYEPSPERVLDTLVPRYAETMFYQLMLESKASEHGARMTAMGNATDNAEEMIAKLTLAYNRARQAAITREISEIVGGANALQG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q2LQZ6 | MAALKDIKRKVAAVEKTKQITRAMNMVAASKFRTSQTRMESFRPYAMKFMEVLSSLAVRVSPDAHPLLAAREAKRIRVVSMSSDRGLCGGFNSSLIKSTERFVREKIAEGLEVDLTPIGRKVREYFKRKYALVSDRADVMSKFDMTLAVEIAEDVIDPFVNEEYDELYLIYNEFINVSMQRPAVVRLLPLPSVGQDAEIEAEKRIDYNYEPSDEELIGKLLPMYIHVLIFRALLETSAGENGARMAAMDNATRNCDEMISTLTLQYNKVRQSAITAELMDIVGGTEALAKG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q31RF0 | MANLKAIRDRIKSVRNTRKITEAMRLVAAAKVRRAQEQVLSTRPFADRLAQVLAGLQQRLQFENVDLPLLQRREVKTVALLVVSGDRGLCGGYNSNVIRRAEQRARELSAQGLDYKFVIVGRKAGQYFQRREQPIEATYSGLEQIPTAQEANDIADELLSLFLSGTVDRVELVYTKFLSLVASNPVVQTLLPLDPQGLASSDDEIFRLTTRGGSFTVEREKLTSEVAPLPRDMIFEQDPAQILSALLPLYLSNQLLRALQEAAASELAARMTAMNSASDNANALVGQLTLVYNKARQAAITQELLEVVAGAEALNG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A0LLF9 | MATLRDIKRKIDAVKKTSQITKAMNMVAAAKLRGAQQNMERFHPYAEKFNEVIERLAEGVEDAGQYVLLTPREEVKKIELVLVTADRGLCGSFNNNLIVMAERFLKAKQAEGCQVRLTAVGRKGGDYFRRRTFEVRKRMTGLLNKPSYEDAAVLGRELIEQFEIGECDEVYVIYSRFLSMVRQQATLMKLLPIAPAKKTEAEEKGRLEYLFEPSHEALLTDLLPNYVFIEILESLYQTAVGEHAARMAAMENATSNCKELVKTLTLTYNKARQAGITKELMDIVGGAEALKK | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q2JSW2 | MANLKRIRDRIKAVKNTRKITEAMRLVAAARVRRAQEQVMATRPFADRLAQVFYRLQTRLRLEDVDLPLLKQRPIETVGLLVVAGDRGLCGAYNANVIKRTEERVRELQETGQQVRLYLVGRKAVQYFQRRSAPIAKTYVNLSQIPTAAEAAQIGDELLSAFLSEKVDKVELIYTRFVSLISSRPVVQSLLPLDPTRLAARDDEIFNLLVRGGEFTVERSKIVAAVSAPPPDMIFEQDPVQILDALLPLYLNNQLLRALQEAAASELAARMTAMSNASDNATELIRTLGLAYNKARQAAITQEILEVVAGAEAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q2JIG1 | MANLKRIRDRIKAVKNTRKITEAMRLVAAARVRRAQEQVMATRPFADRLAQVFYRLQTRLRLEDVNLPLLKQRPIQTVGLLVVAGDRGLCGAYNANVIKRTEERVRELQETGQQVQLYLVGRKAVQYFQRRSAPIAKTYVNLSQIPTAAEAAQIGDQLLAAFLSEKVDKVELLYTRFVSLISSRPVVQSLLPLDPSRLATQDDEIFRLLVRGGEFTVERSKVIAAVSAPPQDMIFEQDPVQILDALLPLYLNNQLLRALQEAAASELAARMTAMNNASDNASELIRTLGLAYNKARQAAITQEILEVVAGAEAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q05384 | MPNLKAIRDRIKTIKDTRKITEAMRLVAAAKVRRAQEQVMASRPFADRLAQVLYGLQTRLRFEDANLPLLAKRPVKTVALLVVTGDRGLCGGYNTNVIRRAKERTEELEAEGIKYTLVIVGRKAAQYFQRRDYPIDAVYSGLEQIPSASEAGQIANELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGLEAADDEIFRLTTRASHLEVNREKVTSNLPALPPDMIFEQDPVQILDALLPLYLSNQLLRALQEAAASELAARMTAMNNASDNAQTLIGTLTLSYNKARQAAITQEILEVVAGAEALR | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
B1XHY7 | MPNLKGIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVTSTRPFANTLLQVLYSLKSRLRLEEADLPLLKQREVKCVGLLVITGDRGLCGGYNANIIRKAERRAKELAAAGINYKFVLVGRKAVQYFQNRQAPVAKTYAGLEQIPSAAEASDIADELLSLFLSEEVDKIELIYTRFVSLISSQPVVQTLLPLVPEALTNPDDETFNLITRGGKFQVEREKVATEVKELPADMIFEQDPKDILNALLPLYLSNQLLRALQEGAASELAARMTAMNNASDNASDLMKTLTLSYNKARQAAITQELSEVVAGANAL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q5N2V4 | MANLKAIRDRIKSVRNTRKITEAMRLVAAAKVRRAQEQVLSTRPFADRLAQVLAGLQQRLQFENVDLPLLQRREVKTVALLVVSGDRGLCGGYNSNVIRRAEQRARELSAQGLDYKFVIVGRKAGQYFQRREQPIEATYSGLEQIPTAQEANDIADQLLSLFLSGTVDRVELVYTKFLSLVASNPVVQTLLPLDPQGLASSDDEIFRLTTRGGSFTVEREKLTSEVAPLPRDMIFEQDPAQILSALLPLYLSNQLLRALQEAAASELAARMTAMNSASDNANALVGQLTLVYNKARQAAITQELLEVVAGAEALNG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A5GNC7 | MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARLLENLQARMRFEDADAPLLEDRPLETVTLMAVTGDRGLCGGYNANIIKRTEQRFEELQSKGYKVNLVLIGRKAISYFTNRSYPIQATFTGLEQVPTADEAGSVANEVFAEFLSETTDRVEIIFTKFINLVSCKPVVQTLLPLDPQGIADADDEIFRLTTKDGDLRVETGSAPANAQPELSSEIVFEQSPDQLLNALLPLYLQNQVLRSLQEAAASELASRMTAMNNASDNAKALAKTLTLDYNKARQAAITQEILEVAGGAAAVG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
A5GV71 | MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQDLVLRSRPFADRLARVLESLQSRIALESADTPLLQARDPRHITLVAMTGDRGLCGGFNANIIKRTEQRFAELKASGYEVALITVGRKVDTYFQNRNYPITASFTGLDQLPTSTDALQVSDAVQAEFLGGATDRVELIYTKFINLVSTKPVSQTLLPLDPQGIASPDDEIFRFVTKEGELGVERSSASNQEDKLKSDLVFEQSPSQLLDVLLPLYLQNQVLRSLQESAASELASRMTAMNNASDNAKALAKELTLDYNKARQAAITQEILEVVGGASAMA | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q0I7R3 | MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARLLENLQARMRFEDADAPLLEQRAVQTITLMAVTGDRGLCGGYNSNIIKRTEKRFAELQRQGYKVALVLIGRKAISYFTNRNYPIQATFTGLEQVPTADEAGSIASEIFAEFLSETSDRVEIIFTKFINLVSCKPVVQTLLPLDPQGIAEADDEIFRLTTKEGRLSVEAGSAPENSQPALPSDIVFEQSPDQLLNALLPLYLQNQLLRSLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAAITQEILEVVGGSAAAGA | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q3AZM0 | MANLKDIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLSRILENLQSRMRFEEADAPLMEQRTVETITLVAITGDRGLCGGYNANIIKRTEQRFAELKGKGFNVKLVVIGSKAISYFSNRDYPIQAKITGLEQVPTADEANTIATDMLAEFMAAGTDRVEMVFTKFINLVSCKPVLQTLLPLDPQDIADPEDEIFNLTTDQGRLTVEPGTSSANTAPKIPSDIVFEQSPDQLLNALLPLYLQNQLLRCLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAAITQEILEVVGGSAAAGG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q3AHK6 | MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARILENLQSRMGFEDAASPLMQQRNVETITLVAVTGDRGLCGGYNANIIKRTEQRFAELKGKGFDVKLLLIGTKAIGYFTRRDYPIQATFSGLEQVPTADEANTISTDLLAEFLAESTDRVELIFTKFINLVSCKPVVQTLLPLDPQDIADPEDEIFRLTTKDGLLTVEPGAGPANTEPKIPSDIVFEQTPEQLLNALLPLYLQNQLLRSLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAAITQEILEVAGGAAAVG | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
P17253 | MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVLSTRPFADALAQVLYNLQNRLSFAETELPLFEQREPKAVALLVVTGDRGLCGGYNVNAIKRAEQRAKELKNQGIAVKLVLVGSKAKQYFGRRDYDVAASYANLEQIPNASEAAQIADSLVALFVSETVDRVELIYTRFVSLISSQPVVQTLFPLSPQGLEAPDDEIFRLITRGGKFQVEREKVEAPVESFPQDMIFEQDPVQILEALLPLYNTNQLLRALQESAASELAARMTAMSNASDNAGQLIGTLTLSYNKARQAAITQELLEVVAGANSL | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
C5BKJ6 | MASGKEIRTKIGSIKNTQKITSAMEMVAASKMRKAQDRMEVGKPYARRMREVVGHIAAGNLEYQHLYITEREVKRVGYIVVSTDRGLCGGLNVNLFKAVLRHSKEWADKGIETDFCMVGAKGTAFFKSVGANIVASLRDIGEQPSITSLIGSVKVMLDAFADGKIDRLYVCSNDFVNTMTQTPKVERLLPLKPEDGAIHKRSWDYLYEPDAKELLDGLMVRYIESQVFQAVVENGACEQAARMIAMKSATDNAGNLINELQLAYNKARQAAITQELSEIVGGAAAV | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Q47M81 | MGAQLRVYRRRIRSTKSMAKITRAMELIAATRITKAQRAAEAAAPYAREITRAVSAVAARVSDHPLLTEAENPTRAAVLVITSDKGLAGAYTANAIKEAERLTALLNEQGKEVLTYMVGRKGIGFYKFRERPLADSWEGFTERPSYMHAMEISSALMEKFIQETAEGGVDEIHIVSTEFISMINQRARASRILPLEVEEVDSKVLEAEQGPLPLYEFEPGAEEVLDQLLPKYVTNRIYFALLESAASQHASRRAAMKAATDNAEELVKTLTRQANQARQAEITNEISEIVGGADALAAASAGSE | Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family. |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.