UniProt ID
stringlengths
6
10
Protein Sequence
stringlengths
2
35.2k
Functional Description
stringlengths
5
30.7k
X2BHY3
MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRERDAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQQVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q7AM16
MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A4XAW6
MFLAAEGSHNPILPIWQELVVGTIAFALLVFVLLKFVMPRMETMYQARVDAIEGGLKRAEAAQAEANQLLEQYRAQLAEVRTEAARIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERTTIVRELRTEVGTLAVDLAGKIVGESLADEARRAGTVDRFLNGLESAGAR
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q7CPE4
MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
O94373
MSSKLFCLRSFPSVQRTAWQRLVLPSTRKFSLTPTTFDKTPSGRIPPDQKAANIISSVPSTSLLTKSGVLTVTAAALATAISKGIYVVNDESIVVASFLGLVGVFGTLGRKAYNEWSDKTIAKIGGIMQAARNDHTSAIRERIDQVASLQEVESVTQALFHTSKETARMEAEIFELEQRVALAKEAKSVLDSWVHHEANVRAEQQERLVEDVLARVNSKVSTQKFQQDALNESLGEIEKVLASA
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity). F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. In yeast, the dimeric form of ATP synthase consists of 17 polypeptides: alpha, beta, gamma, delta, epsilon, 4 (B), 5 (OSCP), 6 (A), 8, 9 (C), d, E (Tim11), f, g, h, i/j and k (By similarity). Belongs to the eukaryotic ATPase B chain family.
A8G7M4
MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLASAERAKKDLDLAQANATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A1SBU4
MNINATLIGQTVAFIIFVWFCMKYVWPPLMNAIEERQKRIADGLANADRAAKDLELAQAKATEQLKEAKATANEIIESANKRKAQIVEEAKAEADAERARIIAQGKAEIEAERNRVKEELRKQVATLALAGAEKILERSIDAAAHSDIVEKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A3DAR8
MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEANAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A6WUJ4
MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A9KX10
MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q12HP7
MNFNATLIGQSVAFLIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELARSKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAILGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q07VU0
MNFNATLFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIKATEQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDLRKQVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
B0TQF8
MSINATLLGQAISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVKATEQLKDAKATANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDLRKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A3QJR4
MNINVTLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q8E8B6
MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A8HAG7
MSINATLLGQAISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVKATEQLKDAKATANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDLRKQVAILAIAGAEKILERSIDEAAHSDIVNKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A4YCI2
MSINATLLGQAISFALFVWFCIKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQAKATEQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIENERSRVKDDLRKQVAALAVLGAERILERSIDQAAHSDIVDKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A0L2T2
MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A8G1W9
MNINATLLGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQSKATDQLKDAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGQAEIEAERNRVKEDLRKQVATLAIYGAEKILERSIDEAAHSDIVNKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q0HD75
MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q0HPF7
MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A7FPE4
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q1C091
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
B2K843
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q74P97
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A9R5U3
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
D1Q305
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
A4TSI9
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q663Q4
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
B1JRM8
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. Belongs to the ATPase B chain family.
Q32RL0
MGERIKSTMDLLIYLQNSHLATGFGFNTNLFETNLINLAVVIGVLVYFGKGVLTTLLNNRKETIVNTIRDAEERYQEATEKLNKAYTRLEQAKAKAEEIRVNGLAQMEIEKQELIKAADEDSKRLEDSKNATLRFEEQRAIEQVRQQVSRLALELALETLKTRLNRDLHAQMIDYHIGLLQSMESVID
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has four main subunits: a(1), b(1), b'(1) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta, b and b' chains. In plastids the F-type ATPase is also known as CF(1)CF(0). Belongs to the ATPase B chain family.
Q01908
MACSNLTTMWVSSKPSLSADSSSLSFRSVLKCPTNTSSPPSRASSVSPLQASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVTGDRGLCGGFNNFIIKKAEARIKELKGLGLEYTVISVGKKGNSYFLRRPYIPVDKYLEAGTLPTAKEAQAVADDVFSLFISEEVDKVELLYTKFVSLVKSEPVIHTLLPLSPKGEICDINGTCVDAAEDEFFRLTTKEGKLTVERETFRTPTADFSPILQFEQDPVQILDALLPLYLNSQILRALQESLASELAARMSAMSSASDNASDLKKSLSMVYNRKRQAKITGEILEIVAGANAQV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a, b, b' and c (By similarity). Interacts with PAB (PubMed:25775508). By light. Belongs to the ATPase gamma chain family.
Q6LLG7
MASAKEIRNKIGSVQNTQKITKAMEMVAASKMRKTQDAMESSRPYAETMRKVIGHIALGNLEYKHPYLEVREAKRVGYIIVSSDRGLCGGLNINLFKSAMTDIKGWADQGADVEMALVGAKATAFFNSYGGNVVAQVSGLGDSPTVNELIGTVGVMLKKYNEGLLDRLYLVYNQFVNTMIQEPVIDQLLPLPKSKDEEMQRNHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMVAMKSATDNAGDIINDLQLVYNKARQAAITQELSEIVSGASAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q01909
MTGSISTSWLLSSPSNSNSASSSESYSFIATLKPVRYYPFQSLTPNRISSRSPLPSIQIRAGIRELRERIDSVKNTQKITEAMRLVAAARVRRAQDAVIKGRPFTETLVEILYSINQSAQLEDIDFPLSIVRPVKRVALVVVTGDKGLCGGFNNAVTKKATLRVQELKQRGIDCVVISVGKKGNAYFSRRDEFDVDKCIEGGGVFPTTKEAQVIADDVFSLFVSEEVDKVELVYTKFVSLVKSDPVIHTLLPLSMKGESCDVKGECVDAIEDEMFRLTSKDGKLAVERTKLEVEKPEISPLMQFEQDPVQILDAMMPLYLNSQILRALQESLASELASRMNAMSNATDNAVELKKNLTMAYNRARQAKITGELLEIVAGAEALRES
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has four main subunits: a, b, b' and c (By similarity). By light. Belongs to the ATPase gamma chain family.
Q6LKZ7
MANAKEIRTKIASVQNTQKITSAMEMVAASKMRKVQDNMAATRPYAENMRKVISHVASGSLEYKHPYLEEREAKRVAYIIISSDRGLCGGLNSNLFKRALTDMRQWQEKNVEVDLTLIGSKAISFFHRFGNVIAQTSGLGDKPKLEDLLGAVTAMLEHFDDGKIDRLYLVYNEFVNTMVQNPRITQLLPHPDKDESQDSKPNDATSRWDYIYEPDPKDILNALMLRYIESQVYQGTVESIACEQAARMVAMKSATDNAGDIINDLQLVYNKARQSAITQELSEIVAGAQAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q7GB12
MAMAVFRREGRRLLPSIAARPIAAIRSPLSSDQEEGLLGVRSISTQVVRNRMKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQPFTALLGDNPSIDVKKSVVVTLSSDKGLCGGINSTVVKVSRALYKLNAGPEKEVQFVIVGEKAKAIMFRDSKNDIVLSVTELNKNPLNYAQVSVLADDILKNVEFDALRIVYNKFHSVVAFLPTVSTVLSPEIIEKESEIGGKLGELDSYEIEGGETKGEILQNLAEFQFSCVMFNAVLENACSEMGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALEAAK
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
P26360
MAMAALRREGRRLAAAPFTSPTPLNALRSSLVSPSEEIGLSGVRSISTQVVRNRMKSVKNIQKITKAMKMVAASKLRAIQTRAENSRGLWQPFTALLGDTPSVDVKKNVIITISSDKGLCGGINSTSVKTSRNIHKLNSGPEKENKYVILGEKAKAQLVRDSKKDIELIITELQKNPLNYTQVSVVADDILKNVEFDALRIVFNKFQSVVSFVPTMSTVLSPEVVERESESGGKLGDLDSYEIEGAESKSEVLQNLTEFQFSSVLFNAVLENACSEQGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALEG
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
P80084
IGTQIVXNXMKSIKNIQKITKAMKMV
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B0BZL3
MPNLKSIRDRISTVKNTKKITEAMRLVAAAKVRRAQEQVTATRPFADRLAQVLYGLQARLKFEEVELPLLQERALRKVCLLVVTGDRGLCGAYNSSVIKRAEERSNELKAKGIDYTFVLVGRKAIQYFQRRDQPIEATYGGLEQIPTAQEASEIADELLSLYLSEEVDHVELIYTRFISLVNSRPVVQTLLPLDPDALVVAEEDEVFRLTTRGGQFQVERERMERGTPQEMPSDMIFEQNPIQILDALLPLYLNNQLLRALQESAASELAARMTAMNNASDNASELIGTLTLSYNKARQAAITQELLEVVGGAEALN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A3DIM8
MAHINEIKLRMKSIRETRQITNAMKLISAAKLKKAKKQLEKASPYFEKVRSTMADILLRSGKIENKYFHARDEKTDKKKAYIVITGEKGFAGGYNHNIIKFTEECLKQDKDPLLFVAGNVGRNHFLKNKYNVYMEFDYPVQNPSIYMAREIMEVILDLFDKEVFDELYIIYTHMFSNIKMEPSIIKLLPLELDTLKEKLQINESTEKIVDGCMEYEPDPEYVFNVLVRKYIKGVVYGAFVESFTSEQNSRMTAMDNATANANDMLKKLDLLYNRARQSKITQDITEIVGGAEALK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
H6LG95
MAENVQDIKRRIKSVNSTMQITHAMELVASAKLRKSRELAEGRRPYFEAMIESIGRIVEKSGNARNIFMDQREVKKTAYIIITGDKGLAGGYNVNVAKLVEEHITDKENAVLFTVGSRGRDHFRNREYHIQGEYLGISERPNFFNAKEVTAIVMEGFKNGEYDEVYIAYTKFVSTITQHAQMMKLLPLSAEELITSGKVKTTEETKEEKSKMSDRELTIMTYEPEPEELLKYLIPNFVSSTVYGSMIESAASEQGARRTAMESATTNANEMIDGLTLQYNRVRQAAITQEISEIVGGAEALN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. Inhibited by nitrate. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A1VXI9
MSNLKEIKRKIKSVYNTQKTTNAMKLVSTAKLKKAEEAAKRSKIYAQKIDEILSEISVQINKIVHNEDDVRLFLFHKKEQIKTVDLIFITADKGLCGGFNIKTLKTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHAAVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGTELLEDLIKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITTELIEIISGVESMK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q5HX60
MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLKKAEEAAKRSKIYAQKIDEILSEISFQINKIVHNEDDVRLSLFHKKEQIKTVDLIFITADKGLCGGFNIKTLKTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHAAVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGTELLEDLMKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITTELIEIISGVESMK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B9KES2
MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLRKAEEAAKKSKVFAQKIDEVLSEIAFKINQYEGLDDKLPFFRKKDNIEKMDIIFVTADKGLCGGFNIKTIKAVNEMLEDCKTKKIKVRLRAIGKTGIEYFNFQNIEILEKYLDTSSSPDYDKACAIIQKAVDDFVNGVTDKIVIIHNGYKNMISQEIRINELLPVEAIVSKEEQKSESLMDLEPEDEEILNDLLKTYFEYNMYFSLVDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITTELIEIISGVESMK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q3A945
MPSMRDLRRRIKSIKNTQQITKAMKMVAAAKLRRAQEMVVASRPYAKRIKDVLARAAAATTETAHPLLIKREVKATGYVLITADRGLCGGFNANLIRKATVELKEFSNPKLITVGRKGRDFFKKRGYEIVGEFTNLGESISFDAARVIAGFIMEKYLDGTFDEVYLVFSEFVNPLVQRPQTLKLLPLEAPAEESGGGEYIFEPSADAVLNTLLPKYVEVQVYRALLESKASEHGARMTAMDTATENATEMIAKLTLQLNRARQAAITKEIAEIVGGAAALEA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B0T336
MASLKEMRNRIASVKATQKITKAMQMVAAAKLRRSQDAAEAARPYARRLAAVIANLAAGVTGDGAPPMLAGTGRDDRHLIIVAAADRGLAGGFTSSIVRAARERIETLIAQGKDVKIVCIGKKSTAQLRRLYSDRIVEDFDLSAYRQFTLTVAQPIADVVTRLYEAGDVDVVTLFYSRFKSVVIQTPTALQLIPATVDGANAPAAAQGAQAVYEYEPSEEEILETLLPRNLTVQILSALLDNMAGFYASQMTAMDNATRNAGDMIKRYTLEYNRSRQAQITKELIEIISGAEAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q9A2V8
MASLKEMRNRISSVKATQKITKAMQMVAAAKLRRSQDAAESARPYARRLASVIANLAAGVSGDGAPKLLAGTGRDDRHLVVVAAADRGLAGGFTSSIVRAARAHIDGLIAQGKDVRVVCVGKKVTAQLAKPYAGRIVETFDLSSYRQLTLSVAQPIADVITREYEAGETDVVTLFYSRFKSVVQQIPTGLQLIPAVVETGEAASGPTAVYEYEPSEEAILETLLPRNLTVQILSALLDNMAGFYASQMTAMDNATRNAGDMIKRYTLEYNRSRQAQITKELIEIISGAEAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B8H5I1
MASLKEMRNRISSVKATQKITKAMQMVAAAKLRRSQDAAESARPYARRLASVIANLAAGVSGDGAPKLLAGTGRDDRHLVVVAAADRGLAGGFTSSIVRAARAHIDGLIAQGKDVRVVCVGKKVTAQLAKPYAGRIVETFDLSSYRQLTLSVAQPIADVITREYEAGETDVVTLFYSRFKSVVQQIPTGLQLIPAVVETGEAASGPTAVYEYEPSEEAILETLLPRNLTVQILSALLDNMAGFYASQMTAMDNATRNAGDMIKRYTLEYNRSRQAQITKELIEIISGAEAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A3PIB8
MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVHLLVVMTAERGLCGGFNSSIVRLARAHAAKLLTQGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDLLDRFDKGEFDVATIFFARFQSVISQVPTAQQVIPAVFEGEGEVSSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIEYNRSRQAAITKELIEIISGAEAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q3J432
MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVHLLVVMTAERGLCGGFNSSIVRLARAHAAKLLTQGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDLLDRFDKGEFDVATIFFARFQSVINQVPTAQQVIPAVFEGEGEVSSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIEYNRSRQAAITKELIEIISGAEAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A4WUM8
MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVQLLVVMTAERGLCGGFNSSIVRLARAHAAKLLAEGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDVLDRFDKGEFDVATIFFARFQSVISQIPTAQQVIPAVFEGEGEVNSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIQYNRSRQAAITKELIEIISGAEAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B9KPI7
MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPFAERMTAVMTGLAGSVGSSESAPRLLAGTGSDKVHLLVVMTAERGLCGGFNSSIVRLARAHAAKLLTQGKTVKILTVGKKGREQLRRDLGQHFIGHVDLSEVKRMGYPVAQGIARDLLDRFDKGEFDVATIFFARFQSVISQVPTAQQVIPAVFEGEGEVSSLYDYEPSEEGVLADLLPRGVATQIFTALLENGASEQGARMSAMDNATRNAGDMINRLTIEYNRSRQAAITKELIEIISGAEAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q11DD6
MPSLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQEAAEAARPYAERMDAVLANVSASISGADAPPLMAGTGKDDVHLVVVCTADRGLAGSFNSQIARLAREHIRKLQANGRQVKIITVGKKGYDLLRRDFGKLVIDRIELREVKQIGFANADAIAKKVIGLFEAGEFDVCTLIYSRFKSVISQIPTEQQIIPAAVPQAEGESTGAIYEYEPDAGAILADLIPRNIAVQIFRALLENAAGEMGAKMTAMDNATRNAGEMINKLTITYNRQRQAQITKELIEIISGAEAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A9WGS5
MPSSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTARVVGAARRGTLLEKRETVKSVALLVVTPDRGLCGSLVANVLRRAGRFITEQRAMGRTVDVYTFGRKGRDFFLRTGFAPAGEATRLGDAPKLEAILGVAISAINGFQSGKYDELYIIYSEFINTLVQRPAIKQLLPVESPDISTTTNVDYTYEPGEEEVLNSILPRYVETQIYQAVLESIASEHSARMVAMRNATNNAKDLVRDLTLSFNKARQAAITKEVSEIASGAAALTS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B8G6G7
MASSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTARVVGAARRGTLLEKRETVKSVALLVVTPDRGLCGSLVANVLRRAGRFITEQRAMGRTVDVYTFGRKGRDFFLRTGFAPAGEAIRLGDAPKLEAILGVAISAISGFQSGKYDELYIIYSEFINTLVQRPAIKQLLPVESPDISTTINVDYTYEPSEEDVLNSILPRYVETQIYQAVLESIASEHSARMVAMRNATNNAKDLVRDLTLSFNKARQAAITKEVSEIASGAAALIS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q3AUA6
MATLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQDRAIMARPYASKLKEMLASLSAKVDTSVNPLFAVRSEVNKVLVILVTSDRGLCGAFNGNIIKLAYKTIHEDYAAQYGKGGVSMICAGTRGYEFFKKRHYTLTKGYPAVFQNLDFAVAKEIADMASNMYLRGEVDRVVVVYNEFKSVLAPQLKSEVLLPITSGDASAKENSGGEYMYEPNPAAIIDVLLPKHLRTQVWRIMLESNAAEQAARMAAMDSATENAKELLRTLNISYNRARQAAITTELSEIVAGAEALNG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B3EHU5
MPTLKDIRVRIKGIKSTQQVTKAMKMVAAAKLRRAQERAIMARPYAGKLKEMLGSLSAKVDTSLNPLLSSRQDVKKVLVILIAADRGLCGAFNTNIIKLAQKVVTEDYAAQYKNGGVSMICAGSRGFDFFRKRGFSIVKGYPSVFQNLDFSVAKEIAETASGMYLRGEADKVIVVYNEFKSVLAPVLKAEDLLPIAAENAGKDNSGDYIYEPSPAVIIDELVPKHLSTQVWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVAGADALKN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q3B1F5
MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRKAQERAVMARPYAAKLKEMLGSLSGKVDTSASPLLADRADASRVLVVLITSDRGLCGAFNTNIIKLAHRTIHEEYAAAYAAGNVQLICAGTRGFDFFRKRGYSVLKGYPAVFQNLDFSTAREIAETASSMYVKGEVDRVVVVYNEFKSVLAPTLKAEVLLPIKSELPVAEGGDYIYEPSPAAIIEELVPKHLNTQVWGMMLESNAAEQAARMTAMDSATENAKELLRGLNISYNRARQAAITKELSEIVGGADALQN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B3QL62
MPTLKDIRIRLKGIKSTQQVTKAMKMVAAAKLRRAQDRAIQARPYAGKLKEMLASLSTKVDTSLNPLLSPREEVNKVLVVLVTSDRGLCGGFNANIMKLAQRVIHEDYAAQHAKGAVTMICAGTKGSDFFRKRGYNVTKAYPGVFQNLDFSSAKEIAELASQMYLKGEADKVILVYNEFKSVLAPNLRTEQLLPIAPEEGTEEAAGSEYLYEPSPEAIIDELVPKHLNTQVWRVMLESNAAEQAARMAAMDSATENAKELIRVLNISYNRARQAAITKELSEIVAGADALKQ
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B3EL40
MATLKDIRTRIQSIASTQQVTKAMKMVSAAKLRRAQDSAIQARPYAAKLKEMLGSLSTRVDTTLNPLLSDRDEVKNVLVVVITSDRGLCGAFNANIIKIAQKVVTEEHGDLYRDGKVEMLCAGSKGNDYFRKRGFSISKAYPGLFQNLHFSVAREIAEYASERYLKGEVDKVVVVYNEFKSVLAPVLKSEVLLPITPEKVEGEKTGSSIDYIYEPSPSAIIDVLVPKHLNTQIWRMMLESNAAEHASRMTAMDSATENAKELMRVLKISYNRARQAAITTELSEIVAGAEALQGE
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A1BJF4
MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAIMARPYARKLKEMLGSLSDKVDTSLNPLLSNRSEVNKVVVILITADRGLCGAFNTNIVKLAYKLIHEDYAAQHSKNGVSLICAGSRGFDFFRKRGYNIIKGYPGVFQRLDFSFAKEIAETVSGMYLRGEADRVVVVYNEFKSVLAPVLKFETLLPITPEASGKDGGSDYIYEPSPESIIDVLVPKHLNTQVWRVMLESNAAEQAARMSAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGADALKG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A9KK93
MASMRDIKRRKESIQSTGQITKAMKLVSTVKLQKAKSKAENAKPYFDHMYDTVLNMLRKSGNISHPYLSAGKSNKKAIIVITSNRGLAGGYNSNILKLVMSSDINKEDAVVYAVGRKGKEALARRGYHIAKDYSEVMNAPIYKDAIEIGKAVLDAFVADEVGEIYLAYTSFKNTVSHEPTLIKLLPVDMEAALQEGEKSEDLNERLTLMNYEPAAEEALNLIIPKYINSLIYGALVQALASENGARMQAMDSATNNAEDMISDLSLKYNRARQSSITQELTEIIAGANAIN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
F9UQR4
MAESLMDVKRRIDSTKKTHQITSAMQMVSTSKLNQIQKHTSTYQVYASKVESIVSHLAKAHLMSASAGVANSNSNTISVSELLAQRPVKKTGLLVITSDRGLVGSYNSNVLKQTNDFMRTHKVDADNAVVLAVGGTGADFYKKNGLNVAYEYRGVSDVPTFKEVREIVKTVTSMYHNEVFDELYVFYNHFINRLSSGFRAVKMLPISEETFEQSESDNRKAKDSRVDVGPEYEMEPSEEAILSAVLPQYAESLVYGAILDAKTAEHASSSTAMKAASDNAGDLIDKLNLKYNRARQAAITTEITEITGGLVAQE
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
C1D5G3
MAVGKEIRSKIKSVQSTQKITRAMQMVATSKMRKTQERMRSARPYAEKIREVMAHVAETNPDFKHPALERRDVVKRVGVILVTTDKGLCGGLNANALRTFYQYAERWAEQGIEVDVCCFGQKGYAALTRLDMKVVSSATQLGDTPQQEKLLGPASHIVRAYLDGEIDELHIVYSKFLNTMKQEPRVEQLLPLKTEELESEFPYSWDYLYEPDVRGVLDVLVRRYLESVVYQAVSENMASEQSARMVAMKAATDNAAQAIERLKLTYNKARQAAITTELSEICAGAAAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q38WK4
MAESLMDIKRRIASTKKTGQITSAMQMVSGAKLSQIEKNSVAYQVYTDKIREIVTHLAASQLIDIARQKSSLQAEPADSTIKKAIKHEVTLSNLLVERPIKKTGYLVITSDRGLVGAYNSSILKAMVQMISETHQSPDEYAILAVGGTGADFFKARGMNLTYEYRGVSDVPSFEEVKQIIKTAVAMYDNGVYDELYVCYNHHVNSLTSGFRAEKMLPITDLDVSEVADQNLEYITEPSVDDALDAILPQYAESLIYGAMLDSKTAEHAASMAAMKSATDNANNLISELSIKYNRARQAQITTEITEIVGGAAALE
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q1MP34
MASLKDVKIKIAGVRKTKQITKAMNMVASAKLRGAQIKIEHFRPYAEKFQDVISNLATRSDETVHKLLEKRTNGTSCIFILITSDRGLCGIFNTMLIIKALELAKQKTTKGKKVSFICIGRKGRDAIKKTHYPILSDYSDKFTRDYQLASHISEKVIDGYLTVNMDEVVLIYGQFINAMRQIVGFSTLLPIHPKPLDKEQLEKYSEYIYEPGVAILLSELLPKFVTTQIYRGFLDTDASENAARMTAMDNATRNCDELIGNLTRLYNKTRQASITSELIDIVSGAEALK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q5X0P2
MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGAIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A5III4
MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGTIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q5ZRA0
MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGTIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q5WSG7
MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSINDFIGVVKIMLDAYYNGTIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEEDKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGAAAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q6AG59
MGAQLRVYRQKIKSAHRTKKITRAMELISASRIQKEQARVAASSPYARAITRAVSAVATYSNVGHVLTTEPEKIERAVIVIFSSDRGLAGAFNSNVLKESEKLAELLRSQGKEVVYFLIGRKAQGYFSFRRRAFERVWTGNTDAPEFEQAKEVADAILESFLRDSADGGVDEIHVIYNRFVSMLTQEPQVVRLLPMEVVEGVEEPDRTQVLPLYEFEPDVNTVLDSLLPVYIESRIFNAMLQSAASKHAATQKAMKAASDNADKLITDYTRLANNARQAEITQQISEIVGGADALSSAN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B0SDA4
MATPREIKKRINSVKNTRKITRTMEMVSTAKAKKATNKVNAAKPYADLTRELVSSLSSLASIIHSPYLRKPDKIRKVAILAIAANRGLCGGFNSNLLRMVKNRIEELKSKGVEVEVHAAGKKAISFFKFAKVELVTSYTNIDDKAGSKEANDLASYFMERFANESVDSVEIISTHYYSAANQKPETTTVLPLQMEETGSKGSSGPEVLYEPDPKTILENLLPMVIKTTFVKIILESVASEHIARRVAMKAATDAAGEMIKLLTRGYNRVRQAKITQEISEIVGGAEAIS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q04S17
MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLSGVVHSPYLRRPEKIKTVALLVITANRGLCGGYNSNVNRLAKAKVAEWKKAGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYKEAEEFANLFLELFANEEVDAVEIASTVYYSSASQKPEVTRILPFEPAKEGNGNDLVVYEPSPERVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q04ZU4
MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLSGVVHSPYLRRPEKIKTVALLVITANRGLCGGYNSNVNRLAKAKVAEWKKAGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYKEAEEFANLFLELFANEEVDAVEIASTVYYSSASQKPEVTRILPFEPAKEGNGNDLVVYEPSPERVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B0SLC7
MATPREIKKRINSVKNTRKITRTMEMVSTAKAKKATNKVNAAKPYADLTRELVSSLSSLASIIHSPYLRKPDKIRKVAILAIAANRGLCGGFNSNLLRMVKNRIEELKSKGVEVEVHAAGKKAISFFKFAKVELVTSYTNIDDKAGSKEANDLASYFMERFANESVDSVEIISTHYYSAANQKPETTTVLPLQMEETGSKGSSGPEVLYEPDPKTILENLLPMVIKTTFVKIILESVASEHIARRVAMKAATDAAGEMIKLLTRGYNRVRQAKITQEISEIVGGAEAIS
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B1Y3S8
MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYADKIRNITANLSRATPEYHHPFVVKNSGSGVVGMIIVTTDKGLCGGMNTNVLRLVTNKMRELDAAGTKVQAVAIGNKGLGFLNRIGAKVVSQATQLGDTPHLDKLIGPVKVLLDLYAEGKLDAVYICYTRFLNTMKQEPQVEQLLPLSDERLSQSAAEQQSHGWDYIYEPDAQAVIDNLMVRYAEALIYQSVAENMASEQSARMVAMKAATDNAGSLIGELKLVYNKTRQAAITKELSEIVSGAAAVG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q72SY0
MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLGGVVHSPYLRRPEKIKTVALLIITANRGLCGGYNSNVNRMAKAKIQEWKKSGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYREAEEFANLFLELFAKEEVDVVEIASTVYYSSASQKPEVTRVLPLEPAGEGSVSDMMVYEPSPEKVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B1MW86
MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQRYGRGYQAYAARLEAVVEHLVAAHLFDNADAKHIPLIAQRPIRKTGILVVTSDRGLVGSYNANVIKQTNALMARLNLDTTNTAILAVGGNGADFYKKRGFEVILEHRGVSDVPSFNEIRSVVKTVTSLYESEVFDALHVVYNHFVNRLTSEYRDVQLLPLTGDTLVAMGGTEAHKAELDIQSAYEVEPDTTAVLNVVLPQFAQSLVYEAVLDAKTAEHAASSTAMKAATDNAKDLIGRLELQFNRARQAAITTEITEITGGMAALE
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q03V28
MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQKYSAGYGSYAARLEAVVEHLVSAHLFDNADADHIPLIAQRPIKKTGILVVTSDRGLVGSYNANVIKQTNVLMQNLNLDTSNTTILAVGGNGADFYKKRGFEVILEHRGVSDVPTFNEIRSVVKTVTSLYENEVFDALHVVYNHFVNRLTSEYRDVQLLPLTGDTLNAMGGTEEQKAELNVQATYEIEPDTTAVLNVVLPQFAQSLVYEAVLDAKTAEHAASSTAMKGATDNAKDLIGRLELQFNRARQAAITTEITEITGGMAALE
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q03QY7
MAESIHDVQRRINSTKATRQITSAMHMVSTAKLNKIQKQAVGYQDYVSKVKAVVMHLSQSHLLDNSSSSLQSNRPVKKTAYLVITSDRGMVGSYNSSVLRDTNAFIKERTPNPDDYMVLAVGGTGADFYKHRGVNVAYEYRGVSDVPEFNEVREIVKTVTTMFNNEVFDELFVCYNHFVNRISSRFRAEKMLPVDKETMSTDAAKDTQAAPLTAEYDTEPSEEEVLQVVLPQYAESLVYGAILDAKTAEHASSTNAMQSATDNADDLIATLQLHYNRARQAAITTEITEITGGQEALNN
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q1WUC7
MPASLQEVKRRIESTKKTSQITSAMQMVSTAKLSQIQKHATSYQVYATKIRSVITHLSKSHLLDSVNTTSKNSDGKVNTLGMLRQRPVKTTGIVVITSDRGLVGSYNSNVIKETLELIENNHHSTEDVAIIAIGGTGADFFKKRGYNVAYEYRGISDIPTYKDARPLVEAIVSMYDKEVYDELFVCYSHFVNTLTSEFRAEKMLPVSAENMGHDDLTSNDEGYSIEYETEPSEDAILEVVLPQYAESLVYGAILDAKTSEHASSSTAMKSASDNAKDIISSLELQYNRARQSAITTEITEITGAQAALE
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A6QB60
MANLKEIKRKISSVKNTQKTTNAMKLVSSAKLKRTEELAKRSRVYAAKLTELIEEIAQKMQHASAEGLDNIFFQENNNPKKVDIIFITADKGLCGGFNSQTIKRTSQMIAEYQSKGAKVRLRAIGRKGIDYFKFNNVELDDAIVGLSAAPDYKQSSEFISEVVTSYVNGDTDRIVLVHNGYVNMITQEIREDQILPVDASQLELSTVSTSEMEVEPDDDDTLLDALVKRYVEYSIYYALIDSLAAEHSARMQAMDAATKNAKEMVKDLNVKYNKARQEAITTELIEIISGMESMK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B2V6N5
MAKLSPRDIKRKINGIKNTQRITKAMKAVSAAKLRKAQALLYATRPYSNKLYELIEDLAVYIDRESHPLLEKREEKSVDLVIITADRGLAGAFNSNVIKTAWREIQRLKSEGKEVSLLLIGRKGVNFYKNKGFNIIEAYEDIYRDQVNLTYTAKVGGILASRFIDKKSDAVYLINNELITSSTYETKIRKLLPLESTASSKKLEEVSVYNIEPSKEEVLSSLLQRYINYQLFRALVESSTAEHSARMLAMDNATKNAGEAIRKWTIIFNKARQEAITTELIDIINAAEAIK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q67TB8
MAENKKAVQRRIRAVKSTQQITKAMKMVDAAKLRRAQEKVQNARPYSRELAKTLGRLIQAGAGIDHPLLHRRTEGTPTVAYVLLTADRGLAGAFNINVIRKAHQALQKESRPTKLITIGRKGRDYFVKRKIQPVLEFVNLGDNITFALARSVLSKIVDLYLSGEVDEVRVIYTEFVNAVTQRPKEMQLLPIQPAQADGAHTHVEYIYEPSPERVLDTLVPRYAETMFYQLMLESKASEHGARMTAMGNATDNAEEMIAKLTLAYNRARQAAITREISEIVGGANALQG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q2LQZ6
MAALKDIKRKVAAVEKTKQITRAMNMVAASKFRTSQTRMESFRPYAMKFMEVLSSLAVRVSPDAHPLLAAREAKRIRVVSMSSDRGLCGGFNSSLIKSTERFVREKIAEGLEVDLTPIGRKVREYFKRKYALVSDRADVMSKFDMTLAVEIAEDVIDPFVNEEYDELYLIYNEFINVSMQRPAVVRLLPLPSVGQDAEIEAEKRIDYNYEPSDEELIGKLLPMYIHVLIFRALLETSAGENGARMAAMDNATRNCDEMISTLTLQYNKVRQSAITAELMDIVGGTEALAKG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q31RF0
MANLKAIRDRIKSVRNTRKITEAMRLVAAAKVRRAQEQVLSTRPFADRLAQVLAGLQQRLQFENVDLPLLQRREVKTVALLVVSGDRGLCGGYNSNVIRRAEQRARELSAQGLDYKFVIVGRKAGQYFQRREQPIEATYSGLEQIPTAQEANDIADELLSLFLSGTVDRVELVYTKFLSLVASNPVVQTLLPLDPQGLASSDDEIFRLTTRGGSFTVEREKLTSEVAPLPRDMIFEQDPAQILSALLPLYLSNQLLRALQEAAASELAARMTAMNSASDNANALVGQLTLVYNKARQAAITQELLEVVAGAEALNG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A0LLF9
MATLRDIKRKIDAVKKTSQITKAMNMVAAAKLRGAQQNMERFHPYAEKFNEVIERLAEGVEDAGQYVLLTPREEVKKIELVLVTADRGLCGSFNNNLIVMAERFLKAKQAEGCQVRLTAVGRKGGDYFRRRTFEVRKRMTGLLNKPSYEDAAVLGRELIEQFEIGECDEVYVIYSRFLSMVRQQATLMKLLPIAPAKKTEAEEKGRLEYLFEPSHEALLTDLLPNYVFIEILESLYQTAVGEHAARMAAMENATSNCKELVKTLTLTYNKARQAGITKELMDIVGGAEALKK
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q2JSW2
MANLKRIRDRIKAVKNTRKITEAMRLVAAARVRRAQEQVMATRPFADRLAQVFYRLQTRLRLEDVDLPLLKQRPIETVGLLVVAGDRGLCGAYNANVIKRTEERVRELQETGQQVRLYLVGRKAVQYFQRRSAPIAKTYVNLSQIPTAAEAAQIGDELLSAFLSEKVDKVELIYTRFVSLISSRPVVQSLLPLDPTRLAARDDEIFNLLVRGGEFTVERSKIVAAVSAPPPDMIFEQDPVQILDALLPLYLNNQLLRALQEAAASELAARMTAMSNASDNATELIRTLGLAYNKARQAAITQEILEVVAGAEAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q2JIG1
MANLKRIRDRIKAVKNTRKITEAMRLVAAARVRRAQEQVMATRPFADRLAQVFYRLQTRLRLEDVNLPLLKQRPIQTVGLLVVAGDRGLCGAYNANVIKRTEERVRELQETGQQVQLYLVGRKAVQYFQRRSAPIAKTYVNLSQIPTAAEAAQIGDQLLAAFLSEKVDKVELLYTRFVSLISSRPVVQSLLPLDPSRLATQDDEIFRLLVRGGEFTVERSKVIAAVSAPPQDMIFEQDPVQILDALLPLYLNNQLLRALQEAAASELAARMTAMNNASDNASELIRTLGLAYNKARQAAITQEILEVVAGAEAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q05384
MPNLKAIRDRIKTIKDTRKITEAMRLVAAAKVRRAQEQVMASRPFADRLAQVLYGLQTRLRFEDANLPLLAKRPVKTVALLVVTGDRGLCGGYNTNVIRRAKERTEELEAEGIKYTLVIVGRKAAQYFQRRDYPIDAVYSGLEQIPSASEAGQIANELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGLEAADDEIFRLTTRASHLEVNREKVTSNLPALPPDMIFEQDPVQILDALLPLYLSNQLLRALQEAAASELAARMTAMNNASDNAQTLIGTLTLSYNKARQAAITQEILEVVAGAEALR
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
B1XHY7
MPNLKGIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVTSTRPFANTLLQVLYSLKSRLRLEEADLPLLKQREVKCVGLLVITGDRGLCGGYNANIIRKAERRAKELAAAGINYKFVLVGRKAVQYFQNRQAPVAKTYAGLEQIPSAAEASDIADELLSLFLSEEVDKIELIYTRFVSLISSQPVVQTLLPLVPEALTNPDDETFNLITRGGKFQVEREKVATEVKELPADMIFEQDPKDILNALLPLYLSNQLLRALQEGAASELAARMTAMNNASDNASDLMKTLTLSYNKARQAAITQELSEVVAGANAL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q5N2V4
MANLKAIRDRIKSVRNTRKITEAMRLVAAAKVRRAQEQVLSTRPFADRLAQVLAGLQQRLQFENVDLPLLQRREVKTVALLVVSGDRGLCGGYNSNVIRRAEQRARELSAQGLDYKFVIVGRKAGQYFQRREQPIEATYSGLEQIPTAQEANDIADQLLSLFLSGTVDRVELVYTKFLSLVASNPVVQTLLPLDPQGLASSDDEIFRLTTRGGSFTVEREKLTSEVAPLPRDMIFEQDPAQILSALLPLYLSNQLLRALQEAAASELAARMTAMNSASDNANALVGQLTLVYNKARQAAITQELLEVVAGAEALNG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A5GNC7
MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARLLENLQARMRFEDADAPLLEDRPLETVTLMAVTGDRGLCGGYNANIIKRTEQRFEELQSKGYKVNLVLIGRKAISYFTNRSYPIQATFTGLEQVPTADEAGSVANEVFAEFLSETTDRVEIIFTKFINLVSCKPVVQTLLPLDPQGIADADDEIFRLTTKDGDLRVETGSAPANAQPELSSEIVFEQSPDQLLNALLPLYLQNQVLRSLQEAAASELASRMTAMNNASDNAKALAKTLTLDYNKARQAAITQEILEVAGGAAAVG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
A5GV71
MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQDLVLRSRPFADRLARVLESLQSRIALESADTPLLQARDPRHITLVAMTGDRGLCGGFNANIIKRTEQRFAELKASGYEVALITVGRKVDTYFQNRNYPITASFTGLDQLPTSTDALQVSDAVQAEFLGGATDRVELIYTKFINLVSTKPVSQTLLPLDPQGIASPDDEIFRFVTKEGELGVERSSASNQEDKLKSDLVFEQSPSQLLDVLLPLYLQNQVLRSLQESAASELASRMTAMNNASDNAKALAKELTLDYNKARQAAITQEILEVVGGASAMA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q0I7R3
MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARLLENLQARMRFEDADAPLLEQRAVQTITLMAVTGDRGLCGGYNSNIIKRTEKRFAELQRQGYKVALVLIGRKAISYFTNRNYPIQATFTGLEQVPTADEAGSIASEIFAEFLSETSDRVEIIFTKFINLVSCKPVVQTLLPLDPQGIAEADDEIFRLTTKEGRLSVEAGSAPENSQPALPSDIVFEQSPDQLLNALLPLYLQNQLLRSLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAAITQEILEVVGGSAAAGA
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q3AZM0
MANLKDIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLSRILENLQSRMRFEEADAPLMEQRTVETITLVAITGDRGLCGGYNANIIKRTEQRFAELKGKGFNVKLVVIGSKAISYFSNRDYPIQAKITGLEQVPTADEANTIATDMLAEFMAAGTDRVEMVFTKFINLVSCKPVLQTLLPLDPQDIADPEDEIFNLTTDQGRLTVEPGTSSANTAPKIPSDIVFEQSPDQLLNALLPLYLQNQLLRCLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAAITQEILEVVGGSAAAGG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q3AHK6
MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARILENLQSRMGFEDAASPLMQQRNVETITLVAVTGDRGLCGGYNANIIKRTEQRFAELKGKGFDVKLLLIGTKAIGYFTRRDYPIQATFSGLEQVPTADEANTISTDLLAEFLAESTDRVELIFTKFINLVSCKPVVQTLLPLDPQDIADPEDEIFRLTTKDGLLTVEPGAGPANTEPKIPSDIVFEQTPEQLLNALLPLYLQNQLLRSLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAAITQEILEVAGGAAAVG
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
P17253
MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVLSTRPFADALAQVLYNLQNRLSFAETELPLFEQREPKAVALLVVTGDRGLCGGYNVNAIKRAEQRAKELKNQGIAVKLVLVGSKAKQYFGRRDYDVAASYANLEQIPNASEAAQIADSLVALFVSETVDRVELIYTRFVSLISSQPVVQTLFPLSPQGLEAPDDEIFRLITRGGKFQVEREKVEAPVESFPQDMIFEQDPVQILEALLPLYNTNQLLRALQESAASELAARMTAMSNASDNAGQLIGTLTLSYNKARQAAITQELLEVVAGANSL
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
C5BKJ6
MASGKEIRTKIGSIKNTQKITSAMEMVAASKMRKAQDRMEVGKPYARRMREVVGHIAAGNLEYQHLYITEREVKRVGYIVVSTDRGLCGGLNVNLFKAVLRHSKEWADKGIETDFCMVGAKGTAFFKSVGANIVASLRDIGEQPSITSLIGSVKVMLDAFADGKIDRLYVCSNDFVNTMTQTPKVERLLPLKPEDGAIHKRSWDYLYEPDAKELLDGLMVRYIESQVFQAVVENGACEQAARMIAMKSATDNAGNLINELQLAYNKARQAAITQELSEIVGGAAAV
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.
Q47M81
MGAQLRVYRRRIRSTKSMAKITRAMELIAATRITKAQRAAEAAAPYAREITRAVSAVAARVSDHPLLTEAENPTRAAVLVITSDKGLAGAYTANAIKEAERLTALLNEQGKEVLTYMVGRKGIGFYKFRERPLADSWEGFTERPSYMHAMEISSALMEKFIQETAEGGVDEIHIVSTEFISMINQRARASRILPLEVEEVDSKVLEAEQGPLPLYEFEPGAEEVLDQLLPKYVTNRIYFALLESAASQHASRRAAMKAATDNAEELVKTLTRQANQARQAEITNEISEIVGGADALAAASAGSE
Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex. F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. Belongs to the ATPase gamma chain family.