UniProt ID
stringlengths
6
10
Protein Sequence
stringlengths
2
35.2k
Functional Description
stringlengths
5
30.7k
A4SGW2
MDIKTLHPAIAAAYRVLETGEPISLEEAELLASLPGEFSLDLASLANKVRNRWGKGGIHACSIMNAKSGVCGENCRFCAQSRHNHADIEVYPLVDEDAVLFEARSCAEHGVSHFGLVTSGYGYRTMNAEFKRILAMIDRLHEELPELNVCASIGILGPETAAALARHGIAHYNINLQVAPEKYAGLIADTHGIEERMETVRLLRREGVNVCCGGIIGVGESMEDRVAMLFALRDLDVSVIPINVLVPIEGTPLQAAESVPLADIVKVFALARLVHPHSIIKFAAGRETLMKDFQGLLMLSGADGYLTGGYLTTRGRDLADDQRFSERLASFS
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q7DE82
MREETVSWSLEDIREIYHTPVFELIHKANAILRSNFLHSELQTCYLISIKTGGCVEDCAYCAQSSRYHTHVTPEPMMKIVDVVERAKRAVELGATRVCLGAAWRNAKDDRYFDRVLAMVKSITDLGAEVCCALGMLSEEQAKKLYDAGLYAYNHNLDSSPEFYETIITTRSYEDRLNTLDVVNKSGISTCCGGIVGMGESEEDRIKLLHVLATRDHIPESVPVNLLWPIDGTPLQDQPPISFWEVLRTIATARVVFPRSMVRLAAGRAFLTVEQQTLCFLAGANSIFYGDKLLTVENNDIDEDAEMIKLLGLIPRPSFGIERGNPCYANNS
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q8KGB6
MKSRLHPDIEKAYAVLDTGEPLSLELASALGRLPDSEVLDLVSLANRVKARHAANHGAIHACSIMNAKSGVCGENCRFCAQSKHNSAEVDVYELVDENKVLEQARSAWEQGIGHFGIVTSGYGYLKVTPEFERILGMIDRLHRELPGLHVCASLGVLGDAPAAELARHGIAHYNINIQVDPARYGELIADTHAVNERIGTIRRLRSNGIGVCCGGILGVGETMQERIGMIFALRDLDVTVIPLNVLVPIDGTPLEGAAPVSVPEIAKTFAICRLAHPTKIIKFAAGRETVMKDFQGLLMLAGADGFLTGGYLTTRGRDISTDRQLARQLSKFS
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q1QYD5
MTAQSRDPAWTDASPTFQPTMRHDWSLEEIEALFALPFNDLLFRAQQVHRAHFDPNAVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLGKEKLLEIEKVVEQARAAKAAGASRFCMGAAWRSPREKDLRVVTEMVGRVKALGLETCMTLGMVDVDQARRLAEAGLDYYNHNLDTSPDYYGEIITTRTYADRLETLANVREAGMKVCSGGILGMGEAPRDRAALLQQLVRLDPHPESVPINMLVKVPGTPMENVEDMDPLTFIRAIAVARILMPKSHVRLSAGREQMDESTQALAFLAGANSIFYGDTLLTTGNPQVERDRALFDKLGLHPEPSDPHADDAHRDDEQAEIALAHAIQRQRDDALFYDATRG
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q7NPW1
MHSATMVFKRAATPHPEKAEWSVDDVEALLGLPFMELVFRAAEIHRQFFDPTKVQLSTLVSIKTGGCPEDCGYCPQSVHHDTPVADQPMMTVDEVVAAARQAKANGAGRFCMGAAWRGPKDADLQKTLDMVREVKALGLETCATFGLLRDGQAEQLKDAGLDYYNHNLDTAPDKYGDIIQTREYEDRLDTLGKVRKAGLSVCCGGIVGMNETRRDRAGLIVQLANLDPQPESVPVNNLVQVVGTPLEGAERLDWTEFVRTIAVARITMPASYVRLSAGRREMDEATQALCFLAGANSIFYGDKLLTTGNPDVVADQSLMAKLNLQPL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B5ECN1
MEKMINDIAHRIIAGGSITEAEAIQLTQVQGTEVYDLFRAATRVKEHFVGNEVHLCSIINAKSGRCAENCAFCAQSAHHKTDAPVYPLVQEEEMLASARMAETNGSACFGIITSGTTVNGPELEQILTALRRIRKETTILPSCSLGIIDEETARKLKEAGMDTYHHNLETAASFFPQICTTHDYQDDVNTVRAVKKAGVKVCCGGIFGLGESAAQRVEMALTLKDLDVDSVPMNFLNPIEGTRLEGAANITAQECLKTIAIYRLILPGKRITVCGGREKNLRDLQSWIFFAGANGTMIGNYLTTLGRNVDTDLTMFSDLGLKTVMCAH
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
P12997
MAHSS
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A8AJ12
MAHHPRWTLSQVTELFNKPLLDLLFDAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEACMTLGTLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLDKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNEDVDAFDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQTSVLAGDNEQQQRLEQALMTPDTDDYYNAAAV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q97MI6
MKNQWNNILSIGEKVLNGEKITADEALTLSKSNGSDIFLLCSFANKLREKFNGNHVDLCSVINAKSGNCSEDCAFCAQSAHHKANVSCYPLLNEDKILEMAKQREAYGARHCDIATSGLGYTGDEKDFQTILKAFKKMKENTNLKLCACLGTLTEKAMNSLAAVGVERYNHNLETAKSFYKNIVSTHGYDERIKTINYAKNAKMEVCSGMIVGLGETMEQRIEHALLLRDLNVDAVPVNILNPVKGTKLENAKPLSPMEIIKTFAIIRFILPDKIIRYAGGREKNLRSLQPLGFLSGLNGMLIGNYLTTNGQSVNDDFNMLKDLELEY
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A7FVS6
MSNIIKYKKKILNGDLLTKEEVEELLEEDITDLAATANEIRESLCGNKFDLCTIINGKSGRCQENCKYCAQSAHFDTDIIEYNILNSDRIINSAISNYNKGVHRFSVVTSGRALNNNEVDTLCKTYSKLKETCSIRLCASHGLLKYEDLKRLKDSGVTRYHNNLETSRKFFTKICTTHKYDDKIETIKNAKKAGIEICSGGIIGLGETMEDRIDMAFTLRELSVESVPVNILNPIKGTPLENQEILSYEEIIKTLALFRFILPTVQIRLAGGRTIISDKGKKALESGVNGAISGDMLTTLGIETSEDIKMIKNLGFEV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A6LUQ4
MEKLAEEIINGRRLTRSDDLEFLLTCDLKKICDGANKIRKTLCGESVDLCTIINGRSGKCSENCKFCAQSNHHKTEIKKYDFLDPNVILKDCKKNEANGVHRYSIVTAGRALVGSDFDKAVQAYKMMNKECSINLCASHGFLSEEQFVLLKEAGVTMYHANIETSKRNFHNICTTHSYDDKIKEIKLAQNAGLKVCSGGIIGMGETWYDRIDMAISLSELGVISIPINVLMPIKGTPLENLKRISNYDILRTIAIFRYINPTAYIRMAAGRTYFEDGGIEIFQSGSNATITGDMLTTVGNNTCQDKIMLQTLGFSI
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B2V167
MNIIDRFKEKILSGELISKKEAIILSKENVDKLASAANDIRMSLCGKKFNLCTIINGKSGRCGENCKYCAQSVYFKTDIEEYNLLDSESIITSAISNYNSGVHRFSVVTSGKKLTNKEIDIVCKTYSEVQEKCAIKLCASHGLLNYEELVKLKESGVIRYHNNLETSRRFFSNICTTHTFDEKINTIKNALKAGLQVCSGGIIGLGETMEDRIDMAFTLRELNVDSIPINILNPIKGTALENQEKLSYDEITKTFALFRFILPEKQIRLAGGRALLNDKGERLMKSGVNSAISGDMLTTSGIKTFDDIKMIKELGFEV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B2TL73
MNIVDKFKEKILSGELISKKEAMILSKENIDELASAANDIRMSLCGKEFNLCTIINGKSGRCGENCKYCAQSVYFKTDIEEYNLLDSESIITSAISNYNNGVHRFSVVTSGKKITNKEVHTVCKTYSELKDKCDIKLCASHGLLNYEELVKLKESGVIRYHNNLETSRNFFSNICTTHTFDEKTHTIKNALKAGLQVCSGGIIGLGETMEDRIDMAFTLRELNVDSIPINILNPIKGTALENQEKLSYDEITKTFALFRFILPKKQIRLAGGRALLNDKGERLMKSGVNAAISGDMLTTSGIKTFDDIKMIKELGFEV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A7G5G4
MSNIIKYKKKILNGDLLTKEEVEELLEEDITDLAATANEIRESLCGNKFDLCTIINGKSGRCQENCKYCAQSAHFDTDIIEYNILNSDRIINSAISNYNKGVHRFSVVTSGRALNNNEVDTLCKTYSKLKETCSIRLCASHGLLKYEDLKRLKDSGVTRYHNNLETSRKFFTKICTTHKYDDKIETIKNAKKAGIEICSGGIIGLGETMEDRIDMAFTLRELSVESVPVNILNPIKGTPLENQEILSYEEIIKTLALFRFILPTVQIRLAGGRTIISDKGKKALESGVNGAISGDMLTTLGIETSEDIKMIKNLGFEV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B1IHH9
MSNIIKYKKKILNGDLLTKEEVEELLEEDITDLAATANEIRESLCGNKFDLCTIINGKSGRCQENCKYCAQSAHFDTDIIEYNILNSDRIMNSAISNYNKGVHRFSVVTSGRALNNNEVDTLCKTYLKLKETCSIRLCASHGLLKYEDLKRLKDSGVTRYHNNLETSRKFFTKICTTHKYDDKIETIKNAKKAGFEICSGGIIGLGETMEDRIDMAFTLRELSVESVPVNILNPIKGTPLENQEILSYEEIIKTLALFRFILPTVQIRLAGGRTIISDKGKKALESGVNGAISGDMLTTLGIETSEDIKMIKNLGFEV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A7GFJ9
MSNIIKYKKKILNGDLLTKEEVEEILEEDITDLAATANEIRESLCGNKFDLCTIINGKSGRCQENCKYCAQSAHFDTDIIEYNILNSDRIINSAISNYNKGVHRFSVVTSGRALNNNEVDTLCKTYSKLKETCSIRLCASHGLLKYEDLKRLKDSGVTRYHNNLETSRKFFTKICTTHKYDDKIETIKNAKKAGLEICSGGIIGLGETMEDRIDMAFTLRELSVESVPVNILNPIKGTPLENQEILSYEEIIKTLALFRFILPTVQIRLAGGRTIISDNGKKALESGVNGAISGDMLTTLGIETSEDIKMIKNLGFEV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q0ATN3
MSLLNDIDQLSQVRTDWTRETAGEIYRAPFNDLIFAAQSVHRQCHPANQVQTSQLLSIKTGGCAEDCGYCNQSAHFDTGLKASKLMPLDDVLDAAKKAKDGGATRFCMGAAWRELKTRDEDVICDMISGVKSMGMETCVTLGMLTDSQANKLREAGLDYYNHNLDTAPEDYGRVISTRTYQDRIDTLSRVRGAGIHVCTGGIVGMGEDEAARIGLLTELASMDPHPESVPINHLVAVPNTPLGDSKPLDGIEFVRTIATARILMPRSMVRLSAGREGMSRELQALCFLAGANSIFVGEELLTTPNPEQNEDFDLFKSLGIEPMRLGETGTVPAE
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A6W0Y1
MSINNISAPRFDWTHAEIKALFDLPFMDLMFRAQTVHRENFAPNEVQVSTLLSIKTGACPEDCKYCPQSGHYNTELEKEKLMEVQKVLEEAALAKEKGASRFCMGAAWKHPSEKDFPYVLEMIKGVKSLGLESCVTLGSLNDDQAKRLSEVGLDYYNHNLDTSAEFYDSIITTRTYQDRLDTLSRVRDSGIKLCCGGIMGMGEEQKDRVGLLRQLSQMTPHPESVPINMLVKVEGTPLENVDDLDTFEFIRTIAVARILMPKSHVRLSAGRQGMNEQTQALCFMAGANSIFYGEKLLTTGNPEADKDMALFANLGINPEKREEHSDAAVAEAIAAQVVKQEESKLFYEASV
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A1U4B2
MTATATRHDWTLQEARELFNLPFNDLLFRAQSIHREHFDPNEVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKEKLLEIEKVVAEARVAREKGASRFCMGAAWRSPSKKDMPYVLDMVRQVKSLGLETCMTLGMLKEEEAKELADAGLDYYNHNLDTSEKYYNHIITTRTYQDRLDTLDNVRKAGMKVCCGGIMGMGEDEDDRVGLLVQLANLPQHPESVPVNMLVKVKGTPLEDVEDLDPFDFIRIIAVARIMMPASHVRLSAGREQMNEQMQALCFMAGANSIFYGEKLLTTSNPEADADMQLFRKLGIRPEQREQCATEEQEEEAIAEAVEYEATRHMFYDATRESA
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
C6C0T2
MDRNEKQALWNAVHGGGAIDEHTAVSVLGASHGELAEILHAAHTMTMRRFGREVSLCSIANVRSGNCSEDCTFCAQSSHFKGTPAPAYPLMSVEEIRDCAEKAGQSPLEFFSYVTSGRALKGKSLDHVCEAVDGMRERSFNHCASLGCLDFESLKKLHESGVVRYHHNLEAAESYFPNVCTTHSYEERVRTVRDAKKAGLEVCCGGLLGLGESHQQRVELALALAELEVDSIPLNFLIPIPGTPLENVEPLQPLEILLTIAMFRLVNPHAEVRMAAGRAALRSLQSFIFHAGCNGLMVGDFLTVSGQGIDHDLTMLEDLGLTVRTKK
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A6UTF3
MEEFTGIGYFYKKSIKNQLDKKDASLLWELPYYTLLYLANCVKKHNNSNNIDLCSIINAKSGLCSENCAFCSQSLHNSSKIKEYPLKPKEDILKQAKYIEKYSNRFSIVVSGKTVNDREYNEIIDAIKDIKKETNLKVCASLGLLDNSQLKELKDLDVRIHNNLETSKEYFDKICTTHTYDDKVKSITMAKKIGLEVCSGGIIGLGESLENRINLFYELKELDVEGIPINIYNPIKGTKTYELLNNNAIKQITPIEALKSIAICKLILPNKDVRLCGGREYNLRDWQSLSLLAIDGLMIGNYLTTNGRNIEDDIKMIVDGGFDGK
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B7KN34
MSDTVVSLTASPAAIRHDWTLAEIQAIHDMPLLDLVHRAGVVHRAHNDPADIQRAALLSIKTGGCPEDCAYCPQSAHHKGANLPRERLMPVDAVLKEAAAAKANGAHRFCMGAAWRKPKDGPDFDAVLEMVRGVRGLGMEACVTLGMLTQSQAQRLAEAGLTSYNHNLDTGPEFYGDIISTRTYDDRLQTLEHVRQAGIGVCCGGIVGMGERVRDRAEMLLVLANHAPHPESVPINALVAVEGTPLEDRPPIDPLDLVRMCATARIVMPKARVRLSAGRKSLTREAQILCFLAGANSIFYGERLLTTANNEADADAELLRDIGVPVPEVTLAAAE
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q609V2
MTNQERAEEPVLRHDWTQGEAEALFALPFNELLFQAQTIHRRHFDPNEVQVSSLLSIKTGACSEDCAYCPQSAHYETGVKRESLMSLEDVLEAAQRAREEGATRFCMGAAWRSPRDGDLEAIAAMVEGVKALGMETCVTAGMLSDEQARRLKEAGLDYYNHNLDTSESYYGEIITTRTYQDRLDTLQRVRDAGMHVCCGGIVGMGESAADRAGLLIGLANLPRHPESVPINLLVRVEGTPLADTAALDPFDFVRTVAVARIMMPASRVRLSAGRSDMSDEMQALCFLAGANSIFYGDRLLTTENPQAQRDRRLFARLGLRMAGLGC
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A9W8M8
MSDTVVSLTASPAAIRHDWTLAEIQAIHDMPLLDLVHRAGVVHRAHNDPADIQRAALLSIKTGGCPEDCAYCPQSAHHKGANLPRERLMPVDAVLKEAAAAKANGAHRFCMGAAWRKPKDGPDFDAVLEMVRGVRGLGMEACVTLGMLTQSQAQRLAEAGLTSYNHNLDTGPEFYGDIISTRTYDDRLQTLEHVRQAGIGVCCGGIVGMGERVRDRAEMLLVLANHAPHPESVPINALVAVEGTPLEDRPPIDPLDLVRMCATARIVMPKARVRLSAGRKSLTREAQILCFLAGANSIFYGERLLTTANNEADADAELLRDIGVPVPEVTLAAAE
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q1GZA6
MRDSVIDIRGLDRVQRARVQAKEEAPKRWSVDDIVALFELPFSDLMHRAQSVHRENFDPNGVQVSTLLSIKTGGCSEDCGYCPQAARYHTDVEKQDLMQLEEVLAAARAAKENGASRFCMGAAWRSPKQRDLEPVLAMIREVKAMGLETCATLGMLKDGQAEQLKEAGLDYYNHNLDTAPEYYGEVITTRTYQDRLDTLDRVREQDINVCCGGIIGMGESRVQRAGLLAQLANMERPPESVPINLLTQVEGTPMYGMDELDPFEFVRTIAAARITMPQSFVRLSAGRQSMHEGIQALCFLAGANSIFYGEKLLTTGNPEAEADRKLFDKLGIHPL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B3DV36
MKDYCAIEQIYHRPLDELLGEALQAKKLSGRNGVQFCQLLNIKSGGCSEDCKYCAQSAHYRTPIEKGALLDEEEILQAGLQAKEKGASRFCLGAAWRGLFEGETKTKKICKIISKISSLGMELCLSAGFLTEKTALMLKESGLKVYNHNLNTGPSYYPRIASTHRFEDRLQTIRIVQKVGLKLCSGGIIGMGERLKDRLEMLFCLYSLPEAPESIPINVYMPIEGTPFYGTPPLDYMDLIRMIATTRILFPLSRIRLAAGRKLLDEKTLTLCYLAGVDSIFIGEKLLTQSNVQLEKDYALLKKLNLRKEER
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q58692
MIFMEIETFLKKSLKNKIDFDDALYLYNNFSAIDLLYLAFKIKNRIKNNSKIKLCAIINAKSGKCKEDCIFCSQSIYSKCNIPIYPLKSKKEILEYAKKIIDECSKISSSIERGTLIGAESPNLMDVGYPNRGFPLWVERFSIVTSGKKINDDEFIEIVEAIELIKEETNLKVCCSLGLLDREKLKELKKLDVRIHNNLEASKNYFKNICSTHSYEDKVKVIKEAKKLDLEVCSGGIFGLGESVEERIKMAFELKELGVDSVPINILHPIEGTKAYEKIKNGEIKPISVSDALKLIALYKIIMPYAEIRLAGGRIYNLRDFQSYALMVLDGLMVGNYLTTKGRCLEDDLKMIADFHSL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A4FWU0
MKEIKLNSDSLEIYEKSASKKLNRNDLIDLWNLDLNDLLDISYALKKLFNKDKIDLCSIMNAKSGICPENCIFCSQSKHNSSKIDTYELKSKEEILKNAKSVEKYSNRFSIVVSGKTVTDLEFEKIIESIEEIQNKTKLKVCVSLGLLNKDQLKALNEKNVRIHNNLETSENYFKNICTTHDYNDKIKVILEAKKIGLEMCSGGIFGMGESIDDRINLFLDLKKLGVDSIALNLLNPIYGTKIYDRINSGDISPINSIGALKSLCIARITLPNKVIRLCGGREHVLKDMQKYSLLAIDGLMIGNYLTTNGQNIQSDLKMIEEMGFER
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A9AA75
MREIKLNPDSLEIYEKSDSGKLNRNDLIDLWNLDLNDLLNISCALKKLFNKDKIDLCSIMNAKSGICPENCIFCSQSKHNTSKIDTYELKSKEEILKNAKSVEKYSNRFSIVVSGKTVTDLEFEKIIESIEEIQNKTKLKVCVSLGLLNKDKLKALKEKNVRIHNNLETSENYFKNICTSHDYNDKVKVILEAKKIGLEMCSGGIFGMGESIEDRVDLFLDLKKLGVDSVALNLLNPIYGTKIYEKIKFGVISPINSIDALKSICIARIALPDKVIRLCGGREHVLKDMQKYSLFALDGLMIGNYLTTNGQNIQSDLKMIKEMGFER
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A6VGH7
MKEIELNSDSLEIYEKSASEKLNKKDLVDLWNLDLKNLLDISYSLKKLFNKEKIDLCSIMNAKSGVCSENCIFCSQSKHNSSKIDTYELKSKEEILKNAKSVEKYSNRFSIVVSGKSVTDLEFENIIESIEEIQNKTKLKVCVSLGLLNKDKLKALKEKNVRIHNNLETSENYFKNICTSHDYIDKIKVILEAKKMGLEMCSGGIFGMGESVADRVDLLLDLKKLDVDSVALNLLNPICGTRIYDKINSGEFIEINHTDALKSICIARIALPKKVIRLCGGREHVLKDMQKYSLYVLDGLMIGNYLTTNGQNIQSDLKMIDEMGFKQ
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q6LXV8
MKEIKLNSDSLEIYEKSVSEKLNRNDFIKLWDLDLNDLLDISYNLKKLFNKEKIDLCSIMNAKSGICPENCIFCSQSKHNTSKIDTYGLKSKEEILKNAKSVEKYSNRFSIVVSGKTVTDLEFEKIIESIEEIQNKTKLRVCVSLGLLNKDKLKALKERNVRIHNNLETSENYFKNICTSHDYSEKIKVILEAKKIGLEMCSGGIFGMGETIEDRVDLFLDLKKLGVDSVALNLLNPIYGTKIYEKIKSGDISPINSTDALKSICIARIALPNKVIRLCGGREHVLKDMQKYSLLALDGLMIGNYLTTNGQNIQSDLKMIEEMGFER
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B8IU36
MTTTTERPDAPIRHDWTVAEIQAIYDLPLLDLVHRASLVHRAHHDPADIQRASLLSIKTGGCPEDCAYCPQSAHHKEAGIGRQRLMPVEAVLREAEAAKAAGATRFCMGAAWRQPKDGPEFDAVLAMVRGVRGLGMEACVTLGMLTPSQAERLAEAGLTAYNHNLDTGPDFYGDIISTRTYADRLNTLQAVRDAGIGVCCGGIIGMGEGVADRAAMLQVLANHAPHPESVPINALVAVAGTPLAERPPVDPLDLVRMCATARIVMPKARVRLSAGRRALTREAQVLCFLAGANSIFYGERLLTTANNEADADAQLLRDIGVPVPGIEVLEAAE
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B1ZFX7
MSDTVVSLASSQAPDAVRQDIRHDWTLAEIQAIHDMPLLDLVHRAGTVHRAHNDPADIQRAALLSIKTGGCPEDCAYCPQSAHHKGANLPRERLMPVDAVLKEAAAAKANGAHRFCMGAAWRKPKDGPEFDAVLEMVRGVRGLGMEACVTLGMLTQSQAQRLAEAGLTSYNHNLDTGPEFYGDIISTRTYDDRLQTLEHVRQAGIGVCCGGIVGMGERVRDRAEMLLVLANHAPHPESVPINALVAVEGTPLEDRPPIDPLDLVRMCATARIVMPKARVRLSAGRKSLTREAQILCFLAGANSIFYGERLLTTANNEADADAELLRDIGVPVPEVTLAAAE
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A2SGQ6
MTATQPVHLVRPAPVHVHPSSERWSVEAIEALFALPFNDLIFRAQQVHREHFDANAVQRSTLLSIKTGGCPEDCAYCPQSVHHDTGVEADKLMDVATVRQAAQAAAAAGATRFCMGAAWREPKDRDIEKVVELVREVKSLGLEACCTLGMLSKPQAQALKEAGVDYYNHNLDTAPEAYGRIISTRVYEERLQTLAHVRDAGMNVCCGGIVGMGESRRERAGLVAQLANLDPHPESVPINELVQVEGTPLAGSDKLDPFEFVRTIAVARITMPTAYVRLSAGRQEMGDAIQALCFLAGANSIFYGDKLLTTGNPDVERDEALFERLGLTSA
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B1LV19
MSATSLPGSQQPDLGEIRHDWSVAEIRAIHDLPLMDLVFRAAQVHRRHNDPADIQRASLLSIKTGGCPEDCAYCPQSAHHKGAGVARERLMPVETVLAEAAAAKAAGAQRFCMGAAWRQPKDGPEFDAVLAMVRGVRGLGMEACVTLGMLTPSQAGRLAEAGLTSYNHNLDTGPDFYEDIISTRTYDERLQTLANVREAGIGVCCGGIVGMGEGVTDRAAMLQVLANHAPHPESVPINALVAVPGTPLEDQPAVDPFDLVRMCATARIVMPRSRVRLSAGRKSLTREAQVLCFLAGANSIFYGERLLTTANNGQDDDAALLADLGIRVGEPVRAAAE
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B0U811
MTTTERSDPAIRHDWTVAQVQAIHDMPLLDLVHRASLVHRAHHDPSDIQRASLLSIKTGGCPEDCGYCSQSAHHKETGVARQRLMPVEAVLREAAAAKAAGATRFCMGAAWRSPKDGPDFDAVLAMVRGVRGLGMEACVTLGMLTPSQAERLAEAGLTAYNHNLDTGPDYYDKIVSTRSYEDRLATLQAVRDAGIGVCCGGIIGMGEGVTDRVAMLQVLANHAPHPESVPINALAAVPGTPLGERPPVDPFEMVRMCATARIVMPRARVRLSAGRRALSREAQVLCFLAGANSIFYGERLLTTANTDADADAQLLRDIGVPVPAISALEAAE
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
P12678
MARHPRWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWRNPHERDMPYLEKIVQGVKAMGLETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLFRKLGLNPQQTRVLAGDNEQQQRLEQTLMTPDTDDYYNAAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
O60050
MFTRTIRQQIRRSSALSLVRNNWTREEIQKIYDTPLIDLIFRAASIHRKFHDPKKVQQCTLLSIKTGGCTEDCKYCAQSSRYNTGVKATKLMKIDEVLEKAKIAKAKGSTRFCMGSAWRDLNGRNRTFKNILEIIKEVRSMDMEVCVTLGMLNEQQAKELKDAGLTAYNHNLDTSREYYSKIISTRTYDERLNTIDNLRKAGLKVCSGGILGLGEKKHDRVGLIHSLATMPTHPESVPFNLLVPIPGTPVGDAVKERLPIHPFLRSIATARICMPKTIIRFAAGRNTCSESEQALAFMAGANAVFTGEKMLTTPAVSWDSDSQLFYNWGLEGMQSFEYGTSTEGEDGTFTLPPKERLAPSPSL
Catalyzes the last step of biotin biosynthesis, the conversion of dethiobiotin to biotin. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Belongs to the radical SAM superfamily. Biotin synthase family.
P36569
MADRIHWTVGQAQALFDKPLLELLFEAQTVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSPRYKTGLESERLMQVEQVLESARKAKANGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGMETCMTLGTLDGTQAERLAEAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLDKVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLADNDDVDPFDFIRTIAVARIMMPSSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQTATEHGDNQQQQVLAKQLLNADTAEFYNAAP
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A8GBC5
MADRIHWTVGLAQTLFDKPLLELLFEAQTVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLESERLMQVEQVLESARKAKANGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGMETCMTLGTLDGTQAERLADAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLGKVRGAGIKVCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNEDVDPFDFIRTIAVARIMMPASYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQTETEHGDNQQQQALAAQLMQADTAEFYNAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A1S5I9
MSSFAVRHDWSRQEVEALFALPMNDLLFRAHSIHREVFDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLEIEKVLTEARAAKDAGATRFCMGAAWRNPHERDMPYLTDMVKEVKSMGLETCMTLGMLSAHQANQLAEAGLDYYNHNLDTSPEFYGDIITTRTYQDRLDTLSNVRAAGMKVCSGGIVGMGEQATDRAGLLQQLANLEQHPDSVPINMLVKVTGTPLDSVDDLDPLEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEENDDMSLFRRLGLKPEQGKAAIVEEDAAVVARAAREQQAEGEAKTKPLFYDAAN
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B8EAJ2
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKEKDMPYLKQMVQEVKALGMETCMTLGMLSEDQANDLASAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAAAKLEEESAVLAKAAAYQDKSSAQFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A3D3F2
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKEKDMPYLKQMVQEVKALGMETCMTLGMLSEDQANDLASAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAAAKLEEESAVLAKAAAYQDKSSAQFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A6WM55
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKEKDMPYLKQMVQEVKALGMETCMTLGMLSEDQANDLASAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAAAKLEEESAVLAKAAAYQDKSSAQFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A9KY60
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKEKDMPYLKQMVQEVKALGMETCMTLGMLSEDQANDLASAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAAAKLEEESAVLAKAAAYQDKSSAQFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q12NN4
MSLFEVRHDWKKAEIEALFALPMNDLLFKAHTIHRESFDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLEIEKVLTEAKSAKAAGASRFCMGAAWRNPRDRDMPYLTQMVKDVKALGLETCMTLGMLSTEQSQKLAGAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLSNVRASGMKVCSGGIVGMGEKASDRAGLLQQLANLEQHPDSVPINMLVKVAGTPFEKIDDLDPLEFVRTIAVARIIMPKSRVRLSAGREKMSDELQSMCFFAGANSIFYGCKLLTTANPEENDDMSLFKRLGLRPEQGPAAPVAQVATNLDQEQALIAKASALNEKATQQFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q084I8
MSLAEVRHDWQKAQIEALFALPMNDLLFKAHSIHRETFDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLEIDKVLTEAKSAKAAGASRFCMGAAWRNPRDKDMPYLTQMVKDVRALGMETCMTLGMLSSEQAGKLADAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLEQHPDSVPINMLVKVAGTPFENIDDLDPLEFVRTIAVARILMPKSRVRLSAGRESMSDELQSMCFFAGANSIFYGCKLLTTPNPEENDDMSLFRRLGLHPEQGPQANIENDSALLAKASAKQDKSTKQFFDAAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B0TJN8
MSEVQLRNNWKREEIESLFALPMNDLLFQAHSIHRQEFDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKERDMPYLKTMVEEVKALGMETCMTLGMLSAEQANTLADAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLSNVRASGMKVCSGGIVGMGEKATDRAGLIQQLANLDQHPDSVPINMLVKVEGTPFEKLDDLDPLEFVRTIAVARITMPKSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEENDDMGLFRRLGLHPEQGVASTKEQDEAMLAKAAAQQDKKVSAFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A3QDN8
MSELALRHDWQRDEIEALFALPMNDLLFKAHSIHRQHFDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLIEIEKVLTEARAAKAAGASRFCMGAAWRNPHERDMPYLKDMVSEVKAMGMETCMTLGMLSESQAKDLADAGLDYYNHNLDTSPEYYGDIITTRTYQDRLNTLDNVRAAGMKVCSGGIVGMGEQASDRAGLLQQLANMAKHPESVPINMLVKVAGTPFENLDDLDPLEFVRTIAVARIVMPLSRVRLSAGREKMTDELQAMCFFAGANSIFYGCKLLTTSNPEENEDMTLFKRLGLHPEQGKAGTVEEDKAVFAKAQAVKDKASQPFYDAAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q8EDK6
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREEYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKDKDMPYLKQMVQEVKALGMETCMTLGMLSAEQANELAEAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLSHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAAASIDDEQAVLAKAAAYQDKASAQFYDAAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A8H3I7
MPEVQLRNNWKREEIEALFALPMNDLLFQAHSIHRQEFDPNEVQVSRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKERDMPYLKTMVEEVKALGMETCMTLGMLSAEQANTLADAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLIQQLANLEQHPDSVPINMLVKVEGTPFEKLDDLDPLEFVRTIAVARITMPKSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEENDDMSLFKRLGLHPEQGIAATKEQDEAMLAKAAAHQDKKSAAFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A4Y7Y3
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKEKDMPYLKQMVQEVKALGMETCMTLGMLSAEQANELADAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLTHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAVATLDDEQAVLAKAAAHQDKSTAQFYDAAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
B8CQY2
MSDVQVRNNWKRDEIETLFALPMNDLLFQAHSVHRQEFDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKERDMPYLKTMVEEVKSLGMETCMTLGMLSADQASELADAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLSNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLDKHPDSVPINMLVKVEGTPFEKIDDLDPLEFVRTIAVARIIMPKSRVRLSAGRENMTDELQAMCFFAGANSIFYGCKLLTTPNPEENDDMSLFRRLGLHPEQGIAATKEQDEAMLAKAAAQQDKKASAFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A0KY79
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKDKDMPYLKQMVQEVKALGMETCMTLGMLSAEQANELADAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLSHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPKSRVRLSAGRENMTDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAAATIDDEQAVLAKAAAHQDKASAPFYDAAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
A8FX10
MSDIQLRHDWKHDEIEALFALPMNDLLFKAHSLHRQVFDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLIEIEKVLTEARSAKAAGASRFCMGAAWRNPHARDMPYLKDMVSEVKAMGMETCMTLGMLSGTQAEELAEAGLDYYNHNLDTSPEYYGEIITTRTYQDRLDTLSNVRSAGMKVCSGGIVGMGEQASDRAGLLQQLANMEQHPDSVPINMLVKVAGTPFENLDDLDPLEFVRTIAVARIIMPHSRVRLSAGREKMTDEMQAMCFFAGANSIFYGCKLLTTNNPEENEDMTLFKRLGLHPEQGKYATVEDDKEVMAKASAKANAIKDKQSGAFYDAGAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q0HHN7
MSQLQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYCPQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKDKDMPYLKQMVQEVKALGMETCMTLGMLSAEQANELADAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLSHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDPLEFVRTIAVARILMPKSRVRLSAGRENMTDELQAMCFFAGANSIFYGCKLLTTPNPEESDDMGLFRRLGLRPEQGAAATIDDEQAVLAKAAAHQDKASAPFYDAAAL
Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. (4R,5S)-dethiobiotin + [sulfur carrier]-SH + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S-adenosyl-L-methionine = 2 5'-deoxyadenosine + [sulfur carrier]-H + biotin + 2 L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] Binds 1 [4Fe-4S] cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine. Binds 1 [2Fe-2S] cluster. The cluster is coordinated with 3 cysteines and 1 arginine. Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 2/2. Homodimer. Belongs to the radical SAM superfamily. Biotin synthase family.
Q8Z890
MTKRYFVTGTDTEVGKTVASCALLQAATQLGYQTVGYKPVASGSEMTTDGLRNSDALALQRNSSLPQPYSAINPYTFAEPTSPHIASADEGRAIDAAVLSRGLRTLEAQADWVLTEGAGGWFTPLSATLTFADWVQTEQLPVILVVGVKLGCINHAMLTALAVEQAGLPLVGWIANDMQPPGARHGEYLATLRRVIPAPLLGEIPWLGVSPSQAATGQYLDLSPLERA
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q8ZQQ5
MTKRYFVTGTDTEVGKTVASCALLQAATQLGYQTVGYKPVASGSEMTTDGLRNSDALALQRNSSLPQPYSAINPYTFAEPTSPHIVSADEGRAIDAAVLSRGLRTLEAQADWVLTEGAGGWFTPLSATLTFADWVQTEQLPVILVVGVKLGCINHAMLTALAVEQAGLPLVGWIANDIQPPGARHGEYLATLRRVIPAPLLGEIPWLGVSPSQAATGQYLDLSPLERA
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q0WHP5
MTKRWFITGTDTDVGKTVASCALLQAATAQGYRTAGYKPVASGSQMTADGLRNSDALALQANSSQRLGYSQVNPFTFLEATSPHIASESEGRAIPLTALSQGLRQLEPSADWILIEGAGGWFTPLSPQATFADWVQQEQLPVIMVVGVKLGCINHALLTAQAIQHAGLTLAGWVANEVTPAGRRQAEYQATLTRMITAPLLGIIPYLSDIEENPVTTRRDLGHYLDLTVLRAAEREAVNM
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family. Extended N-terminus. Extended N-terminus.
Q8X788
MLKRFFITGTDTSVGKTVVSRALLQALASQGKTVAGYKPVAKGSKETPEGLRNKDALVLQSVSTIELPYEAVNPIALSEEESSVAHSCPINYTLISNGLANLTEKVDHVVVEGTGGWRSLMNDLRPLSEWVVQEQLPVLMVVGIQEGCINHALLTAQAIANDGLPLIGWVANRINPGLAHYAEIIDVLGKKLPAPLIGELPYLPRAEQRELGQYIRLAMLRSVLAVDRVTV
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q7VL12
MGKIIFVSGIDTDIGKTIATGFYAKRLMQQGFSVITQKMIQTGCQHISADIIKHRQLQGIELTAEDLNGITCPYLFRYPCSPHLAAEMENNPILPSKIAQASALLAQKYDYVLLEGAGGLAVPYNSQQTTLDYIVEQQLPLILVTSAKLGSINHTLLSLIVCQQHKIEMEAVIYNTYPLEDEKIAKSTQLYLQQYIKQHFPNTEFLVMDRQ
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
P45248
MGKVIFISGIDTDVGKTIATGIYAKKLMEQGCSVITQKMIQTGCKNIADDLLVHRKIQGIDLTEEDLQGKTCPYVFEYPCSPHLAAKRESRKIEAKIIEKSTALLAEKYDYVLLEGAGGLMVPYCEEATTLDYIQLNNYPLILVTSGKLGSINHTLLSLEACRTRGISVLSVMYNGYPEYDLLLVKKPNAI
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q9CJT7
MAKVFFITGIDTDIGKTIATGWYAKKLMQQGASVITQKMIQTGCRGIAEDLLTHRKIQGIELTEEDKQGITCPYVFDYPCSPHLAAKLEQRTIERKKIETCTALLCEKYDYVLLEGAGGLCVPYNEEETTLDYLCQHQYPVILVTSGKLGSINHTLLSLQVLNSKRVSVHAVIYNLYPETDQVISQETQHFLRRYLEKYSPNTLFEVMDLISV
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q8Z6X9
MLKRFFITGTDTSVGKTVVSRALLQALSSGGKSVAGYKPVAKGSKETPEGMRNKDALVLQSVSSLELPYEAINPIALSEEESSVAHSCPINYTLLSNGLASLSDKVDHVVVEGTGGWRSLMNDLRPLSEWVVQEQLPVLMVVGIQEGCINHALLTAQAVANDGLPLIGWVANRINPGLAHYAEIIDVLGKKLPAPLIGELPYLPRAEQRELGQYIRLSMLGSVLAVDRIMA
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q8ZPK6
MLKRFFITGTDTSVGKTVVSRALLQALASSGKSVAGYKPVAKGSKETAEGMRNKDALVLQSVSSLELPYEAINPIALSEEESSVAHSCPINYTLLSNGLASLSDKVDHVVVEGTGGWRSLMNDLRPLSEWVVQEQLPVLMVVGIQEGCINHALLTAQAVANDGLPLIGWVANRINPGLAHYAEIIDVLGKKLPAPLIGELPYLPRAEQRELGQYIRLSMLGSVLAVDRIMA
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q9AGD4
MLTRLFVTGTDTAVGKTVVSRALLQALSQNGRTAVGYKPVATESKETSEGLRNQDALILQASSSIELNYQEVNPYPLQGDVIHACTDTLINYEKMTEGLQCLSAKADTVIVEGCGGWKVMMNDQRFYSDWVVQEQLPVILVVGIKLGCINHALLTAQAIINDGLPLLGWVANRINPGLAHYAETIAMLRDRLAAPQLGQLPYLPRPEEKPLAKYLDLTAISG
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q9FKL5
MIPVTATLIRHRLRHLRHRIRFKSTSVSPFHLPLNHPTYLIWSANTSLGKTLVSTGIAASFLLQQPSSSATKLLYLKPIQTGFPSDSDSRFVFSKLDSLSLRRQIPISISNSVLHSSLPAAKSLGLNVEVSESGMCSLNFRDEKTVTGAPELLCKTLYAWEAAISPHLAAERENATVEDSVVLQMIEKCLKEEMECGVKSEKSDLLCLVETAGGVASPGPSGTLQCDLYRPFRLPGILVGDGRLGGISGTIAAYESLKLRGYDIAAVVFEDHGLVNEVPLTSYLRNKVPVLVLPPVPKDPSDDLIEWFVESDGVFKALKETMVLANLERLERLNGMAKLAGEVFWWPFTQHKLVHQETVTVIDSRCGENFSIYKASDNSSLSQQFDACASWWTQGPDPTFQAELAREMGYTAARFGHVMFPENVYEPALKCAELLLDGVGKGWASRVYFSDNGSTAIEIALKMAFRKFCVDHNFCEATEEEKHIVVKVIALRGSYHGDTLGAMEAQAPSPYTGFLQQPWYTGRGLFLDPPTVFLSNGSWNISLPESFSEIAPEYGTFTSRDEIFDKSRDASTLARIYSAYLSKHLQEHSGVRQSAHVGALIIEPVIHGAGGMHMVDPLFQRVLVNECRNRKIPVIFDEVFTGFWRLGVETTTELLGCKPDIACFAKLLTGGMVPLAVTLATDAVFDSFSGDSKLKALLHGHSYSAHAMGCATAAKAIQWFKDPETNHNITSQGKTLRELWDEELVQQISSHSAVQRVVVIGTLFALELKADASNSGYASLYAKSLLIMLREDGIFTRPLGNVIYLMCGPCTSPEICRRLLTKLYKRLGEFNRT
Bifunctional enzyme that catalyzes two different reactions involved in the biotin biosynthesis. Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA) to form an ureido ring. Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only aminotransferase known to utilize SAM as an amino donor. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate (8S)-8-amino-7-oxononanoate + S-adenosyl-L-methionine = (7R,8S)-7,8-diammoniononanoate + S-adenosyl-4-methylsulfanyl-2-oxobutanoate Shoulder at 335 nm (at pH 7.5 and 30 degrees Celsius). kcat is 0.072 min(-1) for 7,8-diamino-pelargonic acid aminotransferase + dethiobiotin synthetase activities, and 1.85 min(-1) for 7,8-diamino-pelargonic acid aminotransferase activity only (at pH 7.5 and 30 degrees Celsius). Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Cofactor biosynthesis; biotin biosynthesis; 7,8-diaminononanoate from 8-amino-7-oxononanoate (SAM route): step 1/1. Homodimer. Only the isoform BIO3-BIO1 is detected at protein level in mitochondria. Arrested embryos at the transition to cotyledon stages of development (PubMed:11779812, PubMed:17993549). Biotin depletion leading to lethality; this phenotype is rescued by exogenous supply of biotin (PubMed:12644697, PubMed:23031218). May be due to a competing acceptor splice site. May be due to a competing acceptor splice site. May be due to an intron retention. In the N-terminal section; belongs to the dethiobiotin synthetase family. In the C-terminal section; belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. BioA subfamily. Was originally thought to correspond to two different genes At5g57590 and At5g57600. Was originally thought to correspond to two different genes At5g57590 and At5g57600.
C8V1D0
MAPVGAALWRSLRAHQVYGANTDVGKTIVSTFLCNAVNRLKNQGKSAFLKPVSTGPLDEADDRHLQRHAPNTLTKCLYQFDEPVSPHIAAKTFAIPRDDEILSSVHRTLSDWANDGVGFALVETAGGVHSPGPNGNSQADLYRPLRLPIILVADSRLGGISSSISAYESLLLRGYDVHSVLLFKDDYYQNHEYLGNYFRGKSIPLVPVPAPPRRPQEQDPDSRARDLEALDKYYSSVTKSTDVVSLLDELVLKNKQRVEYLDEMASRAQKTIWYPFTQHHGMAAKDITPIDSAYDDFFQTYVTADRSAQQGRLQATFDGSASWWTQGLGHGNPGLALSAAYAAGRYGHVMFPGNIHEPALALAESLLKTVDNPRLQKVFYTDNGSTGMEVALKMGLRAACDRYGWDASKEQINILGLKGSYHGDTIGVMDCSEPSTYNQRVEWYRGRGHWFDFPLVKMSQGVWQVEVPATLQASLGGNQQFSSLDAVFDVESRVRSDAGQRYRKYILETIERLVTQEGKKFGALIMEPIILGAGGMLFCDPLFQRCLADVVRGNPQLFNRGRLTEPQPQTDLSWSGLPVIFDEVFTGLYRLGRKSSASFLGVNPDIAVNAKLLTGGLVPLCTTLASNEIFNAFTSPEKRDALLHGHSYTAHAVGCQVALDSLRTMNNMDEDGSWNDFKNDWKQPHAGDTARVWSVWSHKLLHNLSHAESVDGVFAIGSVLSISLKDAEGAGYTSTAAKGLQTRLAAGGPQFNVHSRVLGNVLYLMSSVTSKQETLRTIEGILREALL
Bifunctional enzyme; part of the cluster involved in the biosynthesis of biotin (also known as vitamin B8 or vitamin H), a water-soluble vitamin that functions as a prosthetic group of many carboxylases, such as acetyl-CoA carboxylase and pyruvate carboxylase (PubMed:20713166). Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA) to form an ureido ring (PubMed:20713166). Catalyzes also the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA) (PubMed:20713166). It is the only animotransferase known to utilize SAM as an amino donor (By similarity). (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate (8S)-8-amino-7-oxononanoate + S-adenosyl-L-methionine = (7R,8S)-7,8-diammoniononanoate + S-adenosyl-4-methylsulfanyl-2-oxobutanoate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Cofactor biosynthesis; biotin biosynthesis; 7,8-diaminononanoate from 8-amino-7-oxononanoate (SAM route): step 1/1. Homodimer. Expression is increased when transferring biotin auxotrophic mutant mycelia from biotin-supplemented medium to biotin-deficient medium. Recovery of biotin-prototrophic clones from transformation of biotin-auxotrophic mutants suggests that bioDA could be usedas a new and convenient genetic marker for transformation. In the N-terminal section; belongs to the dethiobiotin synthetase family. In the C-terminal section; belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. BioA subfamily.
A0A0P0XDC2
MLRLLRHARRHSTSSSSSAAAAAVPLTSPAFAVFGANTGVGKTLVSAGLVASLLASPSPSPSTVAYLKPLQTGFPDDSDARFVFDRAPALLRRLRLAGGGASTRLVASNHTLFPSPAVDPLPERQDTVVNYGGEEGVEEKALVCRTVYAWREPVSPHLAAEREGMPVEDEEVRWLVDRWLAEEDGGGEVWKVLETAGGVASPGPSGTLQCDLYRSSRLPAVLVGDGRLGGISSTLSAYETLLLRGYDVGSVILEDRGLSNDRFLLSYLRKRVPVHVLPPIPEDPKDDLTDWFSESSSAFSSLKDSLQSFHSRRVQRLNSMQRKSKYLLWWPFTQHDLVPVDSVTVIDSRFGENFSAYKVKDKTIVPQFDACASWWTQGPDSNLQIELARDMGYAAARYGHVMFPENVHEPALRCAELLLGGVGKDWASRVYFSDNGSTAIEIALKMAFRKYACDHGIIVDSEKDIRSEGSVHFKVLALNGSYHGDTLGAMEAQAPSAYTSFLQQPWYSGRGLFLDPPTVYIKNKSANLSLPPSIMHDQLSSCDTCFSSLTEVFCKTRDTSSAANVYVSYISQQLSQYAMSNNSEHIAALIIEPVIQGAGGMHLIDPLFQRLLVKECKNRKIPVIFDEVFTGFWRLGVESASELLGCFPDISCYAKLMTGGIVPLAATLATEPIFEAFRSDSKLTALLHGHSYTAHPMGCTAAVKAIQWYKDPSTNSNIDLDRMKLKELWDSALVNHLSSLPNVKRVVSLGTLCAIELKAEGSDAGYASLYASSLIRQLREEDNIYARPLGNVIYLMCGPCTTQDSCTRQLAKVHRRLQKLN
Bifunctional enzyme that catalyzes two different reactions involved in the biotin biosynthesis. Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA) to form an ureido ring. Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only aminotransferase known to utilize SAM as an amino donor (By similarity). (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate (8S)-8-amino-7-oxononanoate + S-adenosyl-L-methionine = (7R,8S)-7,8-diammoniononanoate + S-adenosyl-4-methylsulfanyl-2-oxobutanoate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Cofactor biosynthesis; biotin biosynthesis; 7,8-diaminononanoate from 8-amino-7-oxononanoate (SAM route): step 1/1. In the N-terminal section; belongs to the dethiobiotin synthetase family. In the C-terminal section; belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. BioA subfamily.
A5FZN7
MSHFFITASGTEIGKTHVAAGMIRHWRAGDVPARALKPVASGYQPALSASSDAGILLRAMGSSMVNDEAVATICPWRFPDPISPDMAAARSGRRIPFDDLVAFCQAEIVGAAGPMLVEGVGGAMVPLDETHTVRDWIAALGIEVVLVAGGYLGTISHTLCAVEALRARGIAIAAVVINPMEPLPVPVERTRESLLRHLGATPPPVFIDDTPDWHAWLDEAARR
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
A6VND6
MRTFFVTGTDTGVGKTICSRAIIQALQEMDTQIVGFKPIASGQDEPVYADSLDDPKNDYGDEDNRDVLILQNSTKENVSYRDINSYTFLQTVPMITAEKGRIKLEKVDRDLARLAATYDVVAVEGSFGWLSPMNERFTFADWVVKHNMPVIVAVGIKEGCINHALLTVQSVEKMGLPVLGWIANRINPGLSHYAEIIDVLSSKIAAPLLGCIPYIHKPETQDVGKFLTNTEQLRHIQTLLAK
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
A0KIC9
MVKSFFVTGTDTDVGKTLVARTLLLEFAAHGLRCAGYKPISAGCARTPDGLRNLDAVLLQEAASLPLPYDLVNPYAYEPPIAPHIAASEARDAITLKGLSDGLRQIEQAGAELVVVEGAGGWFLPLDRKHLLSDWVKQENMPVIMVVGAKLGCLNHALLTFAAIRNNNLPVAGWVINRLHGSMSHYQENLDTLRGLLPAPFLGEIPFVNNPLEADLRGRLDISPLL
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
A4SPR4
MVKSFFITGTDTDVGKTLVARTLLLEFVAHGIQCAGYKPISAGCARTPDGLRNLDAVLLQEAANLSLPYDMVNPYAFEPPIAPHIAASEARDAITLKGLSDGLRQIEQAGAELVVVEGAGGWFLPLDRKHLLSDWVKQENIPVIMVVGAKLGCLNHALLTFAAIRNDNLPVAGWVMNRLYGSMSHYQENLDTLRGLLPAPFLGEIPFVNNPLEADLRGRLDISPLL
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
F8BWJ2
MSTRLVVSGTDTDVGKTVFSAALAGALDADYWKPVQAGRDDGTDALRVARLSGLPPERILPERYILNTPASPHYAARIDGITIDTNDLTPPPAKDRPLVIEGAGGLMVPINEDTLFIDVFARWKLPLVLCARTTLGTINHSLLSIEAVKRRDIPLVGIAFIGEDYAESERIICKIGGVRHLGRLPPLSPLTPEALRAAFITSFNLSDFTA
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q8U8T9
MSLRFVISGTDTGIGKTVFAAALTHALEAHYWKPVQSGLEEETDSQTVARLAGASHARILPEAYRLKTPASPHLSARLDNVSIDPARLLPPRPDGPLVIEGAGGLLVPLTDRLLFADIFALWQIPLILCARTALGTINHTLLSLEALRHRAIPVQGVVFIGDEDRENERVITDIGAVRRLGRLPRLPELTPEALHQAFAQHFNLADFLEVPA
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q3BP46
MQHPAFYVTGTDTGIGKTMGSTALLHALRARGHRAVGMKPVASGCEHTPQGWRNEDALALQAASDPQPDYATLNPYALPAPLAPELAAADVGVTLALEPIAHAFAQLLTQAEVVVVEGVGGWAAPLSATLDQADLVRALQLPVVLVVGVRLGCINHARLTAAAIAADGLQCIGWIANEIDPQMERIEENIGMLRQRLAMPCWGRIPWRPGADAAAQAHGLQLPR
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q4UQI6
MQFPAFYVTGTDTGIGKTVASTALLHAVRARGHTAVGMKPVASGCVATPQGWHNEDALALQAASQPQPDYATLNPYALPAALAPELAAADVGVTLSLVPLQQALAQLRAQAEVVVVEGVGGWAAPLSAQLDQADLVRALQLPVVLVVGVRLGCINHARLTAAAIAADGLRCIGWIANEIDPQMERIEDNIRMLGQRLAMPCWGRIPWRPNAQAEGLAQHIRLPE
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
B0RVN9
MQFPAFYVTGTDTGIGKTVASTALLHAVRARGHTAVGMKPVASGCVATPQGWHNEDALALQAASQPQPDYATLNPYALPAALAPELAAADVGVSLSLVPLQLAFAQLRAQAEVVVVEGVGGWAAPLSAQLDQADLVRTLQLPVVLVVGVRLGCINHARLTAAAIAADGLRCIGWIANEIDPQMERIEDNIRMLGQRLAMPCWGRIPWRPNAQAEGLAQHIRLPE
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q8PCW4
MQFPAFYVTGTDTGIGKTVASTALLHAVRARGHTAVGMKPVASGCVATPQGWHNEDALALQAASQPQPDYATLNPYALPAALAPELAAADVGVSLSLVPLQLAFAQLRAQAEVVVVEGVGGWAAPLSAQLDQADLVRALQLPVVLVVGVRLGCINHARLTAAAIAADGLRCIGWIANEIDPQMERIEDNIRMLGQRLAMPCWGRIPWRPNAQAEALAQHIRLPQ
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q2P7M5
MQPPAFYVTGTDTGIGKTMGSTALLHALRARGHTAVGMKPVASGCERTPQGWRNEDALALQAASNPQPAYATLNPYALPAPLAPELAAADVGVTLSLEPITQAFAQLRAQAEVVVVEGVGGWAAPLSATLDQADLVRALQLPVVLVVGVRLGCINHARLTAAAIAADGLQCIGWIANEVDPQMERVEENIGMLRQRLAMPCWGRIPWRPDAEAAAQAQGLQLPR
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
B2SQ77
MQPPAFYVTGTDTGIGKTMGSTALLHALRARGHTAVGMKPVASGCERTPQGWRNEDALALQAASNPQPAYATLNPYALPAPLAPELAAADVGVTLSLEPITQAFAQLRAQAEVVVVEGVGGWAAPLSATLDQADLVRALQLPVVLVVGVRLGCINHARLTAAAIAADGLQCIGWIANEVDPQMERVEENIGMLRQRLAMPCWGRIPWRPDAEAAAQAQGLQLPR
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q9PAL9
MSLSAFYVTGTDTGIGKTFVSCILLHMLRGRGQRAVGMKPVASGCTYSDTGWRNEDALALQAASDPTPAYDLINPYALPAAVAPEIAAIEAGVTVALEPLSAAFTQLRAQADVVVVEGVGGWATPLNATIDQATLVRALEIPVVLVVGLRLGCLNHARLSTTAIMADGLRCIGWIANTIDPHMARIEENLALLRQRLPIPYWGHLPHIPPGINPATLAARLHPQGD
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
B0U3W7
MSLSAFYVTGTDTGIGKTFVSCILLHMLRGRGQRAVGMKPVASGCTYSDTGWRNEDALALQAASDPTPAYDLINPYALPAAVAPEIAAIEARVTVALEPLSASFTQLRAQADVVVVEGVGGWATPLNATIDQATLVRALEIPVVLVVGLRLGCMNHARLSTAAIMADGLRCIGWIANTIDPHMARIEENLALLRQRLPIPYWGHLPHIPPGINPATLATRLHPQGD
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
Q87BG0
MSLSDFYVTGTDTGIGKTFVSCILLHMLRGRGQRAVGMKPVASGCTYSDTGWRNEDALALQAASDPTPAYDLINPYALPAAVAPEIAAIEAGVTVALEPLSASFTQLRAQADVVVVEGVGGWATPLNATFDQATLVRALEIPVVLVVGLRLGCMNHARLSTAAIMADGLRCIGWIANTIDPHMARIEENLALLRQRLPIPYWGHLPHIPPGINPATLATRLHPQGD
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
D6W1N2
MNSKSQQQEQQPIVFVTGTDTDVGKTFVSTLLVHKWKAAYWKPVQTGIESDQGDSETLKNFKIAASTWQPPIFTPTYALQKPLSPLQAMEYEPNVDIRLLDFVVPEEWSAENPLVVEGAGGVCVPITRKLEITTDLIKHLIETSGHPVYVVVVARSGLGTLNHTLLTWNHLCDNGLRSHLFGVILNGEPNEGNVQALKKFGVNIMAQVAQCTTAHDQDMELHELPSVESLMTQQDVE
Dethiobiotin synthetase involved in the biotin biosynthesis pathway. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Belongs to the dethiobiotin synthetase family.
A9R3D1
MTKRWFITGTDTDVGKTVASCALLQAATAQGYRTAGYKPVASGSQMTADGLRNSDALALQANSSQRLGYSQVNPFTFLEATSPHIASESEGRAIPLTALSQGLRQLEPSADWILIEGAGGWFTPLSPQATFADWVQQEQLPVIMVVGVKLGCINHALLTAQAIQHAGLTLAGWVANEVTPAGRRQAEYQATLTRMITAPLLGIIPYLSDIEENPVTTRRDLGHYLDLTVLRAAEREAVNM
Catalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. (7R,8S)-7,8-diammoniononanoate + ATP + CO2 = (4R,5S)-dethiobiotin + ADP + 3 H(+) + phosphate Cofactor biosynthesis; biotin biosynthesis; biotin from 7,8-diaminononanoate: step 1/2. Homodimer. Belongs to the dethiobiotin synthetase family.
O31777
MTKEFEFLKAELNSMKENHTWQDIKQLESMQGPSVTVNHQKVIQLSSNNYLGFTSHPRLINAAQEAVQQYGAGTGSVRTIAGTFTMHQELEKKLAAFKKTEAALVFQSGFTTNQGVLSSILSKEDIVISDELNHASIIDGIRLTKADKKVYQHVNMSDLERVLRKSMNYRMRLIVTDGVFSMDGNIAPLPDIVELAEKYDAFVMVDDAHASGVLGENGRGTVNHFGLDGRVHIQVGTLSKAIGVLGGYAAGSKVLIDYLRHKGRPFLFSTSHPPAVTAACMEAIDVLLEEPEHMERLWENTAYFKAMLVKMGLTLTKSETPILPILIGDEGVAKQFSDQLLSRGVFAQSIVFPTVAKGKARIRTIITAEHTKDELDQALDVIEKTAKELQLL
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
A7Z4X1
MKEFEFLKAELDKMKENKTWQQMKQIETKQGPSVEVKGENVIQLSSNNYLGLTSHPRLVEAAKRAAEEFGAGTGSVRTIAGTFTMHNELEKKLANFKKTEAALVFQSGFTTNQGVLSSILTKEDIVISDELNHASIIDGIRLTKADKKVYRHVDMDDLERVLKKSMNYRMRLIVTDGVFSMDGNIAPLPDIVKLAEAYDAFVMVDDAHASGVLGKNGRGTVNHFGLDGRVHIQVGTLSKAIGVLGGYAAGSQVLIDYLRHKGRPFLFSTSHPPAVTAACIEAIDVLLEEPEHMEKLWENTAYFKDKLVQMGLTLTKSETPIVPILIGEEEKAQALSDLLLTRGVFAQSIVYPTVAQGKARIRTIITAEHTNEELDRALEVIRSAAKELQLV
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
P0A4X4
MKAATQARIDDSPLAWLDAVQRQRHEAGLRRCLRPRPAVATELDLASNDYLGLSRHPAVIDGGVQALRIWGAGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDARSHASLVDACRLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHGALLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKALGSQGGVVLGPTPVRAHLIDAARPFIFDTGLAPAAVGAARAALRVLQAEPWRPQAVLNHAGELARMCGVAAVPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVPAGTSRLRLTARASLNAGELELARRVLTDVLAVARR
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide (By similarity). Can also use pimeloyl-CoA instead of pimeloyl-ACP as substrate. To a lesser extent, can also utilize D-alanine instead of L-alanine as substrate. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Inhibited by D-alanine and D-7-keto-8-amino-pelargonic acid. kcat is 0.007 sec(-1) and 0.0036 sec(-1) with L-alanine and D-alanine as substrate, respectively, and pimeloyl-CoA as co-substrate. Cofactor biosynthesis; biotin biosynthesis. Homodimer. Cells lacking this gene are shown to be highly attenuated in a mouse tuberculosis model (PubMed:14569030). Essential for growth even in liquid culture; growth does not occur on biotin-containing medium after biotin deprivation (PubMed:20565114). Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Q12F38
MAINTPLTNSWLDEFPARIAELDRAHLRRRRRVVVPEDGAHLQVDGQRMLAFCSNDYLGLAGHPALVQAACDGARAFGVGAAASPLVSGHSAANEALEAALARFVGQPRALYFYAGYATNIGIVPALVGKGDAIFSDALNHACLIDGARLSSAQIHRYPHADLAALEQELISSPARRKLIISDAVFSMDGDVADVPALLALCERHDALLLLDDAHGFGVLGPQGRGCLAHFGLSGENASPRVLYMATLGKAAGVAGAFVAGSEALVEWLLQKTRSYIFATAAPALLATALQTSLQLIEQDEWRREHLQRLIARLRSGLAQGLQGSSWRLGESPTAIQPVVIGPNDAALAVMEGLRTRGLWVPAIRPPTVAEGTARLRIALSAAHTEADIDRLVQALTELAKPGSL
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
P53556
MKIDSWLNERLDRMKEAGVHRNLRSMDGAPVPERNIDGENQTVWSSNNYLGLASDRRLIDAAQTALQQFGTGSSGSRLTTGNSVWHEKLEKKIASFKLTEAALLFSSGYLANVGVLSSLPEKEDVILSDQLNHASMIDGCRLSKADTVVYRHIDMNDLENKLNETQRYQRRFIVTDGVFSMDGTIAPLDQIISLAKRYHAFVVVDDAHATGVLGDSGQGTSEYFGVCPDIVIGTLSKAVGAEGGFAAGSAVFIDFLLNHARTFIFQTAIPPASCAAAHEAFNIIEASREKRQLLFSYISMIRTSLKNMGYVVKGDHTPIIPVVIGDAHKTVLFAEKLQGKGIYAPAIRPPTVAPGESRIRITITSDHSMGDIDHLLQTFHSIGKELHII
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
A7Z5B4
MDFDGWLLGRLDAVKRDGLYRTLRTQETALKTKGQKRQTWASNDYLGLSKDERLITAAQTAMSRFGAGSGGSRLTTGNTVWHEKLEHTIADFKQTEAALLFSSGYLANIGVLASLPQKGDVILSDQLNHASIVDGCRLSKAETIVYRHIDMADLEKKLASVQARNRRFIVTDGVFSMDGTIAPLDRIMALAKQYQAFVIADDAHATGVLGENGGGTSDYFGVCPDVVIGTLSKAVGTEGGFAAGSNIFIDFLLNQARTFIFQTALPPSICAASHTAFDIISDMHDTRRELQSSVKMIKTRLADMGFTVRGGDTPIIPVIIGDAKTAVSAAALLEKKGICAPAIRPPAVPEGESRIRLTVTADRSLQDIDELTEAFDSIRKELNINK
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Q7DAK0
MPTGLGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVCFDLATTDRKLTPAWRTTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLAGQMDQLAHDDGSDFLMIRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEALGCLSHKRRLPLKTSLEFRERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNPEFFAACSRHLHGRSRLWLFRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLYRAALMLSLKDAISRDKRRMEMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARMMMHNIQRPTLPDDMSEEFCRWEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFYPRFTGPQRSTVKAAELGEIVLLGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNGTLDLHVSLEQELACFLGKPAAVLCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAARLSGADFTLYRHNDMDHLARVLRRTEGRRRIIVVDAVFSMEGTVADLATIAELADRHGCRVYVDESHALGVLGPDGRGASAALGVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIRHNGSGHVFSASLPPAAAAATHAALRVSRREPDRRARVLAAAEYMATGLARQGYQAEYHGTAIVPVILGNPTVAHAGYLRLMRSGVYVNPVAPPAVPEERSGFRTSYLADHRQSDLDRALHVFAGLAEDLTPQGAAL
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] In the C-terminal section; belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Q9K0U0
MKVFKQQLEQLGAQNQYRSIPDLIHQGRYITRENRKMLNMSSNDYLGLASDENLRRSFLQQYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGIRLSRCAFFRYRHNDYEHLKNLLEKNVGKFDRTFIVTESVFSMDGDVADLKQLVQLKKQFPNTYLYVDEAHAIGVYGQNGLGIAERDNLIAEIDLLVGTFGKALASVGAYAVCNQVLKECLINQMRPLIFSTALPPFNVAWTYFIFERLPQFSKERSHLEQLSAFLRREVAHRTQIMPSQTCIVPYILGGNEATLAKAEYLQRQGYYCLPIRPSTVPKNTSRIRLSLTADMTTDEVRQFAACL
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
A1KVF6
MNVFKQQLEQLGAQNQYRSIPDLIHQGRYITRENRKMLNMSSNDYLGLASDENLRRSFLQQYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGIRLSRCAFSRYRHNDYEHLKNLLEKNVGKFDRTFIVTESVFSMDGDVADLKQLVQLKKQFPNTYLYVDEAHAIGVYGQNGLGIAERDNLIAEIDLLVGTFGKALASVGAYAVCNQVLKECLINQMRPLIFSTALPPFNVAWTYFIFERLPQFSKERSHLEQLSAFLRREVAHRTQIMPSQTCIVPYILGGNEAALAKAEYLQRQGYYCLPIRPPTVPKNTSRIRLSLTADMTTDEVRQFAVCL
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Q0AE73
MLPDLAEALQQRRQEGLYRFRQVLEGPQSPRVTIDGRDFLAFCSNDYLGLANHPALIEAVAAGAQRYGVGSGASHLISGHSRAHHELEEALAEFVGLPRTLLFSTGYMANMAVVTALMGREDAIFADRLNHASLNDAALLSRARFIRYPHLDLVTLEKQLKTIQARRRLIVTDAVFSMDGDRAPVAELLALCQRFDAWLLLDDAHGFGVLGEQGKGSLYDPQEVERNVPHLIYMATLGKAAGVSGAFVAAQASMIETLIQHSRTYGYTTAAAPLLAHALLTSLQLISQGVWRRERLVQLIEQLRQKLQSLPWQLLLSDTPIQPLLVGGSREAVRLDQALRERGIWVPAIRPPTVPQGMARLRISLSAAHAGEDVDQLSAALHDLAGC
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Q81ZZ4
MLADLSEALRERQQEGLYRSRPVLEGPQSPHVTIDGRDFLAFCSNDYLGLANHPALIEAAAEGARCYGVGSGASHLISGHFRAHHELEEALAAFVGLPRTLLFSTGYMANMAVVTALAGRGDAIFADRLNHASLNDAALLSRARFIRYPHLDLDTLARQLETTKARRRLVVTDAVFSMDGDMAPVAELLTLCQRFDAWLLLDDAHGFGVLGERGKGSLYHSQRIERDTPYLIYMATLGKAAGVSGAFVAAQAPVVETLIQHGRTYGYTTAAPPLLAHTLLTSLQLISQESWRRERLALLIERLRQRLHSLPWPLLLSETPIQPLLVGESQEAVRLDLALRERGIWVPAIRPPTVPQGMARLRISLSAVHTEADVDRLGAALRDLAQC
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Q2Y9Y8
MLNDLDSIHQTDEGLREYLRSRGNRSLYRYRLTLESPQAPRITVSGREYLAFCSNDYLGLANHPELIAALCEGATQYGVGAGTSHLVSGHSRAHHLLEEALASFTRFPRALLFSTGYMANAGVVTALTGRGDAVFGDKLNHASLNDAALLSRARLSRYPHLDLATLERQLAASPARRKLVISDAVFSMDGDIAPLPELLELCERYDAWLLLDDAHGFGVLGNQGRGSLAHFNISSPRIIYMGTLGKAAGVFGAFVAAQEEIIETLIQCARSYIYTTATPPFLSHALLKSLELIAGGAGRREKLAQLTKLLKQECHPLRWQLLPSDTPIQPLVMGENAEALQVSEALRQKGILVTAIRPPTVPEGTARLRISLSSSHDIEDVMELGAALREIDRDME
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Q3J9D6
MELRQRQTQSLYRYRRVLEGPQGAELQMDGRRILAFCSNDYLGLANHPATRAAFMQGVREYGVGSGAAHLVTGHSRAHHTLEEALAAFVGRPRVLLFSTGYSANLGVISALIGRQDAVFEDRLNHASLLDGGLLAGARFKRYRHRDYQSLEAALTATKARRRLVVTDGVFSMDGALAPLPDLAAVADRFDAWLMVDDAHGLGVLGEEGRGSVAHFGLGMAQAPILVGTLGKALGTFGAFVAGEEALIETLIQQARTYIYTTAPPSAVAVATLASLRLVETESWRRDKLTRLIAQFRQGAAQLGLQLVDSPTPIQPLLVGDAGAAVKLSERLLAQGILVTAIRPPTVPEGSARLRITLTAAHSEAQVARLLESLVQVL
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
B2J1W1
MNFEFGAKRRDPYAWLEQSLATIHRADWYRSVQPINGRPGATVVLAGQEVINFASNDYLGLAGDKRLMAAATAAIAEFGTGSTGSRLLSGHRELHRELEKAIASTKQTEDALVFSSGYLANLGAITALVGKRDLILSDQYNHSSLKNGAILSGAAVVEYPHCDVAVLKTQLSQQRQNYRRCLILTDTVFSMDGDLCPLPALFDLADEFSCMLLVDEAHATGVLGKTGAGCVEYFGCTGKQLIQIGTLSKALGSLGGYVAGSSALIDFLRNRAPSWIYTTGLSPADTAAALAAIKIVQQEPQHLAQLWRNIHYLKTLLQQLPNLKLLPSESPILCFQLPNATDALKAGKQLRDAGIFAPAIRPPTVPTSRIRISVMATHKVAHIEKLVAALKDVI
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide. 6-carboxyhexanoyl-[ACP] + H(+) + L-alanine = (8S)-8-amino-7-oxononanoate + CO2 + holo-[ACP] Cofactor biosynthesis; biotin biosynthesis. Homodimer. Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.