id int64 39 79M | url stringlengths 31 227 | text stringlengths 6 334k | source stringlengths 1 150 ⌀ | categories listlengths 1 6 | token_count int64 3 71.8k | subcategories listlengths 0 30 |
|---|---|---|---|---|---|---|
52,838,584 | https://en.wikipedia.org/wiki/Bafetinib | Bafetinib (NS-187) is an experimental cancer drug developed by Nippon Shinyaku and licensed to CytRx. It is an inhibitor of Lyn and Bcr-Abl. It reached phase II clinical trials in 2010.
Development
Imatinib was the first Bcr-Abl tyrosine-kinase inhibitor and was highly successful in treatment of chronic myelogenous l... | Bafetinib | [
"Chemistry"
] | 714 | [
"Drug safety",
"Abandoned drugs"
] |
52,840,458 | https://en.wikipedia.org/wiki/Mastodon%20%28social%20network%29 | Mastodon is an open source, self-hosted, social networking service. Mastodon uses the ActivityPub protocol for federation which allows users to communicate between independent Mastodon instances and other ActivityPub compatible services. Mastodon has microblogging features similar to Twitter, and is generally conside... | Mastodon (social network) | [
"Technology"
] | 3,783 | [
"Computing websites",
"Computing and society",
"Free software websites",
"Social media"
] |
52,840,911 | https://en.wikipedia.org/wiki/Google%20Neural%20Machine%20Translation | Google Neural Machine Translation (GNMT) was a neural machine translation (NMT) system developed by Google and introduced in November 2016 that used an artificial neural network to increase fluency and accuracy in Google Translate. The neural network consisted of two main blocks, an encoder and a decoder, both of LSTM ... | Google Neural Machine Translation | [
"Technology"
] | 1,377 | [
"Machine translation",
"Natural language and computing",
"Computational linguistics"
] |
50,461,800 | https://en.wikipedia.org/wiki/YedZ%20family | YedZ (TC# 5.B.7) of E. coli has been examined topologically and has 6 transmembrane segments (TMSs) with both the N- and C-termini localized to the cytoplasm. von Rozycki et al. 2004 identified homologues of YedZ in bacteria and animals. YedZ homologues exhibit conserved histidyl residues in their transmembrane domain... | YedZ family | [
"Biology"
] | 978 | [
"Protein families",
"Protein classification",
"Membrane proteins"
] |
50,466,674 | https://en.wikipedia.org/wiki/History%20of%20the%20compass | The compass is a magnetometer used for navigation and orientation that shows direction in regards to the geographic cardinal points. The structure of a compass consists of the compass rose, which displays the four main directions on it: East (E), South (S), West (W) and North (N). The angle increases in the clockwise p... | History of the compass | [
"Physics",
"Mathematics"
] | 6,672 | [
"Topology",
"Space",
"Geometry",
"Spacetime",
"Orientation (geometry)"
] |
50,468,959 | https://en.wikipedia.org/wiki/Developer%20relations | Developer relations, abbreviated as DevRel, is an umbrella term for practices employed by an organization that builds developer-facing software to connect with the developers that use that software. Developer relations is a form of platform evangelism and the activities involved are sometimes referred to as a developer... | Developer relations | [
"Technology",
"Engineering"
] | 1,541 | [
"Systems engineering",
"Computer engineering",
"Software engineering",
"Computer science",
"Information technology",
"Subfields of computer science"
] |
50,471,084 | https://en.wikipedia.org/wiki/7AK7 | The 7AK7 is a pentode vacuum tube (thermionic valve). According to its manufacturer, Sylvania, it was "designed for service in electronic computers".
The tube was developed in 1948, designed at the request of L. D. Wilson for use in the Whirlwind computer.
Significant attention was directed towards its manufacturing... | 7AK7 | [
"Technology"
] | 152 | [
"Computing stubs",
"Computer hardware stubs"
] |
50,475,634 | https://en.wikipedia.org/wiki/Real%20element | In group theory, a discipline within modern algebra, an element of a group is called a real element of if it belongs to the same conjugacy class as its inverse , that is, if there is a in with , where is defined as . An element of a group is called strongly real if there is an involution with .
An element of... | Real element | [
"Mathematics"
] | 355 | [
"Group theory",
"Fields of abstract algebra"
] |
51,289,352 | https://en.wikipedia.org/wiki/Widowhood%20effect | The widowhood effect is the increase in the probability of a person dying a relatively short time after a long-time spouse has died. It can also be referred to as "dying of a broken heart." Being widowed increases the likelihood of developing severe mental disorders along with psychological and physical illnesses.
Rel... | Widowhood effect | [
"Biology"
] | 1,703 | [
"Behavior",
"Human behavior"
] |
51,291,103 | https://en.wikipedia.org/wiki/Mivar-based%20approach | The Mivar-based approach is a mathematical tool for designing artificial intelligence (AI) systems. Mivar (Multidimensional Informational Variable Adaptive Reality) was developed by combining production and Petri nets. The Mivar-based approach was developed for semantic analysis and adequate representation of humanita... | Mivar-based approach | [
"Mathematics",
"Engineering"
] | 2,563 | [
"Artificial intelligence engineering",
"Mathematical logic",
"Software engineering"
] |
51,291,118 | https://en.wikipedia.org/wiki/Qualified%20digital%20certificate | In the context of Regulation (EU) No 910/2014 (eIDAS), a qualified digital certificate is a public key certificate issued by a trust service provider which has government-issued qualifications. The certificate is designed to ensure the authenticity and data integrity of an electronic signature and its accompanying mess... | Qualified digital certificate | [
"Technology"
] | 765 | [
"Computer law",
"Computing and society"
] |
51,292,061 | https://en.wikipedia.org/wiki/Chlorophycean%20mitochondrial%20code | The chlorophycean mitochondrial code (translation table 16) is a genetic code found in the mitochondria of Chlorophyceae.
Code
AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCA... | Chlorophycean mitochondrial code | [
"Chemistry",
"Biology"
] | 530 | [
"Protein biosynthesis",
"Gene expression",
"Molecular genetics",
"Biosynthesis",
"Cellular processes",
"Molecular biology",
"Biochemistry"
] |
51,292,513 | https://en.wikipedia.org/wiki/Hyperloop%20UPV | Hyperloop UPV (a. k. a. Hyperloop Makers UPV) is a team of students from the Universitat Politècnica de València (Valencia, Spain) with the aim of designing Hyperloop, a proposed future means of transport. With renewable energies, the vehicle will levitate inside a vacuum tube, being able to reach .
The concept develo... | Hyperloop UPV | [
"Technology",
"Engineering"
] | 1,433 | [
"Vacuum systems",
"Hyperloop",
"Transport systems"
] |
51,293,821 | https://en.wikipedia.org/wiki/NGC%20148 | NGC 148 (also known as PGC 2035) is a lenticular galaxy located in the constellation Sculptor. It is about 40,000 light years across. It is in a group of three galaxies along with MCG-5-2-16 and IC 1555. It is a Shapley-Ames galaxy.
References
External links
Sculptor (constellation)
Lenticular galaxies
0148
002035 | NGC 148 | [
"Astronomy"
] | 82 | [
"Constellations",
"Sculptor (constellation)"
] |
51,294,019 | https://en.wikipedia.org/wiki/NGC%20149 | NGC 149 is a lenticular galaxy in the Andromeda constellation. It was discovered by Édouard Stephan on October 4, 1883.
References
External links
SEDS
Andromeda (constellation)
Astronomical objects discovered in 1883
+05-02-024
002028
00332
0149
Lenticular galaxies
Discoveries by Édouard Stephan | NGC 149 | [
"Astronomy"
] | 66 | [
"Andromeda (constellation)",
"Constellations"
] |
51,294,085 | https://en.wikipedia.org/wiki/Cheiromoniliophora%20elegans | Cheiromoniliophora elegans is a species of fungus in the order Pleosporales in the class Dothideomycetes. It is the type species of its genus.
References
External links
Cheiromoniliophora elegans at Mycobank.org
Pleosporales
Fungi described in 1990
Fungus species | Cheiromoniliophora elegans | [
"Biology"
] | 71 | [
"Fungi",
"Fungus species"
] |
51,294,095 | https://en.wikipedia.org/wiki/Milivoje%20Kostic | Milivoje Kostic (also known as, M. Kostic or Milivoje M. Kostic; in Serbian Cyrillic: Миливоје Костић; born 20 March 1952 in Bioska, Užice municipality, Serbia, ex-Yugoslavia), is a Serbian-American thermodynamicist and professor emeritus of mechanical engineering at Northern Illinois University, Professional Engineer ... | Milivoje Kostic | [
"Physics",
"Chemistry",
"Materials_science",
"Engineering"
] | 1,173 | [
"Nanotechnology",
"Materials science",
"Thermodynamics",
"Thermodynamicists"
] |
51,294,361 | https://en.wikipedia.org/wiki/NGC%20150 | NGC 150 (also known as PGC 2052) is a barred spiral galaxy in the constellation Sculptor. It is about 63 million light years away from the Solar System, and it has a diameter of about 94,000 light years. It was discovered by Lewis A. Swift on 20 November 1886.
Supernovae
Two supernovae have been observed in NGC 150:
... | NGC 150 | [
"Astronomy"
] | 192 | [
"Constellations",
"Sculptor (constellation)"
] |
51,294,490 | https://en.wikipedia.org/wiki/Yarovaya%20law | The Yarovaya law (in Russian: Закон Яровой, transliteration: Zakon Jarovoy), also Yarovaya package or Yarovaya — Ozerov package is a set of two Russian federal bills, 374-FZ and 375-FZ, passed in 2016. The bills amend previous counter-terrorism laws and separate laws which regulate additional counter-terror and public ... | Yarovaya law | [
"Technology"
] | 1,887 | [
"Internet access",
"IT infrastructure"
] |
51,295,111 | https://en.wikipedia.org/wiki/Schema-agnostic%20databases | Schema-agnostic databases or vocabulary-independent databases aim at supporting users to be abstracted from the representation of the data, supporting the automatic semantic matching between queries and databases. Schema-agnosticism is the property of a database of mapping a query issued with the user terminology and s... | Schema-agnostic databases | [
"Technology"
] | 1,358 | [
"Computer data",
"Data"
] |
51,295,302 | https://en.wikipedia.org/wiki/Lateral%20movement%20%28cybersecurity%29 | Lateral movement refers to the techniques that cyber attackers, or threat actors, use to progressively move through a network as they search for the key data and assets that are ultimately the target of their attack campaigns. While the development of more sophisticated sequences of attack has helped threat actors deve... | Lateral movement (cybersecurity) | [
"Technology"
] | 130 | [
"Computer security stubs",
"Computing stubs"
] |
51,295,643 | https://en.wikipedia.org/wiki/NGC%20154 | NGC 154 is an elliptical galaxy in the Cetus constellation. The galaxy was discovered by Frederick William Herschel on November 27, 1785.
Notes
References
External links
SEDS
Astronomical objects discovered in 1785
-02-02-053
002058
Cetus
0154
Elliptical galaxies | NGC 154 | [
"Astronomy"
] | 56 | [
"Cetus",
"Constellations"
] |
51,296,070 | https://en.wikipedia.org/wiki/Acsensorize | Acsensorize (v.t.), pronounced as ac-sensor-ize, is the act of adding a multitude of dissimilar sensors, generally of a variety of sensing modalities, to an existing system that may or may not already have sensors;
acsensorizing (pres. part.);
acsensorized (past. part.);
acsensorization (n.) is the process of acse... | Acsensorize | [
"Technology",
"Engineering"
] | 149 | [
"Sensors",
"Measuring instruments"
] |
51,296,109 | https://en.wikipedia.org/wiki/NGC%205053 | NGC 5053 is the New General Catalogue designation for a globular cluster in the northern constellation of Coma Berenices. It was discovered by German-British astronomer William Herschel on March 14, 1784 and cataloged as VI-7. In his abbreviated notation, he described it as, "an extremely faint cluster of extremely sma... | NGC 5053 | [
"Astronomy"
] | 515 | [
"Coma Berenices",
"Constellations"
] |
51,297,098 | https://en.wikipedia.org/wiki/Farris%20effect%20%28rheology%29 | In rheology, the Farris Effect describes the decrease of the viscosity of a suspension upon increasing the dispersity of the solid additive, at constant volume fraction of the solid additive. That is, that a broader particle size distribution yields a lower viscosity than a narrow particle size distribution, for the sa... | Farris effect (rheology) | [
"Physics",
"Chemistry"
] | 177 | [
"Physical phenomena",
"Colloidal chemistry",
"Physical quantities",
"Colloids",
"Surface science",
"Wikipedia categories named after physical quantities",
"Viscosity",
"Physical properties",
"Rheology",
"Fluid dynamics"
] |
51,297,487 | https://en.wikipedia.org/wiki/LkCa%2015 | LkCa 15 is a T Tauri star in the Taurus Molecular Cloud. These types of stars are relatively young pre-main-sequence stars that show irregular variations in brightness. It has a mass that is about 97% of the Sun, an effective temperature of 4370 K, and is slightly cooler than the Sun. Its apparent magnitude is 11.91, m... | LkCa 15 | [
"Astronomy"
] | 391 | [
"Taurus (constellation)",
"Constellations"
] |
51,298,731 | https://en.wikipedia.org/wiki/BOMT | BOMT, also known by its developmental code name Ro 7-2340 and as 6α-bromo-4-oxa-17α-methyl-5α-dihydrotestosterone, is a synthetic steroidal antiandrogen which was first produced in 1970 and was never marketed for medical use. It is the 6α-brominated, 4-oxygenated, and 17α-methylated derivative of the androgen dihydrote... | BOMT | [
"Chemistry"
] | 521 | [
"Drug safety",
"Abandoned drugs"
] |
51,298,870 | https://en.wikipedia.org/wiki/Bolandiol%20dipropionate | Bolandiol dipropionate (USAN; brand names Anabiol, Storinal; former development code SC-7525; also known as bolandiol propionate (JAN), norpropandrolate, 19-nor-4-androstenediol dipropionate, or estr-4-ene-3β,17β-diol 3,17-dipropionate) is a synthetic anabolic-androgenic steroid (AAS) and derivative of 19-nortestostero... | Bolandiol dipropionate | [
"Chemistry"
] | 251 | [
"Chemicals in medicine",
"Prodrugs"
] |
51,299,569 | https://en.wikipedia.org/wiki/Ureas | In chemistry, ureas are a class of organic compounds with the formula (R2N)2CO where R = H, alkyl, aryl, etc. Thus, in addition to describing the specific chemical compound urea ((H2N)2CO), urea is the name of a functional group that is found in many compounds and materials of both practical and theoretical interest. ... | Ureas | [
"Chemistry"
] | 919 | [
"Organic compounds",
"Ureas"
] |
51,300,111 | https://en.wikipedia.org/wiki/Trematode%20mitochondrial%20code | The trematode mitochondrial code (translation table 21) is a genetic code found in the mitochondria of Trematoda.
Code
AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNNKSSSSVVVVAAAADDEEGGGG
Starts = -----------------------------------M---------------M------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAA... | Trematode mitochondrial code | [
"Chemistry",
"Biology"
] | 505 | [
"Protein biosynthesis",
"Gene expression",
"Molecular genetics",
"Biosynthesis",
"Cellular processes",
"Molecular biology",
"Biochemistry"
] |
51,300,183 | https://en.wikipedia.org/wiki/Scenedesmus%20obliquus%20mitochondrial%20code | The Scenedesmus obliquus mitochondrial code (translation table 22) is a genetic code found in the mitochondria of Scenedesmus obliquus, a species of green algae.
Code
Differences from the standard code
Systematic range and comments
Scenedesmus obliquus
See also
List of genetic codes
References
Molecular genetic... | Scenedesmus obliquus mitochondrial code | [
"Chemistry",
"Biology"
] | 76 | [
"Protein biosynthesis",
"Gene expression",
"Molecular genetics",
"Biosynthesis",
"Cellular processes",
"Molecular biology",
"Biochemistry"
] |
51,300,521 | https://en.wikipedia.org/wiki/IAU%20Working%20Group%20on%20Star%20Names | The International Astronomical Union (IAU) established a Working Group on Star Names (WGSN) in May 2016 to catalog and standardize proper names for stars for the international astronomical community. It operates under Division C – Education, Outreach and Heritage.
The IAU states that it is keen to make a distinction b... | IAU Working Group on Star Names | [
"Astronomy"
] | 1,327 | [
"Astronomical nomenclature",
"Astronomical objects",
"Astronomy organizations"
] |
60,542,210 | https://en.wikipedia.org/wiki/Biemann%20Medal | The Biemann Medal is awarded annually by the American Society for Mass Spectrometry (ASMS) to an individual early in his or her career in recognition of significant achievement in basic or applied mass spectrometry. It is named after professor Klaus Biemann.
Nominees must be within the first 15 years of receiving the ... | Biemann Medal | [
"Physics"
] | 334 | [
"Mass spectrometry",
"Spectrum (physical sciences)",
"Mass spectrometry awards"
] |
60,542,400 | https://en.wikipedia.org/wiki/Franti%C5%A1ek%20Ture%C4%8Dek | František Tureček is a Czech-American chemist and professor of chemistry at the University of Washington. His research focuses on the chemistry of highly reactive molecules and mass spectrometric instrumentation and gas-phase ion chemistry.
Tureček was born in Prague and received a PhD in organic chemistry from Charle... | František Tureček | [
"Physics",
"Chemistry"
] | 354 | [
"Biochemists",
"Mass spectrometry",
"Spectrum (physical sciences)",
"Mass spectrometrists"
] |
60,543,102 | https://en.wikipedia.org/wiki/Colletotrichum%20coffeanum | Colletotrichum coffeanum is a species of fungal plant pathogen affecting mainly the species Coffea arabica and occasionally other species of the genus Coffea. Upon infection, the pathogen can cause coffee berry disease (CBD) which is also known as Brown Blight when it occurs on younger fruits still green in color. The ... | Colletotrichum coffeanum | [
"Biology"
] | 327 | [
"Fungi",
"Fungus species"
] |
60,543,161 | https://en.wikipedia.org/wiki/Octopus%20Energy | Octopus Energy Group is a British renewable energy group. It was founded in 2015 with the backing of Octopus Group, a British asset management company. Headquartered in London, the company has operations in the United Kingdom, France, Germany, Italy, Spain, Australia, Japan, New Zealand and the United States. Octopus i... | Octopus Energy | [
"Engineering"
] | 2,929 | [
"Electrical engineering organizations",
"Electric power companies"
] |
60,544,290 | https://en.wikipedia.org/wiki/P.%20A.%20L.%20Chapman-Rietschi | Peter Albert Leslie Chapman-Rietschi (1945-2017) was an independent scholar and research writer in the field of history of astronomy, ancient astral sciences, archaeoastronomy, and astrobiology, including bioastronomy and SETI.
He was a Fellow of the Royal Astronomical Society and in former years also Fellow of the R... | P. A. L. Chapman-Rietschi | [
"Astronomy"
] | 1,161 | [
"People associated with astronomy",
"Historians of astronomy",
"History of astronomy"
] |
60,544,754 | https://en.wikipedia.org/wiki/Markov%20chain%20central%20limit%20theorem | In the mathematical theory of random processes, the Markov chain central limit theorem has a conclusion somewhat similar in form to that of the classic central limit theorem (CLT) of probability theory, but the quantity in the role taken by the variance in the classic CLT has a more complicated definition. See also the... | Markov chain central limit theorem | [
"Mathematics"
] | 700 | [
"Central limit theorem",
"Theorems in probability theory",
"Mathematical theorems",
"Mathematical problems"
] |
60,545,283 | https://en.wikipedia.org/wiki/Ordered%20exponential%20field | In mathematics, an ordered exponential field is an ordered field together with a function which generalises the idea of exponential functions on the ordered field of real numbers.
Definition
An exponential on an ordered field is a strictly increasing isomorphism of the additive group of onto the multiplicative grou... | Ordered exponential field | [
"Mathematics"
] | 619 | [
"Mathematical structures",
"Mathematical logic",
"Mathematical objects",
"E (mathematical constant)",
"Algebraic structures",
"Exponentials",
"Model theory"
] |
60,547,623 | https://en.wikipedia.org/wiki/Tris%28trimethylsilyl%29silane | Tris(trimethylsilyl)silane is the organosilicon compound with the formula (Me3Si)3SiH (where Me = CH3). It is a colorless liquid that is classified as a hydrosilane since it contains an Si-H bond. The compound is notable as having a weak Si-H bond, with a bond dissociation energy estimated at 84 kcal/mol. For compar... | Tris(trimethylsilyl)silane | [
"Chemistry"
] | 375 | [
"Functional groups",
"Trimethylsilyl compounds"
] |
60,547,782 | https://en.wikipedia.org/wiki/Tetrakis%28trimethylsilyl%29silane | Tetrakis(trimethylsilyl)silane is the organosilicon compound with the formula (Me3Si)4Si (where Me = CH3). It is a colorless sublimable solid with a high melting point. The molecule has tetrahedral symmetry. The compound is notable as having silicon bonded to four other silicon atoms, like in elemental silicon.
Pre... | Tetrakis(trimethylsilyl)silane | [
"Chemistry"
] | 252 | [
"Functional groups",
"Trimethylsilyl compounds"
] |
60,550,218 | https://en.wikipedia.org/wiki/Snails%20as%20food | Snails are eaten by humans in many areas such as Africa, Southeast Asia and Mediterranean Europe, while in other cultures, snails are seen as a taboo food. In English, edible land snails are commonly called escargot, from the French word for 'snail'. Snails as a food date back to ancient times, with numerous cultures w... | Snails as food | [
"Technology"
] | 3,261 | [
"Food ingredients",
"Components"
] |
60,552,462 | https://en.wikipedia.org/wiki/CompTox%20Chemicals%20Dashboard | The CompTox Chemicals Dashboard is a freely accessible online database created and maintained by the U.S. Environmental Protection Agency (EPA). The database provides access to multiple types of data including physicochemical properties, environmental fate and transport, exposure, usage, in vivo toxicity, and in vitro ... | CompTox Chemicals Dashboard | [
"Chemistry",
"Biology",
"Environmental_science"
] | 834 | [
"Biochemistry",
"Biochemistry databases",
"Environmental chemistry",
"nan"
] |
60,553,461 | https://en.wikipedia.org/wiki/Mission%20Shakti | On 27 March 2019, India tested an anti-satellite weapon (ASAT) during an operation code named Mission Shakti (IAST: Śakti; lit. "Power"). The target of the test was a satellite present in a low Earth orbit, which was hit with a kinetic kill vehicle.
The ASAT test utilized a modified anti-ballistic missile interceptor ... | Mission Shakti | [
"Technology"
] | 2,879 | [
"Satellite collisions",
"Space debris"
] |
60,555,284 | https://en.wikipedia.org/wiki/Sarco%20pod | The Sarco pod (also known as Pegasos, and sometimes referred to as a "suicide pod") is a euthanasia device or machine consisting of a 3D-printed detachable capsule mounted on a stand that contains a canister of liquid nitrogen to die by suicide through inert gas asphyxiation. "Sarco" is short for "sarcophagus". It is u... | Sarco pod | [
"Physics",
"Chemistry",
"Technology"
] | 830 | [
"Machines",
"Physical systems",
"Euthanasia device",
"Greenhouse gases",
"Carbon dioxide"
] |
60,556,859 | https://en.wikipedia.org/wiki/Dropout%20%28streaming%20service%29 | Dropout is an American comedy subscription streaming service run by the production company of the same name (formerly CollegeHumor), founded in September 2018. Dropout streams original programming, and does not run advertisements. Its content is mainly composed of live play, such as Dimension 20 hosted by Brennan Lee M... | Dropout (streaming service) | [
"Technology"
] | 1,825 | [
"Streaming media systems",
"Telecommunications systems",
"Computer systems"
] |
44,104,210 | https://en.wikipedia.org/wiki/Frank%20H.%20Field | Frank Henry Field (February 27, 1922 – April 12, 2013) was an American chemist and mass spectrometrist known for his work in the development of chemical ionization.
Early life and education
Frank Field was born in Keansburg, New Jersey, on February 27, 1922. His father died two months after he was born and his mother ... | Frank H. Field | [
"Physics",
"Chemistry"
] | 352 | [
"Biochemists",
"Mass spectrometry",
"Spectrum (physical sciences)",
"Mass spectrometrists"
] |
44,104,302 | https://en.wikipedia.org/wiki/Student%20Spaceflight%20Experiments%20Program | The Student Spaceflight Experiments Program (SSEP) provides an opportunity for student groups from upper elementary school through university to design and fly microgravity experiments in low Earth orbit (LEO). SSEP is a program of the National Center for Earth and Space Science Education (NCESSE, a project of the Tide... | Student Spaceflight Experiments Program | [
"Astronomy",
"Technology"
] | 528 | [
"Space science",
"Science competitions",
"Science and technology awards",
"Outer space"
] |
44,105,802 | https://en.wikipedia.org/wiki/Joe%20L.%20Franklin | Joseph Louis Franklin (1906 – August 25, 1982) was a Robert A. Welch Professor of Chemistry at Rice University known for his research in mass spectrometry and ion molecule chemistry. The Frank H. Field and Joe L. Franklin Award for Outstanding Achievement in Mass Spectrometry is named after him and Frank H. Field.
Ear... | Joe L. Franklin | [
"Physics",
"Chemistry"
] | 335 | [
"Biochemists",
"Mass spectrometry",
"Spectrum (physical sciences)",
"Mass spectrometrists"
] |
44,106,181 | https://en.wikipedia.org/wiki/388%20Bridge%20Street | 388 Bridge Street is a 590-foot residential high-rise skyscraper in Downtown Brooklyn, within New York City. It contains 378 market rate units, mixed between 234 rentals and 144 condominiums. The building was originally under construction as an all condominium tower before the 2000s real estate crash and subsequent Gre... | 388 Bridge Street | [
"Engineering"
] | 230 | [
"Postmodern architecture",
"Architecture"
] |
44,106,998 | https://en.wikipedia.org/wiki/Ilham%20Shahmuradov | Ilham Shahmuradov (born 1 January 1958) is the Azerbaijan National Academy of Sciences Head of Bioinformatics laboratory in ANAS Botany Institute, professor of Department of Medical Biology and Genetics in the Azerbaijan Medical University, doctor of biological sciences, Curator of the Bioinformatics courses in the Dep... | Ilham Shahmuradov | [
"Biology"
] | 1,075 | [
"Bioinformatics",
"Bioinformaticians"
] |
44,107,119 | https://en.wikipedia.org/wiki/CAd3-ZEBOV | cAd3-ZEBOV (also known as the NIAID/GSK Ebola vaccine or cAd3-EBO Z) was an experimental vaccine for two ebolaviruses, Ebola virus and Sudan virus, developed by scientists at GlaxoSmithKline (GSK) and tested by National Institute of Allergy and Infectious Disease (NIAID). This vaccine is derived from a chimpanzee adeno... | CAd3-ZEBOV | [
"Biology"
] | 322 | [
"Vaccination",
"Vaccines"
] |
44,107,834 | https://en.wikipedia.org/wiki/Signal%20magnitude%20area | In mathematics, the signal magnitude area (abbreviated SMA or sma) is a statistical measure of the magnitude of a varying quantity.
Definition
The SMA value of a set of values (or a continuous-time waveform) is the normalized integral of the original values.
In the case of a set of n values matching a time length T,... | Signal magnitude area | [
"Mathematics"
] | 113 | [
"Computational statistics",
"Computational mathematics"
] |
44,108,130 | https://en.wikipedia.org/wiki/L-Photo-leucine | -Photo-leucine is a synthetic derivative of the -leucine amino acid that is used as its natural analog and is characterized for having photo-reactivity, which makes it suitable for observing and characterizing protein-protein interactions (PPI). When a protein containing this amino acid (A) is exposed to
ultraviolet li... | L-Photo-leucine | [
"Chemistry",
"Biology"
] | 2,427 | [
"Biochemistry methods",
"Chemical tests",
"nan",
"Biochemistry detection methods"
] |
44,108,758 | https://en.wikipedia.org/wiki/Quantum%20machine%20learning | Quantum machine learning is the integration of quantum algorithms within machine learning programs.
The most common use of the term refers to machine learning algorithms for the analysis of classical data executed on a quantum computer, i.e. quantum-enhanced machine learning. While machine learning algorithms are used... | Quantum machine learning | [
"Mathematics",
"Engineering"
] | 7,623 | [
"Theoretical computer science",
"Applied mathematics",
"Artificial intelligence engineering",
"Machine learning"
] |
44,111,304 | https://en.wikipedia.org/wiki/Overlapping%20markup | In markup languages and the digital humanities, overlap occurs when a document has two or more structures that interact in a non-hierarchical manner.
A document with overlapping markup cannot be represented as a tree.
This is also known as concurrent markup.
Overlap happens, for instance, in poetry, where there may be ... | Overlapping markup | [
"Technology"
] | 3,977 | [
"Digital humanities",
"Computing and society"
] |
44,111,566 | https://en.wikipedia.org/wiki/Robocasting | Robocasting (also known as robotic material extrusion) is an additive manufacturing technique analogous to Direct Ink Writing and other extrusion-based 3D-printing techniques in which a filament of a paste-like material is extruded from a small nozzle while the nozzle is moved across a platform. The object is thus buil... | Robocasting | [
"Engineering"
] | 1,586 | [
"Ceramic engineering"
] |
44,111,579 | https://en.wikipedia.org/wiki/Carbon%20nanothread | A carbon nanothread (also called diamond nanothread) is a sp3-bonded, one-dimensional carbon crystalline nanomaterial. The tetrahedral sp3-bonding of its carbon is similar to that of diamond. Nanothreads are only a few atoms across, more than 300,000 times thinner than a human hair. They consist of a stiff, strong carb... | Carbon nanothread | [
"Physics"
] | 3,022 | [
"Refractory materials",
"Materials",
"Matter"
] |
44,111,699 | https://en.wikipedia.org/wiki/Jennifer%20Gardy | Jennifer Gardy is a Canadian scientist, educator and broadcaster, with expertise in the fields of molecular biology, biochemistry, and bioinformatics. Since February 2019 she has been the Deputy Director, Surveillance, Data, and Epidemiology on the Global Health: Malaria team at the Bill & Melinda Gates Foundation. She... | Jennifer Gardy | [
"Chemistry"
] | 825 | [
"Biochemists",
"Women biochemists"
] |
44,112,242 | https://en.wikipedia.org/wiki/Michael%20Barber%20%28chemist%29 | Michael (Mickey) Barber, FRS (3 November 1934 – 8 May 1991) was a British chemist and mass spectrometrist, best known for his invention of fast atom bombardment ionisation.
Biography
On 3 November 1934, Barber was born at his family's home in Manchester at 166 Lodge Lane in Newton. His family were working-class and ... | Michael Barber (chemist) | [
"Physics",
"Chemistry"
] | 572 | [
"Biochemists",
"Mass spectrometry",
"Spectrum (physical sciences)",
"Mass spectrometrists"
] |
44,112,258 | https://en.wikipedia.org/wiki/Weld%20neck%20flange | A weld neck flange (also known as a high-hub flange and tapered hub flange) is a type of flange. There are two designs. The regular type is used with pipes. The long type is unsuitable for pipes and is used in process plant. A weld neck flange consists of a circular fitting with a protruding rim around the circumferen... | Weld neck flange | [
"Chemistry",
"Engineering"
] | 196 | [
"Piping",
"Chemical engineering",
"Mechanical engineering",
"Building engineering"
] |
44,112,331 | https://en.wikipedia.org/wiki/Mobile%20location%20analytics | Mobile location analytics (MLA) is a type of customer intelligence and refers to technology for retailers, including developing aggregate reports used to reduce waiting times at checkouts, improving store layouts, and understanding consumer shopping patterns. The reports are generated by recognizing the Wi-Fi or Blueto... | Mobile location analytics | [
"Technology"
] | 1,131 | [
"Wireless networking",
"Wireless locating",
"Indoor positioning system"
] |
44,112,420 | https://en.wikipedia.org/wiki/Dicyclohexylamine | Dicyclohexylamine is a secondary amine with the chemical formula HN(C6H11)2. It is a colorless liquid, although commercial samples can appear yellow. It has a fishy odor, typical for amines. It is sparingly soluble in water. As an amine, it is an organic base and useful precursor to other chemicals.
Synthesis
Dicycl... | Dicyclohexylamine | [
"Chemistry"
] | 355 | [
"Amines",
"Bases (chemistry)",
"Functional groups"
] |
44,114,075 | https://en.wikipedia.org/wiki/Bis%28cyclooctatetraene%29iron | Bis(cyclooctatetraene)iron is an organoiron compound with the formula Fe(C8H8)2, abbreviated Fe(COT)2. It is an air-sensitive black solid that is soluble in diethyl ether and aromatic solvents. The compound decomposes in solution after a few days even under inert atmosphere. It has no known practical applications but h... | Bis(cyclooctatetraene)iron | [
"Chemistry"
] | 448 | [
"Organometallic chemistry",
"Sandwich compounds"
] |
44,115,463 | https://en.wikipedia.org/wiki/Maria%20Wonenburger | María Josefa Wonenburger Planells (July 17, 1927, in Montrove, Oleiros, Galicia – June 14, 2014, in A Coruña) was a Galician mathematician who did research in the United States and Canada. She is known for her work on group theory. She was the first Spaniard to obtain a Fulbright scholarship for doctoral studies in mat... | Maria Wonenburger | [
"Mathematics"
] | 527 | [
"Group theory",
"Fields of abstract algebra"
] |
44,115,663 | https://en.wikipedia.org/wiki/Reduced%20level | In surveying, reduced level (RL) refers to equating elevations of survey points with reference to a common assumed vertical datum. It is a vertical distance between survey point and adopted datum surface. Thus, it is considered as the base level which is used as reference to reckon heights or depths of other places or ... | Reduced level | [
"Engineering"
] | 480 | [
"Construction",
"Surveying",
"Civil engineering"
] |
44,115,887 | https://en.wikipedia.org/wiki/GPANG | GPANG (Korean: 지팡) was a 3D mobile game service introduced in 2004 by the Korean provider KTF. This service allowed subscribers to access a downloadable game portal and play advanced 3D mobile games, including MMOs. KTF's GPANG competed with SK Telecom's own 3D mobile game service called GXG. On June 1 2009, GPANG ceas... | GPANG | [
"Technology"
] | 156 | [
"Mobile content",
"Mobile software distribution platforms"
] |
44,116,080 | https://en.wikipedia.org/wiki/POODLE | POODLE (which stands for "Padding Oracle On Downgraded Legacy Encryption") is a security vulnerability which takes advantage of the fallback to SSL 3.0. If attackers successfully exploit this vulnerability, on average, they only need to make 256 SSL 3.0 requests to reveal one byte of encrypted messages. Bodo Möller, Th... | POODLE | [
"Mathematics",
"Technology",
"Engineering"
] | 1,207 | [
"Cybersecurity engineering",
"Cryptography",
"Applied mathematics",
"Computer security exploits",
"Web security exploits"
] |
44,116,151 | https://en.wikipedia.org/wiki/TsIV | TsIV is a toxin from the venom of the Brazilian scorpion Tityus serrulatus which slows the inactivation of sodium channels.
Etymology
TsIV is named after the scorpion from which the toxin is isolated, namely Tityus serrulatus (Ts). Alternative names for the TsIV toxin are TsIV-5, Toxin-4, Tityustoxin IV, Ts-IV and Tox... | TsIV | [
"Chemistry"
] | 878 | [
"Neurochemistry",
"Neurotoxins"
] |
44,116,266 | https://en.wikipedia.org/wiki/Effector-triggered%20immunity | Effector-triggered immunity (ETI) is one of the pathways, along with the pattern-triggered immunity (PTI) pathway, by which the innate immune system recognises pathogenic organisms and elicits a protective immune response. ETI is elicited when an effector protein secreted by a pathogen into the host cell is successfull... | Effector-triggered immunity | [
"Biology"
] | 290 | [
"Immune system process"
] |
64,058,239 | https://en.wikipedia.org/wiki/Verbose%20mode | In computing, Verbose mode is an option available in many computer operating systems and programming languages that provides additional details as to what the computer is doing and what drivers and software it is loading during startup or in programming it would produce detailed output for diagnostic purposes thus make... | Verbose mode | [
"Technology"
] | 117 | [
"Computing stubs",
"Software features"
] |
64,059,255 | https://en.wikipedia.org/wiki/Mar%C3%ADa%20Lionza%20%28statue%29 | María Lionza is a large statue depicting the titular goddess, María Lionza, riding a tapir. The original is located on Sorte mountain in Yaracuy, said to be the goddess' home. A replica is located between lanes of the Francisco Fajardo freeway next to the University City campus of the Central University of Venezuela, i... | María Lionza (statue) | [
"Physics",
"Mathematics"
] | 2,482 | [
"Quantity",
"Colossal statues",
"Physical quantities",
"Size"
] |
64,060,861 | https://en.wikipedia.org/wiki/Doho%20Rice%20Scheme | Doho Rice Scheme is an irrigation rice scheme found in Butaleja District, Eastern Uganda. Rice production in Doho started in 1942 to feed World War II soldiers. After the war, production declined until 1972. However, after several constraints to the scheme including flooding of River Manafwa and scarcity of irrigation ... | Doho Rice Scheme | [
"Engineering"
] | 311 | [
"Irrigation projects"
] |
64,061,713 | https://en.wikipedia.org/wiki/Stephenson%202%20DFK%201 | Stephenson 2 DFK 1, also known as RSGC2-01 or St2-18, is a red supergiant (RSG) or possible extreme red hypergiant (RHG) star in the constellation of Scutum. It lies near the open cluster Stephenson 2, which is located about away from Earth in the Scutum–Centaurus Arm of the Milky Way galaxy, and is assumed to be one ... | Stephenson 2 DFK 1 | [
"Astronomy"
] | 2,142 | [
"Scutum (constellation)",
"Constellations"
] |
64,063,915 | https://en.wikipedia.org/wiki/Phosphorimidazolide | A phosphorimidazolide is a chemical compound in which a phosphoryl mono-ester is covalently bound to a nitrogen atom in an imidazole ring. They are a type of phosphoramidate. These phosphorus (V) compounds are encountered as reagents used for making new phosphoanhydride bonds with phosphate mono-esters, and as reactive... | Phosphorimidazolide | [
"Chemistry",
"Biology"
] | 1,040 | [
"Biological hypotheses",
"Origin of life",
"Functional groups",
"Pyrophosphates"
] |
64,064,108 | https://en.wikipedia.org/wiki/ITF-6 | ITF-6 is the implementation of an Interleaved 2 of 5 (ITF) barcode to encode a addon to ITF-14 and ITF-16 barcodes. Originally was developed as a part of JIS specification for Physical Distribution Center. Instead of ITF-14, it wasn’t standardized by ISO Committee but it is widely used to encode additional data to Glob... | ITF-6 | [
"Technology"
] | 571 | [
"Data",
"Automatic identification and data capture"
] |
64,064,178 | https://en.wikipedia.org/wiki/NBC%20Defense%20Military%20Academy | The Marshal Semyon Timoshenko Nuclear, Biological and Chemical Defense Military Academy () is a military university in Kostroma training officers for service in the Russian NBC Defense Troops of the Russian Ground Forces. It was established in 1932 in Moscow and is named after Semyon Timoshenko. It provides training an... | NBC Defense Military Academy | [
"Chemistry",
"Biology"
] | 866 | [
"Chemical",
" biological",
" radiological and nuclear defense",
"Biological warfare"
] |
64,067,273 | https://en.wikipedia.org/wiki/Unified%20strength%20theory | The unified strength theory (UST). proposed by Yu Mao-Hong is a series of yield criteria (see yield surface) and failure criteria (see Material failure theory). It is a generalized classical strength theory which can be used to describe the yielding or failure of material begins when the combination of principal stress... | Unified strength theory | [
"Materials_science",
"Engineering"
] | 431 | [
"Mechanical failure",
"Materials science",
"Mechanical engineering"
] |
64,067,903 | https://en.wikipedia.org/wiki/Osmocom | Osmocom (open source mobile communications) is an open-source software project that implements multiple mobile communication standards, including GSM, DECT, TETRA and others.
History and usage
In 2008 Harald Welte and Dieter Spaar experimented with a base transceiver station from Siemens that was end-of-life and imp... | Osmocom | [
"Technology"
] | 783 | [
"Information and communications technology",
"Telecommunications"
] |
64,068,355 | https://en.wikipedia.org/wiki/Sulfate%20fluoride | The sulfate fluorides are double salts that contain both sulfate and fluoride anions. They are in the class of mixed anion compounds. Some of these minerals are deposited in fumaroles.
Fluoride sulfates were first discovered by Jean Charles de Marignac in 1859.
Some elements such as cobalt or uranium can form comple... | Sulfate fluoride | [
"Physics",
"Chemistry"
] | 110 | [
"Matter",
"Mixed anion compounds",
"Double salts",
"Sulfates",
"Salts",
"Fluorides",
"Ions"
] |
64,068,396 | https://en.wikipedia.org/wiki/HD%20164509 | HD 164509 is a binary star system in the constellation of Ophiuchus. The primary component has an orbiting exoplanet companion. This system is located at a distance of 175 light years based on parallax measurements, and is drifting further away with a radial velocity of 13.7 km/s. It has an absolute magnitude of 4.64, ... | HD 164509 | [
"Astronomy"
] | 372 | [
"Ophiuchus",
"Constellations"
] |
64,068,598 | https://en.wikipedia.org/wiki/Telluride%20oxide | The telluride oxides or oxytellurides are double salts that contain both telluride and oxide anions (Te2− and O2−). They are in the class of mixed anion compounds.
Compounds that can be mistakenly called "telluride oxides" are tellurium dioxide and tellurite.
Some of these are under investigation as photovoltaic mate... | Telluride oxide | [
"Chemistry"
] | 174 | [
"Oxides",
"Salts"
] |
64,068,666 | https://en.wikipedia.org/wiki/Alpha%20Nu%20Sigma | Alpha Nu Sigma () is an American nuclear engineering honor society affiliated with the American Nuclear Society. It has chartered more than 25 chapters at universities in the United States.
History
Alpha Nu Sigma National Honor Society was established by the American Nuclear Society on June 5, 1979. it was establishe... | Alpha Nu Sigma | [
"Engineering"
] | 440 | [
"Engineering societies",
"Nuclear organizations",
"Energy organizations",
"Engineering honor societies"
] |
64,069,392 | https://en.wikipedia.org/wiki/Packard%20Bell%20Statesman | The Packard Bell Statesman was an economy line of notebook-sized laptops introduced in 1993 by Packard Bell. They were slower in performance and lacked features compared to most competitor products, but they were lower in price. It was created in a collaboration between Packard Bell and Zenith Data Systems. The Statesm... | Packard Bell Statesman | [
"Technology",
"Engineering"
] | 1,444 | [
"Computer engineering",
"Computer hardware",
"Computer systems",
"Computer science",
"Computers"
] |
64,071,936 | https://en.wikipedia.org/wiki/History%20of%20the%20Ukrainian%20hryvnia | The Ukrainian hryvnia has been the national currency of Ukraine since 1996. It was briefly used in the Ukrainian People's Republic before the karbovanets was adopted as a national currency. The hryvnia is named after the grivna, which was used in Kievan Rus' and other states.
Etymology
The word “hryvnia” in Kievan R... | History of the Ukrainian hryvnia | [
"Mathematics"
] | 1,254 | [
"Obsolete units of measurement",
"Quantity",
"Units of measurement"
] |
64,071,953 | https://en.wikipedia.org/wiki/Later%20Life%20Workplace%20Index | The Later Life Workplace Index (LLWI) serves as a measurement instrument for age-inclusive organizational practices and working conditions for the successful employment of age-diverse workforces. Especially in the light of demographic change and shortages of skilled workers, the employment of older workers gains import... | Later Life Workplace Index | [
"Physics",
"Mathematics"
] | 917 | [
"Quantity",
"Physical quantities",
"Measurement",
"Size"
] |
64,072,544 | https://en.wikipedia.org/wiki/Eradication%20of%20suffering | The eradication or abolition of suffering is the concept of using biotechnology to create a permanent absence of involuntary pain and suffering in all sentient beings.
Biology and medicine
The discovery of modern anesthesia in the 19th century was an early breakthrough in the elimination of pain during surgery, but a... | Eradication of suffering | [
"Chemistry",
"Technology",
"Engineering",
"Biology"
] | 996 | [
"Bioethics",
"Genetics techniques",
"Biological engineering",
"Genome editing",
"Genetic engineering",
"Transhumanism",
"Biotechnology",
"nan",
"Ethics of science and technology",
"Molecular biology"
] |
42,666,047 | https://en.wikipedia.org/wiki/Eisenstein%20triple | Similar to a Pythagorean triple, an Eisenstein triple (named after Gotthold Eisenstein) is a set of integers which are the lengths of the sides of a triangle where one of the angles is 60 or 120 degrees. The relation of such triangles to the Eisenstein integers is analogous to the relation of Pythagorean triples to the... | Eisenstein triple | [
"Mathematics"
] | 323 | [
"Arithmetic problems of plane geometry",
"Euclidean plane geometry",
"Mathematical objects",
"Equations",
"Diophantine equations",
"Planes (geometry)",
"Number theory"
] |
42,666,851 | https://en.wikipedia.org/wiki/Red%20neuron | A "red neuron" (acidophilic or "eosinophilic" neuron) is a pathological finding in neurons, generally of the central nervous system, indicative of acute neuronal injury and subsequent apoptosis or necrosis. Acidophilic neurons are often found in the first 12–24 hours after an ischemic injury such as a stroke. Since neu... | Red neuron | [
"Chemistry",
"Biology"
] | 202 | [
"Histology",
"Pathology",
"Microscopy"
] |
42,667,776 | https://en.wikipedia.org/wiki/Paul%20Kuroda | Paul Kazuo Kuroda (1 April 1917 – 16 April 2001) was a Japanese-American chemist and nuclear scientist.
Life
He was born on April 1, 1917, in Fukuoka Prefecture, Japan. He had three children, including Mitzi Kuroda. He died on April 16, 2001, at his home in Las Vegas, Nevada.
Career
He received bachelors and docto... | Paul Kuroda | [
"Chemistry"
] | 360 | [
"Nuclear chemists"
] |
42,667,885 | https://en.wikipedia.org/wiki/Cladosporium%20elegans | Cladosporium elegans is a species of fungus in the genus Cladosporium (anamorphic Davidiella). It forms arid brown spots on living leaves of oranges in Italy.
References
elegans
Fungal citrus diseases
Fungi described in 1882
Fungi of Europe
Fungus species | Cladosporium elegans | [
"Biology"
] | 59 | [
"Fungi",
"Fungus species"
] |
42,668,333 | https://en.wikipedia.org/wiki/Moss%C3%A8n%20Costa%20i%20Llobera%20Gardens | Mossèn Costa i Llobera Gardens is a botanical garden in the center of Barcelona, Catalonia, Spain. It is situated at the foot of Montjuïc facing the sea.
The park owes its name to the renowned Mallorcan poet Miquel Costa i Llobera. Despite the gardens taking up around 6 hectares of the Montjuïc hillside, they are som... | Mossèn Costa i Llobera Gardens | [
"Engineering"
] | 1,012 | [
"Landscape architecture",
"Architecture"
] |
42,670,365 | https://en.wikipedia.org/wiki/Journal%20of%20Geometry%20and%20Physics | The Journal of Geometry and Physics is a scientific journal in mathematical physics. Its scope is to stimulate the interaction between geometry and physics by publishing primary research and review articles which are of common interest to practitioners in both fields. The journal is published by Elsevier since 1984.
T... | Journal of Geometry and Physics | [
"Mathematics"
] | 320 | [
"Geometry",
"Geometry journals"
] |
42,670,400 | https://en.wikipedia.org/wiki/Gabriela%20Gonz%C3%A1lez | Gabriela Ines González, (born 24 February 1965) is an Argentine professor of physics and astronomy at the Louisiana State University and was the spokesperson for the LIGO Scientific Collaboration from March 2011 until March 2017.
Biography
Gabriela González was born on February 24, 1965, in Córdoba, Argentina. She is ... | Gabriela González | [
"Physics",
"Astronomy"
] | 730 | [
"Astronomical sub-disciplines",
"Gravitational-wave astronomy",
"Astrophysics"
] |
42,670,800 | https://en.wikipedia.org/wiki/Optical%20wireless%20communications | Optical wireless communications (OWC) is a form of optical communication in which unguided light is used "in the air" (or in outer space), without an optical fiber. Visible, infrared (IR), or ultraviolet (UV) light is used to carry a wireless signal. It is generally used in short-range communication; extensions exist f... | Optical wireless communications | [
"Technology",
"Engineering"
] | 1,703 | [
"Optical communications",
"Telecommunications engineering",
"Wireless communication systems"
] |
42,671,088 | https://en.wikipedia.org/wiki/The%20Cryosphere | The Cryosphere is a monthly peer-reviewed scientific journal focusing on all aspects of frozen water and ground (especially glaciers) on Earth and on other planetary bodies. It was established in 2007 and is published by Copernicus Publications on behalf of the European Geosciences Union. The editors-in-chief are Chris... | The Cryosphere | [
"Environmental_science"
] | 207 | [
"Cryosphere",
"Hydrology"
] |
42,671,176 | https://en.wikipedia.org/wiki/Peziza%20fimeti | Peziza fimeti is a species of ascomycete fungus belonging to the family Pezizaceae. Found in Europe and North America, the fungus grows on cow dung. It produces small, light brown, cup-shaped fruit bodies up to in diameter. The asci (spore-producing cells) are cylindrical (or nearly so), with dimensions of up to 280 μ... | Peziza fimeti | [
"Biology"
] | 126 | [
"Fungi",
"Fungus species"
] |
42,671,200 | https://en.wikipedia.org/wiki/Epigenetic%20regulation%20of%20transposable%20elements%20in%20the%20plant%20kingdom | Transposable elements (transposons, TEs, 'jumping genes') are short strands of repetitive DNA that can self-replicate and translocate within genomes of plants, animals, and prokaryotes, and they are generally perceived as parasitic in nature. Their transcription can lead to the production of dsRNAs (double-stranded RNA... | Epigenetic regulation of transposable elements in the plant kingdom | [
"Chemistry",
"Biology"
] | 2,770 | [
"Biochemistry",
"Molecular genetics",
"Mobile genetic elements",
"Molecular biology"
] |
42,671,488 | https://en.wikipedia.org/wiki/Corey%E2%80%93Seebach%20reaction | The Corey–Seebach reaction, or Seebach Umpolung is a name reaction of organic chemistry that allows for acylation by converting aldehydes into lithiated 1,3-dithianes. The lithiated 1,3-dithianes serves as an acyl anion equivalent, undergoing alkylation with electrophiles. The reaction is named in honor of its discover... | Corey–Seebach reaction | [
"Chemistry"
] | 524 | [
"Coupling reactions",
"Name reactions",
"Organic reactions"
] |
42,673,705 | https://en.wikipedia.org/wiki/Climate%20resilience | Climate resilience is a concept to describe how well people or ecosystems are prepared to bounce back from certain climate hazard events. The formal definition of the term is the "capacity of social, economic and ecosystems to cope with a hazardous event or trend or disturbance". For example, climate resilience can be ... | Climate resilience | [
"Biology"
] | 3,051 | [
"Ecology terminology"
] |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.